3JAMC

Cryoem structure of 40s-eif1a-eif1 complex from yeast
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
217
structure length
217
Chain Sequence
GWVPVTKLGRLVKAGKISSIEEIFLHSLPVKEFQIIDQLLPNLKDEVMNIKPVQKQTRAGQRTRFKAVVVVGDSNGHVGLGIKTAKEVAGAIRAGIIIAKLSVIPIRRGYWGTNLGQPHSLATKTSGKCGSVSVRLIPAPRGSGIVASPAVKKLMQLAGVEDVYTSSTGSTRTLENTLKAAFVAIGNTYGFLTPNLWEVQALTPSPMDVYADYATAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 18S rRNA
publication title Conformational Differences between Open and Closed States of the Eukaryotic Translation Initiation Complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Translation
total genus 43
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
C PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.770 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3jamC01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 3jamC02
4LFBI 3B82A 4DPTA 4DPWA 3J80C 4DUZE 1QZRA 5BR8I 4JG4A 3K17A 3H4LA 1Z5AA 1RR9A 4AQYE 4OX9I 4UTGA 3OTOI 5IT9Q 1N32E 4FW9A 4LF7E 1XMOE 4DR4E 1MG7A 4JV5I 1NHJA 4DR1E 5A2QC 1U2RA 4P52A 4JI8I 4USKA 4R1FA 4LF5I 3J7AG 3LNUA 1IBMI 1N33I 4X65I 2UU9E 2HK3A 2UXBE 2J7KA 4DR6I 2WW4A 1FWLA 4LF8E 4DR5I 4WUDA 3QT7A 3JAMQ 4DV2I 4P7AA 1IBLI 2E5LI 1XMQI 1HNWE 4B3RE 2OI2A 4FWGA 3PYDA 4GKKI 2UUCI 4JI1E 4MYUA 1IBKI 2X7IA 2VQFE 2HFUA 4DV5E 2BM0A 1N34E 5LMUI 1WUUA 4X64I 1UEKA 1KVKA 2VQEI 4DV0I 4B3MI 4NXNI 3Q1QA 4YY3I 1FJGI 4KHPI 1N0VC 1Z0EA 3B78A 3T1HI 3OTOE 2XEXA 4JI6I 2DEIA 4JV5E 1MU5A 4MYTA 1N36I 4DV4I 3WU5A 4LF4I 4LFCI 1H72C 1PIEA 2R3VA 5IWAI 2UXCE 2BV3A 1J5EI 2UUAI 3GONA 3PYGA 2NPFA 1IBME 2CZ9A 2HK2A 1FI4A 3PYFA 4DUYI 3JAMC 1EI1A 3J81Q 3T1YE 3ZZ0A 1I94E 4DR6E 5LMNI 2HHHI 2Q2EB 4JI2E 1EA6A 1MX0A 4DV6I 2DEJA 1B62A 1ZM2A 4NXMI 2V34A 4DR2E 4LF6I 2F4VI 1XNQI 4M1KA 4JI7E 4JI3I 1KKHA 3CWVA 2HKJA 4ED4A 5LMUE 1BKNA 4K0KE 4X64E 3ZZTA 2UUBI 4DPUA 3LTOA 1HNZI 3QT5A 4FN5A 4LFAE 2X36A 4YY3E 1FJGE 1HR0I 1Z0TA 1K47A 3ZKDA 4DV7I 4FWDA 2ZM6I 4Z7YA 4GKJE 1XNRI 4DV1I 4YHHI 1A6FA 1KTVA 1ZM3A 4WUBA 4DR3I 4LF4E 2GS8A 4JI5E 3J81C 4Z7CA 1J5EE 2UUAE 2HFSA 4LF9E 4LFBE 4AQYI 4DU7A 4DPXA 4DUYE 2V2ZA 5BR8E 1ZM4A 4DV3I 4DPYA 3J7AM 1N32I 4LF7I 5IT9C 1PVGA 3WU4A 4DR7I 1FNMA 4OX9E 4DR1I 4ZVIA 4HYMA 3K1JA 1H7UA 2V2VA 4LF6E 1HNXI 2V8PA 4JI8E 3WU6A 1Z5BA 2VF3A 4YHHE 4PRVA 3ZZUA 4LF5E 2UXDI 4LF8I 2ZBKB 4FWHA 1N33E 2UUBE 4HACA 4B3SI 4B3TI 4X65E 4X66I 1Z0GA 5LL6R 1B63A 1HNWI 4DV7E 4B3RI 3QT6A 2ZM6E 4PRXA 4DR5E 1NHHA 3D4JA 5FLXQ 2VQFI 4DV2E 1IBLE 2E5LE 1XMQE 1N34I 4DR3E 4X62I 2LJPA 3LPSA 1VISA 4PU9A 4GKKE 2UUCE 1NHIA 1XHKA 1IBKE 4WUCA 3V2UC 2HKEA 4I3HA 4HY1A 3HULA 1H7SA 5L3JA 2VQEE 4DV3E 4DV0E 4B3ME 4NXNE 4DR7E 1ELOA 4JI4I 4JI0I 2ZITA 4KQVA 4KHPE 4EMDA 3T1HE 4URLA 4JYAI 4DXLA 2UXCI 1ZXNA 4JI6E 1HNXE 1FKAE 1Z0WA 4UT4A 2EFGA 1RREA 1N36E 1NZ0A 4DV4E 1D6TA 2AJ4A 4LFCE 4DUZI 1OJ4A 4XTJA 4DU8A 1S4EA 3T1YI 5IWAE 1I94I 5GMDA 2UXDE 1N0UA 3B8HA 3ZM7A 4B3SE 4B3TE 1H74A 4X66E 3J80Q 4JI2I 5FLXC 1Z59A 3WU3A 5LMNE 3PYEA 4DR2I 2HHHE 1XMOI 4DR4I 1H73A 4JI7I 4DV6E 1Z0BA 4HXZA 1Z5CA 4X62E 4RPFA 1ZXMA 4NXME 1Z0CA 4K0KI 2F4VE 3M6AA 1XNQE 1PKPA 2BM1A 3ZKBA 5A2QQ 2UU9I 4LFAI 2UXBI 4JI3E 1FWKA 2V2QA 2R42A 4GKJI 1Z0VA 1HNZE 1KIJA 4HACB 1HR0E 4JI4E 3V5RA 4JI0E 2A2DA 3F0NA 4JI5I 1S16A 1DARA 4JI1I 4JYAE 4USMA 1ZM9A 3QT8A 2E1RA 2A2CA 1XNRE 5GMEA 4DV1E 4LF9I 4DV5I
chains in the Genus database with same CATH superfamily
4LFBI 1PJSA 4R2PA 2LJHA 2EPOA 3B82A 2J65A 2DIXA 5KL4A 2LBSB 1IQOA 1Y60A 4LCGA 2YSPA 4DPTA 2K4VA 4DPWA 3J80C 4DUZE 5JEAF 1QZRA 2JOXA 5BR8I 4JG4A 4F9BB 2LMZA 2EMFA 3K17A 4LCFA 2N3HA 3KWRA 4MU0A 2PO1A 5A6BA 3U1YA 3M85D 2EPLX 2NUEA 3H4LA 1Z5AA 2EPPA 1RR9A 4AQYE 1X47A 4NHRA 4OX9I 5LLQA 2O1VA 3FIGA 2EPZA 1T38A 4WX9A 2BR2B 1UN6B 2Z5CB 2GPIA 4UTGA 3ZOQB 1RMDA 2EPRA 2E72A 2RSMA 3OTOI 4R2QA 2L6MA 5IT9Q 2EN3A 2MC6A 1N32E 4LF7E 4FW9A 2JYAA 1XMOE 4DR4E 4P7DA 1MG7A 4JV5I 1NHJA 2EM5A 2JP9A 4DR1E 1R6LA 2NN6C 5A2QC 1U2RA 4P52A 4JI8I 1A1JA 1O0WA 2CVEA 4USKA 1WRJA 4R1FA 1UDOA 2BA1D 2Z5BA 2EQ0A 2PNZB 4LF5I 4WXDA 3L7ZA 2AE8A 3J7AG 4F6NA 4IZKA 3LNUA 1X6FA 1IBMI 2BB8A 3BF2A 1N33I 5T6JA 4GQUA 2JVAA 2ADRA 4X65I 1DGCA 2UU9E 4OO1E 2NUGA 2L33A 4OO1A 2HK3A 2YTJA 3F6GA 2O1TA 2UXBE 3M99B 2I9IA 4BBYA 1EKZA 2J7KA 4DR6I 3Q6NA 2VE7C 4F2JC 1YFHA 5JEAE 5JEAA 3L00A 2WW4A 3EPHA 4LF8E 1FWLA 2WBSA 2EL5A 1NCSA 3C6KA 4WUDA 4DR5I 3LMLA 1X49A 3MHHC 4O43A 4FK5C 4BC9A 1QNTA 2PNLA 2GQ0A 3K85A 3KRNA 3QT7A 2EP3A 2EOXA 4P7AA 2R76A 3JAMQ 4DV2I 1IBLI 2E5LI 1XMQI 1SR9A 2NN6D 1HNWE 4ISAA 2EMKA 2EM6A 2L2NA 2EM9A 5KL5A 4M2ZA 4B3RE 3PS2A 2OI2A 4FWGA 1E3PA 3PYDA 4GKKI 4X8WA 2WNRB 5DRQA 4JI1E 2UUCI 1T39A 1RHYA 1IMUA 4MYUA 4BMJA 2EE8A 4TUGA 1IBKI 2X7IA 2VQFE 5K36C 2GO4A 2HFUA 4IS9A 4DV5E 5A69A 4LU9A 4MLVA 2BM0A 2FV4B 2CSHA 2WZOA 1N34E 1UBDC 1YYWA 2V85A 5LMUI 3NZKA 1WUUA 2Z5EA 3ECRA 4X64I 1UEKA 2O1UA 2JOBA 2LRSA 5EKWA 3ADLA 3BIDA 1X5WA 2WP8A 1X6EA 1KVKA 2JEBB 2VQEI 4DV0I 4NXNI 4B3MI 2H36X 3Q1QA 5DNLA 5DROA 4J8ZA 4MU1A 2V89A 2WCC3 2IOPA 4YY3I 1FJGI 3P76A 2V88A 1MGTA 4LCHA 1EH8A 2LTSA 2NN6B 4KHPI 1N0VC 1Z0EA 2EMCA 2FTXB 3B78A 1LLMC 2NABA 3J7Yp 3T1HI 5GMDA 3OTOE 2XEXA 4JI6I 5CFFE 2DEIA 5A6BD 2RSIA 1UHZA 4JV5E 1MU5A 4MYTA 1N36I 4DV4I 3WU5A 5K36D 5ADZA 2LV2A 4DMIA 2C37A 2RPCA 5DRPA 4LFCI 1TN9A 4OOGC 4LF4I 1H72C 2EMWA 4ZYGA 2A25A 5C0XF 2YZTA 1PIEA 2R3VA 5JEAC 5IWAI 3C4BA 2UXCE 4ZYHA 2BV3A 2PO0A 1GZ6A 1J5EI 2UUAI 3GONA 4LTYA 2LCEA 2GO3A 2L2KB 1IBME 3PYGA 1AH5A 2NPFA 2CZ9A 2HK2A 1OYSA 3GLLA 1FI4A 1DI2A 2C38B 3PYFA 2DSYA 4DUYI 1USUA 4WSPA 2V8QB 3JAMC 5F3WA 3RMPA 1EI1A 3T1YE 4J3DA 3ZZ0A 1BB8A 3J81Q 4BHBA 1I94E 4DR6E 2PO2A 4P78A 5LMNI 2DB2A 2EM0A 4FW3A 2HHHI 3UK3C 1GQEA 3VYXA 2Q2EB 2EQ3A 2EQ1A 4WXCA 4IFDC 4JI2E 2EOFA 2YTEA 2EPXA 2JE6B 2VRDA 1EA6A 2B3TB 1MX0A 4O4KA 4DV6I 5K36B 2DEJA 3HQ1A 1B62A 2ENHA 1ZM2A 5DNXA 4AIMA 5FWKA 4ZYDA 3GMEA 4O5GA 2EM2A 5A6KA 1E3HA 1G2DC 5C0XB 4NXMI 4N4RB 2V34A 4DR2E 5DRRA 4LF6I 2F4VI 1XNQI 3AV0A 5A6JA 2EOSA 4M1KA 1YPNA 4JI7E 4IZJA 4JI3I 2L2MA 3ADJA 2LVHA 1KKHA 3CWVA 2BR2A 2RS6A 2MDGA 2HKJA 4ED4A 2Z5CA 4OZEA 3KZYA 2ODRC 5LMUE 2EMBA 1F2IG 2G7HA 1BKNA 3JU0A 2F8BA 2L3CA 4K0KE 5AE2A 4X64E 3M7ND 4U3BA 4BA2B 3ZZTA 2YTNA 3L7ZB 2B9DA 2C39B 2UUBI 4IZKB 1PJTA 2V86A 4FW5A 4DPUA 3LTOA 1QU6A 3QT5A 1HNZI 4LFAE 2YPNA 4FN5A 3M85G 2X36A 2YRMA 1MEYC 4IFDD 4YY3E 1FJGE 2L3JA 4QNKA 1HR0I 1Z0TA 1K47A 2BA0D 3ZKDA 4DV7I 4FWDA 2MKDA 2ZM6I 2PNZA 4Z7YA 4Q28A 2E1MA 4GKJE 2EM7A 1XNRI 2EOQA 2EL4A 4AIDA 4DV1I 3HPZA 1YYOA 2EJ4A 2IERA 2YRHA 4YHHI 1A6FA 1KTVA 2NN6F 4MDTA 3DF6A 1ZM3A 5DNYA 1J26A 4WUBA 5AC4A 4DR3I 1ZBTA 2MKNA 2EOJA 4LF4E 1EH6A 2GS8A 2EOIA 4JI5E 1YYKA 2LJUA 1WXRA 4M9VC 2ENAA 2YU5A 3J81C 4Z7CA 2ODRD 2BA1G 4BC7A 4F9CB 5KL2A 2JWOA 5AASA 1J5EE 2UUAE 2CTDA 1OYRA 2HFSA 4LF9E 1X48A 2YTPA 4LFBE 4AQYI 4LOMA 4BA1A 4DU7A 3ADGA 2IOQA 4DPXA 4IFDB 4DUYE 2V2ZA 2EOEA 2KOUA 2M1SA 5BR8E 4NBQA 2FGGA 1ZM4A 2WNRA 2BA0G 2N8XA 1BBGA 4DV3I 3PS3A 2EOYA 3H09A 2K7IA 4DPYA 3J7AM 4FW6A 4LF7I 2NUFA 1N32I 5IT9C 1PVGA 5AE3A 3WU4A 2L8TA 4KWYA 3EPLA 4DR7I 1FNMA 4OX9E 2F1DA 2RS7A 4R2RA 4DR1I 2V83A 4ZVIA 2LO3A 4R2SA 2EN6A 4HYMA 2D9HA 3IWDA 3K1JA 4R2DA 1ZBQA 3P06A 2JEAB 2LUQA 3MHSC 3OMLA 1H7UA 1XXEA 4DKKA 4L5NC 2V2VA 2LUPB 3U1KA 5A6AA 2KONA 4LF6E 3THNA 2JEBA 1HNXI 4OO1C 2HGHA 5K36F 2V8PA 4JI8E 2EMGA 2NN6E 3WU6A 2NN6A 1Z5BA 2EMXA 2C37B 4IJDA 2CGEA 1VI7A 4I8OA 4LF5E 1TF6A 2VF3A 4M30A 4PRVA 3ZZUA 5KL6A 3EQ1A 1A1GA 4WFTA 4F9AB 3P3EA 2UXDI 4LF8I 2HC5A 2ZBKB 1N33E 4FWHA 2M7QA 2EN7A 2UUBE 4HACA 4X65E 4B3SI 4HTGA 4X66I 4B3TI 4AM3A 1T4OA 2B7VA 2EMAA 1Z0GA 2J7JA 3VHTB 2EMIA 5LL6R 1PDAA 4IZJD 1Y4SA 2DMIA 3KZZA 3HXLA 1B63A 1HNWI 4DV7E 4B3RI 3DJWA 3QT6A 2ZM6E 1YUIA 2JR1A 4PRXA 4KZSA 3HKMA 2PO2B 3ADIA 2PO1B 4DR5E 3CDJA 3TQMA 3VK6A 1NEIA 5KL7A 1NHHA 3IWCA 3HJCA 3THOB 3D4JA 5FLXQ 2VQFI 4R2EA 4DV2E 2C38A 4OO1D 3EPKA 1IBLE 2EOOA 2EPKX 4R2CA 2E5LE 1XMQE 2EPAA 1JK2A 2O1WA 1N34I 2IESA 4DR3E 1A1LA 4X62I 3IWBA 2PRTA 1Z1BA 4ZYEA 4WSGA 2LJPA 1VISA 4GKKE 1OYPA 3LPSA 3Q6MA 4PU9A 5JEAD 2BBGA 2EPMX 2YT4A 2YU8A 2UUCE 1ZU1A 1P47A 2EL6A 1NHIA 1XHKA 1IBKE 2YWQA 1UDNA 1A1KA 4WUCA 3V2UC 4OKGA 2HKEA 3UHMA 3PRYA 2JE6A 4I3HA 5K36E 2GHFA 5K36A 1STUA 1WHNA 1ZAAC 4IZJB 2HJJA 3QG5C 4HY1A 3HULA 1H7SA 1A1HA 2NA2A 3JTZA 2EOZA 2Z5BB 5C0XE 5KL3A 5C0XA 1WJPA 4DV5I 4QNJA 5L3JA 3P1XA 2VQEE 4DV3E 2CG9A 4DV0E 4B3ME 4NXNE 5ELWA 1AAYA 4IFDF 4MLQA 2EMHA 2JY9A 1T4NA 4DR7E 1ELOA 2EPCA 4OO1B 2LE2A 2JXPA 4JI4I 4JI0I 2ZITA 2M4IA 3AUZA 1TF3A 4KQVA 2EM8A 2CT1A 1B69A 1DQ3A 4KHPE 4MU4A 4EMDA 4BS9A 3T1HE 4URLA 2YTDA 3H1CA 4BA2A 4JYAI 4DXLA 5JEAB 1N3GA 2UXCI 1ZXNA 2EWLA 2C39A 4JI6E 4FW4A 2YTOA 4BCAA 4RHBB 4RH8A 4IS1C 1HNXE 1FKAE 1Z0WA 4UT4A 1WHQA 2EFGA 4R8OA 2IHR1 1RREA 1N36E 3P3CA 1NZ0A 4DV4E 2RQLA 2GLIA 1D6TA 2AJ4A 2EPNA 2MC5A 4LFCE 4DUZI 1OJ4A 4NZVA 2PNMA 4XTJA 1GTKA 1UILA 2EMYA 2EPUA 3F6HA 4N3OA 1S4EA 4DU8A 3T1YI 5IWAE 3EPJA 4GZNC 1I94I 4R2AA 2EMLA 2DRPA 3CDIA 4M0VA 1Y5YA 4R03A 2UXDE 4Q35B 1N0UA 3B8HA 1YH8A 1PJQA 3BBGA 1UDQA 1YSAC 1G2FC 1KJKA 3PS1A 1RC7A 3ZM7A 3M7NG 2EORA 1HK7A 4B3SE 4B3TE 1SFEA 2DLQA 1Y4UA 4X66E 1H74A 5EL9A 2EN1A 4U3DA 2RTXA 3K6QA 3J80Q 4JI2I 2JT2A 3C4TA 5FLXC 4BA1B 2N3GA 2V87A 5TSEA 1Z59A 3P3GA 1UDSA 2L92A 3WU3A 5LMNE 3C6MA 3PYEA 1RQ0A 4WYQB 3VYYA 2HHHE 4DR2I 2EOHA 1IQSA 2MDRA 1XMOI 2B7TA 4DR4I 2WP8B 2EM3A 4TUIA 2EN8A 4BHCA 2DGCA 1H73A 1YHCA 3BGHA 5IXMB 2KHXA 4IFDE 4JI7I 3GCMA 4WPYA 1EH7A 2DLKA 4DV6E 2YTGA 4IFDA 1Z0BA 4HXZA 1Z5CA 4MQYA 4X62E 5C0XC 4RPFA 1X6HA 1USVA 1ZXMA 4NXME 2VESA 1Z0CA 4K0KI 2EMZA 1ZR9A 2F4VE 2YRKA 3HPSA 1T4LB 1JK1A 1L4SA 3M6AA 4X9JA 1XNQE 4O24A 1PKPA 3HTXA 1YUJA 2BM1A 3ZKBA 5A2QQ 2UU9I 2M9AA 2VF1A 2YSOA 1P42A 2EZ6A 1A1FA 4LFAI 5IV8B 1Y6ZA 2UXBI 1BBOA 1X3CA 4JI3E 1KYQA 1FWKA 2JEAA 2LTRA 4LPFA 2JPAA 2ELYA 5AE1A 2V2QA 2R42A 2YTQA 4GKJI 2I13A 2ELZA 2PO0B 3MSWA 2O3ZA 2EOMA 3LLHA 1YZ9A 1Z0VA 2WBUA 1HNZE 1KIJA 4HACB 2EN4A 2YTIA 4GEQB 2CPNA 1HR0E 4JI4E 4JI0E 3V5RA 4F6MA 3B4TA 3DD6A 4HEIA 1A1IA 2ENCA 2A2DA 3F0NA 4JI5I 4F54A 2R1FA 1S16A 1DARA 4JYAE 4JI1I 2WBTA 1ZM9A 4USMA 3QT8A 2EM4A 2E1RA 2LT7A 1XNRE 2A2CA 5C0XD 4FW7A 5GMEA 2Q8UA 2DMYA 4MU3A 4DV1E 4OO1F 5AC5A 1R6MA 2EN2A 2YTFA 4L8NA 4LF9I 4YHHE
chains in the Genus database with same CATH topology
4LFBI 2LJHA 3B82A 2DIXA 2LBSB 4DPTA 4DPWA 2K4VA 3J80C 4DUZE 1QZRA 2JOXA 5BR8I 4JG4A 4F9BB 2LMZA 3K17A 2N3HA 3KWRA 2NUEA 3H4LA 1Z5AA 1RR9A 4AQYE 1X47A 4OX9I 2O1VA 3FIGA 2Z5CB 4UTGA 3ZOQB 2RSMA 3OTOI 2L6MA 5IT9Q 2MC6A 1N32E 4LF7E 4FW9A 1XMOE 4DR4E 4P7DA 1MG7A 4JV5I 1NHJA 4DR1E 5A2QC 1U2RA 4P52A 4JI8I 1O0WA 4USKA 4R1FA 2Z5BA 4LF5I 3J7AG 4IZKA 3LNUA 1IBMI 1N33I 5T6JA 2JVAA 4X65I 2UU9E 2NUGA 2L33A 2HK3A 3F6GA 2O1TA 2UXBE 1EKZA 4BBYA 2J7KA 4DR6I 3Q6NA 2VE7C 2WW4A 4LF8E 1FWLA 4DR5I 4WUDA 3LMLA 1X49A 3QT7A 4BC9A 3K85A 2PNLA 2GQ0A 3JAMQ 4DV2I 4P7AA 1IBLI 2E5LI 1XMQI 1SR9A 1HNWE 4B3RE 2L2NA 4M2ZA 2OI2A 4FWGA 3PYDA 4GKKI 4X8WA 4JI1E 2UUCI 4MYUA 4BMJA 4TUGA 1IBKI 2X7IA 2VQFE 2HFUA 4DV5E 4LU9A 2BM0A 2FV4B 2WZOA 1N34E 1YYWA 2V85A 5LMUI 1WUUA 2Z5EA 4X64I 1UEKA 2O1UA 2JOBA 2LRSA 3ADLA 1KVKA 2VQEI 4DV0I 4NXNI 4B3MI 2H36X 3Q1QA 4J8ZA 2V89A 2IOPA 4YY3I 1FJGI 2V88A 2LTSA 4KHPI 1N0VC 1Z0EA 2FTXB 3B78A 3J7Yp 3T1HI 3OTOE 2XEXA 4JI6I 5CFFE 2DEIA 1UHZA 4JV5E 1MU5A 4MYTA 1N36I 4DV4I 3WU5A 5ADZA 4DMIA 4LF4I 4LFCI 4OOGC 1H72C 2YZTA 1PIEA 2R3VA 5IWAI 3C4BA 2UXCE 2BV3A 1GZ6A 1J5EI 2UUAI 3GONA 4LTYA 2L2KB 1IBME 3PYGA 2NPFA 2CZ9A 2HK2A 1FI4A 1DI2A 3PYFA 2DSYA 4DUYI 1USUA 4WSPA 2V8QB 3JAMC 5F3WA 3RMPA 1EI1A 3T1YE 3ZZ0A 3J81Q 1I94E 4DR6E 4P78A 5LMNI 2DB2A 2HHHI 2Q2EB 1GQEA 3VYXA 4JI2E 1EA6A 2B3TB 1MX0A 4DV6I 2DEJA 3HQ1A 1B62A 5FWKA 1ZM2A 4NXMI 2V34A 4DR2E 4LF6I 2F4VI 1XNQI 3AV0A 4M1KA 4JI7E 4IZJA 4JI3I 2L2MA 3ADJA 1KKHA 3CWVA 2RS6A 2HKJA 4ED4A 2Z5CA 2ODRC 5LMUE 2G7HA 1BKNA 3JU0A 2F8BA 2L3CA 4K0KE 5AE2A 4X64E 3ZZTA 2B9DA 2UUBI 4IZKB 2V86A 4DPUA 3LTOA 1QU6A 3QT5A 1HNZI 4LFAE 4FN5A 2X36A 4YY3E 1FJGE 2L3JA 1HR0I 1Z0TA 1K47A 3ZKDA 4DV7I 4FWDA 2ZM6I 4Z7YA 4Q28A 2E1MA 4GKJE 1XNRI 4DV1I 3HPZA 1YYOA 4YHHI 1A6FA 1KTVA 3DF6A 1ZM3A 5DNYA 1J26A 4WUBA 4DR3I 1ZBTA 4LF4E 2GS8A 4JI5E 1YYKA 1WXRA 3J81C 4Z7CA 2ODRD 4BC7A 4F9CB 2JWOA 5AASA 1J5EE 2UUAE 2HFSA 4LF9E 1X48A 4LFBE 4AQYI 4DU7A 3ADGA 2IOQA 4DPXA 4DUYE 2V2ZA 2KOUA 2M1SA 5BR8E 2FGGA 1ZM4A 4DV3I 3H09A 4DPYA 3J7AM 1N32I 4LF7I 2NUFA 5IT9C 1PVGA 5AE3A 3WU4A 2L8TA 4DR7I 1FNMA 4OX9E 2RS7A 4DR1I 2V83A 4ZVIA 4HYMA 3IWDA 3K1JA 1ZBQA 3P06A 2LUQA 3OMLA 1H7UA 4DKKA 4L5NC 2V2VA 2LUPB 2KONA 4LF6E 1HNXI 2V8PA 4JI8E 3WU6A 1Z5BA 2CGEA 4I8OA 4LF5E 2VF3A 4PRVA 4M30A 3ZZUA 4WFTA 4F9AB 2UXDI 4LF8I 2ZBKB 1N33E 4FWHA 2M7QA 2UUBE 4HACA 4B3SI 4X65E 4B3TI 4X66I 1T4OA 2B7VA 1Z0GA 5LL6R 4IZJD 1Y4SA 3HXLA 1B63A 1HNWI 4DV7E 4B3RI 3DJWA 3QT6A 2ZM6E 2JR1A 4PRXA 4KZSA 3ADIA 4DR5E 3VK6A 1NHHA 3IWCA 3HJCA 3D4JA 5FLXQ 2VQFI 4DV2E 1IBLE 2E5LE 1XMQE 2O1WA 1N34I 4DR3E 4X62I 3IWBA 3Q6MA 2LJPA 3LPSA 1VISA 4GKKE 4PU9A 2YT4A 2UUCE 1NHIA 1XHKA 1IBKE 4WUCA 3V2UC 2HKEA 3PRYA 4I3HA 1STUA 1WHNA 4IZJB 4HY1A 3HULA 1H7SA 2NA2A 3JTZA 2Z5BB 4DV5I 5L3JA 3P1XA 2VQEE 4DV3E 2CG9A 4DV0E 4B3ME 4NXNE 2JY9A 1T4NA 4DR7E 1ELOA 2LE2A 4JI4I 4JI0I 2ZITA 2M4IA 3AUZA 4KQVA 1DQ3A 4KHPE 4EMDA 4BS9A 3T1HE 4URLA 4JYAI 4DXLA 2UXCI 1ZXNA 2EWLA 4JI6E 4BCAA 1HNXE 1FKAE 1Z0WA 4UT4A 1WHQA 2EFGA 4R8OA 2IHR1 1RREA 1N36E 1NZ0A 4DV4E 1D6TA 2AJ4A 2MC5A 4LFCE 4DUZI 1OJ4A 4XTJA 2PNMA 1UILA 3F6HA 4N3OA 4DU8A 1S4EA 3T1YI 5IWAE 1I94I 4M0VA 5GMDA 4R03A 2UXDE 1N0UA 3B8HA 1RC7A 3ZM7A 1HK7A 4B3SE 4B3TE 1Y4UA 4X66E 1H74A 3J80Q 4JI2I 2RTXA 3K6QA 3C4TA 5FLXC 2N3GA 2V87A 1Z59A 2L92A 3WU3A 5LMNE 3PYEA 1RQ0A 4WYQB 3VYYA 2HHHE 4DR2I 2MDRA 1XMOI 2B7TA 4DR4I 4TUIA 1H73A 2KHXA 4JI7I 4WPYA 4DV6E 1Z0BA 4HXZA 1Z5CA 4X62E 4RPFA 1USVA 1ZXMA 4NXME 1Z0CA 4K0KI 2F4VE 3HPSA 1T4LB 3M6AA 3HTXA 1XNQE 1PKPA 2BM1A 3ZKBA 5A2QQ 2UU9I 2VF1A 2EZ6A 4LFAI 1Y6ZA 2UXBI 4JI3E 1FWKA 2LTRA 2V2QA 5AE1A 2R42A 4GKJI 3MSWA 3LLHA 1YZ9A 1Z0VA 1HNZE 1KIJA 4HACB 4GEQB 2CPNA 1HR0E 4JI4E 4JI0E 3V5RA 2A2DA 3F0NA 4JI5I 4F54A 1S16A 1DARA 4JYAE 4JI1I 4USMA 1ZM9A 3QT8A 2E1RA 1XNRE 2A2CA 5GMEA 2DMYA 4DV1E 4L8NA 4LF9I 4YHHE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LFB I;  3B82 A;  4DPT A;  4DPW A;  3J80 C;  4DUZ E;  1QZR A;  5BR8 I;  4JG4 A;  3K17 A;  3H4L A;  1Z5A A;  1RR9 A;  4AQY E;  4OX9 I;  4UTG A;  3OTO I;  5IT9 Q;  1N32 E;  4FW9 A;  4LF7 E;  1XMO E;  4DR4 E;  1MG7 A;  4JV5 I;  1NHJ A;  4DR1 E;  5A2Q C;  1U2R A;  4P52 A;  4JI8 I;  4USK A;  4R1F A;  4LF5 I;  3J7A G;  3LNU A;  1IBM I;  1N33 I;  4X65 I;  2UU9 E;  2HK3 A;  2UXB E;  2J7K A;  4DR6 I;  2WW4 A;  1FWL A;  4LF8 E;  4DR5 I;  4WUD A;  3QT7 A;  3JAM Q;  4DV2 I;  4P7A A;  1IBL I;  2E5L I;  1XMQ I;  1HNW E;  4B3R E;  2OI2 A;  4FWG A;  3PYD A;  4GKK I;  2UUC I;  4JI1 E;  4MYU A;  1IBK I;  2X7I A;  2VQF E;  2HFU A;  4DV5 E;  2BM0 A;  1N34 E;  5LMU I;  1WUU A;  4X64 I;  1UEK A;  1KVK A;  2VQE I;  4DV0 I;  4B3M I;  4NXN I;  3Q1Q A;  4YY3 I;  1FJG I;  4KHP I;  1N0V C;  1Z0E A;  3B78 A;  3T1H I;  3OTO E;  2XEX A;  4JI6 I;  2DEI A;  4JV5 E;  1MU5 A;  4MYT A;  1N36 I;  4DV4 I;  3WU5 A;  4LF4 I;  4LFC I;  1H72 C;  1PIE A;  2R3V A;  5IWA I;  2UXC E;  2BV3 A;  1J5E I;  2UUA I;  3GON A;  3PYG A;  2NPF A;  1IBM E;  2CZ9 A;  2HK2 A;  1FI4 A;  3PYF A;  4DUY I;  3JAM C;  1EI1 A;  3J81 Q;  3T1Y E;  3ZZ0 A;  1I94 E;  4DR6 E;  5LMN I;  2HHH I;  2Q2E B;  4JI2 E;  1EA6 A;  1MX0 A;  4DV6 I;  2DEJ A;  1B62 A;  1ZM2 A;  4NXM I;  2V34 A;  4DR2 E;  4LF6 I;  2F4V I;  1XNQ I;  4M1K A;  4JI7 E;  4JI3 I;  1KKH A;  3CWV A;  2HKJ A;  4ED4 A;  5LMU E;  1BKN A;  4K0K E;  4X64 E;  3ZZT A;  2UUB I;  4DPU A;  3LTO A;  1HNZ I;  3QT5 A;  4FN5 A;  4LFA E;  2X36 A;  4YY3 E;  1FJG E;  1HR0 I;  1Z0T A;  1K47 A;  3ZKD A;  4DV7 I;  4FWD A;  2ZM6 I;  4Z7Y A;  4GKJ E;  1XNR I;  4DV1 I;  4YHH I;  1A6F A;  1KTV A;  1ZM3 A;  4WUB A;  4DR3 I;  4LF4 E;  2GS8 A;  4JI5 E;  3J81 C;  4Z7C A;  1J5E E;  2UUA E;  2HFS A;  4LF9 E;  4LFB E;  4AQY I;  4DU7 A;  4DPX A;  4DUY E;  2V2Z A;  5BR8 E;  1ZM4 A;  4DV3 I;  4DPY A;  3J7A M;  1N32 I;  4LF7 I;  5IT9 C;  1PVG A;  3WU4 A;  4DR7 I;  1FNM A;  4OX9 E;  4DR1 I;  4ZVI A;  4HYM A;  3K1J A;  1H7U A;  2V2V A;  4LF6 E;  1HNX I;  2V8P A;  4JI8 E;  3WU6 A;  1Z5B A;  2VF3 A;  4YHH E;  4PRV A;  3ZZU A;  4LF5 E;  2UXD I;  4LF8 I;  2ZBK B;  4FWH A;  1N33 E;  2UUB E;  4HAC A;  4B3S I;  4B3T I;  4X65 E;  4X66 I;  1Z0G A;  5LL6 R;  1B63 A;  1HNW I;  4DV7 E;  4B3R I;  3QT6 A;  2ZM6 E;  4PRX A;  4DR5 E;  1NHH A;  3D4J A;  5FLX Q;  2VQF I;  4DV2 E;  1IBL E;  2E5L E;  1XMQ E;  1N34 I;  4DR3 E;  4X62 I;  2LJP A;  3LPS A;  1VIS A;  4PU9 A;  4GKK E;  2UUC E;  1NHI A;  1XHK A;  1IBK E;  4WUC A;  3V2U C;  2HKE A;  4I3H A;  4HY1 A;  3HUL A;  1H7S A;  5L3J A;  2VQE E;  4DV3 E;  4DV0 E;  4B3M E;  4NXN E;  4DR7 E;  1ELO A;  4JI4 I;  4JI0 I;  2ZIT A;  4KQV A;  4KHP E;  4EMD A;  3T1H E;  4URL A;  4JYA I;  4DXL A;  2UXC I;  1ZXN A;  4JI6 E;  1HNX E;  1FKA E;  1Z0W A;  4UT4 A;  2EFG A;  1RRE A;  1N36 E;  1NZ0 A;  4DV4 E;  1D6T A;  2AJ4 A;  4LFC E;  4DUZ I;  1OJ4 A;  4XTJ A;  4DU8 A;  1S4E A;  3T1Y I;  5IWA E;  1I94 I;  5GMD A;  2UXD E;  1N0U A;  3B8H A;  3ZM7 A;  4B3S E;  4B3T E;  1H74 A;  4X66 E;  3J80 Q;  4JI2 I;  5FLX C;  1Z59 A;  3WU3 A;  5LMN E;  3PYE A;  4DR2 I;  2HHH E;  1XMO I;  4DR4 I;  1H73 A;  4JI7 I;  4DV6 E;  1Z0B A;  4HXZ A;  1Z5C A;  4X62 E;  4RPF A;  1ZXM A;  4NXM E;  1Z0C A;  4K0K I;  2F4V E;  3M6A A;  1XNQ E;  1PKP A;  2BM1 A;  3ZKB A;  5A2Q Q;  2UU9 I;  4LFA I;  2UXB I;  4JI3 E;  1FWK A;  2V2Q A;  2R42 A;  4GKJ I;  1Z0V A;  1HNZ E;  1KIJ A;  4HAC B;  1HR0 E;  4JI4 E;  3V5R A;  4JI0 E;  2A2D A;  3F0N A;  4JI5 I;  1S16 A;  1DAR A;  4JI1 I;  4JYA E;  4USM A;  1ZM9 A;  3QT8 A;  2E1R A;  2A2C A;  1XNR E;  5GME A;  4DV1 E;  4LF9 I;  4DV5 I; 
#chains in the Genus database with same CATH topology
 4LFB I;  1PJS A;  4R2P A;  2LJH A;  2EPO A;  3B82 A;  2J65 A;  2DIX A;  5KL4 A;  2LBS B;  1IQO A;  1Y60 A;  4LCG A;  2YSP A;  4DPT A;  2K4V A;  4DPW A;  3J80 C;  4DUZ E;  5JEA F;  1QZR A;  2JOX A;  5BR8 I;  4JG4 A;  4F9B B;  2LMZ A;  2EMF A;  3K17 A;  4LCF A;  2N3H A;  3KWR A;  4MU0 A;  2PO1 A;  5A6B A;  3U1Y A;  3M85 D;  2EPL X;  2NUE A;  3H4L A;  1Z5A A;  2EPP A;  1RR9 A;  4AQY E;  1X47 A;  4NHR A;  4OX9 I;  5LLQ A;  2O1V A;  3FIG A;  2EPZ A;  1T38 A;  4WX9 A;  2BR2 B;  1UN6 B;  2Z5C B;  2GPI A;  4UTG A;  3ZOQ B;  1RMD A;  2EPR A;  2E72 A;  2RSM A;  3OTO I;  4R2Q A;  2L6M A;  5IT9 Q;  2EN3 A;  2MC6 A;  1N32 E;  4LF7 E;  4FW9 A;  2JYA A;  1XMO E;  4DR4 E;  4P7D A;  1MG7 A;  4JV5 I;  1NHJ A;  2EM5 A;  2JP9 A;  4DR1 E;  1R6L A;  2NN6 C;  5A2Q C;  1U2R A;  4P52 A;  4JI8 I;  1A1J A;  1O0W A;  2CVE A;  4USK A;  1WRJ A;  4R1F A;  1UDO A;  2BA1 D;  2Z5B A;  2EQ0 A;  2PNZ B;  4LF5 I;  4WXD A;  3L7Z A;  2AE8 A;  3J7A G;  4F6N A;  4IZK A;  3LNU A;  1X6F A;  1IBM I;  2BB8 A;  3BF2 A;  1N33 I;  5T6J A;  4GQU A;  2JVA A;  2ADR A;  4X65 I;  1DGC A;  2UU9 E;  4OO1 E;  2NUG A;  2L33 A;  4OO1 A;  2HK3 A;  2YTJ A;  3F6G A;  2O1T A;  2UXB E;  3M99 B;  2I9I A;  4BBY A;  1EKZ A;  2J7K A;  4DR6 I;  3Q6N A;  2VE7 C;  4F2J C;  1YFH A;  5JEA E;  5JEA A;  3L00 A;  2WW4 A;  3EPH A;  4LF8 E;  1FWL A;  2WBS A;  2EL5 A;  1NCS A;  3C6K A;  4WUD A;  4DR5 I;  3LML A;  1X49 A;  3MHH C;  4O43 A;  4FK5 C;  4BC9 A;  1QNT A;  2PNL A;  2GQ0 A;  3K85 A;  3KRN A;  3QT7 A;  2EP3 A;  2EOX A;  4P7A A;  2R76 A;  3JAM Q;  4DV2 I;  1IBL I;  2E5L I;  1XMQ I;  1SR9 A;  2NN6 D;  1HNW E;  4ISA A;  2EMK A;  2EM6 A;  2L2N A;  2EM9 A;  5KL5 A;  4M2Z A;  4B3R E;  3PS2 A;  2OI2 A;  4FWG A;  1E3P A;  3PYD A;  4GKK I;  4X8W A;  2WNR B;  5DRQ A;  4JI1 E;  2UUC I;  1T39 A;  1RHY A;  1IMU A;  4MYU A;  4BMJ A;  2EE8 A;  4TUG A;  1IBK I;  2X7I A;  2VQF E;  5K36 C;  2GO4 A;  2HFU A;  4IS9 A;  4DV5 E;  5A69 A;  4LU9 A;  4MLV A;  2BM0 A;  2FV4 B;  2CSH A;  2WZO A;  1N34 E;  1UBD C;  1YYW A;  2V85 A;  5LMU I;  3NZK A;  1WUU A;  2Z5E A;  3ECR A;  4X64 I;  1UEK A;  2O1U A;  2JOB A;  2LRS A;  5EKW A;  3ADL A;  3BID A;  1X5W A;  2WP8 A;  1X6E A;  1KVK A;  2JEB B;  2VQE I;  4DV0 I;  4NXN I;  4B3M I;  2H36 X;  3Q1Q A;  5DNL A;  5DRO A;  4J8Z A;  4MU1 A;  2V89 A;  2WCC 3;  2IOP A;  4YY3 I;  1FJG I;  3P76 A;  2V88 A;  1MGT A;  4LCH A;  1EH8 A;  2LTS A;  2NN6 B;  4KHP I;  1N0V C;  1Z0E A;  2EMC A;  2FTX B;  3B78 A;  1LLM C;  2NAB A;  3J7Y p;  3T1H I;  5GMD A;  3OTO E;  2XEX A;  4JI6 I;  5CFF E;  2DEI A;  5A6B D;  2RSI A;  1UHZ A;  4JV5 E;  1MU5 A;  4MYT A;  1N36 I;  4DV4 I;  3WU5 A;  5K36 D;  5ADZ A;  2LV2 A;  4DMI A;  2C37 A;  2RPC A;  5DRP A;  4LFC I;  1TN9 A;  4OOG C;  4LF4 I;  1H72 C;  2EMW A;  4ZYG A;  2A25 A;  5C0X F;  2YZT A;  1PIE A;  2R3V A;  5JEA C;  5IWA I;  3C4B A;  2UXC E;  4ZYH A;  2BV3 A;  2PO0 A;  1GZ6 A;  1J5E I;  2UUA I;  3GON A;  4LTY A;  2LCE A;  2GO3 A;  2L2K B;  1IBM E;  3PYG A;  1AH5 A;  2NPF A;  2CZ9 A;  2HK2 A;  1OYS A;  3GLL A;  1FI4 A;  1DI2 A;  2C38 B;  3PYF A;  2DSY A;  4DUY I;  1USU A;  4WSP A;  2V8Q B;  3JAM C;  5F3W A;  3RMP A;  1EI1 A;  3T1Y E;  4J3D A;  3ZZ0 A;  1BB8 A;  3J81 Q;  4BHB A;  1I94 E;  4DR6 E;  2PO2 A;  4P78 A;  5LMN I;  2DB2 A;  2EM0 A;  4FW3 A;  2HHH I;  3UK3 C;  1GQE A;  3VYX A;  2Q2E B;  2EQ3 A;  2EQ1 A;  4WXC A;  4IFD C;  4JI2 E;  2EOF A;  2YTE A;  2EPX A;  2JE6 B;  2VRD A;  1EA6 A;  2B3T B;  1MX0 A;  4O4K A;  4DV6 I;  5K36 B;  2DEJ A;  3HQ1 A;  1B62 A;  2ENH A;  1ZM2 A;  5DNX A;  4AIM A;  5FWK A;  4ZYD A;  3GME A;  4O5G A;  2EM2 A;  5A6K A;  1E3H A;  1G2D C;  5C0X B;  4NXM I;  4N4R B;  2V34 A;  4DR2 E;  5DRR A;  4LF6 I;  2F4V I;  1XNQ I;  3AV0 A;  5A6J A;  2EOS A;  4M1K A;  1YPN A;  4JI7 E;  4IZJ A;  4JI3 I;  2L2M A;  3ADJ A;  2LVH A;  1KKH A;  3CWV A;  2BR2 A;  2RS6 A;  2MDG A;  2HKJ A;  4ED4 A;  2Z5C A;  4OZE A;  3KZY A;  2ODR C;  5LMU E;  2EMB A;  1F2I G;  2G7H A;  1BKN A;  3JU0 A;  2F8B A;  2L3C A;  4K0K E;  5AE2 A;  4X64 E;  3M7N D;  4U3B A;  4BA2 B;  3ZZT A;  2YTN A;  3L7Z B;  2B9D A;  2C39 B;  2UUB I;  4IZK B;  1PJT A;  2V86 A;  4FW5 A;  4DPU A;  3LTO A;  1QU6 A;  3QT5 A;  1HNZ I;  4LFA E;  2YPN A;  4FN5 A;  3M85 G;  2X36 A;  2YRM A;  1MEY C;  4IFD D;  4YY3 E;  1FJG E;  2L3J A;  4QNK A;  1HR0 I;  1Z0T A;  1K47 A;  2BA0 D;  3ZKD A;  4DV7 I;  4FWD A;  2MKD A;  2ZM6 I;  2PNZ A;  4Z7Y A;  4Q28 A;  2E1M A;  4GKJ E;  2EM7 A;  1XNR I;  2EOQ A;  2EL4 A;  4AID A;  4DV1 I;  3HPZ A;  1YYO A;  2EJ4 A;  2IER A;  2YRH A;  4YHH I;  1A6F A;  1KTV A;  2NN6 F;  4MDT A;  3DF6 A;  1ZM3 A;  5DNY A;  1J26 A;  4WUB A;  5AC4 A;  4DR3 I;  1ZBT A;  2MKN A;  2EOJ A;  4LF4 E;  1EH6 A;  2GS8 A;  2EOI A;  4JI5 E;  1YYK A;  2LJU A;  1WXR A;  4M9V C;  2ENA A;  2YU5 A;  3J81 C;  4Z7C A;  2ODR D;  2BA1 G;  4BC7 A;  4F9C B;  5KL2 A;  2JWO A;  5AAS A;  1J5E E;  2UUA E;  2CTD A;  1OYR A;  2HFS A;  4LF9 E;  1X48 A;  2YTP A;  4LFB E;  4AQY I;  4LOM A;  4BA1 A;  4DU7 A;  3ADG A;  2IOQ A;  4DPX A;  4IFD B;  4DUY E;  2V2Z A;  2EOE A;  2KOU A;  2M1S A;  5BR8 E;  4NBQ A;  2FGG A;  1ZM4 A;  2WNR A;  2BA0 G;  2N8X A;  1BBG A;  4DV3 I;  3PS3 A;  2EOY A;  3H09 A;  2K7I A;  4DPY A;  3J7A M;  4FW6 A;  4LF7 I;  2NUF A;  1N32 I;  5IT9 C;  1PVG A;  5AE3 A;  3WU4 A;  2L8T A;  4KWY A;  3EPL A;  4DR7 I;  1FNM A;  4OX9 E;  2F1D A;  2RS7 A;  4R2R A;  4DR1 I;  2V83 A;  4ZVI A;  2LO3 A;  4R2S A;  2EN6 A;  4HYM A;  2D9H A;  3IWD A;  3K1J A;  4R2D A;  1ZBQ A;  3P06 A;  2JEA B;  2LUQ A;  3MHS C;  3OML A;  1H7U A;  1XXE A;  4DKK A;  4L5N C;  2V2V A;  2LUP B;  3U1K A;  5A6A A;  2KON A;  4LF6 E;  3THN A;  2JEB A;  1HNX I;  4OO1 C;  2HGH A;  5K36 F;  2V8P A;  4JI8 E;  2EMG A;  2NN6 E;  3WU6 A;  2NN6 A;  1Z5B A;  2EMX A;  2C37 B;  4IJD A;  2CGE A;  1VI7 A;  4I8O A;  4LF5 E;  1TF6 A;  2VF3 A;  4M30 A;  4PRV A;  3ZZU A;  5KL6 A;  3EQ1 A;  1A1G A;  4WFT A;  4F9A B;  3P3E A;  2UXD I;  4LF8 I;  2HC5 A;  2ZBK B;  1N33 E;  4FWH A;  2M7Q A;  2EN7 A;  2UUB E;  4HAC A;  4X65 E;  4B3S I;  4HTG A;  4X66 I;  4B3T I;  4AM3 A;  1T4O A;  2B7V A;  2EMA A;  1Z0G A;  2J7J A;  3VHT B;  2EMI A;  5LL6 R;  1PDA A;  4IZJ D;  1Y4S A;  2DMI A;  3KZZ A;  3HXL A;  1B63 A;  1HNW I;  4DV7 E;  4B3R I;  3DJW A;  3QT6 A;  2ZM6 E;  1YUI A;  2JR1 A;  4PRX A;  4KZS A;  3HKM A;  2PO2 B;  3ADI A;  2PO1 B;  4DR5 E;  3CDJ A;  3TQM A;  3VK6 A;  1NEI A;  5KL7 A;  1NHH A;  3IWC A;  3HJC A;  3THO B;  3D4J A;  5FLX Q;  2VQF I;  4R2E A;  4DV2 E;  2C38 A;  4OO1 D;  3EPK A;  1IBL E;  2EOO A;  2EPK X;  4R2C A;  2E5L E;  1XMQ E;  2EPA A;  1JK2 A;  2O1W A;  1N34 I;  2IES A;  4DR3 E;  1A1L A;  4X62 I;  3IWB A;  2PRT A;  1Z1B A;  4ZYE A;  4WSG A;  2LJP A;  1VIS A;  4GKK E;  1OYP A;  3LPS A;  3Q6M A;  4PU9 A;  5JEA D;  2BBG A;  2EPM X;  2YT4 A;  2YU8 A;  2UUC E;  1ZU1 A;  1P47 A;  2EL6 A;  1NHI A;  1XHK A;  1IBK E;  2YWQ A;  1UDN A;  1A1K A;  4WUC A;  3V2U C;  4OKG A;  2HKE A;  3UHM A;  3PRY A;  2JE6 A;  4I3H A;  5K36 E;  2GHF A;  5K36 A;  1STU A;  1WHN A;  1ZAA C;  4IZJ B;  2HJJ A;  3QG5 C;  4HY1 A;  3HUL A;  1H7S A;  1A1H A;  2NA2 A;  3JTZ A;  2EOZ A;  2Z5B B;  5C0X E;  5KL3 A;  5C0X A;  1WJP A;  4DV5 I;  4QNJ A;  5L3J A;  3P1X A;  2VQE E;  4DV3 E;  2CG9 A;  4DV0 E;  4B3M E;  4NXN E;  5ELW A;  1AAY A;  4IFD F;  4MLQ A;  2EMH A;  2JY9 A;  1T4N A;  4DR7 E;  1ELO A;  2EPC A;  4OO1 B;  2LE2 A;  2JXP A;  4JI4 I;  4JI0 I;  2ZIT A;  2M4I A;  3AUZ A;  1TF3 A;  4KQV A;  2EM8 A;  2CT1 A;  1B69 A;  1DQ3 A;  4KHP E;  4MU4 A;  4EMD A;  4BS9 A;  3T1H E;  4URL A;  2YTD A;  3H1C A;  4BA2 A;  4JYA I;  4DXL A;  5JEA B;  1N3G A;  2UXC I;  1ZXN A;  2EWL A;  2C39 A;  4JI6 E;  4FW4 A;  2YTO A;  4BCA A;  4RHB B;  4RH8 A;  4IS1 C;  1HNX E;  1FKA E;  1Z0W A;  4UT4 A;  1WHQ A;  2EFG A;  4R8O A;  2IHR 1;  1RRE A;  1N36 E;  3P3C A;  1NZ0 A;  4DV4 E;  2RQL A;  2GLI A;  1D6T A;  2AJ4 A;  2EPN A;  2MC5 A;  4LFC E;  4DUZ I;  1OJ4 A;  4NZV A;  2PNM A;  4XTJ A;  1GTK A;  1UIL A;  2EMY A;  2EPU A;  3F6H A;  4N3O A;  1S4E A;  4DU8 A;  3T1Y I;  5IWA E;  3EPJ A;  4GZN C;  1I94 I;  4R2A A;  2EML A;  2DRP A;  3CDI A;  4M0V A;  1Y5Y A;  4R03 A;  2UXD E;  4Q35 B;  1N0U A;  3B8H A;  1YH8 A;  1PJQ A;  3BBG A;  1UDQ A;  1YSA C;  1G2F C;  1KJK A;  3PS1 A;  1RC7 A;  3ZM7 A;  3M7N G;  2EOR A;  1HK7 A;  4B3S E;  4B3T E;  1SFE A;  2DLQ A;  1Y4U A;  4X66 E;  1H74 A;  5EL9 A;  2EN1 A;  4U3D A;  2RTX A;  3K6Q A;  3J80 Q;  4JI2 I;  2JT2 A;  3C4T A;  5FLX C;  4BA1 B;  2N3G A;  2V87 A;  5TSE A;  1Z59 A;  3P3G A;  1UDS A;  2L92 A;  3WU3 A;  5LMN E;  3C6M A;  3PYE A;  1RQ0 A;  4WYQ B;  3VYY A;  2HHH E;  4DR2 I;  2EOH A;  1IQS A;  2MDR A;  1XMO I;  2B7T A;  4DR4 I;  2WP8 B;  2EM3 A;  4TUI A;  2EN8 A;  4BHC A;  2DGC A;  1H73 A;  1YHC A;  3BGH A;  5IXM B;  2KHX A;  4IFD E;  4JI7 I;  3GCM A;  4WPY A;  1EH7 A;  2DLK A;  4DV6 E;  2YTG A;  4IFD A;  1Z0B A;  4HXZ A;  1Z5C A;  4MQY A;  4X62 E;  5C0X C;  4RPF A;  1X6H A;  1USV A;  1ZXM A;  4NXM E;  2VES A;  1Z0C A;  4K0K I;  2EMZ A;  1ZR9 A;  2F4V E;  2YRK A;  3HPS A;  1T4L B;  1JK1 A;  1L4S A;  3M6A A;  4X9J A;  1XNQ E;  4O24 A;  1PKP A;  3HTX A;  1YUJ A;  2BM1 A;  3ZKB A;  5A2Q Q;  2UU9 I;  2M9A A;  2VF1 A;  2YSO A;  1P42 A;  2EZ6 A;  1A1F A;  4LFA I;  5IV8 B;  1Y6Z A;  2UXB I;  1BBO A;  1X3C A;  4JI3 E;  1KYQ A;  1FWK A;  2JEA A;  2LTR A;  4LPF A;  2JPA A;  2ELY A;  5AE1 A;  2V2Q A;  2R42 A;  2YTQ A;  4GKJ I;  2I13 A;  2ELZ A;  2PO0 B;  3MSW A;  2O3Z A;  2EOM A;  3LLH A;  1YZ9 A;  1Z0V A;  2WBU A;  1HNZ E;  1KIJ A;  4HAC B;  2EN4 A;  2YTI A;  4GEQ B;  2CPN A;  1HR0 E;  4JI4 E;  4JI0 E;  3V5R A;  4F6M A;  3B4T A;  3DD6 A;  4HEI A;  1A1I A;  2ENC A;  2A2D A;  3F0N A;  4JI5 I;  4F54 A;  2R1F A;  1S16 A;  1DAR A;  4JYA E;  4JI1 I;  2WBT A;  1ZM9 A;  4USM A;  3QT8 A;  2EM4 A;  2E1R A;  2LT7 A;  1XNR E;  2A2C A;  5C0X D;  4FW7 A;  5GME A;  2Q8U A;  2DMY A;  4MU3 A;  4DV1 E;  4OO1 F;  5AC5 A;  1R6M A;  2EN2 A;  2YTF A;  4L8N A;  4LF9 I;  4YHH E; 
#chains in the Genus database with same CATH homology
 4LFB I;  2LJH A;  3B82 A;  2DIX A;  2LBS B;  4DPT A;  4DPW A;  2K4V A;  3J80 C;  4DUZ E;  1QZR A;  2JOX A;  5BR8 I;  4JG4 A;  4F9B B;  2LMZ A;  3K17 A;  2N3H A;  3KWR A;  2NUE A;  3H4L A;  1Z5A A;  1RR9 A;  4AQY E;  1X47 A;  4OX9 I;  2O1V A;  3FIG A;  2Z5C B;  4UTG A;  3ZOQ B;  2RSM A;  3OTO I;  2L6M A;  5IT9 Q;  2MC6 A;  1N32 E;  4LF7 E;  4FW9 A;  1XMO E;  4DR4 E;  4P7D A;  1MG7 A;  4JV5 I;  1NHJ A;  4DR1 E;  5A2Q C;  1U2R A;  4P52 A;  4JI8 I;  1O0W A;  4USK A;  4R1F A;  2Z5B A;  4LF5 I;  3J7A G;  4IZK A;  3LNU A;  1IBM I;  1N33 I;  5T6J A;  2JVA A;  4X65 I;  2UU9 E;  2NUG A;  2L33 A;  2HK3 A;  3F6G A;  2O1T A;  2UXB E;  1EKZ A;  4BBY A;  2J7K A;  4DR6 I;  3Q6N A;  2VE7 C;  2WW4 A;  4LF8 E;  1FWL A;  4DR5 I;  4WUD A;  3LML A;  1X49 A;  3QT7 A;  4BC9 A;  3K85 A;  2PNL A;  2GQ0 A;  3JAM Q;  4DV2 I;  4P7A A;  1IBL I;  2E5L I;  1XMQ I;  1SR9 A;  1HNW E;  4B3R E;  2L2N A;  4M2Z A;  2OI2 A;  4FWG A;  3PYD A;  4GKK I;  4X8W A;  4JI1 E;  2UUC I;  4MYU A;  4BMJ A;  4TUG A;  1IBK I;  2X7I A;  2VQF E;  2HFU A;  4DV5 E;  4LU9 A;  2BM0 A;  2FV4 B;  2WZO A;  1N34 E;  1YYW A;  2V85 A;  5LMU I;  1WUU A;  2Z5E A;  4X64 I;  1UEK A;  2O1U A;  2JOB A;  2LRS A;  3ADL A;  1KVK A;  2VQE I;  4DV0 I;  4NXN I;  4B3M I;  2H36 X;  3Q1Q A;  4J8Z A;  2V89 A;  2IOP A;  4YY3 I;  1FJG I;  2V88 A;  2LTS A;  4KHP I;  1N0V C;  1Z0E A;  2FTX B;  3B78 A;  3J7Y p;  3T1H I;  3OTO E;  2XEX A;  4JI6 I;  5CFF E;  2DEI A;  1UHZ A;  4JV5 E;  1MU5 A;  4MYT A;  1N36 I;  4DV4 I;  3WU5 A;  5ADZ A;  4DMI A;  4LF4 I;  4LFC I;  4OOG C;  1H72 C;  2YZT A;  1PIE A;  2R3V A;  5IWA I;  3C4B A;  2UXC E;  2BV3 A;  1GZ6 A;  1J5E I;  2UUA I;  3GON A;  4LTY A;  2L2K B;  1IBM E;  3PYG A;  2NPF A;  2CZ9 A;  2HK2 A;  1FI4 A;  1DI2 A;  3PYF A;  2DSY A;  4DUY I;  1USU A;  4WSP A;  2V8Q B;  3JAM C;  5F3W A;  3RMP A;  1EI1 A;  3T1Y E;  3ZZ0 A;  3J81 Q;  1I94 E;  4DR6 E;  4P78 A;  5LMN I;  2DB2 A;  2HHH I;  2Q2E B;  1GQE A;  3VYX A;  4JI2 E;  1EA6 A;  2B3T B;  1MX0 A;  4DV6 I;  2DEJ A;  3HQ1 A;  1B62 A;  5FWK A;  1ZM2 A;  4NXM I;  2V34 A;  4DR2 E;  4LF6 I;  2F4V I;  1XNQ I;  3AV0 A;  4M1K A;  4JI7 E;  4IZJ A;  4JI3 I;  2L2M A;  3ADJ A;  1KKH A;  3CWV A;  2RS6 A;  2HKJ A;  4ED4 A;  2Z5C A;  2ODR C;  5LMU E;  2G7H A;  1BKN A;  3JU0 A;  2F8B A;  2L3C A;  4K0K E;  5AE2 A;  4X64 E;  3ZZT A;  2B9D A;  2UUB I;  4IZK B;  2V86 A;  4DPU A;  3LTO A;  1QU6 A;  3QT5 A;  1HNZ I;  4LFA E;  4FN5 A;  2X36 A;  4YY3 E;  1FJG E;  2L3J A;  1HR0 I;  1Z0T A;  1K47 A;  3ZKD A;  4DV7 I;  4FWD A;  2ZM6 I;  4Z7Y A;  4Q28 A;  2E1M A;  4GKJ E;  1XNR I;  4DV1 I;  3HPZ A;  1YYO A;  4YHH I;  1A6F A;  1KTV A;  3DF6 A;  1ZM3 A;  5DNY A;  1J26 A;  4WUB A;  4DR3 I;  1ZBT A;  4LF4 E;  2GS8 A;  4JI5 E;  1YYK A;  1WXR A;  3J81 C;  4Z7C A;  2ODR D;  4BC7 A;  4F9C B;  2JWO A;  5AAS A;  1J5E E;  2UUA E;  2HFS A;  4LF9 E;  1X48 A;  4LFB E;  4AQY I;  4DU7 A;  3ADG A;  2IOQ A;  4DPX A;  4DUY E;  2V2Z A;  2KOU A;  2M1S A;  5BR8 E;  2FGG A;  1ZM4 A;  4DV3 I;  3H09 A;  4DPY A;  3J7A M;  1N32 I;  4LF7 I;  2NUF A;  5IT9 C;  1PVG A;  5AE3 A;  3WU4 A;  2L8T A;  4DR7 I;  1FNM A;  4OX9 E;  2RS7 A;  4DR1 I;  2V83 A;  4ZVI A;  4HYM A;  3IWD A;  3K1J A;  1ZBQ A;  3P06 A;  2LUQ A;  3OML A;  1H7U A;  4DKK A;  4L5N C;  2V2V A;  2LUP B;  2KON A;  4LF6 E;  1HNX I;  2V8P A;  4JI8 E;  3WU6 A;  1Z5B A;  2CGE A;  4I8O A;  4LF5 E;  2VF3 A;  4PRV A;  4M30 A;  3ZZU A;  4WFT A;  4F9A B;  2UXD I;  4LF8 I;  2ZBK B;  1N33 E;  4FWH A;  2M7Q A;  2UUB E;  4HAC A;  4B3S I;  4X65 E;  4B3T I;  4X66 I;  1T4O A;  2B7V A;  1Z0G A;  5LL6 R;  4IZJ D;  1Y4S A;  3HXL A;  1B63 A;  1HNW I;  4DV7 E;  4B3R I;  3DJW A;  3QT6 A;  2ZM6 E;  2JR1 A;  4PRX A;  4KZS A;  3ADI A;  4DR5 E;  3VK6 A;  1NHH A;  3IWC A;  3HJC A;  3D4J A;  5FLX Q;  2VQF I;  4DV2 E;  1IBL E;  2E5L E;  1XMQ E;  2O1W A;  1N34 I;  4DR3 E;  4X62 I;  3IWB A;  3Q6M A;  2LJP A;  3LPS A;  1VIS A;  4GKK E;  4PU9 A;  2YT4 A;  2UUC E;  1NHI A;  1XHK A;  1IBK E;  4WUC A;  3V2U C;  2HKE A;  3PRY A;  4I3H A;  1STU A;  1WHN A;  4IZJ B;  4HY1 A;  3HUL A;  1H7S A;  2NA2 A;  3JTZ A;  2Z5B B;  4DV5 I;  5L3J A;  3P1X A;  2VQE E;  4DV3 E;  2CG9 A;  4DV0 E;  4B3M E;  4NXN E;  2JY9 A;  1T4N A;  4DR7 E;  1ELO A;  2LE2 A;  4JI4 I;  4JI0 I;  2ZIT A;  2M4I A;  3AUZ A;  4KQV A;  1DQ3 A;  4KHP E;  4EMD A;  4BS9 A;  3T1H E;  4URL A;  4JYA I;  4DXL A;  2UXC I;  1ZXN A;  2EWL A;  4JI6 E;  4BCA A;  1HNX E;  1FKA E;  1Z0W A;  4UT4 A;  1WHQ A;  2EFG A;  4R8O A;  2IHR 1;  1RRE A;  1N36 E;  1NZ0 A;  4DV4 E;  1D6T A;  2AJ4 A;  2MC5 A;  4LFC E;  4DUZ I;  1OJ4 A;  4XTJ A;  2PNM A;  1UIL A;  3F6H A;  4N3O A;  4DU8 A;  1S4E A;  3T1Y I;  5IWA E;  1I94 I;  4M0V A;  5GMD A;  4R03 A;  2UXD E;  1N0U A;  3B8H A;  1RC7 A;  3ZM7 A;  1HK7 A;  4B3S E;  4B3T E;  1Y4U A;  4X66 E;  1H74 A;  3J80 Q;  4JI2 I;  2RTX A;  3K6Q A;  3C4T A;  5FLX C;  2N3G A;  2V87 A;  1Z59 A;  2L92 A;  3WU3 A;  5LMN E;  3PYE A;  1RQ0 A;  4WYQ B;  3VYY A;  2HHH E;  4DR2 I;  2MDR A;  1XMO I;  2B7T A;  4DR4 I;  4TUI A;  1H73 A;  2KHX A;  4JI7 I;  4WPY A;  4DV6 E;  1Z0B A;  4HXZ A;  1Z5C A;  4X62 E;  4RPF A;  1USV A;  1ZXM A;  4NXM E;  1Z0C A;  4K0K I;  2F4V E;  3HPS A;  1T4L B;  3M6A A;  3HTX A;  1XNQ E;  1PKP A;  2BM1 A;  3ZKB A;  5A2Q Q;  2UU9 I;  2VF1 A;  2EZ6 A;  4LFA I;  1Y6Z A;  2UXB I;  4JI3 E;  1FWK A;  2LTR A;  2V2Q A;  5AE1 A;  2R42 A;  4GKJ I;  3MSW A;  3LLH A;  1YZ9 A;  1Z0V A;  1HNZ E;  1KIJ A;  4HAC B;  4GEQ B;  2CPN A;  1HR0 E;  4JI4 E;  4JI0 E;  3V5R A;  2A2D A;  3F0N A;  4JI5 I;  4F54 A;  1S16 A;  1DAR A;  4JYA E;  4JI1 I;  4USM A;  1ZM9 A;  3QT8 A;  2E1R A;  1XNR E;  2A2C A;  5GME A;  2DMY A;  4DV1 E;  4L8N A;  4LF9 I;  4YHH E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...