3JAMC

Cryoem structure of 40s-eif1a-eif1 complex from yeast
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
217
structure length
217
Chain Sequence
b'GWVPVTKLGRLVKAGKISSIEEIFLHSLPVKEFQIIDQLLPNLKDEVMNIKPVQKQTRAGQRTRFKAVVVVGDSNGHVGLGIKTAKEVAGAIRAGIIIAKLSVIPIRRGYWGTNLGQPHSLATKTSGKCGSVSVRLIPAPRGSGIVASPAVKKLMQLAGVEDVYTSSTGSTRTLENTLKAAFVAIGNTYGFLTPNLWEVQALTPSPMDVYADYATAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational Differences between Open and Closed States of the Eukaryotic Translation Initiation Complex.
pubmed doi rcsb
molecule keywords 18S rRNA
source organism Saccharomyces cerevisiae
molecule tags Translation
total genus 43
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
C PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.770 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3jamC01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 3jamC02
1S4EA 2X36A 3OTOI 4DR7I 3HULA 4FW9A 4JYAI 1HNXE 3B8HA 4WUBA 4JI6I 1FKAE 4JI5I 1KIJA 1N33I 2VQEI 2UUCI 1WUUA 5FLXC 4DR3I 4M1KA 1KKHA 1N36I 4LF4E 4JI8E 2HKEA 1HNXI 5GMDA 1RREA 1IBME 4ED4A 4I3HA 4GKKE 5LMUE 4ZVIA 1XNRE 2UUBE 4LF4I 1DARA 4JI8I 1N32E 2VQFE 2A2DA 2A2CA 2ZITA 4PRXA 1PIEA 1FNMA 5IT9Q 4KQVA 1FWKA 4USMA 1IBMI 4DR4E 4DV5E 4URLA 2V2VA 4OX9E 4GKKI 5LMUI 4DV0E 4P7AA 3J7AG 1XNRI 2UUBI 2NPFA 4WUDA 1N32I 1A6FA 1VISA 4K0KE 4JI0E 1EA6A 1H72C 4DR1E 3ZKBA 3QT7A 2V34A 2BM0A 2V8PA 4DR4I 4DV5I 1Z0CA 3WU5A 4B3SE 4LF6E 4OX9I 3T1YE 4DV0I 2CZ9A 1ZM3A 4K0KI 4JI0I 3QT5A 3QT6A 2HK2A 1J5EE 4DR1I 4R1FA 1Z5CA 4B3SI 4LF6I 1Z0VA 1ZXMA 1KTVA 4WUCA 1N36E 4DV4E 3T1YI 4DR5E 1Z0WA 1EI1A 1BKNA 4UTGA 2XEXA 4FWGA 1J5EI 1UEKA 4FWHA 4LF5E 1Z0EA 4DU7A 1D6TA 4DPYA 1I94E 3H4LA 4JI4E 2UXCE 3J80Q 4DV4I 4DR5I 4HXZA 3J80C 4X66E 4JI1E 3F0NA 4LF5I 1ZXNA 4LF7E 2J7KA 1NZ0A 1XNQE 3JAMQ 1QZRA 1I94I 2WW4A 4DXLA 4JI4I 2R3VA 2UXCI 4NXNE 4JV5E 3LNUA 3K17A 2E1RA 1NHHA 5BR8E 4X66I 4JI1I 4NXME 1IBKE 1H73A 4LF7I 1N34E 5IT9C 1NHIA 2VF3A 1FWLA 1B62A 1XNQI 4DUZE 4Z7YA 4P52A 4JI2E 1XMOE 4NXNI 4JV5I 1HR0E 4DV6E 5BR8I 2BM1A 2ZBKB 1Z0BA 1PKPA 4LFCE 4NXMI 2E5LE 1MU5A 3T1HE 3QT8A 1IBKI 1HNZE 2LJPA 1N34I 4LF9E 4FWDA 2R42A 3GONA 4DV2E 4DUZI 4YHHE 4B3TE 4JI2I 4MYTA 3PYFA 3D4JA 1XMOI 2HHHE 1K47A 4KHPE 1ZM4A 1HR0I 4DV6I 1ELOA 3LTOA 2ZM6E 4LFCI 4AQYE 2E5LI 1H7UA 3T1HI 3J7AM 1HNZI 4LFBE 4LF9I 1N0UA 3ZZTA 4DV2I 4X65E 5A2QQ 4EMDA 4YHHI 4UT4A 4B3TI 3M6AA 2V2QA 1MX0A 2BV3A 2HHHI 3ZM7A 2HFSA 1H7SA 4KHPI 4HACB 4B3RI 2Q2EB 4DV3E 2UUAE 5LMNE 4DPXA 2ZM6I 4AQYI 4RPFA 2EFGA 4LFBI 4DPWA 3Q1QA 4JI7E 4X65I 3ZKDA 1RR9A 2UXBE 4X64E 3PYGA 2V2ZA 1ZM9A 1B63A 3J81Q 3V2UC 2UU9E 1Z59A 4DR2E 1ZM2A 3J81C 4HYMA 4DV3I 2UUAI 5LMNI 2F4VE 5FLXQ 4JI7I 3JAMC 2OI2A 4DUYE 2UXBI 4X64I 4MYUA 2UU9I 1Z0TA 4DR6E 1IBLE 4DR2I 4Z7CA 4X62E 4USKA 4YY3E 4PU9A 4JI3E 2F4VI 1MG7A 2UXDE 4B3ME 3LPSA 2AJ4A 1S16A 2HK3A 2DEIA 4DUYI 2HFUA 3PYEA 1NHJA 1U2RA 1KVKA 4DR6I 1IBLI 1XHKA 4HY1A 4DV7E 4X62I 4YY3I 1HNWE 4JI3I 3ZZUA 3PYDA 1XMQE 2UXDI 2X7IA 1OJ4A 4B3MI 4GKJE 1N0VC 1H74A 1FJGE 2DEJA 4DPTA 3WU6A 2VQFI 5GMEA 4B3RE 5LL6R 4PRVA 4LF8E 3B78A 4DV1E 5L3JA 3K1JA 3CWVA 3B82A 4FN5A 4DV7I 4LFAE 1Z5BA 5IWAE 1HNWI 1XMQI 4GKJI 3ZZ0A 3WU4A 4DPUA 1FJGI 4HACA 4XTJA 3OTOE 4DR7E 3V5RA 5A2QC 4JYAE 3WU3A 4JG4A 2GS8A 2HKJA 4JI6E 4JI5E 1N33E 1Z5AA 4LF8I 2VQEE 4DV1I 2UUCE 1Z0GA 1FI4A 4DU8A 4LFAI 1PVGA 5IWAI 4DR3E
chains in the Genus database with same CATH superfamily
1S4EA 2X36A 2Z5CB 4LCHA 4WSGA 3OTOI 4DR7I 1DGCA 3HULA 4FW9A 4JYAI 4ZYGA 3GLLA 1MEYC 2EOFA 2L2MA 4ZYDA 1HNXE 3B8HA 2B9DA 2ENAA 4WUBA 4JI6I 2EPCA 1FKAE 1YHCA 4JI5I 3PRYA 1KIJA 4BC7A 1N33I 2N3GA 2JVAA 3F6HA 2VQEI 5ELWA 2UUCI 2HC5A 4TUIA 2EM9A 2EM7A 1WHQA 3PS2A 1WUUA 2LUQA 4FW5A 2EL5A 5FLXC 4DR3I 4M1KA 4Q28A 1KKHA 1N36I 2R76A 3IWDA 4R2QA 2I13A 4LF4E 3KRNA 4JI8E 5AE1A 2HKEA 2LO3A 3M7ND 2PNZB 2EMIA 2EPXA 5DRPA 5JEAE 4IS1C 5DRRA 2CGEA 2LCEA 1HNXI 4N4RB 5GMDA 1R6MA 1UDQA 1RREA 3VK6A 1QU6A 2ELYA 5K36B 4HTGA 1IBME 3J7Yp 4OO1E 4NBQA 2EQ3A 3EPHA 2E1MA 1T38A 4ED4A 3OMLA 1Y6ZA 2NN6A 4I3HA 4RH8A 4GKKE 5LMUE 1XNRE 2LBSB 4ZVIA 2UUBE 2MDRA 1YH8A 4LF4I 2Z5BB 1DARA 4JI8I 1N32E 2JE6A 1TN9A 2VQFE 2A2DA 4R2PA 2A2CA 2HGHA 2JPAA 2F8BA 3UK3C 2ZITA 4PRXA 1PIEA 4N3OA 2WNRA 1FNMA 2DMIA 5IT9Q 2EOJA 4KQVA 3JTZA 1QNTA 2EN2A 1A1FA 1FWKA 2AE8A 4USMA 2LTSA 3DJWA 4DR4E 4DV5E 1IBMI 5TSEA 4URLA 2CSHA 4IZJA 2LTRA 1Z1BA 3KZYA 1UHZA 2NUFA 4OX9E 2EN7A 2V2VA 4M9VC 4DV0E 1L4SA 5LMUI 4P7AA 3J7AG 1KYQA 1XNRI 4GKKI 4IFDF 5A6BA 2UUBI 2NPFA 4F9CB 4M0VA 4IFDC 2K7IA 4IZKB 4WUDA 4BHBA 3UHMA 1N32I 1UILA 1A6FA 4IFDD 2PNLA 1VISA 2KOUA 4BMJA 4JI0E 4K0KE 1EA6A 4OO1F 5IXMB 1H72C 4BA1B 4NHRA 4DR1E 1YPNA 2DIXA 2PO0B 2YTPA 3M99B 1A1JA 3QT7A 3ZKBA 2JEAA 5K36E 4MQYA 2DB2A 2V34A 2M9AA 2BM0A 2V8PA 3Q6NA 4DV5I 4B3SE 1Z0CA 4LF6E 3PS1A 3WU5A 4DR4I 5JEAA 2EQ1A 2JYAA 2KHXA 1AAYA 3K6QA 2EORA 4OX9I 2B3TB 3T1YE 4DV0I 4IS9A 2WP8B 1NCSA 1RHYA 2CZ9A 5AC4A 2EL6A 1ZM3A 3P3EA 3U1KA 5IV8B 2EP3A 1GZ6A 3M7NG 1WXRA 4J8ZA 5C0XB 4JI0I 4K0KI 3L7ZA 3QT5A 3QT6A 1JK1A 2HK2A 1J5EE 2EMKA 2EL4A 2JEBB 2YT4A 2EM8A 4DR1I 4R1FA 2KONA 4FW6A 3HPZA 5EKWA 1Z5CA 2PNMA 2LRSA 2VE7C 2V86A 4ZYHA 1BB8A 1YUIA 2O3ZA 2EPKX 4B3SI 4LF6I 2MC5A 5KL3A 1Z0VA 1ZXMA 2Z5CA 2EN3A 1KTVA 1N36E 1A1IA 4DV4E 1X5WA 2IERA 4DR5E 4WUCA 2EOEA 3T1YI 1YYWA 2EN1A 1Z0WA 1ZBQA 1EI1A 4ZYEA 4L8NA 1G2FC 1BKNA 4UTGA 5KL7A 1T4NA 3P3CA 2XEXA 3B4TA 1X49A 5KL6A 2M1SA 2M4IA 4R2RA 1RMDA 1YSAC 3JU0A 4FWGA 1PJQA 3LLHA 1J5EI 1UEKA 4FWHA 4LF5E 2YZTA 2EMZA 4KWYA 1Z0EA 1X6FA 4DU7A 4O5GA 4DKKA 2YU5A 1D6TA 4NZVA 2ENHA 4DPYA 1I94E 3IWCA 3H4LA 3M85D 1BBOA 2PO1B 3ADIA 3EPLA 4JI4E 1UDNA 5FWKA 2PNZA 2NN6F 2C39B 2UXCE 2EM4A 4F9AB 3J80Q 4DV4I 2NN6C 4DR5I 1JK2A 1BBGA 4FW4A 4HXZA 2YTEA 3J80C 2C38B 2NN6D 1IQOA 2EWLA 3CDIA 4AIMA 4BS9A 2EZ6A 5K36A 2EN6A 2O1UA 1WHNA 2VRDA 4WFTA 4X66E 3TQMA 1USVA 1VI7A 3HJCA 2LV2A 3P06A 1X6HA 4ISAA 4JI1E 5C0XE 2DMYA 4LU9A 4BA2B 4DMIA 3F0NA 4AIDA 1RC7A 2JY9A 1ZXNA 4LF7E 4LF5I 1TF3A 1EH6A 4LCFA 2HJJA 3KWRA 2J7KA 3PS3A 1NZ0A 1XNQE 4FW3A 2RS6A 2R1FA 4FK5C 1QZRA 4F6NA 1UDSA 3JAMQ 2IESA 1I94I 3MSWA 2WW4A 2Z5BA 2EMWA 3H09A 5A6AA 2EPAA 4DXLA 4JI4I 2R3VA 2J65A 1A1KA 2UXCI 2DLKA 4IZJD 4NXNE 2LJHA 3EPJA 4JV5E 2EMBA 1X48A 4WXDA 5KL4A 2RS7A 3LNUA 3K17A 2E1RA 2EOOA 1NHHA 2GQ0A 5BR8E 2EMLA 5A6BD 2MC6A 4X66I 3CDJA 3EPKA 2LUPB 2EPMX 4JI1I 4NXME 4LCGA 1IBKE 1DI2A 1H73A 4LF7I 1N34E 2GHFA 3HQ1A 5IT9C 1NHIA 1PJSA 1FWLA 2VF3A 1B62A 2L3JA 4M2ZA 4IJDA 1P42A 4DUZE 2PO2B 1XNQI 2ENCA 2NUGA 4Z7YA 2J7JA 5DNXA 1PJTA 2LT7A 2JWOA 5JEAF 4IZKA 3RMPA 4P52A 4JI2E 3IWBA 2YRMA 1XMOE 5JEAC 1KJKA 1USUA 5JEAD 3MHSC 2L2KB 4NXNI 4JV5I 5T6JA 4QNJA 4BA1A 2I9IA 1GTKA 1HR0E 4DV6E 2GLIA 2EMFA 2GO4A 1T4LB 2PO0A 5BR8I 3VYYA 2BM1A 4WYQB 2WBUA 4OO1C 1EH7A 1Z0BA 1PKPA 4LFCE 2ZBKB 2E5LE 1MU5A 3T1HE 4NXMI 3QT8A 1IBKI 4MLQA 1HNZE 2IOPA 2LJPA 4OO1D 1N34I 4LF9E 2ODRC 4WXCA 2R42A 3THOB 4FWDA 1Y4SA 3ADLA 3GONA 2ODRD 4DV2E 3FIGA 2M7QA 2WP8A 4DUZI 2RSMA 2JR1A 2G7HA 2DLQA 4YHHE 4B3TE 3M85G 1ZBTA 2WBSA 4MYTA 5DROA 4JI2I 3KZZA 3P1XA 4X9JA 3PYFA 3D4JA 5C0XA 2EM0A 2HHHE 1K47A 2B7TA 1XMOI 4KHPE 2BA1D 2NABA 3EQ1A 2EM2A 2JEBA 2LVHA 1G2DC 1ZM4A 2EMYA 2EOZA 3HKMA 2EOMA 1HR0I 1SFEA 4DV6I 1ELOA 1IMUA 2RTXA 2L3CA 2V87A 2ELZA 4BBYA 3LTOA 2K4VA 1EKZA 4J3DA 2ZM6E 2YTFA 2EMHA 4AQYE 4LFCI 1H7UA 3T1HI 2E5LI 2MKDA 1E3HA 1HNZI 3QG5C 4LFBE 3J7AM 2EM6A 3K85A 4LF9I 2EOQA 2EOHA 2BA0D 2BR2B 1N0UA 3ZZTA 4U3DA 2NA2A 4DV2I 2V83A 4X65E 1N3GA 5A2QQ 4WPYA 3C6MA 4EMDA 4YHHI 4UT4A 4B3TI 3HTXA 4IFDB 2EPOA 2V2QA 3M6AA 1MX0A 1T4OA 2BV3A 2HHHI 4R2SA 1P47A 3ZM7A 1IQSA 1H7SA 2HFSA 4KHPI 4HACB 4AM3A 2O1VA 4MU1A 2VESA 2BB8A 2RQLA 3DF6A 2C37B 5DRQA 4B3RI 4LOMA 4OO1B 5K36F 5AE2A 2EPNA 2Q2EB 2B7VA 2L2NA 4DV3E 2UUAE 4U3BA 4R2DA 5K36C 4R2EA 2YSPA 2YTQA 5LMNE 2EOIA 4DPXA 2PO1A 5K36D 2ZM6I 4AQYI 4Q35B 4RPFA 2EPPA 2EFGA 4LFBI 4TUGA 2C39A 4DPWA 2EJ4A 2O1WA 4MLVA 3Q1QA 1YYKA 2EMAA 1HK7A 4JI7E 4X65I 2V89A 2NUEA 2BBGA 2C38A 2Z5EA 2JT2A 1PDAA 1UN6B 1SR9A 5KL5A 2Q8UA 2UXBE 1RR9A 3P3GA 3HXLA 5CFFE 4X64E 3PYGA 3ZKDA 2V2ZA 1ZM9A 1B69A 1B63A 2UU9E 3V2UC 3J81Q 4MU3A 2VF1A 1Z59A 2YTJA 4DR2E 1ZM2A 3P76A 1EH8A 4BA2A 3J81C 2YRHA 4HYMA 2EPZA 2YWQA 2MKNA 4DV3I 2UUAI 3C6KA 5KL2A 5LMNI 2F4VE 4F9BB 2EPUA 5F3WA 5FLXQ 1AH5A 2IOQA 2YTIA 2L33A 5DNYA 2LJUA 2F1DA 2L92A 3C4TA 1UBDC 4O24A 4JI7I 3JAMC 3GMEA 1GQEA 2OI2A 5DNLA 2LE2A 4DUYE 4BC9A 1X6EA 5AE3A 2EPLX 2UXBI 4L5NC 4X64I 2EMXA 3AUZA 2EMGA 4MYUA 4IFDE 1X3CA 2RSIA 4GEQB 2UU9I 2CPNA 4F6MA 1Z0TA 2YTNA 4DR6E 4MDTA 1IBLE 2BA1G 5EL9A 4DR2I 2RPCA 2YRKA 4F54A 2EM5A 4WSPA 5JEAB 4Z7CA 2PRTA 1RQ0A 1ZR9A 2N3HA 3ZOQB 5ADZA 2EN8A 5AC5A 2WZOA 2YTDA 3VYXA 2DGCA 4I8OA 4WX9A 2N8XA 4X62E 2PO2A 1TF6A 2MDGA 1OYRA 2CT1A 3BGHA 4LTYA 4YY3E 4JI3E 4PU9A 4USKA 2F4VI 3BF2A 3BBGA 4GZNC 1MG7A 2YPNA 2UXDE 4B3ME 3LPSA 4KZSA 1S16A 2AJ4A 4HEIA 2BA0G 4O43A 1STUA 2HK3A 2L8TA 4M30A 2JP9A 2NN6B 2DEIA 5A69A 4DUYI 3THNA 2HFUA 3VHTB 4F2JC 3HPSA 2DSYA 3PYEA 5C0XF 2EE8A 3NZKA 1NHJA 2JE6B 1U2RA 5C0XC 4OZEA 1KVKA 4DR6I 1IBLI 1A1GA 1XHKA 4HY1A 1A1LA 1YYOA 5C0XD 4MU0A 1YFHA 2ADRA 1MGTA 1UDOA 2EN4A 5LLQA 1E3PA 4DV7E 2WNRB 3Q6MA 4X62I 2JXPA 4YY3I 1HNWE 4JI3I 1ZU1A 3ZZUA 3PYDA 3F6GA 2D9HA 1XMQE 2UXDI 2X7IA 1OJ4A 4O4KA 1XXEA 1YZ9A 3L00A 4GKJE 1N0VC 4IZJB 1H74A 4B3MI 3C4BA 1FJGE 2DEJA 4FW7A 4QNKA 1A1HA 1NEIA 3ADJA 2IHR1 4DPTA 3MHHC 5A6JA 3WU6A 2FGGA 4P7DA 2YTOA 3ADGA 2DRPA 1Y60A 2E72A 2VQFI 5AASA 2LMZA 4OKGA 1YUJA 4B3RE 5GMEA 1OYPA 5LL6R 2GO3A 4R2CA 4PRVA 2EPRA 4LF8E 3B78A 2YU8A 4DV1E 2EQ0A 2JOXA 5L3JA 2V85A 3K1JA 2BR2A 3CWVA 2EM3A 3B82A 2YSOA 4LFAE 2WBTA 3DD6A 4FN5A 4DV7I 1Z5BA 2JEAB 5IWAE 1HNWI 4IFDA 1F2IG 2YTGA 3AV0A 4R8OA 1XMQI 4RHBB 5A6KA 3H1CA 4GKJI 4BHCA 4BCAA 2WCC3 3WU4A 2FTXB 1J26A 2CVEA 3U1YA 3ZZ0A 4DPUA 4X8WA 1FJGI 2A25A 3OTOE 4HACA 4DR7E 4XTJA 3V5RA 1DQ3A 5A2QC 1OYSA 2C37A 2NN6E 4JYAE 4MU4A 4OOGC 4R2AA 2O1TA 4OO1A 4P78A 4JG4A 3WU3A 2L6MA 1WJPA 2GS8A 2HKJA 2CG9A 2V8QB 4JI6E 1WRJA 4R03A 4JI5E 1N33E 2CTDA 2V88A 1LLMC 2EOXA 3L7ZB 2FV4B 1Z5AA 2EOYA 1R6LA 2VQEE 4LF8I 1X47A 2JOBA 1T39A 4DV1I 2EOSA 2UUCE 1Z0GA 1FI4A 4DU8A 3BIDA 3LMLA 4LFAI 2EMCA 4LPFA 1PVGA 1O0WA 5IWAI 1Y5YA 4DR3E 1ZAAC 3GCMA 3ECRA 2GPIA 2H36X 1Y4UA 4GQUA
chains in the Genus database with same CATH topology
1S4EA 2X36A 2Z5CB 3OTOI 4DR7I 3HULA 4FW9A 4JYAI 2L2MA 1HNXE 3B8HA 2B9DA 4WUBA 4JI6I 1FKAE 4JI5I 3PRYA 1KIJA 4BC7A 1N33I 2N3GA 2JVAA 3F6HA 2VQEI 2UUCI 4TUIA 1WHQA 1WUUA 2LUQA 5FLXC 4DR3I 4M1KA 4Q28A 1KKHA 1N36I 3IWDA 4LF4E 4JI8E 5AE1A 2HKEA 2CGEA 1HNXI 5GMDA 1RREA 3VK6A 1QU6A 1IBME 3J7Yp 2E1MA 4ED4A 3OMLA 1Y6ZA 4I3HA 4GKKE 5LMUE 1XNRE 2LBSB 4ZVIA 2UUBE 2MDRA 4LF4I 2Z5BB 1DARA 4JI8I 1N32E 2VQFE 2A2DA 2A2CA 2F8BA 2ZITA 4PRXA 1PIEA 4N3OA 1FNMA 5IT9Q 4KQVA 3JTZA 1FWKA 4USMA 2LTSA 3DJWA 4DR4E 4DV5E 1IBMI 4URLA 4IZJA 2LTRA 1UHZA 2NUFA 4OX9E 2V2VA 4GKKI 4DV0E 5LMUI 4P7AA 3J7AG 1XNRI 2UUBI 2NPFA 4F9CB 4M0VA 4IZKB 4WUDA 1N32I 1UILA 1A6FA 2PNLA 1VISA 2KOUA 4BMJA 4JI0E 4K0KE 1EA6A 1H72C 4DR1E 2DIXA 3ZKBA 3QT7A 2DB2A 2V34A 2BM0A 3Q6NA 2V8PA 4DR4I 4DV5I 4B3SE 1Z0CA 4LF6E 3WU5A 2KHXA 3K6QA 4OX9I 2B3TB 3T1YE 4DV0I 2CZ9A 1ZM3A 1GZ6A 1WXRA 4J8ZA 4K0KI 4JI0I 3QT5A 3QT6A 2HK2A 1J5EE 2YT4A 4DR1I 4R1FA 2KONA 3HPZA 1Z5CA 2PNMA 2LRSA 2VE7C 2V86A 4B3SI 4LF6I 2MC5A 1Z0VA 1ZXMA 2Z5CA 1KTVA 1N36E 4WUCA 4DV4E 3T1YI 4DR5E 1YYWA 1Z0WA 1ZBQA 1EI1A 1BKNA 4L8NA 4UTGA 1T4NA 2XEXA 1X49A 2M1SA 2M4IA 4FWGA 3JU0A 3LLHA 1J5EI 1UEKA 4FWHA 4LF5E 2YZTA 1Z0EA 4DU7A 4DKKA 1D6TA 4DPYA 1I94E 3IWCA 3H4LA 3ADIA 4JI4E 5FWKA 2UXCE 4F9AB 3J80Q 4DV4I 4DR5I 4HXZA 3J80C 2EWLA 4BS9A 2EZ6A 2O1UA 1WHNA 4WFTA 4X66E 3HJCA 3P06A 1USVA 4JI1E 2DMYA 4LU9A 4DMIA 3F0NA 1RC7A 2JY9A 1ZXNA 4LF7E 4LF5I 3KWRA 2J7KA 1NZ0A 1XNQE 2RS6A 3JAMQ 1QZRA 1I94I 3MSWA 2WW4A 2Z5BA 3H09A 4DXLA 4JI4I 2R3VA 2UXCI 4IZJD 4NXNE 4JV5E 2LJHA 1X48A 2RS7A 3LNUA 3K17A 2E1RA 1NHHA 2GQ0A 5BR8E 2MC6A 4X66I 2LUPB 4JI1I 4NXME 1IBKE 1DI2A 1H73A 4LF7I 1N34E 3HQ1A 5IT9C 1NHIA 2VF3A 1FWLA 1B62A 2L3JA 4M2ZA 1XNQI 4DUZE 2NUGA 4Z7YA 2JWOA 4IZKA 3RMPA 4P52A 4JI2E 3IWBA 1XMOE 1USUA 2L2KB 4NXNI 4JV5I 5T6JA 1HR0E 4DV6E 1T4LB 5BR8I 3VYYA 2BM1A 4WYQB 2ZBKB 1Z0BA 1PKPA 4LFCE 4NXMI 2E5LE 1MU5A 3T1HE 3QT8A 1IBKI 1HNZE 2IOPA 2LJPA 1N34I 4LF9E 2ODRC 4FWDA 2R42A 1Y4SA 3ADLA 3GONA 2ODRD 4DV2E 3FIGA 2M7QA 4DUZI 2RSMA 2JR1A 2G7HA 4YHHE 4B3TE 1ZBTA 4JI2I 4MYTA 3PYFA 3P1XA 3D4JA 1XMOI 2HHHE 1K47A 2B7TA 4KHPE 1ZM4A 1HR0I 4DV6I 1ELOA 2RTXA 2L3CA 2V87A 4BBYA 3LTOA 2K4VA 1EKZA 2ZM6E 4AQYE 4LFCI 2E5LI 1H7UA 3T1HI 3J7AM 1HNZI 4LFBE 4LF9I 3K85A 1N0UA 3ZZTA 2NA2A 4DV2I 2V83A 4X65E 5A2QQ 4WPYA 4EMDA 4YHHI 4UT4A 4B3TI 3HTXA 3M6AA 2V2QA 1MX0A 1T4OA 2BV3A 2HHHI 3ZM7A 2HFSA 1H7SA 4KHPI 4HACB 2O1VA 4B3RI 3DF6A 5AE2A 2Q2EB 2B7VA 2L2NA 4DV3E 2UUAE 5LMNE 4DPXA 2ZM6I 4AQYI 4RPFA 2EFGA 4LFBI 4TUGA 4DPWA 2O1WA 3Q1QA 1YYKA 1HK7A 4JI7E 4X65I 2V89A 2NUEA 2Z5EA 1SR9A 2UXBE 1RR9A 3ZKDA 3HXLA 5CFFE 4X64E 3PYGA 2V2ZA 1ZM9A 1B63A 2UU9E 3V2UC 3J81Q 2VF1A 1Z59A 4DR2E 1ZM2A 3J81C 4HYMA 4DV3I 2UUAI 5LMNI 2F4VE 4F9BB 5F3WA 5FLXQ 2IOQA 2L33A 5DNYA 2L92A 3C4TA 4JI7I 3JAMC 1GQEA 2OI2A 2LE2A 4DUYE 4BC9A 5AE3A 2UXBI 4L5NC 4X64I 3AUZA 4MYUA 4GEQB 2UU9I 2CPNA 1Z0TA 4DR6E 1IBLE 4DR2I 4F54A 4WSPA 4Z7CA 1RQ0A 2N3HA 3ZOQB 5ADZA 2WZOA 3VYXA 4I8OA 4X62E 4LTYA 4YY3E 4PU9A 4JI3E 4USKA 2F4VI 1MG7A 2UXDE 4B3ME 3LPSA 4KZSA 1S16A 2AJ4A 1STUA 2HK3A 2L8TA 4M30A 2DEIA 4DUYI 2HFUA 3HPSA 2DSYA 3PYEA 1NHJA 1U2RA 1KVKA 4DR6I 1IBLI 1XHKA 4HY1A 1YYOA 4DV7E 3Q6MA 4X62I 4YY3I 1HNWE 4JI3I 3ZZUA 3PYDA 3F6GA 1XMQE 2UXDI 2X7IA 1OJ4A 4B3MI 1YZ9A 4GKJE 1N0VC 4IZJB 1H74A 3C4BA 1FJGE 2DEJA 4DPTA 3ADJA 2IHR1 3WU6A 2FGGA 4P7DA 3ADGA 2VQFI 5AASA 2LMZA 5GMEA 4B3RE 5LL6R 4PRVA 4LF8E 3B78A 4DV1E 2JOXA 5L3JA 2V85A 3K1JA 3CWVA 3B82A 4FN5A 4LFAE 4DV7I 1Z5BA 5IWAE 1HNWI 3AV0A 4R8OA 1XMQI 4GKJI 4BCAA 3WU4A 3ZZ0A 2FTXB 1J26A 4DPUA 1FJGI 4X8WA 3OTOE 4HACA 4DR7E 4XTJA 3V5RA 1DQ3A 5A2QC 4JYAE 4OOGC 3WU3A 2O1TA 4P78A 4JG4A 2L6MA 2GS8A 2HKJA 2CG9A 2V8QB 4JI6E 4JI5E 4R03A 1N33E 2V88A 2FV4B 1Z5AA 4LF8I 2VQEE 1X47A 2JOBA 4DV1I 2UUCE 1Z0GA 1FI4A 4DU8A 3LMLA 4LFAI 1PVGA 1O0WA 5IWAI 4DR3E 2H36X 1Y4UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S4E A;  2X36 A;  3OTO I;  4DR7 I;  3HUL A;  4FW9 A;  4JYA I;  1HNX E;  3B8H A;  4WUB A;  4JI6 I;  1FKA E;  4JI5 I;  1KIJ A;  1N33 I;  2VQE I;  2UUC I;  1WUU A;  5FLX C;  4DR3 I;  4M1K A;  1KKH A;  1N36 I;  4LF4 E;  4JI8 E;  2HKE A;  1HNX I;  5GMD A;  1RRE A;  1IBM E;  4ED4 A;  4I3H A;  4GKK E;  5LMU E;  4ZVI A;  1XNR E;  2UUB E;  4LF4 I;  1DAR A;  4JI8 I;  1N32 E;  2VQF E;  2A2D A;  2A2C A;  2ZIT A;  4PRX A;  1PIE A;  1FNM A;  5IT9 Q;  4KQV A;  1FWK A;  4USM A;  1IBM I;  4DR4 E;  4DV5 E;  4URL A;  2V2V A;  4OX9 E;  4GKK I;  5LMU I;  4DV0 E;  4P7A A;  3J7A G;  1XNR I;  2UUB I;  2NPF A;  4WUD A;  1N32 I;  1A6F A;  1VIS A;  4K0K E;  4JI0 E;  1EA6 A;  1H72 C;  4DR1 E;  3ZKB A;  3QT7 A;  2V34 A;  2BM0 A;  2V8P A;  4DR4 I;  4DV5 I;  1Z0C A;  3WU5 A;  4B3S E;  4LF6 E;  4OX9 I;  3T1Y E;  4DV0 I;  2CZ9 A;  1ZM3 A;  4K0K I;  4JI0 I;  3QT5 A;  3QT6 A;  2HK2 A;  1J5E E;  4DR1 I;  4R1F A;  1Z5C A;  4B3S I;  4LF6 I;  1Z0V A;  1ZXM A;  1KTV A;  4WUC A;  1N36 E;  4DV4 E;  3T1Y I;  4DR5 E;  1Z0W A;  1EI1 A;  1BKN A;  4UTG A;  2XEX A;  4FWG A;  1J5E I;  1UEK A;  4FWH A;  4LF5 E;  1Z0E A;  4DU7 A;  1D6T A;  4DPY A;  1I94 E;  3H4L A;  4JI4 E;  2UXC E;  3J80 Q;  4DV4 I;  4DR5 I;  4HXZ A;  3J80 C;  4X66 E;  4JI1 E;  3F0N A;  4LF5 I;  1ZXN A;  4LF7 E;  2J7K A;  1NZ0 A;  1XNQ E;  3JAM Q;  1QZR A;  1I94 I;  2WW4 A;  4DXL A;  4JI4 I;  2R3V A;  2UXC I;  4NXN E;  4JV5 E;  3LNU A;  3K17 A;  2E1R A;  1NHH A;  5BR8 E;  4X66 I;  4JI1 I;  4NXM E;  1IBK E;  1H73 A;  4LF7 I;  1N34 E;  5IT9 C;  1NHI A;  2VF3 A;  1FWL A;  1B62 A;  1XNQ I;  4DUZ E;  4Z7Y A;  4P52 A;  4JI2 E;  1XMO E;  4NXN I;  4JV5 I;  1HR0 E;  4DV6 E;  5BR8 I;  2BM1 A;  2ZBK B;  1Z0B A;  1PKP A;  4LFC E;  4NXM I;  2E5L E;  1MU5 A;  3T1H E;  3QT8 A;  1IBK I;  1HNZ E;  2LJP A;  1N34 I;  4LF9 E;  4FWD A;  2R42 A;  3GON A;  4DV2 E;  4DUZ I;  4YHH E;  4B3T E;  4JI2 I;  4MYT A;  3PYF A;  3D4J A;  1XMO I;  2HHH E;  1K47 A;  4KHP E;  1ZM4 A;  1HR0 I;  4DV6 I;  1ELO A;  3LTO A;  2ZM6 E;  4LFC I;  4AQY E;  2E5L I;  1H7U A;  3T1H I;  3J7A M;  1HNZ I;  4LFB E;  4LF9 I;  1N0U A;  3ZZT A;  4DV2 I;  4X65 E;  5A2Q Q;  4EMD A;  4YHH I;  4UT4 A;  4B3T I;  3M6A A;  2V2Q A;  1MX0 A;  2BV3 A;  2HHH I;  3ZM7 A;  2HFS A;  1H7S A;  4KHP I;  4HAC B;  4B3R I;  2Q2E B;  4DV3 E;  2UUA E;  5LMN E;  4DPX A;  2ZM6 I;  4AQY I;  4RPF A;  2EFG A;  4LFB I;  4DPW A;  3Q1Q A;  4JI7 E;  4X65 I;  3ZKD A;  1RR9 A;  2UXB E;  4X64 E;  3PYG A;  2V2Z A;  1ZM9 A;  1B63 A;  3J81 Q;  3V2U C;  2UU9 E;  1Z59 A;  4DR2 E;  1ZM2 A;  3J81 C;  4HYM A;  4DV3 I;  2UUA I;  5LMN I;  2F4V E;  5FLX Q;  4JI7 I;  3JAM C;  2OI2 A;  4DUY E;  2UXB I;  4X64 I;  4MYU A;  2UU9 I;  1Z0T A;  4DR6 E;  1IBL E;  4DR2 I;  4Z7C A;  4X62 E;  4USK A;  4YY3 E;  4PU9 A;  4JI3 E;  2F4V I;  1MG7 A;  2UXD E;  4B3M E;  3LPS A;  2AJ4 A;  1S16 A;  2HK3 A;  2DEI A;  4DUY I;  2HFU A;  3PYE A;  1NHJ A;  1U2R A;  1KVK A;  4DR6 I;  1IBL I;  1XHK A;  4HY1 A;  4DV7 E;  4X62 I;  4YY3 I;  1HNW E;  4JI3 I;  3ZZU A;  3PYD A;  1XMQ E;  2UXD I;  2X7I A;  1OJ4 A;  4B3M I;  4GKJ E;  1N0V C;  1H74 A;  1FJG E;  2DEJ A;  4DPT A;  3WU6 A;  2VQF I;  5GME A;  4B3R E;  5LL6 R;  4PRV A;  4LF8 E;  3B78 A;  4DV1 E;  5L3J A;  3K1J A;  3CWV A;  3B82 A;  4FN5 A;  4DV7 I;  4LFA E;  1Z5B A;  5IWA E;  1HNW I;  1XMQ I;  4GKJ I;  3ZZ0 A;  3WU4 A;  4DPU A;  1FJG I;  4HAC A;  4XTJ A;  3OTO E;  4DR7 E;  3V5R A;  5A2Q C;  4JYA E;  3WU3 A;  4JG4 A;  2GS8 A;  2HKJ A;  4JI6 E;  4JI5 E;  1N33 E;  1Z5A A;  4LF8 I;  2VQE E;  4DV1 I;  2UUC E;  1Z0G A;  1FI4 A;  4DU8 A;  4LFA I;  1PVG A;  5IWA I;  4DR3 E; 
#chains in the Genus database with same CATH topology
 1S4E A;  2X36 A;  2Z5C B;  4LCH A;  4WSG A;  3OTO I;  4DR7 I;  1DGC A;  3HUL A;  4FW9 A;  4JYA I;  4ZYG A;  3GLL A;  1MEY C;  2EOF A;  2L2M A;  4ZYD A;  1HNX E;  3B8H A;  2B9D A;  2ENA A;  4WUB A;  4JI6 I;  2EPC A;  1FKA E;  1YHC A;  4JI5 I;  3PRY A;  1KIJ A;  4BC7 A;  1N33 I;  2N3G A;  2JVA A;  3F6H A;  2VQE I;  5ELW A;  2UUC I;  2HC5 A;  4TUI A;  2EM9 A;  2EM7 A;  1WHQ A;  3PS2 A;  1WUU A;  2LUQ A;  4FW5 A;  2EL5 A;  5FLX C;  4DR3 I;  4M1K A;  4Q28 A;  1KKH A;  1N36 I;  2R76 A;  3IWD A;  4R2Q A;  2I13 A;  4LF4 E;  3KRN A;  4JI8 E;  5AE1 A;  2HKE A;  2LO3 A;  3M7N D;  2PNZ B;  2EMI A;  2EPX A;  5DRP A;  5JEA E;  4IS1 C;  5DRR A;  2CGE A;  2LCE A;  1HNX I;  4N4R B;  5GMD A;  1R6M A;  1UDQ A;  1RRE A;  3VK6 A;  1QU6 A;  2ELY A;  5K36 B;  4HTG A;  1IBM E;  3J7Y p;  4OO1 E;  4NBQ A;  2EQ3 A;  3EPH A;  2E1M A;  1T38 A;  4ED4 A;  3OML A;  1Y6Z A;  2NN6 A;  4I3H A;  4RH8 A;  4GKK E;  5LMU E;  1XNR E;  2LBS B;  4ZVI A;  2UUB E;  2MDR A;  1YH8 A;  4LF4 I;  2Z5B B;  1DAR A;  4JI8 I;  1N32 E;  2JE6 A;  1TN9 A;  2VQF E;  2A2D A;  4R2P A;  2A2C A;  2HGH A;  2JPA A;  2F8B A;  3UK3 C;  2ZIT A;  4PRX A;  1PIE A;  4N3O A;  2WNR A;  1FNM A;  2DMI A;  5IT9 Q;  2EOJ A;  4KQV A;  3JTZ A;  1QNT A;  2EN2 A;  1A1F A;  1FWK A;  2AE8 A;  4USM A;  2LTS A;  3DJW A;  4DR4 E;  4DV5 E;  1IBM I;  5TSE A;  4URL A;  2CSH A;  4IZJ A;  2LTR A;  1Z1B A;  3KZY A;  1UHZ A;  2NUF A;  4OX9 E;  2EN7 A;  2V2V A;  4M9V C;  4DV0 E;  1L4S A;  5LMU I;  4P7A A;  3J7A G;  1KYQ A;  1XNR I;  4GKK I;  4IFD F;  5A6B A;  2UUB I;  2NPF A;  4F9C B;  4M0V A;  4IFD C;  2K7I A;  4IZK B;  4WUD A;  4BHB A;  3UHM A;  1N32 I;  1UIL A;  1A6F A;  4IFD D;  2PNL A;  1VIS A;  2KOU A;  4BMJ A;  4JI0 E;  4K0K E;  1EA6 A;  4OO1 F;  5IXM B;  1H72 C;  4BA1 B;  4NHR A;  4DR1 E;  1YPN A;  2DIX A;  2PO0 B;  2YTP A;  3M99 B;  1A1J A;  3QT7 A;  3ZKB A;  2JEA A;  5K36 E;  4MQY A;  2DB2 A;  2V34 A;  2M9A A;  2BM0 A;  2V8P A;  3Q6N A;  4DV5 I;  4B3S E;  1Z0C A;  4LF6 E;  3PS1 A;  3WU5 A;  4DR4 I;  5JEA A;  2EQ1 A;  2JYA A;  2KHX A;  1AAY A;  3K6Q A;  2EOR A;  4OX9 I;  2B3T B;  3T1Y E;  4DV0 I;  4IS9 A;  2WP8 B;  1NCS A;  1RHY A;  2CZ9 A;  5AC4 A;  2EL6 A;  1ZM3 A;  3P3E A;  3U1K A;  5IV8 B;  2EP3 A;  1GZ6 A;  3M7N G;  1WXR A;  4J8Z A;  5C0X B;  4JI0 I;  4K0K I;  3L7Z A;  3QT5 A;  3QT6 A;  1JK1 A;  2HK2 A;  1J5E E;  2EMK A;  2EL4 A;  2JEB B;  2YT4 A;  2EM8 A;  4DR1 I;  4R1F A;  2KON A;  4FW6 A;  3HPZ A;  5EKW A;  1Z5C A;  2PNM A;  2LRS A;  2VE7 C;  2V86 A;  4ZYH A;  1BB8 A;  1YUI A;  2O3Z A;  2EPK X;  4B3S I;  4LF6 I;  2MC5 A;  5KL3 A;  1Z0V A;  1ZXM A;  2Z5C A;  2EN3 A;  1KTV A;  1N36 E;  1A1I A;  4DV4 E;  1X5W A;  2IER A;  4DR5 E;  4WUC A;  2EOE A;  3T1Y I;  1YYW A;  2EN1 A;  1Z0W A;  1ZBQ A;  1EI1 A;  4ZYE A;  4L8N A;  1G2F C;  1BKN A;  4UTG A;  5KL7 A;  1T4N A;  3P3C A;  2XEX A;  3B4T A;  1X49 A;  5KL6 A;  2M1S A;  2M4I A;  4R2R A;  1RMD A;  1YSA C;  3JU0 A;  4FWG A;  1PJQ A;  3LLH A;  1J5E I;  1UEK A;  4FWH A;  4LF5 E;  2YZT A;  2EMZ A;  4KWY A;  1Z0E A;  1X6F A;  4DU7 A;  4O5G A;  4DKK A;  2YU5 A;  1D6T A;  4NZV A;  2ENH A;  4DPY A;  1I94 E;  3IWC A;  3H4L A;  3M85 D;  1BBO A;  2PO1 B;  3ADI A;  3EPL A;  4JI4 E;  1UDN A;  5FWK A;  2PNZ A;  2NN6 F;  2C39 B;  2UXC E;  2EM4 A;  4F9A B;  3J80 Q;  4DV4 I;  2NN6 C;  4DR5 I;  1JK2 A;  1BBG A;  4FW4 A;  4HXZ A;  2YTE A;  3J80 C;  2C38 B;  2NN6 D;  1IQO A;  2EWL A;  3CDI A;  4AIM A;  4BS9 A;  2EZ6 A;  5K36 A;  2EN6 A;  2O1U A;  1WHN A;  2VRD A;  4WFT A;  4X66 E;  3TQM A;  1USV A;  1VI7 A;  3HJC A;  2LV2 A;  3P06 A;  1X6H A;  4ISA A;  4JI1 E;  5C0X E;  2DMY A;  4LU9 A;  4BA2 B;  4DMI A;  3F0N A;  4AID A;  1RC7 A;  2JY9 A;  1ZXN A;  4LF7 E;  4LF5 I;  1TF3 A;  1EH6 A;  4LCF A;  2HJJ A;  3KWR A;  2J7K A;  3PS3 A;  1NZ0 A;  1XNQ E;  4FW3 A;  2RS6 A;  2R1F A;  4FK5 C;  1QZR A;  4F6N A;  1UDS A;  3JAM Q;  2IES A;  1I94 I;  3MSW A;  2WW4 A;  2Z5B A;  2EMW A;  3H09 A;  5A6A A;  2EPA A;  4DXL A;  4JI4 I;  2R3V A;  2J65 A;  1A1K A;  2UXC I;  2DLK A;  4IZJ D;  4NXN E;  2LJH A;  3EPJ A;  4JV5 E;  2EMB A;  1X48 A;  4WXD A;  5KL4 A;  2RS7 A;  3LNU A;  3K17 A;  2E1R A;  2EOO A;  1NHH A;  2GQ0 A;  5BR8 E;  2EML A;  5A6B D;  2MC6 A;  4X66 I;  3CDJ A;  3EPK A;  2LUP B;  2EPM X;  4JI1 I;  4NXM E;  4LCG A;  1IBK E;  1DI2 A;  1H73 A;  4LF7 I;  1N34 E;  2GHF A;  3HQ1 A;  5IT9 C;  1NHI A;  1PJS A;  1FWL A;  2VF3 A;  1B62 A;  2L3J A;  4M2Z A;  4IJD A;  1P42 A;  4DUZ E;  2PO2 B;  1XNQ I;  2ENC A;  2NUG A;  4Z7Y A;  2J7J A;  5DNX A;  1PJT A;  2LT7 A;  2JWO A;  5JEA F;  4IZK A;  3RMP A;  4P52 A;  4JI2 E;  3IWB A;  2YRM A;  1XMO E;  5JEA C;  1KJK A;  1USU A;  5JEA D;  3MHS C;  2L2K B;  4NXN I;  4JV5 I;  5T6J A;  4QNJ A;  4BA1 A;  2I9I A;  1GTK A;  1HR0 E;  4DV6 E;  2GLI A;  2EMF A;  2GO4 A;  1T4L B;  2PO0 A;  5BR8 I;  3VYY A;  2BM1 A;  4WYQ B;  2WBU A;  4OO1 C;  1EH7 A;  1Z0B A;  1PKP A;  4LFC E;  2ZBK B;  2E5L E;  1MU5 A;  3T1H E;  4NXM I;  3QT8 A;  1IBK I;  4MLQ A;  1HNZ E;  2IOP A;  2LJP A;  4OO1 D;  1N34 I;  4LF9 E;  2ODR C;  4WXC A;  2R42 A;  3THO B;  4FWD A;  1Y4S A;  3ADL A;  3GON A;  2ODR D;  4DV2 E;  3FIG A;  2M7Q A;  2WP8 A;  4DUZ I;  2RSM A;  2JR1 A;  2G7H A;  2DLQ A;  4YHH E;  4B3T E;  3M85 G;  1ZBT A;  2WBS A;  4MYT A;  5DRO A;  4JI2 I;  3KZZ A;  3P1X A;  4X9J A;  3PYF A;  3D4J A;  5C0X A;  2EM0 A;  2HHH E;  1K47 A;  2B7T A;  1XMO I;  4KHP E;  2BA1 D;  2NAB A;  3EQ1 A;  2EM2 A;  2JEB A;  2LVH A;  1G2D C;  1ZM4 A;  2EMY A;  2EOZ A;  3HKM A;  2EOM A;  1HR0 I;  1SFE A;  4DV6 I;  1ELO A;  1IMU A;  2RTX A;  2L3C A;  2V87 A;  2ELZ A;  4BBY A;  3LTO A;  2K4V A;  1EKZ A;  4J3D A;  2ZM6 E;  2YTF A;  2EMH A;  4AQY E;  4LFC I;  1H7U A;  3T1H I;  2E5L I;  2MKD A;  1E3H A;  1HNZ I;  3QG5 C;  4LFB E;  3J7A M;  2EM6 A;  3K85 A;  4LF9 I;  2EOQ A;  2EOH A;  2BA0 D;  2BR2 B;  1N0U A;  3ZZT A;  4U3D A;  2NA2 A;  4DV2 I;  2V83 A;  4X65 E;  1N3G A;  5A2Q Q;  4WPY A;  3C6M A;  4EMD A;  4YHH I;  4UT4 A;  4B3T I;  3HTX A;  4IFD B;  2EPO A;  2V2Q A;  3M6A A;  1MX0 A;  1T4O A;  2BV3 A;  2HHH I;  4R2S A;  1P47 A;  3ZM7 A;  1IQS A;  1H7S A;  2HFS A;  4KHP I;  4HAC B;  4AM3 A;  2O1V A;  4MU1 A;  2VES A;  2BB8 A;  2RQL A;  3DF6 A;  2C37 B;  5DRQ A;  4B3R I;  4LOM A;  4OO1 B;  5K36 F;  5AE2 A;  2EPN A;  2Q2E B;  2B7V A;  2L2N A;  4DV3 E;  2UUA E;  4U3B A;  4R2D A;  5K36 C;  4R2E A;  2YSP A;  2YTQ A;  5LMN E;  2EOI A;  4DPX A;  2PO1 A;  5K36 D;  2ZM6 I;  4AQY I;  4Q35 B;  4RPF A;  2EPP A;  2EFG A;  4LFB I;  4TUG A;  2C39 A;  4DPW A;  2EJ4 A;  2O1W A;  4MLV A;  3Q1Q A;  1YYK A;  2EMA A;  1HK7 A;  4JI7 E;  4X65 I;  2V89 A;  2NUE A;  2BBG A;  2C38 A;  2Z5E A;  2JT2 A;  1PDA A;  1UN6 B;  1SR9 A;  5KL5 A;  2Q8U A;  2UXB E;  1RR9 A;  3P3G A;  3HXL A;  5CFF E;  4X64 E;  3PYG A;  3ZKD A;  2V2Z A;  1ZM9 A;  1B69 A;  1B63 A;  2UU9 E;  3V2U C;  3J81 Q;  4MU3 A;  2VF1 A;  1Z59 A;  2YTJ A;  4DR2 E;  1ZM2 A;  3P76 A;  1EH8 A;  4BA2 A;  3J81 C;  2YRH A;  4HYM A;  2EPZ A;  2YWQ A;  2MKN A;  4DV3 I;  2UUA I;  3C6K A;  5KL2 A;  5LMN I;  2F4V E;  4F9B B;  2EPU A;  5F3W A;  5FLX Q;  1AH5 A;  2IOQ A;  2YTI A;  2L33 A;  5DNY A;  2LJU A;  2F1D A;  2L92 A;  3C4T A;  1UBD C;  4O24 A;  4JI7 I;  3JAM C;  3GME A;  1GQE A;  2OI2 A;  5DNL A;  2LE2 A;  4DUY E;  4BC9 A;  1X6E A;  5AE3 A;  2EPL X;  2UXB I;  4L5N C;  4X64 I;  2EMX A;  3AUZ A;  2EMG A;  4MYU A;  4IFD E;  1X3C A;  2RSI A;  4GEQ B;  2UU9 I;  2CPN A;  4F6M A;  1Z0T A;  2YTN A;  4DR6 E;  4MDT A;  1IBL E;  2BA1 G;  5EL9 A;  4DR2 I;  2RPC A;  2YRK A;  4F54 A;  2EM5 A;  4WSP A;  5JEA B;  4Z7C A;  2PRT A;  1RQ0 A;  1ZR9 A;  2N3H A;  3ZOQ B;  5ADZ A;  2EN8 A;  5AC5 A;  2WZO A;  2YTD A;  3VYX A;  2DGC A;  4I8O A;  4WX9 A;  2N8X A;  4X62 E;  2PO2 A;  1TF6 A;  2MDG A;  1OYR A;  2CT1 A;  3BGH A;  4LTY A;  4YY3 E;  4JI3 E;  4PU9 A;  4USK A;  2F4V I;  3BF2 A;  3BBG A;  4GZN C;  1MG7 A;  2YPN A;  2UXD E;  4B3M E;  3LPS A;  4KZS A;  1S16 A;  2AJ4 A;  4HEI A;  2BA0 G;  4O43 A;  1STU A;  2HK3 A;  2L8T A;  4M30 A;  2JP9 A;  2NN6 B;  2DEI A;  5A69 A;  4DUY I;  3THN A;  2HFU A;  3VHT B;  4F2J C;  3HPS A;  2DSY A;  3PYE A;  5C0X F;  2EE8 A;  3NZK A;  1NHJ A;  2JE6 B;  1U2R A;  5C0X C;  4OZE A;  1KVK A;  4DR6 I;  1IBL I;  1A1G A;  1XHK A;  4HY1 A;  1A1L A;  1YYO A;  5C0X D;  4MU0 A;  1YFH A;  2ADR A;  1MGT A;  1UDO A;  2EN4 A;  5LLQ A;  1E3P A;  4DV7 E;  2WNR B;  3Q6M A;  4X62 I;  2JXP A;  4YY3 I;  1HNW E;  4JI3 I;  1ZU1 A;  3ZZU A;  3PYD A;  3F6G A;  2D9H A;  1XMQ E;  2UXD I;  2X7I A;  1OJ4 A;  4O4K A;  1XXE A;  1YZ9 A;  3L00 A;  4GKJ E;  1N0V C;  4IZJ B;  1H74 A;  4B3M I;  3C4B A;  1FJG E;  2DEJ A;  4FW7 A;  4QNK A;  1A1H A;  1NEI A;  3ADJ A;  2IHR 1;  4DPT A;  3MHH C;  5A6J A;  3WU6 A;  2FGG A;  4P7D A;  2YTO A;  3ADG A;  2DRP A;  1Y60 A;  2E72 A;  2VQF I;  5AAS A;  2LMZ A;  4OKG A;  1YUJ A;  4B3R E;  5GME A;  1OYP A;  5LL6 R;  2GO3 A;  4R2C A;  4PRV A;  2EPR A;  4LF8 E;  3B78 A;  2YU8 A;  4DV1 E;  2EQ0 A;  2JOX A;  5L3J A;  2V85 A;  3K1J A;  2BR2 A;  3CWV A;  2EM3 A;  3B82 A;  2YSO A;  4LFA E;  2WBT A;  3DD6 A;  4FN5 A;  4DV7 I;  1Z5B A;  2JEA B;  5IWA E;  1HNW I;  4IFD A;  1F2I G;  2YTG A;  3AV0 A;  4R8O A;  1XMQ I;  4RHB B;  5A6K A;  3H1C A;  4GKJ I;  4BHC A;  4BCA A;  2WCC 3;  3WU4 A;  2FTX B;  1J26 A;  2CVE A;  3U1Y A;  3ZZ0 A;  4DPU A;  4X8W A;  1FJG I;  2A25 A;  3OTO E;  4HAC A;  4DR7 E;  4XTJ A;  3V5R A;  1DQ3 A;  5A2Q C;  1OYS A;  2C37 A;  2NN6 E;  4JYA E;  4MU4 A;  4OOG C;  4R2A A;  2O1T A;  4OO1 A;  4P78 A;  4JG4 A;  3WU3 A;  2L6M A;  1WJP A;  2GS8 A;  2HKJ A;  2CG9 A;  2V8Q B;  4JI6 E;  1WRJ A;  4R03 A;  4JI5 E;  1N33 E;  2CTD A;  2V88 A;  1LLM C;  2EOX A;  3L7Z B;  2FV4 B;  1Z5A A;  2EOY A;  1R6L A;  2VQE E;  4LF8 I;  1X47 A;  2JOB A;  1T39 A;  4DV1 I;  2EOS A;  2UUC E;  1Z0G A;  1FI4 A;  4DU8 A;  3BID A;  3LML A;  4LFA I;  2EMC A;  4LPF A;  1PVG A;  1O0W A;  5IWA I;  1Y5Y A;  4DR3 E;  1ZAA C;  3GCM A;  3ECR A;  2GPI A;  2H36 X;  1Y4U A;  4GQU A; 
#chains in the Genus database with same CATH homology
 1S4E A;  2X36 A;  2Z5C B;  3OTO I;  4DR7 I;  3HUL A;  4FW9 A;  4JYA I;  2L2M A;  1HNX E;  3B8H A;  2B9D A;  4WUB A;  4JI6 I;  1FKA E;  4JI5 I;  3PRY A;  1KIJ A;  4BC7 A;  1N33 I;  2N3G A;  2JVA A;  3F6H A;  2VQE I;  2UUC I;  4TUI A;  1WHQ A;  1WUU A;  2LUQ A;  5FLX C;  4DR3 I;  4M1K A;  4Q28 A;  1KKH A;  1N36 I;  3IWD A;  4LF4 E;  4JI8 E;  5AE1 A;  2HKE A;  2CGE A;  1HNX I;  5GMD A;  1RRE A;  3VK6 A;  1QU6 A;  1IBM E;  3J7Y p;  2E1M A;  4ED4 A;  3OML A;  1Y6Z A;  4I3H A;  4GKK E;  5LMU E;  1XNR E;  2LBS B;  4ZVI A;  2UUB E;  2MDR A;  4LF4 I;  2Z5B B;  1DAR A;  4JI8 I;  1N32 E;  2VQF E;  2A2D A;  2A2C A;  2F8B A;  2ZIT A;  4PRX A;  1PIE A;  4N3O A;  1FNM A;  5IT9 Q;  4KQV A;  3JTZ A;  1FWK A;  4USM A;  2LTS A;  3DJW A;  4DR4 E;  4DV5 E;  1IBM I;  4URL A;  4IZJ A;  2LTR A;  1UHZ A;  2NUF A;  4OX9 E;  2V2V A;  4GKK I;  4DV0 E;  5LMU I;  4P7A A;  3J7A G;  1XNR I;  2UUB I;  2NPF A;  4F9C B;  4M0V A;  4IZK B;  4WUD A;  1N32 I;  1UIL A;  1A6F A;  2PNL A;  1VIS A;  2KOU A;  4BMJ A;  4JI0 E;  4K0K E;  1EA6 A;  1H72 C;  4DR1 E;  2DIX A;  3ZKB A;  3QT7 A;  2DB2 A;  2V34 A;  2BM0 A;  3Q6N A;  2V8P A;  4DR4 I;  4DV5 I;  4B3S E;  1Z0C A;  4LF6 E;  3WU5 A;  2KHX A;  3K6Q A;  4OX9 I;  2B3T B;  3T1Y E;  4DV0 I;  2CZ9 A;  1ZM3 A;  1GZ6 A;  1WXR A;  4J8Z A;  4K0K I;  4JI0 I;  3QT5 A;  3QT6 A;  2HK2 A;  1J5E E;  2YT4 A;  4DR1 I;  4R1F A;  2KON A;  3HPZ A;  1Z5C A;  2PNM A;  2LRS A;  2VE7 C;  2V86 A;  4B3S I;  4LF6 I;  2MC5 A;  1Z0V A;  1ZXM A;  2Z5C A;  1KTV A;  1N36 E;  4WUC A;  4DV4 E;  3T1Y I;  4DR5 E;  1YYW A;  1Z0W A;  1ZBQ A;  1EI1 A;  1BKN A;  4L8N A;  4UTG A;  1T4N A;  2XEX A;  1X49 A;  2M1S A;  2M4I A;  4FWG A;  3JU0 A;  3LLH A;  1J5E I;  1UEK A;  4FWH A;  4LF5 E;  2YZT A;  1Z0E A;  4DU7 A;  4DKK A;  1D6T A;  4DPY A;  1I94 E;  3IWC A;  3H4L A;  3ADI A;  4JI4 E;  5FWK A;  2UXC E;  4F9A B;  3J80 Q;  4DV4 I;  4DR5 I;  4HXZ A;  3J80 C;  2EWL A;  4BS9 A;  2EZ6 A;  2O1U A;  1WHN A;  4WFT A;  4X66 E;  3HJC A;  3P06 A;  1USV A;  4JI1 E;  2DMY A;  4LU9 A;  4DMI A;  3F0N A;  1RC7 A;  2JY9 A;  1ZXN A;  4LF7 E;  4LF5 I;  3KWR A;  2J7K A;  1NZ0 A;  1XNQ E;  2RS6 A;  3JAM Q;  1QZR A;  1I94 I;  3MSW A;  2WW4 A;  2Z5B A;  3H09 A;  4DXL A;  4JI4 I;  2R3V A;  2UXC I;  4IZJ D;  4NXN E;  4JV5 E;  2LJH A;  1X48 A;  2RS7 A;  3LNU A;  3K17 A;  2E1R A;  1NHH A;  2GQ0 A;  5BR8 E;  2MC6 A;  4X66 I;  2LUP B;  4JI1 I;  4NXM E;  1IBK E;  1DI2 A;  1H73 A;  4LF7 I;  1N34 E;  3HQ1 A;  5IT9 C;  1NHI A;  2VF3 A;  1FWL A;  1B62 A;  2L3J A;  4M2Z A;  1XNQ I;  4DUZ E;  2NUG A;  4Z7Y A;  2JWO A;  4IZK A;  3RMP A;  4P52 A;  4JI2 E;  3IWB A;  1XMO E;  1USU A;  2L2K B;  4NXN I;  4JV5 I;  5T6J A;  1HR0 E;  4DV6 E;  1T4L B;  5BR8 I;  3VYY A;  2BM1 A;  4WYQ B;  2ZBK B;  1Z0B A;  1PKP A;  4LFC E;  4NXM I;  2E5L E;  1MU5 A;  3T1H E;  3QT8 A;  1IBK I;  1HNZ E;  2IOP A;  2LJP A;  1N34 I;  4LF9 E;  2ODR C;  4FWD A;  2R42 A;  1Y4S A;  3ADL A;  3GON A;  2ODR D;  4DV2 E;  3FIG A;  2M7Q A;  4DUZ I;  2RSM A;  2JR1 A;  2G7H A;  4YHH E;  4B3T E;  1ZBT A;  4JI2 I;  4MYT A;  3PYF A;  3P1X A;  3D4J A;  1XMO I;  2HHH E;  1K47 A;  2B7T A;  4KHP E;  1ZM4 A;  1HR0 I;  4DV6 I;  1ELO A;  2RTX A;  2L3C A;  2V87 A;  4BBY A;  3LTO A;  2K4V A;  1EKZ A;  2ZM6 E;  4AQY E;  4LFC I;  2E5L I;  1H7U A;  3T1H I;  3J7A M;  1HNZ I;  4LFB E;  4LF9 I;  3K85 A;  1N0U A;  3ZZT A;  2NA2 A;  4DV2 I;  2V83 A;  4X65 E;  5A2Q Q;  4WPY A;  4EMD A;  4YHH I;  4UT4 A;  4B3T I;  3HTX A;  3M6A A;  2V2Q A;  1MX0 A;  1T4O A;  2BV3 A;  2HHH I;  3ZM7 A;  2HFS A;  1H7S A;  4KHP I;  4HAC B;  2O1V A;  4B3R I;  3DF6 A;  5AE2 A;  2Q2E B;  2B7V A;  2L2N A;  4DV3 E;  2UUA E;  5LMN E;  4DPX A;  2ZM6 I;  4AQY I;  4RPF A;  2EFG A;  4LFB I;  4TUG A;  4DPW A;  2O1W A;  3Q1Q A;  1YYK A;  1HK7 A;  4JI7 E;  4X65 I;  2V89 A;  2NUE A;  2Z5E A;  1SR9 A;  2UXB E;  1RR9 A;  3ZKD A;  3HXL A;  5CFF E;  4X64 E;  3PYG A;  2V2Z A;  1ZM9 A;  1B63 A;  2UU9 E;  3V2U C;  3J81 Q;  2VF1 A;  1Z59 A;  4DR2 E;  1ZM2 A;  3J81 C;  4HYM A;  4DV3 I;  2UUA I;  5LMN I;  2F4V E;  4F9B B;  5F3W A;  5FLX Q;  2IOQ A;  2L33 A;  5DNY A;  2L92 A;  3C4T A;  4JI7 I;  3JAM C;  1GQE A;  2OI2 A;  2LE2 A;  4DUY E;  4BC9 A;  5AE3 A;  2UXB I;  4L5N C;  4X64 I;  3AUZ A;  4MYU A;  4GEQ B;  2UU9 I;  2CPN A;  1Z0T A;  4DR6 E;  1IBL E;  4DR2 I;  4F54 A;  4WSP A;  4Z7C A;  1RQ0 A;  2N3H A;  3ZOQ B;  5ADZ A;  2WZO A;  3VYX A;  4I8O A;  4X62 E;  4LTY A;  4YY3 E;  4PU9 A;  4JI3 E;  4USK A;  2F4V I;  1MG7 A;  2UXD E;  4B3M E;  3LPS A;  4KZS A;  1S16 A;  2AJ4 A;  1STU A;  2HK3 A;  2L8T A;  4M30 A;  2DEI A;  4DUY I;  2HFU A;  3HPS A;  2DSY A;  3PYE A;  1NHJ A;  1U2R A;  1KVK A;  4DR6 I;  1IBL I;  1XHK A;  4HY1 A;  1YYO A;  4DV7 E;  3Q6M A;  4X62 I;  4YY3 I;  1HNW E;  4JI3 I;  3ZZU A;  3PYD A;  3F6G A;  1XMQ E;  2UXD I;  2X7I A;  1OJ4 A;  4B3M I;  1YZ9 A;  4GKJ E;  1N0V C;  4IZJ B;  1H74 A;  3C4B A;  1FJG E;  2DEJ A;  4DPT A;  3ADJ A;  2IHR 1;  3WU6 A;  2FGG A;  4P7D A;  3ADG A;  2VQF I;  5AAS A;  2LMZ A;  5GME A;  4B3R E;  5LL6 R;  4PRV A;  4LF8 E;  3B78 A;  4DV1 E;  2JOX A;  5L3J A;  2V85 A;  3K1J A;  3CWV A;  3B82 A;  4FN5 A;  4LFA E;  4DV7 I;  1Z5B A;  5IWA E;  1HNW I;  3AV0 A;  4R8O A;  1XMQ I;  4GKJ I;  4BCA A;  3WU4 A;  3ZZ0 A;  2FTX B;  1J26 A;  4DPU A;  1FJG I;  4X8W A;  3OTO E;  4HAC A;  4DR7 E;  4XTJ A;  3V5R A;  1DQ3 A;  5A2Q C;  4JYA E;  4OOG C;  3WU3 A;  2O1T A;  4P78 A;  4JG4 A;  2L6M A;  2GS8 A;  2HKJ A;  2CG9 A;  2V8Q B;  4JI6 E;  4JI5 E;  4R03 A;  1N33 E;  2V88 A;  2FV4 B;  1Z5A A;  4LF8 I;  2VQE E;  1X47 A;  2JOB A;  4DV1 I;  2UUC E;  1Z0G A;  1FI4 A;  4DU8 A;  3LML A;  4LFA I;  1PVG A;  1O0W A;  5IWA I;  4DR3 E;  2H36 X;  1Y4U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...