3JALM

Cryo-em structure of gmpcpp-microtubule co-polymerized with eb3
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
131
structure length
131
Chain Sequence
MAVNVYSTSVTSENLSRHDMLAWVNDSLHLNYTKIEQLCSGAAYCQFMDMLFPGCVHLRKVKFQAKLEHEYIHNFKVLQAAFKKMGVDKIIPVEKLVKGKFQDNFEFIQWFKKFFDANYDGKDYNPLLARQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tubulin alpha-1B chain
publication title Mechanistic Origin of Microtubule Dynamic Instability and Its Modulation by EB Proteins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 34
structure length 131
sequence length 131
chains with identical sequence N
ec nomenclature
pdb deposition date 2015-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00307 CH Calponin homology (CH) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.418.10 Mainly Alpha Orthogonal Bundle Actin-binding Protein, T-fimbrin; domain 1 Calponin-like domain 3jalM00
2K2RA 2WA6A 1UJOA 3JAKM 1V5KA 4TXKA 2WFNA 1AOAA 2YRNA 1P5SA 4Q58A 1P2XA 1BHDA 2VZCA 2QJXA 5L0OA 2VZIB 1SH6A 1TJTA 1WYNA 3F7PA 2QJZA 5A37A 1UEGA 1WYPA 3HOPA 1SH5A 1WYRA 4Q57B 4EDMA 4EDLA 2D86A 2VZDA 1PA7A 4TXIA 1BKRA 3CO1A 5A36A 1WYLA 1QAGA 1WJOA 2EE7A 2WA5A 2R0OA 2E9KA 4Q59A 2D88A 2D87A 3I6XA 2DK9A 1WYQA 3FERA 1MB8A 2WA7A 4B7LA 3KY9A 2JV9A 1PXYA 3KMWB 2L3GA 4EDNA 1VKAA 2EYNA 2R8UA 2RR8A 5A38A 2EYIA 3KMUB 3JALM 5BVRA 5J8EA 1H67A 1DXXA 5A4BA 2VZGB 1WIXA 3HOCA 1WKUA 2D89A 2K3SA 2D85A 3HORA 3JARM 1RT8A 1WYOA 1WYMA 1AA2A 3REPB
chains in the Genus database with same CATH superfamily
2K2RA 2WA6A 1UJOA 2VE7C 2HKPA 2HL9A 3JAKM 3VP7A 1V5KA 4TXKA 2WFNA 1AOAA 2YRNA 1P5SA 4Q58A 1P2XA 1BHDA 2VZCA 2QJXA 5L0OA 2VZIB 1SH6A 4DDPA 1TJTA 2WE6A 1WYNA 3F7PA 2QJZA 5A37A 1UEGA 1WYPA 3HOPA 2HL8A 1SH5A 1WYRA 4Q57B 4EDMA 4EDLA 2D86A 4LVPA 2VZDA 5FMTA 1PA7A 2VE7A 2WDTA 4TXIA 1EUVA 1BKRA 3CO1A 5A36A 1WYLA 2EQOA 1QAGA 1WJOA 2EE7A 2WA5A 4LVRA 2R0OA 2E9KA 4Q59A 2D88A 3EAYA 2D87A 3I6XA 2DK9A 1WYQA 3FERA 1MB8A 2WA7A 2IGPA 4B7LA 3KY9A 2JV9A 1PXYA 3KMWB 2L3GA 4EDNA 1VKAA 2EYNA 2R8UA 2RR8A 5FMUA 5A38A 2EYIA 3KMUB 3JALM 5BVRA 5J8EA 1H67A 1DXXA 5A4BA 2VZGB 1WIXA 3HOCA 1WKUA 2D89A 2K3SA 2D85A 3HORA 3JARM 1RT8A 1WYOA 1WYMA 1AA2A 3REPB
chains in the Genus database with same CATH topology
2K2RA 2WA6A 1UJOA 3JAKM 1V5KA 4TXKA 2WFNA 1AOAA 2YRNA 1P5SA 4Q58A 1P2XA 1BHDA 2VZCA 2QJXA 5L0OA 2VZIB 1SH6A 1TJTA 1WYNA 3F7PA 2QJZA 5A37A 1UEGA 1WYPA 3HOPA 1SH5A 1WYRA 4Q57B 4EDMA 4EDLA 2D86A 2VZDA 1PA7A 4TXIA 1BKRA 3CO1A 5A36A 1WYLA 1QAGA 1WJOA 2EE7A 2WA5A 2R0OA 2E9KA 4Q59A 2D88A 2D87A 3I6XA 2DK9A 1WYQA 3FERA 1MB8A 2WA7A 4B7LA 3KY9A 2JV9A 1PXYA 3KMWB 2L3GA 4EDNA 1VKAA 2EYNA 2R8UA 2RR8A 5A38A 2EYIA 3KMUB 3JALM 5BVRA 5J8EA 1H67A 1DXXA 5A4BA 2VZGB 1WIXA 3HOCA 1WKUA 2D89A 2K3SA 2D85A 3HORA 3JARM 1RT8A 1WYOA 1WYMA 1AA2A 3REPB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K2R A;  2WA6 A;  1UJO A;  3JAK M;  1V5K A;  4TXK A;  2WFN A;  1AOA A;  2YRN A;  1P5S A;  4Q58 A;  1P2X A;  1BHD A;  2VZC A;  2QJX A;  5L0O A;  2VZI B;  1SH6 A;  1TJT A;  1WYN A;  3F7P A;  2QJZ A;  5A37 A;  1UEG A;  1WYP A;  3HOP A;  1SH5 A;  1WYR A;  4Q57 B;  4EDM A;  4EDL A;  2D86 A;  2VZD A;  1PA7 A;  4TXI A;  1BKR A;  3CO1 A;  5A36 A;  1WYL A;  1QAG A;  1WJO A;  2EE7 A;  2WA5 A;  2R0O A;  2E9K A;  4Q59 A;  2D88 A;  2D87 A;  3I6X A;  2DK9 A;  1WYQ A;  3FER A;  1MB8 A;  2WA7 A;  4B7L A;  3KY9 A;  2JV9 A;  1PXY A;  3KMW B;  2L3G A;  4EDN A;  1VKA A;  2EYN A;  2R8U A;  2RR8 A;  5A38 A;  2EYI A;  3KMU B;  3JAL M;  5BVR A;  5J8E A;  1H67 A;  1DXX A;  5A4B A;  2VZG B;  1WIX A;  3HOC A;  1WKU A;  2D89 A;  2K3S A;  2D85 A;  3HOR A;  3JAR M;  1RT8 A;  1WYO A;  1WYM A;  1AA2 A;  3REP B; 
#chains in the Genus database with same CATH topology
 2K2R A;  2WA6 A;  1UJO A;  2VE7 C;  2HKP A;  2HL9 A;  3JAK M;  3VP7 A;  1V5K A;  4TXK A;  2WFN A;  1AOA A;  2YRN A;  1P5S A;  4Q58 A;  1P2X A;  1BHD A;  2VZC A;  2QJX A;  5L0O A;  2VZI B;  1SH6 A;  4DDP A;  1TJT A;  2WE6 A;  1WYN A;  3F7P A;  2QJZ A;  5A37 A;  1UEG A;  1WYP A;  3HOP A;  2HL8 A;  1SH5 A;  1WYR A;  4Q57 B;  4EDM A;  4EDL A;  2D86 A;  4LVP A;  2VZD A;  5FMT A;  1PA7 A;  2VE7 A;  2WDT A;  4TXI A;  1EUV A;  1BKR A;  3CO1 A;  5A36 A;  1WYL A;  2EQO A;  1QAG A;  1WJO A;  2EE7 A;  2WA5 A;  4LVR A;  2R0O A;  2E9K A;  4Q59 A;  2D88 A;  3EAY A;  2D87 A;  3I6X A;  2DK9 A;  1WYQ A;  3FER A;  1MB8 A;  2WA7 A;  2IGP A;  4B7L A;  3KY9 A;  2JV9 A;  1PXY A;  3KMW B;  2L3G A;  4EDN A;  1VKA A;  2EYN A;  2R8U A;  2RR8 A;  5FMU A;  5A38 A;  2EYI A;  3KMU B;  3JAL M;  5BVR A;  5J8E A;  1H67 A;  1DXX A;  5A4B A;  2VZG B;  1WIX A;  3HOC A;  1WKU A;  2D89 A;  2K3S A;  2D85 A;  3HOR A;  3JAR M;  1RT8 A;  1WYO A;  1WYM A;  1AA2 A;  3REP B; 
#chains in the Genus database with same CATH homology
 2K2R A;  2WA6 A;  1UJO A;  3JAK M;  1V5K A;  4TXK A;  2WFN A;  1AOA A;  2YRN A;  1P5S A;  4Q58 A;  1P2X A;  1BHD A;  2VZC A;  2QJX A;  5L0O A;  2VZI B;  1SH6 A;  1TJT A;  1WYN A;  3F7P A;  2QJZ A;  5A37 A;  1UEG A;  1WYP A;  3HOP A;  1SH5 A;  1WYR A;  4Q57 B;  4EDM A;  4EDL A;  2D86 A;  2VZD A;  1PA7 A;  4TXI A;  1BKR A;  3CO1 A;  5A36 A;  1WYL A;  1QAG A;  1WJO A;  2EE7 A;  2WA5 A;  2R0O A;  2E9K A;  4Q59 A;  2D88 A;  2D87 A;  3I6X A;  2DK9 A;  1WYQ A;  3FER A;  1MB8 A;  2WA7 A;  4B7L A;  3KY9 A;  2JV9 A;  1PXY A;  3KMW B;  2L3G A;  4EDN A;  1VKA A;  2EYN A;  2R8U A;  2RR8 A;  5A38 A;  2EYI A;  3KMU B;  3JAL M;  5BVR A;  5J8E A;  1H67 A;  1DXX A;  5A4B A;  2VZG B;  1WIX A;  3HOC A;  1WKU A;  2D89 A;  2K3S A;  2D85 A;  3HOR A;  3JAR M;  1RT8 A;  1WYO A;  1WYM A;  1AA2 A;  3REP B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...