3JAMA

Cryoem structure of 40s-eif1a-eif1 complex from yeast
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
208
structure length
208
Chain Sequence
SLPSTFDLTSEDAQLLLAARVHLGAKNVQVHQEPYVYKARPDGVNVINVGKTWEKIVLAARIIAAIPNPEDVVAISSRTYGQRAVLKYAAHTGATPIAGRFTPGSFTNYITRSFKEPRLVIVTDPRSDAQAIKESSYVNIPVIALTDLDSPSEYVDVAIPCNNRGKHSIGLIWYLLAREVLRLRGALPDRTQPWAIMPDLYFYRNPEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational Differences between Open and Closed States of the Eukaryotic Translation Initiation Complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Translation
molecule keywords 18S rRNA
total genus 47
structure length 208
sequence length 208
ec nomenclature
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00318 Ribosomal_S2 Ribosomal protein S2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10490 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glucose-6-phosphate isomerase like protein; domain 1 3jamA01
2CXTA 5A2QA 4DV0B 1WIWA 1IBMB 2CXUA 1U0GA 1N33B 1M3SA 4YHHB 3PR3A 1N8TA 5IWAB 1HNXB 1XMQB 1Q50A 1XNQB 1HOXA 2YVAA 1IRIA 1NUHA 1HNZB 1C7QA 2A3NA 4OX9B 4NXNB 1FJGB 3FKJA 1JEOA 1DQRA 5FLXA 2UUBB 1JXAA 2CVPA 3IFSA 1HNWB 2XBLA 2V4MA 4DR6B 4DUYB 3QKIA 2VF5X 2UXDB 1B0ZA 3J7AC 4DV6B 1VI5A 4AMVA 2ZM6B 4LF5B 5LMNB 4DV3B 4DV7B 2UXBB 1X9IA 3BJZA 2CB0A 2DF8A 3UJHA 3NBUA 2CXRA 2F4VB 4LFAB 4KHPB 2O2DA 4IVNA 5I01A 2PUTA 2ZJ3A 4EM6A 5BY2A 4DR5B 1G98A 1N34B 4DR2B 4X64B 4B3MB 5LL6P 5IT9A 1N32B 4LF4B 1JLHA 4DV2B 2WU8A 3ODPA 2POCA 1JIQA 4JI1B 3OOJA 4LF8B 3I0ZA 4NXMB 4JYAB 4JI6B 4DUZB 1I94B 3JX9A 1NRIA 3ETNA 3HBAA 1U0EA 2E5FA 3Q7IA 2CXQA 3TRJA 2VQEB 1IATA 3T1HB 4DV5B 2I22A 2UUCB 1XMOB 4JI0B 1HR0B 3BCHA 2DECA 2CXOA 1T10A 4B3SB 2X3YA 1GZDA 1VIMA 1VIVA 2VF4X 2VQFB 1KOJA 3SHOA 4DR3B 1ZZGA 1IBKB 4DR4B 2PUWA 1J5XA 1U0FA 4B3TB 2XHZA 4LFBB 1HM5A 3LJKA 3C3JA 2CXPA 4JI5B 4JI8B 2J6HA 4DR7B 4YY3B 1TZBA 2O2CA 4JI2B 4U6NA 1MOSA 4DR1B 4JI3B 4DV4B 4S1WA 2CXNA 4K0KB 3HJBA 1X9HA 3JAMA 2UUAB 4B3RB 4DV1B 1TZCA 3J81A 4LF7B 2PUVA 1MORA 2HHHB 4GKJB 4LFCB 2CXSA 4AQYB 4JI4B 3Q88A 2I2WA 3G68A 3FXAA 4X62B 4LZJA 4TOIA 1C7RA 3FF1A 3KNZA 3TBFA 4X66B 5LMUB 1MOQA 3T1YB 1XTBA 2Q8NA 3EUAA 2ZJ4A 4JI7B 3FJ1A 1TK9A 3OTOB 4M0DA 1GZVA 3M5PA 4JV5B 1VI6A 3CVJA 3J80A 1X92A 2E5LB 1XNRB 1IBLB 5BR8B 4S12A 2UU9B 2AMLA 1N36B 1X94A 4LF9B 2PGIA 4X65B 1J5EB 4GKKB 2UXCB 4LF6B
chains in the Genus database with same CATH superfamily
1WX1A 4CHTA 3HLYA 4LJKA 3G2JA 4QTXA 2CL7X 3VZSA 1ADBA 4HR7A 5J58A 2WVAA 3LCRA 1O97D 4TKVB 3H5OA 2IWHA 4IRMA 2B69A 4LJ6A 2ZUFA 4IX1A 4GE3A 3H7AA 1JHUA 3K31A 2V97A 2NTYC 3KUXA 5B64A 3I42A 3COWA 4KITB 4H1VA 3CZCA 1SUPA 3BFXA 1TO6A 5IX8A 1G55A 5HTKA 1Q83A 4JYMA 1EBBA 2WJHA 3GGDA 1PYDA 3L5OA 4R9NA 3M9WA 1OH5A 2O9JA 3WBJA 3OZTA 1WUKS 3SC2B 3WQBA 2OO3A 3IAS6 3JAKB 4J7AA 4RDXA 3W05A 3KJHA 2G1AA 2VFAA 3MTQA 1CUHA 1JIIA 2OBLA 1J2TA 5GY7A 4WZBA 2OZLA 4D9NA 4HDKA 1GPDG 3KSDO 1UINA 2FCAA 4ESEA 1P31A 3FETA 3NDRA 5TJHA 5I9SA 2UZ1B 4LYEA 5F1YA 4B7AA 2B8EA 2WPDA 3PF9A 4HX2A 1N2CE 2E1PA 3JAWB 1FUIA 1L1RA 1OWNA 2B82A 3EG9B 3WGVA 1TQ2A 3EN0A 3HN6A 3WGYA 1ECJA 3NOQA 1CQWA 1DB3A 3IQWA 3C6YA 4EPYA 3VA7A 1QGED 2GAOA 3D3NA 4IVNA 4QTZA 5FTNA 1PYGA 2GN4A 1GDTA 2H8KA 4E31A 1ZSVA 5JH7B 4TROA 1F0PA 3RTBA 1JIKA 5LM3A 3RT7A 1V39A 2JI8A 3E9EA 4HNAA 4LRSB 3THWB 3WLLA 2QZ9A 5BMVF 3DV0B 3RYTC 3NHAA 4Q16A 3UGJA 3S5JA 3HB5X 1YT5A 3ZUPA 5HJ7A 1UQUA 4YRNA 3T7TA 1B0AA 1E2HA 3B2EA 1Z25A 4DC9A 3FRHA 2I4IA 3HV0A 4URWR 3RC7A 1BYUA 2W6CX 3E9ZA 3KKQA 5EIXA 2CF6A 3DLCA 2G36A 4JL8A 3GVPA 1TM2A 3I1IA 4MVJA 3K2IA 1GZ5A 1WSBA 2C07A 1QMGA 2ZT7A 4XJXA 2ZYUX 5KAPA 2TMGA 1QS0B 3EIUA 1Z0ZA 1QPBA 2XUFA 4QUBA 3KAQA 4AS1A 1K6MA 3HKEB 5INTA 3C7AA 5FYQA 4DIBA 5BORA 3N75A 3DE3X 1QF7A 2VXCA 5JWOA 4BXOB 1WD7A 3T54A 4YC7A 1R1DA 3BCRA 4PO9A 1F8GA 1CXZA 4UBOA 1H9BA 3WL8A 1N5OX 3FCSB 2NV0A 4J4TA 5JQGA 4G36A 2AR9A 3K7EA 3PDHA 4RFLA 1IQRA 4KDCA 4PXSA 3L79A 5TQ2A 1O95D 4DV4B 3ZEIA 4ARUA 4XJSA 4KGDA 5T41A 1XX6A 1KGDA 4YJHB 5IAAA 1M1NA 3U44B 2JL1A 4LXYA 3W34A 3P9SA 5JZMA 3Q88A 4MR7B 3MXOA 4ZJZA 1RXVA 1NX6A 1JHVA 1KMHA 2HD4A 2I99A 4WOPA 3NAMA 4LY9A 3IQIX 4P4GA 4DADA 4P98A 5EFZA 2W5UA 2ZQ5A 2BMVA 2I6XA 2C9BA 3AC0A 5I7AA 3W9BA 4GNKA 1F8XA 4RSMA 1IEQA 3PJEA 2E85A 3K6KA 3USCS 5I4IA 5F23A 1RWOA 1PHPA 2FEXA 3GEGA 2PBRA 4D80A 3I2KA 2UU9B 3LHFA 3V7NA 2QTBA 2JJMA 4J7CA 4YWHA 3WIOA 1DO2A 3KAJA 1YF3A 3RS3A 4JOCA 5C51B 3IQEA 4IIYA 5A02A 1ZMOA 4L4UA 5JO0A 2FQ1A 3CG4A 3PC8C 1CR0A 3GB9A 3N59A 2I03A 5EGSA 2W11A 4MRSA 5C32A 5ECYA 1CPYA 1ZSYA 3WTBA 5KHLB 3T5AA 4Y2SA 5I8WA 2C9MA 4PZAA 2EKDA 3GLFA 2Y2UA 3WRXA 4FOPA 2G67A 3CEHA 5JSFA 1WZCA 4ITRC 5GM1A 2A3NA 2OK7A 2FPGA 3KZCA 1ADJA 4YJFB 4PZUA 2PMDA 3NIBA 4HS4A 4JLPA 4HADA 1CUAA 4WLFA 5TV2A 1HORA 2I71A 2VRCA 2VXYA 3GC6A 1UODA 4GAEA 2HU8A 4NS1A 5ALJA 3QPAA 1G1MA 1FSPA 4KXUA 1Q3KA 1DMSA 3ORHA 4CL8A 1JKJA 3WTCA 1J09A 4OSOA 3S8MA 2B25A 2GHRA 2FSVA 3EIFA 2PLWA 2ZI6A 2FSGA 4JT4A 2WIKA 3ROZA 2FLVA 4Y98A 4HFRA 3TFQA 2JIZA 3R3UA 4FP9A 3LU1A 4K6OA 2YWBA 4RBNA 4G01B 5M7EA 3DDUA 1GPH1 2W6OA 3K53A 4JELA 3TTXA 4TTAA 1DG3A 1N0UA 4EM6A 3RVKA 5BY2A 1ONOA 2D59A 1W36B 3VKGA 5HMLA 4R8KA 2Q2OA 4WBNA 3PHHA 3R8CA 1ZM7A 2XT9A 1NW9B 1OAOA 3FOBA 3IJPA 4IDPA 5J4HA 2L69A 5KKNB 4HCJA 1BEZA 1I0IA 2OHVA 5BO5A 2AFIA 3AFHA 4HD8A 1P9RA 1N2CB 2E82A 2YWFA 1GEEA 3MAAC 1J0CA 4LC0A 1NWHA 1AGXA 3OZAA 4C01A 1HETA 1WSAA 4NMHA 4R7GA 3KIPA 2YXDA 4IIJB 4JEIA 4RD0A 2JDIA 3C45A 1K5PA 4IJUA 1GPYA 1OU0A 3PGXA 1Z08A 3REQB 2FWAA 3ZDFA 1FA9A 1Q0HA 1UZMA 4LJSA 5BVHB 3N1UA 1N8KA 3K9QO 1H66A 4P4SB 4F7DA 5FPKA 3C7KA 1GAJA 4MMZB 5HCUA 1OSNA 5IULC 4TV8A 4YAEA 3LSYA 1ZMTA 1AJEA 2YZMA 1IEXA 2AJLI 3BFJA 1E64A 3RUEA 3HJBA 1RZ3A 4OI4A 3AUFA 3G8CA 4B74A 5CBPB 5EWMA 1NFFA 2AI1A 4UJ5A 5KO2A 1IY0A 3JSAA 1MG0A 4UHFA 3KDAA 2CXSA 1DEXA 1K63A 2B8WA 2RG1A 3VV2A 4CCAA 4YLGA 2H00A 1LC0A 1X3SA 3E58A 3KZ1E 4HS9A 5BUZA 5CVUA 1V11B 3GDWA 4JBWA 4YP9A 3N2KA 4X66B 2VDUE 2Q8NA 1UUFA 2HLDD 3KCQA 2IQ5A 3M5PA 1MFZA 1KFBB 1SG0A 2P91A 3B1WA 4N39A 5IPFA 2Q0XA 2DM6A 4JIGA 1T25A 3B5JA 1QF6A 1LDEA 5KTSA 1CZUA 3L7BA 2BGIA 1ZDMA 4XWKA 5IDQA 2AC7A 3KRTA 1G18A 1Z4OA 2XNCA 3K9BA 5F1PA 3P8ZA 1O7JA 1Z4JA 2ZK7A 1MNQA 4BO4A 4ZDJA 2W6ID 2WNIA 2ZUWA 1M6NA 1U0BB 3FDJA 3Q9SA 4HDRA 1KPIA 1KY3A 1UBKS 1TVCA 3VPHA 3WNDA 1L5HB 1G8JA 3GELA 4J1TC 2BWJA 5TLSA 1BROA 4G6ZA 4XJTA 4AWXA 3KYJB 4G5RA 4I46A 5L7YA 1GFWA 5KX5A 1AA6A 2YVAA 1KMQA 3BRSA 3OTQA 2V7VA 3KDSE 2XQGA 5CA0A 1SQFA 1MC5A 2FK8A 3CX7A 2PMEA 5IJ0A 2IIBA 4EH1A 3WV5A 3LDFA 3PWKA 5I4BA 2DTEA 1HEIA 2OO5C 3S27A 1I2DA 3TKLA 5C37A 3BJEA 5B36A 1EXDA 5L9AA 3K6JA 2F9LA 4C0BA 5C8XA 3RB8A 4XIGS 5T4HA 3AR3A 3X3HA 4EQZA 4GDFA 4CT4B 2FW8A 2WHYA 2C61A 3EQZA 3W3AA 1K7SN 1V9SA 2JI6A 4XEHA 1ZM9A 3UMSA 1P74A 3M4ZA 5D6OA 1AMUA 1M8PA 3UHOA 1M1NB 3NKLA 3KJEA 5LYYA 3UC9A 3FR7A 1JJBA 3QWAA 1TIPA 4WJZA 1FSSA 5AK4A 4AP5A 3UXHA 2IWRA 4B3MB 1UJ4A 5DYTA 3W9SA 1LWNA 2WPNA 1X42A 4TSFD 3S3TA 4XVUA 1BWSA 1RQ7A 4GM4A 4RANA 4BFCA 2FDCA 3ONFA 1LSUA 1KOGA 1A7JA 4QUGA 3L7MA 1Q7CA 5EQDA 1R74A 3M1LA 2R4UA 4YRKA 2OG2A 3L6RA 2IXAA 1Q7TA 1KIAA 2IXEA 2XCUA 4BNGA 3PX2A 4P22A 3X43A 3UUGA 1ICIA 1N0IA 2G04A 5KJEA 3T0IA 3N05A 3EIXA 5KVAA 4H2DA 3I4CA 3D1JA 1BRMA 3P9KA 2JIDA 3NBZC 1SXJA 4BX2A 5JD5A 5JTUA 4OHUA 2JLAA 1E9DA 1T34A 3QFSA 1JBQA 1W5BA 9LDTA 1QK5A 3L6DA 1T9CA 1M0TA 1UAYA 2IEGA 1LPSA 4ETIA 2ZSBA 2VDOB 4L5JA 1IEWA 1CE8A 2ZE8A 5AD1A 4ZDWA 5C8YA 1QWOA 2UYOA 1A4UA 1U0SY 5FPPA 1MOZA 3V8NA 1VPWA 1J5PA 4LS3A 4URXR 2GX6A 2NO0A 4ZGWA 4WI1A 1Y7LA 3O73A 1CQJB 4N7RA 5EJ8A 4AO6A 3EW7A 2FPRA 4OEHA 1K89A 3PS9A 3TNFA 3MSCA 1R7RA 3GDGA 4CLRB 5FUBA 2BBTA 2ZRBA 3JZMA 2YOFA 1W96A 1YI0A 3AVXA 3BBLA 3DVQX 4MOWA 4QGFA 1P7CA 5DCYA 1Y8ZA 4O2RA 3OTIA 5HBGA 3V7YA 2EQAA 4LI3X 3EQ8A 5TJ9A 5KB3A 4UEWA 3T7DA 1BGVA 1UBGA 2HA2A 2HJVA 2PT9A 2WKRA 4JGBA 4PC1A 3PKJA 3K0HA 1BH2A 3OCUA 2PA0A 2R00A 4PPQA 3KQSA 3WMFA 3EB9A 1FYXA 3HKBB 4KG7A 1CR2A 2HLDA 2NZYA 4TRJA 2JAPA 1JPNA 1S8OA 3EFOB 2D62A 2F3QA 1R6UA 2QIPA 3R3JA 4JP3A 4KWTA 1CETA 1KO4A 2P9GA 2QI9F 3E7FA 1SBTA 4HP8A 5GVRA 2HXSA 2DFLA 3DHYA 4LMRA 4F3KA 1QGDA 4OYHA 1HFWA 3EMDA 3G8AA 2JBAB 4FGZA 4YDSA 5C1DA 1WY5A 1G9SA 3O3NB 4N8SA 5I7UA 5EERA 1S7CA 5TGZA 1CLUA 2O2HA 2X1LA 1LJLA 1TYAE 3SLGA 4Z99A 4KXLA 4BUZA 3ECCA 3QPUA 1NDQA 3V2GA 3AHDA 4KK3A 4CMJA 2A5JA 1C0PA 2ZTSA 3Q87B 1R8XA 2BKUA 4URYR 1NLFA 1Q5PA 5HFJA 4RNCA 1NN5A 2OEPA 2VHVA 4F72A 2VPQA 1PLKA 2NZ2A 3GFPA 5JYCA 1N6KA 4KIGA 4EK9A 4F3NA 3ISJA 4FFBB 3HE3A 3QV1A 5DPMA 1SH7A 1L7DA 4MMXB 3KHSA 2Q8QA 5L95A 4JJEA 1XU7A 4UTOA 4D43A 1UPCA 3AR5A 5IDWA 3G3EA 4PFQA 1ECBA 1P5RA 4YAIA 5U1PA 4C7MA 1FFEA 1SQGA 4HNRA 1XU4A 2ZU6A 1H8EA 3RGGA 2H1FA 1N77A 1G20A 2FG5A 2HK9A 4LKOA 1SHKA 4PCVA 3IAFA 4RPJA 2FN9A 3WQHA 4E3ZA 3S2IA 4MCAA 2I6UA 1A88A 1ADFA 3FDZB 3MJSA 2IODA 1GTJ1 3PP8A 5DLEA 3GJ0A 2C77A 1JWAB 5TQ0B 4ND6A 3B7WA 1DX4A 2YW2A 2ZOSA 3CO5A 3D2LA 3F3MA 3I9MA 1EA5A 2WJJA 1T9ZA 3JASB 1OREA 3K15A 5EXEA 3INYA 2HHJA 4OUKX 5JQWA 3LUPA 4O8CA 2NXJA 3VR5A 1WMSA 1XPUA 3A28A 2JB9A 4FQ7A 2FPIB 4C3ZA 1Q77A 3ND8A 3V8RA 1SA0A 2AN5A 2VDPB 1NBMA 2ZWPA 3QQPA 1R9MA 1R5OA 1JB9A 1HYHA 1RSZA 2A1IA 2EJBA 1H6DA 2ZTMA 4UBKA 3V48A 1GNRA 4Y1RA 1J39A 3BL8A 3ORSA 5JO9A 1PR9A 1V35A 1NXWA 3CNOA 3G9QA 3IO3A 4RYDA 4MUNA 3HCRA 2VWQA 3JATA 5BWBA 4WNCA 1JXOA 2XGSA 4QYIA 3ZNNA 1L7NA 4C6HA 3NC4A 5JS7A 3FDXA 2JD2A 3RDPA 4GZ6A 3KYDB 4IWXA 2JIOA 4WK6A 4ACAA 4ZYWA 1NVMB 1Q84A 1CF4A 4P83A 4FYJA 3O8CA 1JU4A 2OECA 1XSEA 3CBGA 5FD8A 4YCCA 1W4RA 1MBZA 1QKKA 1IUNA 3CRMA 4M8IA 4ENWA 3Q6MA 2H1IA 4DVJA 2H4HA 3ED1A 5BUCA 2QUJA 1F2VA 2O2EA 4HL6A 3UK6A 1Q17A 1WM1A 2PK3A 4ZO9A 3ST7A 3VPDA 1ZL2A 2QXTA 3O4FA 3AINA 4TZ0A 4QXPA 2HOQA 2PRKA 5E2IA 1NY6A 3BM5A 3RHSA 3CRRA 1V6CA 3HR4A 3IUBA 4A0SA 4UOZA 3GVXA 1M2KA 3VFDA 1VBNA 3GR6A 1EM6A 1DKRA 4QM7A 2BEWA 1M1XB 4PYQA 3ASYA 1PTJC 3AJAA 3P19A 3HPQA 2WV9A 2XTAA 4DCSA 1THMA 1QB8A 4DIOA 4E1BA 3EZXA 3EC7A 3B9PA 2CJPA 4G8CA 2ZYAA 1A69A 3JQAB 1P3DA 1ZESA 3OQVA 4KUEA 4UAJA 5EINA 1N1DA 1K06A 5G53C 3ZR4B 5B1YA 5A3RA 5F3WB 5FQOA 4ZOLB 5IZCC 1WLSA 1M6VB 1VLLA 2G25A 2H31A 2RHMA 2XYRA 4F85A 1F9EA 1XZPA 4YO7A 1A9XA 2VI5A 1Y8QA 2C9OA 2PM8A 3VVLA 3P2EA 3NC1C 2AR7A 1GT91 2HFKA 3CINA 3ER9A 3S44A 1C41A 1QYVA 3G82C 1LNZA 3AMVA 3KWJA 1JZQA 3NNNA 4KP7A 4RTPA 2MDTA 3N8NA 4MUXA 4PYJA 3VC3A 1W75A 4C07A 1OTYA 1U04A 5DM1A 4A91A 2WTUA 1RYMA 4JU9A 4XGKA 3B3FA 4ALJA 3OX4A 1EESA 2Q2NA 1C2YA 2Q1TA 1ZLYA 2D54A 3O94A 5LVAA 3WB2A 1YU9A 2BRUA 2Q3DA 3B82A 4KQ1A 3WSWA 3ZU6A 1YB2A 2JVIA 2X8JB 3LY7A 1HDXA 1EFTA 1KP9A 1FOEB 4RIEA 1JEEA 4EBFA 1RRFA 2O05A 5F52A 1HTBA 4BBPA 2F4VB 4LFAB 1R0WA 1PYOA 1SC3A 4FQ5A 1L7QA 3GD7A 1S02A 2Q3HA 4HN9A 1IPFA 1RI5A 4MV8A 2AOXA 4MWSA 4CM6A 3TZLA 4MRMB 3VDRA 4DC0A 5JHHB 1PT9A 3IXMA 3B3GA 5B1HA 1AV6A 4HAUA 3TL2A 1QQ6A 1UFVA 4MS4B 2XUHA 4OGGA 3EDRA 4F9FA 2MCFA 3ZY2A 2FE4A 4RZHA 1EGQA 1OXSC 4Q66C 4S35A 5FTJA 4ZCTA 2XA1A 3OZVA 2BC9A 1FP7A 1J2JA 1X1BA 1U9ZA 3I9LA 3I9FA 3B70A 1RRVA 3LF1A 3PQCA 4YLYA 4RIGA 1ZCFA 3ZHQA 1PEYA 1WRBA 1Z6PA 1QG2A 5CVVA 4CWAA 1XMOB 3UMFA 3VYSB 3A6JA 3DWEX 2GPTA 2BHSA 4L9AA 4XQCA 3RIXA 4NS4A 1CY1A 2UZ0A 4PQYA 4MHOA 3C8MA 3LHSA 1C30B 1E3WA 2P4HX 1J42A 2XY4A 3ORFA 1IN8A 5CA0B 4NK4A 4YRBA 4ZHQF 3F8SA 3I04M 3O0DA 4MQFA 4DLZA 5A4DA 2H5EA 4DOMA 4LFBB 4G81A 2DEUA 3VJRA 1I2CA 2GXUA 1E1KA 1KGSA 1PQYA 3TSZA 2ACKA 2J5KA 2LV8A 2WU1A 5HBRA 4DREA 5KVSA 3K4PA 4ON9A 1F4LA 2GJ4A 2PQ0A 2XUGA 3B5EA 2GDZA 2B0JA 4I6GA 3ZHOA 4EHLA 1TQ8A 3OLQA 4Y6LA 4Z4IA 3DLAA 5DHSA 3KTAB 4AKHA 1DRVA 2PMBA 3ZJ4A 3QY9A 4FMDF 4LZJA 4C6RA 1I6LA 1YJ8A 3U0VA 2H7YA 3JQBA 3WYDA 5J2TB 1PX2A 2EBWA 1FMFA 1Q0SA 3D6HA 3ZJTA 1MAAA 4H7HA 1H3NA 1QRDA 4HFNA 5L6LB 1L4UA 3TOSA 4AG6A 2EHJA 1PBNA 1RPAA 1I7NA 5AM5A 3U7FB 3CVJA 3FBWA 3OOHA 1YS1X 4HATA 2XA2A 3DTYA 1Z0UA 2AXQA 2OLEA 2QZPA 2PYDA 2V55B 3KCNA 4R1QA 4UMFA 4M54A 1Z74A 1KVQA 2GB4A 4W1RA 3NBAA 1OX5A 1T3GA 5FNZA 5LWHA 1A2BA 2FFAA 1STOA 1KY4A 4DLPA 1TD1A 3T5DA 5HIKA 4CQMA 4M1MA 1KNQA 1BJTA 1ZOPA 4H35A 5JATA 2QMQA 3KQLA 1H05A 5K0NA 4RA6B 4ND8A 3D3QA 1JAZA 1H2HA 4NZZA 4XYGA 1PJAA 3LKZA 5CH3A 4WNYA 4FB5A 1K75A 2IHJA 1ZHHA 1Q0RA 2WMNB 4CMCA 1UPBA 1YDEA 1N57A 4NCHA 5G40A 3I52A 3AEKB 4KQFA 4WA7A 1SQSA 2YHBA 4RIFA 1U8ZA 2ZWOA 5TS2A 2ZS9A 3AG6A 3C5EA 3OJCA 1P2VA 4TUYF 4V02A 1DO0A 2DC1A 3DKPA 1VJRA 5DYIA 1SCIA 4EA8A 3RRXA 3HNRA 2FP4B 3V1MA 4HDOB 3SXUB 3RVJA 3U5ZB 1BVRA 4BFWA 3I61A 1SOVA 2XIQA 3QUTA 3OSZA 2PNFA 1ZW6A 4D2IA 1DXHA 4J2OA 3NM5A 2W2KB 2ZDHA 4RKFA 5JAQA 4L78A 1N7IA 3U40A 3AEUB 3MRTA 4DPKA 1U2ZA 1I7SB 1N2HA 2P11A 3PWSA 3JZFA 3I2FA 2V6BA 4LWZA 2QAIA 4AJIA 3TIVA 4KHPB 4C4ZA 2WLTA 2GARA 1E0KA 5AW7A 1EX7A 5F35A 2DUUA 1CBUA 4KN6A 2X2OA 3VAZA 4LSGA 3OPXA 5FH9A 3QMWA 4W1QA 2BELA 4LIPD 4AKIA 4GRIA 1JAHA 1M2EA 1WP9A 2AE1A 4MV1A 5CEFA 3FIUA 1M72A 4W6ZA 4Z8XA 5JD3A 3D6VA 1FNMA 1YJXA 1AUPA 1XF1A 4WKCA 4DV5B 3UJ9A 2W4MA 4F86A 3LCJA 1TO2E 1X8KA 5L8VA 4UJ3A 2L42A 3AFGA 5TE9A 1TLTA 4LSZA 3RYCA 2Z0MA 1UIMA 4MEBA 3PGA1 2C8KA 3VO2A 3WOVA 4GLOA 3FVQA 2DXIA 5IM5A 3WYAA 4X71A 3DMNA 3KHKA 4Z0NA 4DY6A 1E32A 3ZDBA 1VB5A 1BEEA 1WXHA 4UUAA 1IUOA 2H2WA 2YZKA 4R3WA 3ZC3A 1K3UB 2C99A 4RGVA 4CF4A 2PXXA 4NPHA 3CVVA 2QE7D 2CUZA 3MGBA 4YALA 2TRSB 2AZMA 1W85A 5KOJB 3G1UA 4I81A 5I5GA 1UBMS 4DGQA 2Y93A 4FKMA 4JEUA 1WVIA 1F7VA 2PUVA 2PX0A 1UDWA 1T1SA 2WTBA 4KAFA 4U3JB 1GQSA 1O9HA 2DPXA 4Y2VA 2W6JD 1QDEA 2PAAA 3KOWA 4RMJA 3QEBZ 3U80A 3HCNA 2HMWA 3F6PA 421PA 1J8DA 2GDJA 3W6ZA 2XBMA 3QU7A 4KGVA 4I08A 2EBHX 5TQVA 1AB5A 4IFEA 4A27A 3CZPA 5IXYA 1P1BA 3DV2A 5L3ZA 4XPIA 3A6KA 4BU0A 2PSEA 1OMOA 1TJ5A 3FBGA 3CUUA 1W9MA 5KYYA 3DL2A 1TXGA 1NW7A 3NTVA 1DV1A 4AAYA 3EH1A 2J9GA 3ZXXA 3A36A 4HJXA 1E8NA 4JGIA 1QM5A 1SHTX 2IYNA 3OCCA 5B1SA 2ZZNA 4BVJA 1PS9A 4MVXA 3ZJVA 4IV5A 1Y7TA 1DEAA 1KHTA 3DNPA 4QVIA 1ZU5A 3EBOA 4HQFA 3H05A 3OQPA 3WLTA 2B2NA 4YTEA 1DKOA 1LZLA 2ZRAA 1HLFA 2AG1A 2PD3A 4AJ2A 3KT8A 2CFTA 2JKVA 2VAXA 4COKA 4Y8VA 1AS2A 2B8JA 5DCWA 1FLDA 1MX3A 2HBQA 2J3MA 2WFAA 1RXWA 2IXFA 3DVSX 3GEBA 2GH1A 5FIUA 3R8XA 2QDKA 5FFFA 3WGUA 2G9NA 5A3JA 4ZVUA 1P81A 3GRFA 3B48A 3F5MA 5K0ZA 3A14A 4L28A 2EX1A 3D4BA 5E0OA 2IW3A 2IIVA 3QLVC 1K7YA 5IF9A 5JY6A 4P3YA 4UM8B 1BSVA 5TARA 2LXNA 4EL0A 1C14A 1E2QA 2YXBA 4LJ5A 1Q15A 1QK4A 3OHMA 3QKIA 3NEAA 2IOHA 5AHOA 4BO1A 4Z7JA 4PS0A 3VYUB 2D06A 1FUEA 3DQQA 3HBLA 1BQ3A 2C42A 4O4HB 5A3QA 2FA9A 4OTZA 4U4AA 5BSWA 4DNOA 3TFWA 2JG3A 3M6VA 1Y3FE 5FFNA 1PJTA 2WG2A 1U8EA 5DRYA 3T9CA 3W3AH 1UAAA 2DF8A 4KQ2A 3NETA 4M0CA 1TO1E 3G9XA 2BUAA 5K6RA 2PGOA 2OZPA 3JRXA 4R2HA 2GD0A 5TIIA 1RQGA 1ORIA 1RI3A 1Y4UA 2ORWA 4TS3A 1KTIA 1PV4A 2AX4A 4DR2B 4QOJA 1ENYA 4LYYA 2V5UA 3LK6A 3H5AA 3M6FA 1F6BA 3B1ZA 1SQ5A 3D7SA 1E7WA 4Y30A 5IEBA 1N92A 2HHLA 3AF3A 2GZRA 4MUMA 4O0MA 5H82A 4ZDIA 1F17A 1H1LB 3H0EA 2VO1A 3HYNA 2N47A 3LT1A 5EY5B 5G3YA 2AOUA 4EG7A 5K8LA 1ESNA 2R7KA 5IRCD 1DAFA 4YMHA 1T3ZA 1DGQA 2FFQA 2FMIA 2K5UA 3A3NA 3DEIA 5ICEA 4NZMA 3MT8A 5DI9A 2FMHA 3LQQA 4CMAA 4ER3A 3TDKA 2EFJA 4YX9A 3GP3A 1NN0A 3ETCA 3MLEA 4QXRA 5GGYA 3KEGA 1TEXA 5ALRA 5IW8A 1DINA 1SUBA 3RF6A 1OWLA 2QTTA 1QSGA 3RUDA 4Z4CA 4WLUA 4HEJA 5E6UB 1FLAA 1JRLA 3JQ9A 2WW8A 2PO7A 1THTA 4L3VA 5E4FA 4U8GA 1AU9A 3JS5A 4EFMA 2EU8A 4M1TA 4O4IB 4XGIA 4OHZA 3SX0A 1RHMA 5EVCA 3WJ7A 1XKTA 1YUNA 4AZ0A 4L8GA 3M7IA 5JW6A 5D2CA 1FX0A 2HDNB 3PWZA 3Q7SA 3EDOA 2ECOA 3LPNA 2DETA 5G1NA 4UBLA 4YUVA 2R68A 1G19A 2VBCA 3TG2A 2O3SA 1N5RA 3QKRA 1Z5NA 1TVKA 2WF7A 3CF4A 3OE7A 4WERA 3IX7A 4XVQA 5E7QA 1GGMA 4YUZA 4K7JA 1HT1E 4B2YA 4E2FA 4JMPA 4XQ0A 1OZFA 4Q15A 5HW0A 4GDMA 4CKBA 2QTZA 2EFYA 3ONWA 1ZVVA 2X1HA 4RCVA 8AT1A 2F8SA 2ZUUA 5K3EA 3GZTB 3OLZA 4BU1A 1PNOA 4ER0A 4MI3A 1FP1D 2EYUA 4M89A 2YNMA 3BDAA 3OECA 1ZM2A 3DMYA 2FZKA 3GLGB 2ZSDA 3BMNA 3P9YA 1E1MA 1DZIA 1JHDA 5EHQA 3PPIA 4WW0A 3X1YA 5C81A 3BA6A 1UJ2A 3GG9A 4WZZA 5H02A 4O3MA 3QPBA 1DV2A 1XRQA 1O95C 1TAGA 3NYIA 2C96A 1G5PA 2VVTA 4ILEA 2IHYA 1GCIA 1A2KC 1BMFD 1BD3A 2R25B 3PTZA 4RPHA 1U6JA 2N9UA 1XTTA 4UUNA 3KSAC 3DPSA 4EJSA 1I0ZA 1KR5A 1NBEA 3ZY3A 5ICMA 4ER7A 3OM8A 3P45A 4J9UE 3S28A 5KWJA 1LLQA 3CVYA 3PRJA 3WL7A 4FBMA 3ODGA 1QFSA 3Q1LA 4ZAGA 3RNOA 4Y6OA 1DC6A 3IYLW 4OX9B 4FEYA 1EVJA 2GFIA 3MGCA 4R98A 1H2XA 4DSAA 4QULA 2XBLA 1PU2A 3DD5A 2QN2A 5K8TA 1HPLA 3CLTC 1DTWB 4QGHA 3LGSA 1OFUX 2C2YA 5AM0A 3R7FA 4WNAA 4Q7LA 1R5JA 1AKQA 3PYLA 4BASA 4TL7A 2G63A 1N6HA 1IZ8A 3HDHA 4DBZA 3JCZA 2A8YA 2JAHA 3P32A 4HDKB 4R69A 1QH8A 1UOEA 3O4VA 3T4PA 3WL3A 3WYCA 4C3VA 4X1IA 4H0CA 2EP5A 5E0KB 2I7XA 1LSJA 2DY1A 1N9KA 2ORIA 2ZJ3A 4HNGA 2MTBA 4L6CA 4YJ2F 4IJ5A 2Q9CA 4M9UA 5HGJA 3ZYCA 4J91A 4DJEC 1ND5A 3G59A 4EKIA 2D2FA 4LF4B 3K6SA 2FPXA 1UDBA 2CD7A 3G49A 2POCA 3IBCA 2GBPA 3WIVA 2JIRA 3E48A 1D2GA 2I55A 4ISCA 1LDYA 4JWTA 4GSLA 4MEAA 4OL0A 4Y9SA 1NBIA 3RARA 4O4JB 4B3CA 2FVYA 3BMQA 5B3LA 5JH7A 1C0LA 1YZ3A 4DCGA 4F12A 1CULC 4K9LA 3CSSA 3AUYA 5J5AA 2ATCA 4JI0B 4A7PA 2AJDA 1MQSA 1EB8A 5JXWA 1MFPA 2H2DA 5D00A 2ZJZA 4RVFA 6CHYA 5CHEA 2D1RA 1NUPA 2FUNB 3CXUA 4MS3A 2WSSA 3VHXB 2QLLA 2YHSA 4DCCA 4DA9A 2AN4A 2RH9B 2AC2A 3WLRA 1NNEA 1F7UA 4QGGA 1LDMA 4K9OA 3V9AA 4CDRA 2WIJA 1JPVA 2Z2JA 1EIWA 2BFNA 2RI1A 4LX0A 2PL9A 4X6XA 2D1FA 4QRHA 1N9GA 2G77B 4E08A 1YZKA 2H48A 2ZANA 5AW9A 3DAYA 4JI8B 2CFRA 3DUWA 4EEKA 2WB4A 1BHJA 3LDGA 1FSFA 4B45A 3F97A 4FR0A 4R05A 4RHCA 5DHQA 3F9RA 1WXGA 2IYOA 3FTEA 2C54A 1FBNA 1VP9A 2DERA 2ZVJA 1KOLA 3OEEA 5HIJA 3E5HA 4II3A 1XQXA 3P4YA 4E15A 2DQ4A 4GKBA 2H16A 4JLMA 3FHOA 4NU0A 4BQSA 4P34A 1S3SA 2ZTLA 3AJDA 1FFXA 4FS3A 3TTVA 1UBOS 4KDEA 4I55F 2ECFA 4YYZA 1M6EX 3OG9A 3TG8A 3GRKA 2BDUA 2XITA 1W4AA 3DV0A 2HWUA 3LXMA 4MRVA 3VC2A 3RSOA 3E82A 1VTKA 5BMVB 4D9IA 2F1KA 2QVCA 1V7CA 2DBVO 4NESA 2PE5A 2PX6A 1PP4A 2VQDA 3H4IA 3IP9A 4D41A 1O8CA 1P0FA 1YI8A 3EXFB 2FPSA 3HJCA 4GI5A 4FGUA 4P80A 4BBAA 1F4VA 2ZYWX 2KLHA 2ZB2A 3HB4X 5EJ4A 2BTOA 3U39A 3B9RA 1CY8A 4P7GA 4LSMA 2YUTA 3BKXA 5CLQA 3VYVA 4E88A 3KJZA 4KR2A 3VZRA 2ZSUA 3FTPA 2XXAA 4O33A 4B81A 1Y9JA 1JLMA 2WOOA 1A8PA 2ZYGA 1POXA 3VHLB 2UYCA 3ONNA 3ICCA 3NHUA 1R4ZA 3BBPA 1W8DA 1USGA 1XK6A 2WE7A 1JV2B 2WWVD 3JZIA 3BWVA 3W9YA 4R83A 4D4KA 1HNZB 3ER8A 2CNNA 2HXGA 3L6OO 3OLWA 5CCDA 4BQIA 4K86A 2FN3A 2TMYA 4HWPA 4MW5A 3CEPB 4BJ3A 2WA1A 5EUCA 1RVV1 1IN1A 1WUTA 1R88A 3H1EA 3U3MA 1ISRA 1YC2A 2IXDA 3V6LA 4AMUA 1WLYA 2Q4TA 4DV6B 3L0IB 3UICA 3PR2B 2OILA 4EW1A 1AQUA 2VPIA 3D7KA 4V3CA 2GZSA 2REQB 3PSAA 3AGPA 3O38A 1XC7A 1QHSA 1XTQA 4EGFA 5CITA 2FZ5A 1SVNA 1UDAA 4S0XA 5HIAA 5ED4A 3OEED 3SJAA 4R8SA 2OM2A 2G9ZA 3LXUX 4XPIB 1DQNA 2WJAA 3GLKA 3LF2A 3QG1A 4RENA 3SIRA 1Z83A 5DBFA 4CEIB 1A97A 1T9KA 4PIVA 2FN4A 3H18A 3IO5A 4CN8A 4MW0A 4N9WA 5EHZA 5LL6P 4UQOA 1GRRA 2BFMA 2GZ3A 3K8OE 3VR5D 5CUQA 4D92A 2VDWB 2PR7A 4HWGA 4JCCA 1T0HB 1L3IA 4OVKA 1Y3AA 2WI8A 1TF5A 3FRJA 4JSTA 4Y0VA 4JFAA 3VNQA 4K9MA 4Y9TA 1QC5A 4UE2A 3IOCA 3L3BA 5A05A 4I1PA 4YMWA 3PLAE 3BF7A 2E21A 3QSYA 3ZQKA 2NSLA 1BGWA 4Z4FA 4BUJA 5IC6A 1PVVA 1A7KA 2VF4X 1MCZA 1Z7GA 3PNVA 1P33A 1V9CA 1D5WA 1ATZA 1Y9ZA 2NPOA 3FNRA 5I7SA 1AT1A 4UFPA 2D7DA 1V8ZA 2BY4A 4I55A 1TNDA 5SYNA 3TWOA 3KSRA 3ZHBA 4EHFA 1GO2A 1PZMA 4U7TB 5BWCA 4ZTUB 3MMSA 3B1XA 3LA8A 3PXCX 4Q19A 5I9NA 1JH9A 3UBMA 1NV9A 3GJQA 1I32A 4JXJA 4DHWA 5K8JB 1AGNA 1JA9A 5AXDA 2I2FA 1SO8A 4IDHA 4RVCA 3D59A 2FDXA 1ZY2A 4J3NA 5LP6A 2KYRA 1GD1O 1EZ4A 2QJRA 3PGMA 2I8AA 4MITA 1N1EA 1S6YA 1JTVA 1JHXA 1SC9A 2A9QA 3GNTA 3NIDB 2XNKA 3PNOA 4D0RA 4DFDA 3VR6D 4YUAA 4I6EA 1O9GA 2WFZA 4CMIB 1M8KA 2NUTB 4OQLA 2Q46A 3LDHA 4DUGD 1Z7EA 5IS2A 1IYZA 4NJEA 3D54D 3OY7A 1F60A 2OFOA 4M9SA 2IOYA 4LJ8A 4EHDA 1VCNA 4C03A 2EP8A 1J2YA 4N49A 2ONCA 3VR2D 5I48A 3WK4A 4XUGB 1OB2A 1GQFA 1NLZA 2AF3C 3CNNA 3NIFB 4BQRA 2HF9A 1HI9A 1NF8A 1AN0A 1LH0A 3OUUA 5IMBA 1XD2A 3WWZA 4CODB 2UXCB 4KVAA 1G7TA 5ITZA 2VPYA 3IKVA 1TJ4A 2HO4A 2CVHA 3PIIA 1U5BB 4FONA 4GG1A 3WDMA 4DV0B 3ROMA 3ZHRA 3BMQB 2W83A 2JKZA 2YFHA 3H2GA 3OM1A 4RE6A 3A58B 2QSJA 4ZYLA 4YHHB 2BISA 1UK8A 5EWJA 1DBRA 1SU4A 2YJ3A 3B7PA 3L0DA 2JRLA 4INJA 4AIIA 2C5LA 1RRKA 4WD3A 1JZSA 4IBOA 4ARVA 5AR1A 1C7QA 4TYPA 1DWQA 1V8BA 4K0RA 1L4MA 4X90A 3HVIA 3LY5A 5C2JB 2AQHA 2GCIA 3BC1A 5LQAA 1HGXA 4DMRA 2PY6A 1N5IA 2YV5A 5FWYB 5H83A 1G3UA 3RVOA 5AK0A 1D5CA 1WUHS 4FUQA 3K6RA 3C1AA 4O63O 1KS2A 1QONA 1NJFA 1FTYA 3D2CA 5IYZF 5COBA 5LZ5A 1WCV1 1R0BA 4DV7B 1M5RA 4AJ9A 1M7HA 1Q7EA 4CVNA 3AKZA 3IV7A 3TR5A 1KQ3A 4ZYTA 4X41A 1VCMA 4WLVA 3CLUC 2Q5FA 3HH8A 1XCOA 4N0QA 2ABWA 3TLBA 1AKEA 1XZLA 1MH9A 2GLXA 2XKJE 4Z3DA 1EQUA 2PFSA 4EY6A 3EWSA 4J0CA 3X1MA 2C5HA 2DZDA 4M49A 4PPFA 2OD9A 3K32A 2G28A 3DLIA 4TYMA 4U6SA 4JQYA 4X00A 4FMDB 2WOJA 2OP0A 4R8VA 3AZOA 1IWBB 3L43A 2AC4A 3KSUA 4QWWA 4NAUA 1FX1A 4X93A 2O0HA 4MW2A 3SSNA 2JAQA 1RWQA 3GA7A 3JYOA 2XUZA 1RCFA 1SCNE 4J07A 3QKUA 4NONA 2CHVA 2OV2A 2D2XA 3DO8A 3RWBA 3EC1A 3WO0A 4A03A 3TUIC 3MA0A 4EI9A 2DB3A 1Z5VA 5ENZA 5JCJD 4CKCB 4FDVA 2DGDA 1NATA 2LIPA 4YROA 5EC8A 3CM0A 4HMQA 3I1JA 1Z73A 4F11A 2PX5A 3FJOA 4IINA 2GRAA 4GP9A 1KRXA 2R6HA 1N2OA 1KO5A 4A2PA 3GUZA 5LP6F 3K5IA 1ZP6A 3UMGA 5ES4B 4G5GA 5JHGB 3KB6A 2CHFA 3H6HA 5TF0A 1BVUA 3ZHUA 1CJMA 1TF7A 4LF7B 2FZVA 5J2TA 4BKQA 4EQ6A 3FUTA 4GZLA 3NGXA 1N4AA 3H11A 3BYZA 3A9RA 1PI3A 3CGWA 3QLVA 1O97C 4MCJA 4U7JA 3T3PB 3WE7A 1T2CA 5CFZA 2HWYA 4KBGA 3W5CA 4BNWA 1N3LA 2KS6A 3E3AA 4R0NA 1M2GA 4BC1A 5H4HA 3NLLA 1ULSA 4DQ0A 2H3HA 3FGZA 3MUNA 2Z9DA 4JROA 1EM8B 1KU6A 4PIMA 3PEVA 5FBLB 5E3HA 3NUZA 1AN9A 1X13A 4YRFA 1R0ZA 3OE7D 5B3JA 4Z9FA 2ATEA 1E3SA 2ZRIA 2P2NA 5G02A 2VSYA 3BEDA 4KPEC 3GIDA 1YCFA 2YIJA 3SFTA 2PL3A 4RH3A 3BRCA 1DO8A 1L8LA 3ZEAA 1VG9B 5J2UF 3OQ1A 1SU7A 2II6A 4QHYA 3OQJA 1JEQA 4Z9BA 1YQ9A 3JPWA 5GTDA 4YXWD 1K2VN 2LD4A 2YJ5A 5L3QB 1XRJA 1G8AA 1WW3A 2P0AA 3HVRA 1SVKA 3V4ZA 1OYOA 1L7OA 1JKMA 3HA3A 4F06A 2VXBA 3GMTA 5ALSA 2W0SA 1R15A 4JQCA 5EQJB 3S2SA 5GJWC 5EMNA 2CMGA 3TZ6A 1XKLA 4DB4A 1KETA 3L4EA 3WL4A 1OAKA 4NCXA 3X1XA 5C7IO 4AF6A 1ISJA 3CZQA 5SZJA 4JLVA 3OUTA 1HE2A 4HGOA 4OBBA 4LV5B 4PO1A 5AKIA 3WA7A 4BXOA 2YMPA 2BZ0A 2VF5X 4YRDA 1RD4A 4C6TA 3ICEA 3O1HB 3DBLA 1E99A 5JS1A 1RLTA 2BGUA 2CGEA 4JENA 2VWHA 1N5MA 1E9EA 1JKFA 3CJQA 3FDFA 1ONPA 1ADGA 5TQ2B 4GUAA 3UJCA 3UMMA 3O21A 4CEJB 4CEIA 3I62A 1EG7A 1JNXX 3VKUA 4BNVA 2VPZA 1M7GA 1SU6A 2GK3A 4YJGB 5G3ZA 1KC3A 4Z53A 4NRDA 1MDFA 4I8DA 5JC1A 4X24A 2Q1YA 2GPAA 2Z8YM 2VSFA 4IS2A 3QI2A 2QYTA 3W5JA 3HFJA 4JL5A 3R3SA 2EG9A 2XZTA 3I83A 3RHTA 1EDOA 3ADCA 1H9AA 1Z4NA 1VRCA 3R74A 1CRLA 1DSSG 4J9VA 2BTEA 1EK2A 1G0NA 3HWSA 2Q3FA 3BD6A 1OY1A 1VLQA 2A9VA 2JFHA 3G89A 3I30X 3IPRA 3EXG1 2W58A 3BIOA 2XQKA 3CWCA 4BZPA 5AW4A 1PR6A 5KYYB 3L5KA 3HBAA 2XB2A 3GRPA 3G2IA 5AK3A 1M2JA 1GSHA 3NHMA 3RC8A 2X4DA 3C6KA 1XN1A 2FE1A 5AK5A 1T3TA 4CKWA 4FHZA 2QSYA 3BWEA 4MVJF 4S2EA 3VZCA 4ND1A 2A2ZA 4Q9LA 1PS8A 4UVIA 3PVSA 3BF8A 3LP8A 4LQ4A 1T8WA 2OGZA 2XNJA 3OMWA 4P0TA 1RZRA 5GJBA 3RAPR 3Q3VA 4Q4JB 2H7VA 2XNSA 5TVKA 2X0FA 3ID6C 3FFWA 2NMVA 2CZCA 3I2IA 5HMMA 1DRWA 2WPDD 4RZXA 4C4OA 5KOJA 1LS1A 4NE9A 4MHSA 2CLDX 4X95A 3UJPA 1L5LA 3AYXB 1XWFA 2E87A 2JGDA 1LNQA 3ROTA 1EH5A 1MOSA 1T8RA 4TVSA 4RPLA 3QEMB 4HGPA 1CVIA 2DUNA 2PSJA 5DGDA 4JYBA 1K92A 1W4BA 3E05A 1U1GA 2Z2XA 5JPCA 1F51E 2HW8A 4WZAA 1F0NA 1TE2A 2FX2A 2KBEA 2Y27A 2ZTUA 3KQUA 3MTBA 3ZZUA 1CU1A 3ELBA 2OD7A 1XYVA 2Y68A 3K4QA 4QYXA 1PQWA 3E35A 3GT7A 4LE2A 1PN3A 3A37A 2NX2A 2X3FA 1Z47A 4OI2A 4FWIB 3M9XA 4RV9A 5J5VA 2VWGA 2JFVA 5EP3A 3FSGD 4DVGA 3GH3A 4KN9S 2FG6C 3RWOA 1YU6A 3PEWA 4GQBA 5FWXA 1JQEA 2ZRHA 4LXTA 4BPBA 1XDDA 3HA7A 4MDEA 3N2EA 1SNYA 3EVAA 2NU7A 2RHGB 3O4HA 3OZBA 1U8YA 2VDRB 4ZCRA 3GVCA 4HSEA 3A06A 4C9BA 4LF6B 1OBCA 3OEYA 2Q29A 4GH5A 1OI2A 4QLAA 2X6QA 4IJKA 1G5RA 1Q2XA 4LG1A 4GKVA 3VOTA 3FB4A 3KZVA 2X15A 1IXSB 1DTEA 2LRHA 3ABQB 3CF4G 5EXSA 3ZHCA 1DX9A 1M2VB 3HKDA 1L7BA 1SELA 1X70A 4L02A 4MQ4A 4FQ8A 1XV5A 3KE9A 4H18A 3NTUA 2ZM5A 2Z6QA 2X40A 4UUPA 3ADKA 4PG7A 4OSEA 4MTCA 3M3PA 1KR2A 5DXAA 1UXKA 2HJHA 4Y2HA 1LI4A 4P08A 4UU8A 4JBXA 3SC6A 3VR6A 2RD2A 3CRQA 1OFTA 3JQDA 1RBZA 2AH5A 2YBDA 3DG9A 4R8MA 1PZEA 2FZEA 3T8YA 4C4XA 4TS4A 4ZCMA 3I0MA 2LBPA 5CLFA 4QG3A 4F5DA 2FWIA 3TKAA 1BEUB 3DF7A 5FULA 2UYGA 1UPXA 4UVGA 3VR5H 3WFJA 4AICA 1X1QA 3V4LA 4A0RA 5CA1B 4ZALA 2BGLA 2RFLA 4B6FA 2BHLA 2JRCA 2GNPA 2IHBA 3LGXA 3M3HA 4LTDA 3AJ9A 4N82A 5LFAA 4NNJA 3TUJC 1OE0A 2V3CC 1AUXA 2BEJA 1U9IA 2Y1EA 3BEOA 4A4DA 4GR5A 4EFNA 1J8YF 1MO4A 1IXYA 2I6SA 5FPHA 2IIQA 1EFRA 1Z35A 2IX9A 2ZYDA 3II6X 5JSKA 3BXXA 2BFCB 4C7XA 1NP3A 5K3DA 1K4MA 3F5QA 1USUA 2HRZA 3KT3A 1AZTA 4Q39A 2I3BA 2OGSA 4P9NA 4WN9A 3SWWA 5BOSB 1C7JA 4LXXA 3KALA 4IJ6A 1MAHA 2FW1A 5IC5A 3S70A 4E11A 2DJ5A 1MRNA 1Q12A 2JJ8A 3ASUA 3BE5A 1ZUNB 4L3OA 4EF5A 1E6KA 1TKBA 2WP8J 3DEZA 1A9PA 1PHRA 1PT7A 2IDKA 3HG7A 4IV8A 5LBUA 4RK1A 3RO7A 3WLOA 4RJTA 1NKVA 3PC8A 3ZDQA 1YMUA 3CC8A 3CUTA 2ZYHA 3WFZA 5JY1A 4HQKA 4UEKA 2Q9AA 2ZCVA 5FUVA 3USZA 5CX1A 3U4AA 4FOOA 4JHXA 3K70B 5HQTA 3E2IA 2Z95A 3GUHA 5A7HA 4YT5A 1SQ6A 2X7XA 4CCYB 1Y8AA 4LY6A 1SKQA 1F3LA 1YKFA 3AHCA 3WRYC 3ZQUA 3MRSA 3QE2A 3GRYA 2J6HA 1FNSA 3E9YA 4W1SA 3VU9A 3W79A 3LG2A 3SQLA 3NFYA 4CMBA 3G2OA 4WK0B 2ZBFA 2PGAA 4CQMD 4YQFA 1BMTA 1SPXA 5AJZA 4GD3Q 3ZCVA 2YZ2A 4X6YA 2BEVA 3IT3A 3UPTA 1LJUA 1D1QA 1B2LA 3K5PA 3AFIA 5I6DA 4G65A 3UOAB 3ZLUA 1KSFX 1LBTA 4ZYUA 2DJIA 2CEKA 4IEEA 3R24A 1N25A 5JEDA 4KXXA 3KNZA 3OX3A 3ZBPA 1V8DA 2IC5A 3SEQA 4I50B 3TFOA 3FYCA 4B3XA 1ZC4A 1XWIA 4IG9A 1RR6A 1H2ZA 1G8YA 3TW4A 4IHQA 4RTKA 4H0NA 3N2KB 3GCDA 4ROTA 5ALIA 3QMPA 1C1XB 1OQAA 3RVSA 1KS9A 3NEJA 1ZVKA 4D56A 4HQOA 1OA1A 3BB4A 3KJIA 4DARA 2EKQA 2Y1XA 3L8YA 3W3ZB 2I4TA 1KDOA 2QPAA 4G5SA 5THKA 3NX4A 1JXQA 1HQKA 3F2VA 3ZVMA 1MT3A 1PQ4A 4EGAA 5FPSA 4PZDA 1M2HA 3QKTA 1OAAA 3OU6A 4MWGA 4X1YB 2DR2A 5JNVA 1O57A 1Z7BA 2ZAMA 5HJEA 1QYWA 2BFBB 5DYGA 4HAOA 3ZGXA 4EG8A 5TPZA 3OPQA 3HJGA 3QTBA 3K0EA 3X1ZA 1FNDA 1FEZA 3B7GA 4LBWA 1UP4A 4ZQHA 5KX5F 5C3UA 1JLKA 2QTMA 4W99A 1B6GA 1Z2NX 3GRRA 4JYPA 2F48A 3Q0EA 3ANTA 1WW8A 1JXAA 5DVZA 3CMMA 4MAAA 1XD9A 3RRJA 3HB7A 1TQHA 1RLUA 1U2TA 2B5VA 1LDBA 2E5WA 3LFTA 1Z4PX 3MWDB 1NVBA 2A1TR 5KJFA 4LYHA 4AY5A 3MB5A 3T7EA 3WRXC 1GLVA 4OLHA 4M99A 1VMDA 4IWNA 4FKBA 4ZQBA 1Q6ZA 1J90A 1NY5A 5DSZA 4RLHA 2JGDB 1S5PA 5EHIA 1JDBC 3ZTYA 5J9FA 3TLKA 3F67A 1ECFA 1QIHA 2IZ5A 2J08A 4IIVA 4NYIQ 3TYXA 4YV2A 1E5QA 3PHIA 2FQQA 2GNOA 1RYHA 1ZIPA 2X4GA 4BZQA 4CYMA 5H7XA 3DYBA 4QDXA 4JXZA 1UXHA 2NGRA 2A35A 4REQA 3JQAD 2JFYA 4UMDA 2YWJA 2BMAA 4RVSA 5A7GA 1S01A 5LQNA 4OQDA 1WKCA 2R1VB 1JSRA 3KEQA 3KUCA 1D1SA 3VNAA 1OCEA 3WLKX 4CF3A 4OI0A 4AYTA 3QY0A 2JFUA 4B17A 4D8TA 7YASA 1XCMA 2AA3A 4H9GA 4HTFA 4BJ5A 4HB3A 6REQB 5KOHA 3RSLA 4JJ7A 2PUEA 1FSGA 3NOVA 4RA6A 1N2ZA 4KU4A 4OGLA 3N9IA 5BV7A 3ZIAD 1KOFA 1L5OA 5AUPB 4J0FA 1YHYA 2PVPA 4YP5A 3AYZB 4QAJA 3NDJA 3GEMA 2HV8A 1G0OA 1EFRD 1E2IA 1NA5A 2OHOA 3DHWC 3NBYC 4Z2AA 4YPFA 1N9GB 2FHSA 5BQXA 3E4DA 1T4GA 4IHJB 3RYHA 4ZMSA 4EJ6A 2IE0A 1QIMA 1VXOA 2BFWA 2XWQA 1DTSA 4GBJA 5ANRB 1SIUA 3UT6A 3HZHA 1OVGA 2OCPA 3ONDA 3PCTA 4MV3A 3KJNA 2WUWE 3DOIA 5HUHA 1JWLA 2F43A 2UVPB 1SC6A 1GGHA 1UDCA 2P2DA 3T5CA 3U2QA 5KNDH 4FFOA 4DLSA 4R1LA 4OJTA 2YTZA 3ZX4A 5B57C 2OLJA 3IAAA 3KXPA 3RASA 4W5JA 4C88A 1NXVA 4LZLA 4MKGA 2YYYA 4JYCA 1UFOA 2J48A 1G7CA 2WG1A 4RUKA 5D5PA 1CUWA 4BLPA 3P9IA 4CGZA 1DVRA 1QANA 3MRXA 2OAEA 2RGRA 3NV9A 3CRNA 1A98A 3E22B 2WHPB 2REQA 2QTNA 4IVPA 4NJOA 5HK9A 2DPHA 3PWTA 3LDUA 4YJ3A 2A30A 1CSEE 1GQOA 1DMRA 1BNCA 2D2IA 4KTVE 4EW3A 3WQSB 2QMOA 4NV0A 3HHPA 4UM9B 3FZEA 4QUEA 3MWEB 3OZFA 3AB3A 3EWNA 3GO4A 2NN3C 3PICA 1D1TA 3R4VA 4TV9F 2Q0SA 3ENKA 5AKYA 2QTVB 3MD0A 5EKUA 2B4YA 2JLBA 5KUTA 2XTNA 4Q3CA 1JQ3A 1P0QA 4FGKA 5LA6A 3O5AA 1CNEA 1RP7A 2PJDA 2LIVA 1JE0A 3PUJA 1Y1QA 3HKDB 4HEA6 3DZBA 3AY3A 3CPSA 4J43A 3A4YA 3A6FA 4J0HA 4LY0A 3GT0A 2OPBA 5JASA 1R0RE 3DW3X 1CNMA 4YGXB 3PHBE 2QN8A 3M5WA 5E3JA 3HB0A 3UKDA 4IKOA 1T36B 2G1JA 1J1ZA 4K9DA 2GR9A 4TLEA 4XGNA 3FTFA 1JR3A 4KDRA 3QYPA 4LDAA 2XB6A 4LRXA 5EJFA 3FHJA 1Z82A 4C7OB 1QOPB 4IM7A 2OYSA 1IRIA 3LQKA 2W4IA 4MKFA 1G9XA 3E5RA 1IIRA 2VRNA 3HKEA 1TVEA 4R81A 3L84A 2QT9A 3K16A 3RNLA 2A1UA 2DVMA 3VKVA 4OGWA 5CLHA 4KXQA 2JI7A 4B6EA 2Z4SA 2XB4A 4NSNA 2B7BA 1JG7A 2PMKA 4FFBA 1A71A 1VYTA 5FI3A 1Z5OA 3E3OA 4X8MA 3UUWA 2AFHE 2MSDB 3V55A 2DCUA 3EXEB 2F67A 4KRGA 5FEMA 1WU8A 2J30A 5C1IA 5KTYA 4BNYA 4B2LA 4CMGA 2BGTA 1NFRA 1ZHOA 1JT9A 4LHYA 1U2DC 2QORA 3ZGZA 2YY5A 3FSEA 4M88A 1U0NA 4YUXA 4X20B 2RCYA 1W49A 1RZUA 1L8QA 4GSYA 1ZX1A 5FBRB 4ND5A 2NUTA 3OSUA 5A4KA 5L4LA 2A9KA 3ZZ1A 3P9RA 3AESA 4WV3A 1SIWA 1SXJC 2IY8A 4JLBA 4GLLA 4INAA 4W9NA 4ID9A 3E1KA 4DLRA 2Y66A 4HYTA 4MUIA 1JTEA 3WADA 2QX4A 3RSZA 4F0JA 3K9FC 2I22A 2J3DA 1HR0B 1WVGA 3L7CA 2DQYA 3VO1A 1GUZA 2HCFA 3LPDA 4V0LA 4KKXB 2QDXA 2JJQA 4R2KA 4OLBA 1QBGA 1AKWA 1QXSA 3PD1A 4OMUA 3A7EA 3F4KA 2GERA 1K9VF 1TCCA 4XI9A 4CCYA 1VKOA 3SBEA 3ZWVA 3EIEA 1PZXA 2WTMA 1D6SA 2NPIA 1RXUA 3T3IA 4ABTA 4MGHA 1G20E 4ECEA 3U56A 1NJ5A 2VUUA 2CNWA 4K6MA 3C4QA 2NZXA 3BXGA 3PJFA 2J9YB 3MCWA 3GLQA 5AVJA 1W6UA 3A10A 2XYQA 2Q5EA 4IFIA 5ALKA 3UMBA 4S1WA 4JS0A 3UFXA 5JMTA 4WKOA 1YS6A 4X92A 3FRIA 1X2EA 1TRKA 1X7ZA 2BI8A 2H07A 3TLMA 4UZFA 4IUDS 3D8SA 5AXAA 5IAJA 2XPCA 5A2GA 5J3JA 2PGJA 4QPNA 5LXTA 1T5DX 3SEZA 1EK1A 3IBTA 1C9EA 4N8EA 1K0FA 3L0PA 3MJ4A 4M21A 1NVGA 3QLJA 4MQLA 2ZATA 1BJKA 3RUHA 1YDFA 2FPKA 2Y77A 3CT4A 4Y0NA 1FNCA 3S8EA 4MKZA 5DNWA 5LLTA 5KTMA 1TKAA 5ITVA 3JWIA 3LS2A 4ZOLF 2D6FA 1IMOA 3QXSA 1HT2E 4B3BA 3MCVA 1I51A 1SZPA 3V2UA 2QRQA 4OMDA 3DMTA 4TTPA 1DBWA 5SY4A 4HZGA 1N5KA 1GZ6A 1XCBA 4BKMA 5AW2A 1J5EB 4BNZA 4TKVA 3O8NA 1CJVC 1RW4A 1PS0A 1E6UA 1KJ9A 3HMKA 2PO5A 4EZEA 2GM9A 3HMQA 3IP6A 2H2IA 1V1MA 3DXFA 1G8SA 2P0EA 2RGUA 3D5EA 1FP6A 4LJ4A 3G79A 1MEOA 4RZQA 1IN5A 4EG3A 3QOYA 1ZD9A 1C4XA 2WICA 2W4QA 3SJUA 6ADHA 3E9MA 4DMKA 2R6FA 3GUUA 4BJ6A 4WXPA 1Y6GA 1EXMA 2FXVA 3VPAA 1D8TA 1UBNA 5KYGA 4HDSA 1DQRA 3B53X 4FBGA 1E8DA 1SVLA 4HQRA 4Q3OA 3AWIA 1KYTA 3H9JA 1NSFA 1AKRA 3OJFA 4XZ3A 4WY2A 4KK4A 2I7DA 3AUAA 1U8TA 3FPCA 3V8MA 2IGTA 1MTZA 5HDBB 3B60A 3WSVA 5TX7A 4N3GA 5K7SA 4IH1A 1WHSB 2H1SA 3DVAB 1JMYA 5C4IA 1JA1A 1R6BX 4IVQA 1MOPA 5BN4A 5FTKA 1R8QA 3F5FA 1Q0PA 2PD6A 1H4QA 1J20A 4BO5A 4RAOA 1BAPA 3IBYA 3VR0A 3FMFA 1NF3A 3PXBA 1JLRA 2HNAA 3CH5A 3GRCA 1P80A 1W5TA 4EF4A 5LWQA 2R8PA 5F9FA 1Z6YA 1AQIA 1RKVA 4OHMA 1IY8A 4X6LA 4BFVA 1Y82A 1U3UA 1CZNA 3DTVB 3EXIA 3HJUA 1CDEA 2P69A 3TI7A 3ACBA 3INTA 4CXMA 3ZWCA 1HDGO 2IS2A 3E4CA 4GYJA 2X8AA 4EP1A 2EFCB 4HWSA 4ER5A 3G88A 2Q4EA 4FXOA 4HNSA 4GPTA 1KI1A 5CW1A 1H6AA 3OAAA 3ZBTA 1XKQA 4F2DA 1IHDA 2P4SA 1NU8A 3R0ZA 4O2AF 1Z0AA 1ZFNA 3UJAA 4BV9A 5CDFE 4I3GA 1GA1A 1II8B 1PD1A 3J81k 4R68A 2YL2A 2EZTA 4QECA 4CG1A 2ZJFA 5J1SB 4LJ7A 1JGTA 1CT9A 2XE6A 5I4KA 4TT3D 3QEOA 3GCGA 1XNHA 4CL0A 4KVZA 1B14A 3CKKA 4LISA 1EAMA 2EKPA 3GPDG 4XUCA 5TB5A 3TGPA 5AESA 4ZO7A 1O5TA 3JAMA 2CZGA 3SDSA 4Z3OA 2OBNA 4K9SA 3K8ZA 3SF0A 3LLSA 2VZ0A 1XJ5A 4Z7OB 2PWBA 4EUNA 2XOKA 5K3CA 4TMKA 5JD4A 2GZHA 2DUWA 3E7WA 4IRUB 4J0EA 1GIAA 3HZOA 4ZIRA 3GDFA 2VRWA 3F4BA 2C8JA 4LPSA 4X7MA 4Y9RA 3ZIUA 4CEJA 4YRPA 1TK9A 4RVDA 1JHAA 4OHCA 5BT9A 3STYA 2JH8A 1GZHB 3O4JA 3P5SA 4HNTA 3IPLA 1CJCA 3UANA 3QOWA 4D97A 3MWKA 5ILGA 5KDLA 2ODBA 1KQFA 5B3KA 1U3FA 3JQ6A 4YRAA 2IDZA 3CT6A 1I14A 2ZSFA 2Y6UA 2ZT8A 4ANFA 1BX0A 3QG5A 3HLTA 2O5VA 4G0XA 2NV2B 4YV7A 2P2GA 2Q1SA 4P81A 4RGBA 5IBCA 2RKWA 5JAMA 5HE9A 1PE0A 3QKSB 1PFVA 3H17A 4C4TA 1J8FA 3VBCA 1R2QA 3IRUA 5EE0A 2DHRA 4OQFA 1FRVA 4JR1A 4CKWB 2YKGA 4UTVA 1TI7A 4W8HA 1G3MA 4HDMA 5ADVA 2WJ6A 3OKFA 1GGEA 3IQGX 1CS4C 1NQWA 4F6LA 2OXIA 3A4VA 1H94A 1TK2A 4IDEA 2WM3A 3C0KA 2BFOA 1GN8A 3T61A 4NR0A 2JLWA 8ADHA 2QQ5A 1CUIA 5HKLA 3G2PA 1BOFA 4TLCA 1SFRA 2GKGA 1FFXB 2TYSB 3F3KA 4BDTA 2VYQA 1W85B 2SNIE 3VBEA 2NXWA 3ETJA 4OBWA 4XDYA 2VLIA 1Z38A 2A4KA 2NQ2C 3GPLA 5E9QA 1T9GS 4XSHA 2UZ1A 4QQ8A 4KREA 3HCPA 3DONA 4WN3A 4C08A 1DIOB 2HSGA 4HPXB 1HE1C 2HMUA 4RAQA 4WH0A 1C1YA 3R9XB 1XALA 1ZGAA 3JRWA 1MIHA 1TD9A 2VHJA 4I4TA 3HACA 3PGVA 2MSWA 2QLBA 3QNUA 5FUXA 2RK3A 1I1QB 1RKXA 3C24A 2H7CA 3Q9UA 1JIQA 3QA3E 4OAOA 3QE0A 2DFTA 3WK9A 4H27A 1ENZA 3GT3A 3GT4A 2ZUEA 2O8VA 1UMDA 3JX9A 4LCJA 3BAFA 4AZTA 2ZUTA 4HUQA 3T1HB 2JFWA 2VQEB 4YJDA 4NNPA 1PNVA 1BKSB 2WKSA 5DSXA 1XLVA 1J7JA 1FFDA 1FXWF 1W5FA 2QVXX 2V45A 1BDJA 4A8JA 2O1SA 2XMZA 4L4SA 4D79A 3C6QA 1N2BA 2P9BA 3BXFA 2NAPA 2WFLA 2QM8A 2IZ0A 3HY6A 1IEVA 3EGCA 4PBSA 2PDAA 2WJWA 3FPAA 1GA4A 5HUJA 5KYXB 1QS0A 1QG4A 1T9DA 4GYWA 5AJUA 1A9RA 4GMXA 3GJRA 4OQNA 3PQ4A 1GM5A 2GO7A 3RVMA 3RV3A 3VKWA 3LUGA 5ALYA 2JZCA 4PQGA 1COWA 2NO5A 1PEAA 2BSAA 3DKVA 1DRUA 1X38A 3EMVA 1Z2AA 2AI3A 2YYSA 3BMOA 1AK9A 1V9LA 2WKPA 4IXWA 2KI5A 4LYDA 4QPDA 5F1OA 3FE2A 1IM5A 3H4MA 3DXYA 2X0DA 2R751 2WRZA 1A8QA 1COWD 4E6EA 2LP4Y 2PZMA 4GNRA 4NZNA 3QVOA 5CEEA 1NHWA 1EGMB 2P3SA 3A3KA 3B85A 4FC6A 4LNUA 3JALA 4KNYA 4WLNA 4X62B 1XDUA 3UHAA 4TOIA 3N39C 2WTAA 3AKEA 4K3VA 2B7CA 1U94A 2O4UX 3GFTA 4NYJR 3RS5A 3F2IA 3KU1A 3VGJA 1B23P 2F7SA 1JDBB 2W6PA 1C4WA 1S2IA 3QMVA 4R51A 3OETA 3WNZA 1M2NA 4RPCA 1WE2A 4G26A 4QT0A 1FU8A 1U0TA 4Y2TA 5EEHA 4Y6QA 1T2DA 1I4LD 3KZMA 1DIGA 4IWYA 4RZ3A 5LYJA 2C4VA 2RB5A 4CMKA 1EQAA 1F8FA 3FUWA 2CNDA 2INGX 4PSUA 4AJ1A 1KKUA 2Z5GA 1E59A 2RH5A 4QJBA 4MPJA 4MJ7A 4NYMR 4Q05A 1LUAA 2PKCA 5JSZA 1LCIA 3E18A 4J1SA 2DSTA 4XAQA 2X2FA 4ENPA 2QROA 3PQ3A 5JCOC 5LJLA 1MVLA 2PL1A 1SXJE 4H3HB 1MRZA 3SHFA 3N3AC 1WBDA 4CM5A 5A62A 1IQPA 3RYIA 3SKVA 3OJ0A 1RZRD 2JCSA 4H4CA 3VR3A 2VK8A 3AIIA 3PNMA 4KWIA 4AZVA 1GL9B 1V3UA 3AFNA 4WDQA 4JZKA 4NCIA 3U4GA 2JBHA 3VH3A 1XNQB 1LX7A 3S2YA 3R76A 1NQUA 1K1EA 3ZY5A 1CFZA 1CTQA 1UJNA 2EF1A 2ADOA 1XG5A 3TCNA 4W9MC 5H68A 4PVDA 4CT0A 5JRZA 4UUBA 3TN7A 3I9V6 1JECA 3H75A 3VI4B 5CFRA 3WGGA 5HWSA 1VMEA 4NENA 4RHUA 1BOOA 1IXRC 1ZZEA 5B4UA 1KFCB 2QTLA 5HHTA 1XELA 2GJ9A 5LXTB 3DMHA 1Y4DE 4TWIA 4EOGA 4OHWA 4PHCA 2VYNA 3JZDA 3FWZA 2CSUA 2X0JA 4DTCA 5LMNB 4LF5B 3MTGA 2HBRA 3OOSA 4J0GA 1YACA 1ZNZA 3IPYA 1ZJZA 221PA 4RY8A 3GW8A 2VHCA 2NWQA 1YBAA 3LLUA 3RRNA 3OIDA 2XMSA 1RM4A 2YIDA 3O47A 3U09A 4ND2A 1GQYA 3D9QX 3KPJA 5E1OA 2Y8EA 2A92A 4IPTA 4MLPA 4R5HA 1X74A 5K9ZA 4HEHA 4PG5A 1TQ6A 5CAEA 1PUJA 1BWPA 3N87A 4LRYA 4YMSA 2J3KA 3NZEA 1Z7WA 2IYPA 2Z1DA 3NRCA 1JR2A 2XECA 1KJNA 3QWFA 2FZWA 2OORA 1Z26A 3QFHA 3H1PA 4B47A 1RAAA 2X1MA 5FLYA 2YFYA 5AI9A 2KQUA 3HR7A 1CUDA 4CTOA 2FB9A 2Y67A 4I50F 1BVYF 4G89A 3KZNA 3CE6A 1PIWA 1KBQA 1BCRA 4OQMA 3RQSA 1IONA 5CFQA 1DDGA 3C48A 3RJTA 4PLZA 3L0SA 3PPWA 3F7TA 3F6EX 5TEVA 2G0AA 1IH8A 5DNCA 1ZUWA 2R6AA 4L4XA 2D74A 3D81A 1I1OA 1JVNA 3CV3A 4L57A 5A3VA 3ZXIA 5GADl 5CJJA 4GEGA 4KR6A 1Q1QA 1A9XB 4OX9Y 3U3XA 1U3TA 3Q11A 1PFWA 2Y2VA 3D0RA 1GUFA 3FNIA 2P78A 4OIMA 3V4PB 1EXWA 1K8YB 1GSIA 1DELA 4JUCA 1W73A 1X9HA 1Q19A 3N6RA 1Y98A 5BYBA 2VT6A 2I78A 2SKEA 2WUGA 4V0QA 5I9MA 2R8BA 4PFSA 2Q6TA 1K8RA 3SF8B 3KV1A 1CEQA 4K9QA 4P92A 4I50A 4C2AA 3U60B 1VLMA 2H59A 2XWJI 1E4VA 1T26A 2DQSA 5KREA 1D2AA 1GNSA 3AU8A 1EDZA 1VP3A 3B1JA 3BA1A 4KE6A 2CYAA 3Q3GE 2R97A 2ZGVA 1XJCA 2OHIA 4RDHA 1N5DA 2D5BA 5JSQA 2A78A 3DYVA 2P2YA 1G59A 2UKDA 2Q3MA 4R01A 3IQFA 3EGVA 3TAXA 1OR8A 4CMEC 3CN7A 4RZSA 3R7LA 4LRQA 5EGNA 2I54A 3NR2A 3QHPA 5BW4A 3I5XA 1XTRA 3B2QA 3THSA 4MW4A 2JJYA 3L4SO 4B35A 3DBHB 3PXUA 4P4TA 3VUEA 2VTBA 4YXFA 3KOYA 1XDWA 4Q1EA 1BU8A 3IDAA 4PBTA 1TAQA 2AD1A 3BGIA 3IAEA 3HJRA 1PLLA 2Y05A 2DYKA 4G97A 2VHZA 4M7PA 2HSJA 5D84A 5EE9A 4IR7A 4NZOA 3C6XA 2QI9C 1O89A 2GBIA 3H6KA 1HKHA 1ZOSA 4FYKA 4OF4A 4WECA 1TZMA 4LGYA 2YY6A 2Y1CA 1KWGA 2A0YA 2OOSA 1XZNA 3CEAA 4I1RA 5BSMA 1N2GA 1GTL1 2V5VA 2DSNA 3L7AA 1HRDA 3NWPA 2FH5B 3QWBA 2KWIA 4GFDA 4JP1A 3ZZNA 4BB0A 4IHJA 3G6KA 3MTIA 4NECA 5EPUA 1TLFA 3LLVA 2O2JA 4KRXA 3DE6X 4LTMA 3D6MA 1YE8A 2VP2A 4B7ZA 1A9ZA 1USKA 3JYQA 4X5OA 5CFMA 4BTEA 1ESCA 3LBAA 4X1KB 1TVKB 2EQ5A 2VPTA 5EZYF 2Q07A 3DOUA 5DX1A 4Y6RA 3GU3A 3ZS8A 4AECA 1TA0A 2CLCX 1GP2A 3HRHA 4Y1EA 4B6PA 1WOMA 4JJIA 3S1LA 1DPFA 1YFLA 2ORYA 1B0UA 1QE0A 4GOND 2QTAA 3AW8A 3MLBA 2I1LA 2W6IA 3V6MA 3GLHE 3MAJA 4Q7EA 2XUKA 3QFRA 3UZUA 5IANA 1CWUA 2JLVA 1KJYA 5E3IA 4ZZIA 4P3KA 2R7MA 1HL7A 2O1XA 1AGPA 1ZNXA 2DLDA 3E22A 1MABB 2WF8A 1MUUA 3W6OA 1ODLA 1QO0A 1YQQA 3FX2A 1HL3A 4HT3B 1R9GA 3GFBA 1UKZA 3P71T 1TU4A 3CVOA 1N0VC 1Z9BA 4CPDA 5HKBA 1XZFA 2B4RO 3QUSA 1KI9A 3GGCA 3Q3IA 3QPCA 2X6TA 1O6ZA 2BJHA 3OJEA 4I4TF 4UHDA 3GJ4A 3RUPA 1DHRA 4C0SA 3D2AA 2BDTA 5D86A 2HO5A 4OXKA 4UFOA 1H23A 3H2YA 1FZTA 1J2RA 1EVQA 3D8UA 1IB6A 1XZAA 4WWHA 5GJCA 1E9SA 3S2UA 4JWKA 3A9VA 1IJFA 2DPYA 3D6TB 2FFRA 4R1SA 3QJGA 2OXTA 3HCAA 1AD2A 5JNLA 4EIWA 1Q3TA 3O3MB 1NVDA 2C20A 3ABRB 4P4NA 4G4SO 1PK9A 1GUDA 1TC2A 2R86A 4O3FA 2Q5OA 5CDHA 3IC5A 4B85A 3LWNA 3FJYA 3MJCA 4J29A 5FNVB 4YRSA 1EKXA 2XQJA 2GBFA 3HC7A 4MVYA 5BRAA 1CD5A 1PFYA 4XGRA 3ZIDA 4CU5A 1KRWA 4OLAA 2BHTA 1FDIA 1VMIA 3GP5A 3F1LA 2B1GA 3NB0A 4YJGA 5DYWA 5AICA 2R11A 2ID4A 3RI3A 3V4VB 1POWA 1V5IA 1BU5A 5C18A 5JDCA 2VHXA 3NYRA 5I7FA 4AT1A 2CMDA 1SY7A 3I53A 2B78A 3PNBA 2R8EA 4QJIA 4F9TA 3P4UA 2EL9A 4B87A 4YWJA 1ITZA 2YJ4A 4WZAB 3O2SB 5I7RA 1JMKC 1TM3E 2B4KA 4JB3A 4M8NE 3GFRA 4O8ZA 3C8ZA 1M34B 4Q6BA 4UAGA 3IOBA 3A1DA 4XDGA 3LXXA 4LC9A 4XYBA 1YHZA 1H8HA 1WG8A 1G21B 1FDOA 1W88B 4MUKA 2VC2B 3WDKA 4BEWA 2O59A 1OJ7A 3C6MA 5JI2E 1MW8X 2HK7A 3RRZA 2QPOA 3UQYS 3L1KA 4B43A 3OOEA 1WF6A 3WNVA 5TEWA 1FDSA 1U2RA 4GLFA 1DQYA 5F12A 2ENUA 3X0DA 4CEHA 2OHGA 3RJMA 4MJLA 3S1SA 3DT9A 2ZXEA 3PQ7A 1NXOA 1WDMA 1LY1A 2TS1A 2VJMB 3KG2A 1JDSA 3PNQA 2FZGA 4MCIA 2Z08A 3T3DA 2GJAA 2W8BB 3NHFA 1W93A 3PE4A 6NULA 2NQ8A 1J70A 2FPGB 1X19A 2BV3A 3F6CA 3GP8A 2CBGA 1L4LA 1Z29A 2WTNA 3AEKA 5HF6A 5B7GA 3ADDA 1QGAA 2XHEA 2XF2A 5A7FA 4GR4A 1DS6A 1ORVA 4MPPA 5A6SB 1EIZA 2V98A 4XDHA 1OU4A 5ILOA 2JK0A 4HMOA 1AKUA 5IJXA 2DFKB 2G4CA 1ECGA 4M36A 1WNTA 5JG7A 5KCMA 1JIUA 2O23A 3GRVA 3OU2A 4Z7NB 2WMYA 1UFRA 1FIUA 1U8FO 2D3WA 3JALB 2CMKA 1E6LA 3UGKA 2WHQA 3JAKA 4BVKA 4DV3B 1WU7A 2H51A 1C81A 4TWAA 4X20A 1U1DA 4EJ0A 1QP4A 4HQ6A 5D1HA 3UENA 4U00A 1V26A 1UAGA 4L7VA 2WP0A 2JI9A 3AP2A 5DNDA 3PQ5A 4UUQA 5M5BA 4V1CA 2H18A 2XT0A 3UJHA 7REQB 2J85A 2NO1A 2MHCA 2Q5LA 4KKVA 4WDRA 5DM4A 2JCVA 2Z8ZA 2ZRQA 5KOYA 2R7LA 1V5EA 1TJNA 4HTAA 3TLAA 5A9RA 2GVZC 3V2HA 4MGKR 3I5YA 2QG6A 4MQ6A 2CV0A 2PUBA 4HRAA 2ZIFA 1K3TA 3G0GA 4IY1A 4JDUA 4PRLA 1VL0A 2GEJA 1P2DA 4EF6A 4LF8B 1T13A 1M34A 4MYDA 3ENNA 1TTQB 4HAZA 4Z51A 1PW7A 4GP6A 4BEVA 4L8FA 4E2WA 4HV4A 16PKA 4WCFA 2D4AA 4U2BA 3W2IA 1SCQA 3D4LA 1EK6A 1P44A 3UCFA 4M9QA 3KWMA 1XMIA 4BAZA 1WR8A 4POOA 3KKMA 1Z2PX 4K6HA 3UWDA 1PFGA 1EFUA 1GZUA 2YY7A 4PCLA 1KJ8A 4DNFA 2CNLA 5ALVA 2QGNA 3CMCO 4O4LF 3T7KA 3IXQA 2FZ4A 2HSZA 3F9CA 3UUFA 1GGKA 1TEVA 2XYHA 4E22A 2W71A 1A9OA 5ARBA 4LEIA 1EDBA 1LB1B 2B36A 4UBNA 2O4CA 4MROA 3HGMA 4ZZ1A 3AR8A 2XKKA 3AK4A 4FNMA 3WGQA 4DYDA 2HQ1A 4KQMA 4DYVA 3DB2A 3ZWXA 2HUNA 4RSRA 4DV1B 2BW0A 2P2CA 2QV0A 1QHHB 3GJ3A 1ZOLA 3L06A 4NJEB 4TTVA 3TRHA 3WMRA 1VPTA 2J32A 2WTEA 3HNPA 1YR7A 3TX2A 2BKVA 3UMYA 1WHSA 1AXRA 5CFOA 2RAPA 1PUXA 2Q0HA 3KLNA 1FXSA 2VT7A 3NHWA 3GZJA 4LWQA 1D4AA 4OAQA 2FSPA 1O1YA 3B1YA 5JZSA 4OOFA 1N7JA 2F3SA 1XUOA 2NVBA 1A5AB 4TMTA 4MVJD 1NN3A 1VSUA 2QHXA 1ZU4A 4JIMA 1E2KA 3KQTA 4C21A 2PTGA 1QNFA 4GKKB 1X7WB 4IMPA 4MKRA 1U8XX 4J1QA 1HSOA 1S2GA 1ABFA 3R3XA 3QUQA 4YNBA 2QL5A 5ALOA 4DS3A 1J8QA 1WB9A 1EVZA 1Z12A 2AZDA 5DTMA 5A1JA 5EWJB 1IQUA 3ZX5A 4XASA 3R9IA 1IJEA 3K30A 3ONVA 1V6SA 3I5MA 3WB0A 3ZKWB 4EPXA 3WNCA 3OQHA 2ZRFA 1DC7A 4QL3A 5ALLA 2IRWA 1GG5A 3FF4A 3MVEA 2DFNA 2JGKA 3IVRA 1C7IA 4JN6B 1XB2A 4MR8A 4OHPA 3Q10A 3W2FA 5IYZB 4JB0A 4PHGA 1HLDA 1HDEA 1ZGJA 4HDSB 3H9BA 3BILA 5J63A 1PT5A 4AF8A 2YN0A 2UZ3A 4NE7A 4DUZB 3GLFB 1W36C 1MA0A 1ZVQA 4HLDA 3TXXA 1JEOA 3QXCA 3IESA 4BRSA 1OLXA 2HZBA 4AC9A 6AT1A 2YQZA 4CIWA 3QLUA 3T4UA 4D5GA 1QH1A 2I4OA 3H19A 2JIPA 4D4MA 3JWHA 2GKSA 4E09A 1UDRA 2JPDA 1UMCB 5JZOA 3DZCA 4DRXB 3BB3A 4AMVA 1KBOA 2LCFA 3IKJA 2O0JA 3NCTA 3AFOA 2AFVA 4PYIA 2D1QA 2ZE5A 4MPRA 1GR1A 5JXJA 2IELA 3M4YA 4R9SA 2XT6A 4CR7A 4U9UA 1HE5A 1NOJA 2CXHA 2O57A 4REOA 3WR5A 2NIPA 3DOFA 4DA4A 2M1ZA 3OA2A 1JHRA 4G9BA 2YHAA 1WWKA 2CK3D 4RA9A 4IDDA 4BNNA 4G0PA 1JHPA 4QWMA 5HRUA 5IASA 3A1FA 5KBYA 4G0ZA 1YR1A 5JISA 2HL6A 2P7HA 1XDGA 1JB1A 1P3Y1 4S0ZA 2PXAA 2DH6A 3E7DA 3ND6A 1GSOA 2AOWA 3VHRA 2FK7A 3TGLA 1GDHA 3ZGLA 1NXPA 4CLXA 1JL3A 1PJ2A 3TZEA 2HMAA 3NVAA 3GFFA 3I2YX 1AZSC 4UU0A 2B0CA 2B2CA 4PTZA 4NOMA 2OAQ1 4YS6A 2ZCJA 1AX9A 1RS0A 4I9GA 4B3DA 2G3YA 4DLLA 3C3XA 2HA4A 2ISQA 1R4AA 1WXEA 1YB1A 1MB9A 2Y0BA 3N3BC 3NTQA 4PLTA 5AVXA 2XDQA 4LWPA 4IH9A 2C7GA 2Q7OE 2YJ6A 4D0NA 2DWCA 4C5AA 2HIAA 5BPHA 2XGJA 1J25A 4CR6A 4RXMA 3AR7A 1N5JA 2J9FB 2X9GA 5K3SA 4GOLD 4FK8A 1A5ZA 3S40A 1E3QA 4R6WA 1ZJ5A 5F73A 1KO1A 2HRDA 4M1ZA 2HT1A 5DLYA 2RE8A 2Y0DA 2JF0A 5ES3A 1O54A 1Y1SA 4PRZA 2AVDA 2H52A 5DBIA 1W52X 1D4OA 2WWXA 5FL7D 4F9GA 2PMWB 4BOYA 3BL5A 1PWZA 3PCRB 4TM7A 2O1WA 4DZRA 1C3LA 1QH1B 3G1TA 1EBUA 1GZ7A 5I7HA 3V4FA 1UEIA 4Y2UA 4BJHB 2XOEA 5DGXA 4QT4A 5JNWA 2JGRA 1UKEA 3GLVA 4YPOA 1N6LA 3KT0A 3LWDA 1FY2A 1OFIA 3PFKA 3N0TA 1V4BA 2A6PA 2ZIVB 3JVIA 4OA5A 4P3OA 3ABSB 2QD2A 3NXKA 4A2CA 3OURA 3LPMA 1J7KA 5DI3A 5TNXA 4EFKA 1P7YA 1LQUA 1YB4A 1LNSA 5JLAA 1OILA 1WSDA 1ZEMA 3TUZC 1ORHA 4YJ3B 1W44A 4MUHA 1R4MB 3U3KA 2PSSA 4ZAZA 3WK5A 4OB8A 3ZWQA 4IJVA 4XYEA 4LF9B 1NW3A 2QOEA 4LOHA 1D7OA 1R0KA 4JL6A 2FSHA 5G0WA 2SICE 2AE2A 2H3EA 4PAGA 5DYYA 3ZK9A 3N8DA 1XR3A 1GA6A 1SURA 1TU3A 3MJDA 4HFMA 3HEMA 3U5TA 2R4TA 1JQDA 1N8TA 3TJZA 2VP0A 1MQ8B 2A5LA 3BAZA 4IFBA 3SHVA 4DSOA 3BD8A 2WZBA 3CZ9A 4G85A 4MB0A 1PGOA 5HTOA 2R65A 4NEHB 3E15A 4DA8A 3RAEC 3KEFA 3V1KA 2P9EA 3NONA 5C3MA 4C0LA 3T3GA 2YVLA 1DRJA 5L3QA 4M1KA 2NVUA 2Z6AA 2Y0CA 5EWLB 2WVHA 2P30A