3JAMC

Cryoem structure of 40s-eif1a-eif1 complex from yeast
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
217
structure length
217
Chain Sequence
GWVPVTKLGRLVKAGKISSIEEIFLHSLPVKEFQIIDQLLPNLKDEVMNIKPVQKQTRAGQRTRFKAVVVVGDSNGHVGLGIKTAKEVAGAIRAGIIIAKLSVIPIRRGYWGTNLGQPHSLATKTSGKCGSVSVRLIPAPRGSGIVASPAVKKLMQLAGVEDVYTSSTGSTRTLENTLKAAFVAIGNTYGFLTPNLWEVQALTPSPMDVYADYATAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational Differences between Open and Closed States of the Eukaryotic Translation Initiation Complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Translation
molecule keywords 18S rRNA
total genus 43
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
C PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.770 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3jamC01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 3jamC02
1MG7A 4WUDA 4AQYE 2E5LE 1UEKA 1A6FA 4WUBA 2UUBI 3T1YI 2A2DA 4X65I 4JI0I 3OTOE 4HXZA 4UTGA 1IBLI 4X64E 4Z7CA 4LF6E 4DUZE 1HR0E 4DV7I 2UXBE 1BKNA 2VQEI 1FI4A 1FNMA 4JI4E 5BR8E 5IT9Q 2V2ZA 4NXNE 3HULA 4LF8I 4DR4E 2UXDI 4EMDA 1HNXE 1XMQE 1XMOI 3JAMC 1IBKI 1KVKA 4NXMI 4DV1I 3QT7A 4B3TE 5LL6R 1N32I 5L3JA 1KKHA 2GS8A 1Z59A 4JI7I 2HKJA 1IBMI 4R1FA 4P52A 4DV6E 1HNZI 4M1KA 1MX0A 2HK3A 4LF5I 4DR6I 4K0KE 3ZZUA 1H72C 4B3ME 4JI3E 3WU5A 4LF9I 2VF3A 3WU4A 4FWHA 4X62E 1N34I 2A2CA 4LFAI 2R3VA 1MU5A 4PRXA 4GKJI 1ZM2A 4DPUA 2CZ9A 1FWLA 1U2RA 1I94I 2X7IA 4B3TI 4DR3E 2UU9I 1QZRA 4USKA 1OJ4A 4LFBE 3WU6A 4NXME 1IBKE 1Z0WA 5GMEA 1XMOE 1XNRE 3JAMQ 1XNRI 1NHHA 4DU7A 3T1HE 3ZKBA 1N0VC 4OX9I 4FW9A 4NXNI 2ZITA 4DV2E 3B8HA 4FWDA 1XHKA 1NHIA 2VQEE 4GKKE 3D4JA 4DPYA 4DV0E 1ZM4A 2DEIA 1Z0TA 5A2QQ 1EA6A 3J80Q 4DV5E 3LTOA 5A2QC 4DUYI 2UUBE 4AQYI 1ZM9A 1S16A 3ZM7A 4DR1E 1H7SA 2HFUA 1ZM3A 4ZVIA 1N34E 4X62I 2AJ4A 5LMNE 1Z5AA 2HHHE 2ZM6E 2F4VI 5IWAE 1PVGA 3CWVA 2HFSA 3V2UC 2HK2A 4LF5E 4JI7E 4KQVA 4JI8I 2VQFI 4LF4I 3K17A 3M6AA 4LFCE 2BV3A 4X66E 3ZZ0A 4DXLA 2NPFA 1FWKA 4DR5E 1FKAE 4UT4A 2V34A 4DR5I 1Z0BA 3V5RA 3WU3A 1HNWI 1XMQI 1HNXI 2UXDE 1B62A 4LF8E 3QT6A 3Q1QA 1KTVA 4B3RI 4YY3E 3B78A 4JG4A 1J5EE 5LMUI 4FWGA 4LF6I 3LNUA 2OI2A 4RPFA 1IBLE 3T1YE 2E1RA 1Z5CA 2E5LI 2UUCE 4JI5E 1DARA 4DUYE 4JI6E 1PKPA 4DR7E 4WUCA 4DV5I 1B63A 4P7AA 1VISA 4Z7YA 5LMUE 1NZ0A 4HACB 2BM0A 4YY3I 4B3RE 4PU9A 1D6TA 1Z0VA 3T1HI 2BM1A 1Z0GA 1N33E 5FLXQ 4JV5I 2UUAE 4MYTA 1FJGI 4JI1E 2UXCE 2V2QA 4JI2E 2LJPA 1Z5BA 3QT8A 4I3HA 4DR2E 4LF7I 1Z0EA 3H4LA 3F0NA 4FN5A 4JI8E 2EFGA 3PYFA 1NHJA 2R42A 4LFAE 3QT5A 4B3SE 1S4EA 1EI1A 4PRVA 2HHHI 2V2VA 4B3SI 1N0UA 1RR9A 4KHPE 3J7AG 5GMDA 4JI3I 4HACA 4K0KI 4DR6E 4DR1I 3ZZTA 4USMA 1ELOA 1N32E 4LF7E 4DV4I 1Z0CA 3J81Q 4YHHE 4HY1A 4DV0I 4ED4A 4GKKI 4JI2I 2Q2EB 4JI1I 2UXCI 1FJGE 4DV2I 4URLA 4OX9E 4DV3I 2WW4A 1ZXMA 4DR4I 4DV3E 3B82A 4LFBI 5FLXC 2UU9E 4DR3I 3PYGA 4DUZI 1I94E 4YHHI 4X64I 4DV4E 3OTOI 4JI0E 4X65E 1ZXNA 4JI6I 2UUCI 2ZBKB 1H73A 4GKJE 1N36E 2J7KA 4KHPI 5IT9C 3GONA 3PYDA 4HYMA 1H7UA 1J5EI 4LF9E 1KIJA 2HKEA 4B3MI 1XNQE 4DV6I 1HNZE 1IBME 1HNWE 4DR2I 4JYAI 1K47A 4MYUA 1RREA 2DEJA 4DPTA 4JYAE 4DV1E 2X36A 4X66I 3LPSA 3J80C 4LFCI 4DPWA 4LF4E 2VQFE 3J81C 4XTJA 3J7AM 2UUAI 1H74A 4JV5E 1N33I 4DPXA 2V8PA 1XNQI 5BR8I 1PIEA 4JI4I 5IWAI 4DU8A 2F4VE 2ZM6I 4DV7E 1HR0I 2UXBI 1WUUA 3ZKDA 5LMNI 4DR7I 2XEXA 3PYEA 1N36I 4JI5I 3K1JA
chains in the Genus database with same CATH superfamily
4IZJB 1RQ0A 5AC5A 2L33A 1EH6A 2EPZA 4F2JC 2RQLA 2V89A 1MG7A 4WUDA 5DNXA 2O3ZA 1B69A 4AIMA 4AQYE 2E5LE 1UEKA 1A6FA 4WUBA 2UUBI 3T1YI 4GQUA 2F8BA 2A2DA 4MU3A 4R2QA 2CVEA 1YPNA 3OTOE 1J26A 3Q6NA 4HXZA 4UTGA 4JI0I 2EQ3A 5FWKA 1IBLI 4BA2A 4O5GA 2NA2A 3JU0A 4X64E 2EN1A 4LF6E 1PDAA 3C6MA 4Z7CA 4DUZE 5JEAE 1HR0E 2UXBE 2NABA 2EM7A 4DV7I 1BKNA 3BIDA 5DROA 4F9AB 2VQEI 1FI4A 2LTSA 1FNMA 5DRQA 2EPKX 4JI4E 5BR8E 2C39A 5IT9Q 1UILA 2V2ZA 2AE8A 4NXNE 1STUA 5DNYA 3HULA 1SR9A 4NZVA 1ZBQA 1QNTA 5ADZA 4LF8I 2ENHA 4DR4E 2UXDI 3M85G 4O4KA 4EMDA 2R1FA 1HNXE 1XMQE 2NN6B 4LCHA 1XMOI 4IZKB 1UHZA 2L92A 2LE2A 1T4OA 3JAMC 4L8NA 4WXDA 4BHBA 3Q6MA 1IBKI 1KVKA 2BBGA 4NXMI 2BB8A 2MDGA 4DV1I 3QT7A 3M85D 4B3TE 5LL6R 5AE1A 4R2RA 1A1LA 1N32I 2EORA 5L3JA 2EN7A 1HK7A 1KKHA 2GS8A 1USUA 1Z59A 1YYOA 3F6HA 4JI7I 2HKJA 1IBMI 4R1FA 4P52A 4DV6E 3NZKA 1IMUA 2EMHA 1MX0A 4M1KA 3P3GA 1ZAAC 4OO1A 1HNZI 2HK3A 4LF5I 1XXEA 2J65A 1AAYA 2PO2A 2DMYA 4MLQA 4ZYHA 3EQ1A 2C38A 4K0KE 4FW6A 4DR6I 3ZZUA 4B3ME 1H72C 2MKDA 4JI3E 2Q8UA 4IS9A 1R6LA 3WU5A 4LF9I 4MDTA 2VF3A 2Z5CB 3WU4A 3C4BA 4MU1A 3UHMA 5JEAF 4WSGA 3HJCA 3QG5C 4FWHA 2ENAA 3OMLA 4DKKA 2O1VA 4X62E 2LUQA 4R2CA 4N3OA 4BA1B 1N34I 2O1TA 1YYKA 2A2CA 3K1JA 4LFAI 2R3VA 2L2KB 2YWQA 1MU5A 2PNLA 4PRXA 1YSAC 5K36F 4AM3A 4GKJI 4N4RB 2YZTA 3JTZA 2M7QA 1ZM2A 2WNRA 4R03A 1WHNA 2YRKA 2KONA 2LT7A 2C38B 4DPUA 5K36E 1GTKA 2MDRA 1X47A 2YTFA 2YPNA 5KL4A 4IZJD 2JT2A 1UBDC 1FWLA 2CZ9A 5C0XD 5C0XC 4BC9A 3M7ND 2EM4A 3DJWA 1A1JA 4J8ZA 1U2RA 3HPSA 1ZBTA 2BA0D 4RH8A 1I94I 2X7IA 4B3TI 2LBSB 4DR3E 5F3WA 2UU9I 4X9JA 1QZRA 2C37B 4USKA 4R8OA 5K36B 3FIGA 1MGTA 2JOXA 1WXRA 4LFBE 1OJ4A 3M7NG 3WU6A 4NXME 2JEAB 1X49A 1IBKE 1Z0WA 2RS7A 3L00A 2EMFA 2CTDA 5DRPA 5EL9A 5GMEA 4ZYEA 2ADRA 4OO1E 4MU0A 2CT1A 1XMOE 1YH8A 1XNRE 4KWYA 2GHFA 3JAMQ 2DGCA 1XNRI 1NHHA 4DU7A 2EMGA 3T1HE 3ZKBA 1N0VC 3CDJA 4OX9I 4FW9A 4NXNI 2V87A 1RMDA 4M30A 2ZITA 4DV2E 1ZU1A 3B8HA 2B3TB 1T4NA 1YUJA 4FWDA 2YSPA 1XHKA 1A1FA 1PJSA 2EN6A 2VQEE 1NHIA 5A69A 3GMEA 4GKKE 3U1KA 5CFFE 4BA1A 2DIXA 3D4JA 4DPYA 4DV0E 3H1CA 1ZM4A 2DEIA 2PO1A 2EJ4A 1Z0TA 1EA6A 5A2QQ 2DLQA 1TF3A 2N3HA 2WNRB 4DV5E 3LTOA 2WP8B 3J80Q 4R2AA 5C0XB 2EN4A 2EWLA 1DQ3A 5A2QC 2LJHA 4DUYI 4F9BB 2UUBE 3C4TA 2RS6A 1ZM9A 1QU6A 2EZ6A 1A1IA 1S16A 3GLLA 1TN9A 3ZM7A 3F6GA 4DR1E 1BB8A 4R2PA 2NN6A 1H7SA 1X48A 2EL6A 3K6QA 4LOMA 5A6KA 1RC7A 2EMIA 2DMIA 1E3PA 1OYPA 1ZM3A 2HFUA 3LMLA 4FW3A 4LCGA 4R2SA 2CG9A 4ZVIA 1N34E 4X62I 2BA1D 5LMNE 2AJ4A 5JEAA 1Z5AA 2EQ0A 2EM6A 5A6BD 3PS1A 2HHHE 2ZM6E 2DRPA 2NN6C 5ELWA 2F4VI 5IV8B 5IWAE 1PVGA 3CWVA 2ENCA 2HFSA 3V2UC 2GO3A 2ELZA 2WBTA 4O24A 2HK2A 1X6EA 1DGCA 4LF5E 1IQOA 2BA0G 1Z1BA 4GEQB 2EN2A 2J7JA 3ZOQB 2EMZA 1UN6B 4JI7E 2VRDA 4KQVA 4JI8I 1E3HA 2VQFI 4LF4I 3HPZA 3K17A 3M6AA 4LFCE 2BV3A 2MKNA 2IOQA 1G2DC 3CDIA 2EMYA 4X66E 1T38A 3ZZ0A 2LO3A 3IWDA 4DXLA 2NPFA 4FW7A 2EOYA 2K4VA 2JP9A 1FWKA 2YTEA 4DR5E 2EPXA 1UDOA 2JWOA 2VF1A 1FKAE 4UT4A 2HC5A 1X5WA 1A1GA 2V34A 4NBQA 2EOQA 2EPCA 1UDQA 5C0XA 4DR5I 4IZKA 2KOUA 3HXLA 4LCFA 1Z0BA 4RHBB 1SFEA 3BBGA 1T39A 3V5RA 2EOZA 2PO2B 2PNMA 2EE8A 2NN6D 4LPFA 3WU3A 2EOXA 1HNWI 2PRTA 2EMKA 4IJDA 1XMQI 3ECRA 3K85A 1HNXI 2JPAA 1YZ9A 2UXDE 5EKWA 1B62A 2YTQA 4LF8E 1PJQA 3QT6A 4IFDB 3Q1QA 3ADGA 3P3EA 2Z5CA 2YT4A 1Y6ZA 3THOB 1KTVA 4B3RI 3P1XA 4YY3E 5KL3A 3B78A 4X65I 4JG4A 1J5EE 5LMUI 2NUGA 4FWGA 4L5NC 5DNLA 4LF6I 3LNUA 5JEAD 2PO1B 4TUGA 2OI2A 4RPFA 1TF6A 2RTXA 1IBLE 1EKZA 4F6NA 4I8OA 1X6FA 4ZYGA 3T1YE 2E1RA 4WSPA 2EPOA 4BBYA 1Z5CA 2E5LI 2ODRD 2LCEA 2BA1G 2JYAA 4WYQB 2WCC3 2D9HA 2CPNA 4ZYDA 2UUCE 5AC4A 4JI5E 1DARA 1EH8A 1Y4UA 4DUYE 3MHHC 2JR1A 2V83A 4JI6E 2EP3A 4MQYA 5DRRA 1PKPA 2EM0A 4DR7E 4WUCA 4DV5I 1JK2A 1YYWA 4R2EA 2EM8A 3KWRA 1B63A 4P7AA 1VISA 2C37A 4HEIA 3IWCA 2JE6B 3HKMA 3PRYA 4AQYI 4Z7YA 5LMUE 2M4IA 1NZ0A 4HACB 4OO1D 4F9CB 2BM0A 2RSMA 3B4TA 2EOEA 2F1DA 4OZEA 4YY3I 2EM3A 3P76A 4B3RE 5AE3A 2VE7C 4BCAA 4IFDD 2EPUA 4PU9A 2FV4B 1D6TA 3HQ1A 1Z0VA 2O1UA 3T1HI 2BM1A 1Z0GA 5KL7A 1N33E 5FLXQ 1Y5YA 2PO0A 4JV5I 1JK1A 2JXPA 1GQEA 4WFTA 5A6AA 3VYXA 3P06A 2UUAE 1WRJA 4MYTA 4OOGC 5AASA 3J7Yp 1AH5A 3L7ZB 2N3GA 1FJGI 2V85A 4JI1E 2UXCE 2V2QA 2N8XA 2M1SA 3EPJA 4JI2E 3KZYA 5A6BA 2EOHA 2NN6F 1WHQA 2LJPA 1Z5BA 5K36A 2NN6E 2YU5A 1P42A 1PJTA 1L4SA 3QT8A 4I3HA 4DR2E 2YTOA 4BS9A 4LF7I 2YTPA 4F54A 1Z0EA 3H4LA 4IZJA 3MSWA 1YFHA 3F0NA 2K7IA 4FN5A 4JI8E 2LJUA 4DMIA 2MC5A 5IXMB 1F2IG 2EFGA 2DLKA 2I9IA 1GZ6A 3PYFA 2A25A 1NEIA 4OKGA 1NHJA 4R2DA 4M9VC 5KL2A 2YTJA 2V8QB 4TUIA 2R42A 2EPRA 4LFAE 4P7DA 2GQ0A 4FK5C 4M0VA 2WP8A 2M9AA 2EPLX 2V88A 3ADLA 3QT5A 3VK6A 4B3SE 3THNA 3LLHA 2IERA 1S4EA 1EI1A 1YUIA 2EPPA 2EQ1A 4MLVA 4BMJA 5AE2A 3HTXA 2RSIA 4PRVA 2HHHI 1UDSA 4GZNC 2V2VA 2EMCA 2NUEA 4B3SI 3EPKA 2B9DA 2EOSA 1N0UA 1RR9A 2G7HA 3J7AG 4KHPE 2BR2A 5GMDA 4JI3I 4IFDE 4HACA 2HJJA 4K0KI 1KYQA 1BBGA 4DR6E 3L7ZA 2JE6A 2IHR1 1X3CA 4X8WA 2H36X 2FGGA 4DR1I 1ZR9A 3ZZTA 3KRNA 1NCSA 4OO1F 2JEAA 2L3CA 2DB2A 4Q35B 4USMA 1ELOA 1N32E 2LTRA 4LF7E 4IFDF 2LMZA 4DV4I 1Z0CA 3J81Q 2RPCA 2FTXB 4YHHE 4QNKA 2E1MA 4HY1A 1MEYC 2ODRC 4DV0I 4ED4A 4GKKI 2PNZA 4JI2I 1YHCA 1R6MA 2Q2EB 2YRHA 2LRSA 2Z5EA 3U1YA 4JI1I 2UXCI 4IS1C 1FJGE 2O1WA 4DV2I 2CGEA 2NUFA 3IWBA 4URLA 4OX9E 4DV3I 2EMBA 2IOPA 4U3BA 2VESA 2WW4A 2EN8A 5A6JA 2JOBA 1ZXMA 2EMXA 2YTDA 4DR4I 4BC7A 2B7VA 4DV3E 1KJKA 3B82A 2YSOA 4ISAA 5KL6A 4NHRA 3EPLA 4FW4A 2HGHA 4LFBI 4HTGA 2LV2A 2CSHA 3RMPA 2IESA 5FLXC 2UU9E 2LVHA 4DR3I 4Q28A 5JEAC 3PYGA 4DUZI 1I94E 4YHHI 1P47A 4KZSA 3AUZA 4X64I 4J3DA 1USVA 3KZZA 2DSYA 4DV4E 4JI0E 3OTOI 4X65E 1ZXNA 1A1HA 3EPHA 1N3GA 3GCMA 2Z5BB 4JI6I 1EH7A 3VYYA 1OYSA 2UUCI 2ZBKB 4BA2B 2BR2B 1H73A 2EM2A 4GKJE 2YTGA 3MHSC 4AIDA 2WBUA 1T4LB 1N36E 2J7KA 3UK3C 4LU9A 2V86A 2WBSA 5LLQA 3H09A 4M2ZA 5IT9C 3GONA 3PS3A 1X6HA 4KHPI 3PYDA 4HYMA 4WX9A 2EPNA 1H7UA 2EPAA 2R76A 4WPYA 2ELYA 1RHYA 1J5EI 5KL5A 1VI7A 5T6JA 1UDNA 4LF9E 1KIJA 3TQMA 2HKEA 4B3MI 1XNQE 2EOFA 2JY9A 3P3CA 3DF6A 2EMAA 4U3DA 5K36D 2EOOA 1A1KA 3ADJA 1IQSA 5JEAB 3BGHA 2EN3A 2PO0B 1HNZE 4DV6I 2GO4A 1IBME 2L8TA 2EL4A 2WZOA 4F6MA 1HNWE 2PNZB 1Y4SA 4IFDA 1LLMC 2YTNA 4QNJA 4O43A 4DR2I 4JYAI 2YTIA 1K47A 2EMWA 3ADIA 4MYUA 2EL5A 2EOIA 4MU4A 2JEBA 2YRMA 1RREA 2DEJA 4JYAE 4DPTA 4DV1E 2EOMA 2X36A 4IFDC 4X66I 3LPSA 3M99B 3J80C 3VHTB 3DD6A 1OYRA 2L6MA 4LFCI 4DPWA 1BBOA 4LF4E 4LTYA 2VQFE 3J81C 4XTJA 3J7AM 4OO1B 2C39B 1H74A 2UUAI 2LUPB 4JV5E 2L2MA 1N33I 1O0WA 3PS2A 2I13A 5K36C 2E72A 3AV0A 5TSEA 2L2NA 4DPXA 1WJPA 2YU8A 1DI2A 2V8PA 4BHCA 2JVAA 1XNQI 3BF2A 2MC6A 2Z5BA 1PIEA 4WXCA 2EOJA 1G2FC 4FW5A 5C0XE 5BR8I 4JI4I 3C6KA 5IWAI 4DU8A 2GPIA 2F4VE 2JEBB 2ZM6I 2KHXA 4DV7E 1HR0I 2UXBI 1WUUA 3ZKDA 5LMNI 2GLIA 4DR7I 4P78A 5C0XF 2EPMX 2EM5A 2EM9A 2XEXA 2B7TA 2L3JA 1Y60A 4OO1C 3PYEA 1N36I 4JI5I 2EMLA
chains in the Genus database with same CATH topology
4IZJB 1RQ0A 2L33A 2V89A 1MG7A 4WUDA 4AQYE 2E5LE 1UEKA 1A6FA 4WUBA 2UUBI 3T1YI 2F8BA 2A2DA 5FWKA 4X65I 3OTOE 1J26A 3Q6NA 4HXZA 4UTGA 4JI0I 1IBLI 4X64E 2NA2A 3JU0A 4Z7CA 4LF6E 4DUZE 1HR0E 2UXBE 4DV7I 1BKNA 4F9AB 2VQEI 1FI4A 2LTSA 1FNMA 4JI4E 5BR8E 5IT9Q 1UILA 2V2ZA 4NXNE 1STUA 5DNYA 3HULA 1SR9A 1ZBQA 5ADZA 4LF8I 4DR4E 2UXDI 4EMDA 1HNXE 1XMQE 1XMOI 4IZKB 1UHZA 2L92A 2LE2A 1T4OA 3JAMC 4L8NA 3Q6MA 1IBKI 1KVKA 4NXMI 4DV1I 3QT7A 4B3TE 5LL6R 5AE1A 1N32I 5L3JA 1HK7A 1KKHA 2GS8A 1USUA 1Z59A 1YYOA 3F6HA 4JI7I 2HKJA 1IBMI 4R1FA 4P52A 4DV6E 1HNZI 4M1KA 1MX0A 2HK3A 4LF5I 2DMYA 4DR6I 4K0KE 3ZZUA 4B3ME 1H72C 4JI3E 3WU5A 4LF9I 2VF3A 2Z5CB 3WU4A 3C4BA 3HJCA 4FWHA 3OMLA 4DKKA 2O1VA 4X62E 2LUQA 4N3OA 1N34I 2O1TA 1YYKA 2A2CA 4LFAI 2R3VA 2L2KB 1MU5A 2PNLA 4PRXA 4GKJI 2YZTA 3JTZA 2M7QA 1ZM2A 4R03A 1WHNA 2KONA 4DPUA 2MDRA 1X47A 4IZJD 2CZ9A 1FWLA 4BC9A 3DJWA 1U2RA 4J8ZA 3HPSA 1ZBTA 1I94I 2X7IA 4B3TI 2LBSB 4DR3E 5F3WA 2UU9I 1QZRA 4USKA 4R8OA 3FIGA 2JOXA 1WXRA 4LFBE 1OJ4A 3WU6A 4NXME 1X49A 1IBKE 1Z0WA 2RS7A 5GMEA 1XMOE 1XNRE 3JAMQ 1XNRI 1NHHA 4DU7A 3T1HE 3ZKBA 1N0VC 4OX9I 4FW9A 4NXNI 2V87A 4M30A 2ZITA 4DV2E 3B8HA 2B3TB 1T4NA 4FWDA 1XHKA 1NHIA 2VQEE 4GKKE 5CFFE 2DIXA 3D4JA 4DPYA 4DV0E 1ZM4A 2DEIA 1Z0TA 5A2QQ 1EA6A 2N3HA 3J80Q 4DV5E 3LTOA 2EWLA 1DQ3A 5A2QC 2LJHA 4DUYI 4F9BB 2UUBE 3C4TA 2RS6A 1ZM9A 1QU6A 2EZ6A 1S16A 4AQYI 3ZM7A 3F6GA 4DR1E 1H7SA 1X48A 3K6QA 1RC7A 2HFUA 1ZM3A 3LMLA 2CG9A 4ZVIA 1N34E 4X62I 5LMNE 2AJ4A 1Z5AA 2HHHE 2ZM6E 2F4VI 5IWAE 1PVGA 3CWVA 2HFSA 3V2UC 2HK2A 4LF5E 4GEQB 3ZOQB 4JI7E 4KQVA 4JI8I 2VQFI 4LF4I 3HPZA 3K17A 3M6AA 4LFCE 2BV3A 2IOQA 4X66E 3ZZ0A 3IWDA 4DXLA 2NPFA 2K4VA 1FWKA 4DR5E 2JWOA 2VF1A 1FKAE 4UT4A 2V34A 4DR5I 4IZKA 2KOUA 3HXLA 1Z0BA 3V5RA 2PNMA 3WU3A 1HNWI 1XMQI 3K85A 1HNXI 1YZ9A 2UXDE 1B62A 4LF8E 3QT6A 3Q1QA 3ADGA 2Z5CA 2YT4A 1Y6ZA 1KTVA 4B3RI 3P1XA 4YY3E 3B78A 4JG4A 1J5EE 5LMUI 2NUGA 4FWGA 4L5NC 4LF6I 3LNUA 4TUGA 2OI2A 4RPFA 2RTXA 1IBLE 1EKZA 4I8OA 3T1YE 2E1RA 4WSPA 4BBYA 1Z5CA 2E5LI 2ODRD 4WYQB 2CPNA 2UUCE 4JI5E 1DARA 1Y4UA 4DUYE 2JR1A 2V83A 4JI6E 1PKPA 4DR7E 4WUCA 4DV5I 1YYWA 3KWRA 1B63A 4P7AA 1VISA 3IWCA 3PRYA 4Z7YA 5LMUE 2M4IA 1NZ0A 4HACB 4F9CB 2BM0A 2RSMA 4YY3I 4B3RE 5AE3A 2VE7C 4BCAA 4PU9A 2FV4B 1D6TA 3HQ1A 1Z0VA 2O1UA 3T1HI 2BM1A 1Z0GA 1N33E 5FLXQ 4JV5I 4WFTA 1GQEA 3VYXA 3P06A 2UUAE 4MYTA 4OOGC 5AASA 3J7Yp 1FJGI 2N3GA 2V85A 4JI1E 2UXCE 2V2QA 2M1SA 4JI2E 1WHQA 2LJPA 1Z5BA 3QT8A 4I3HA 4DR2E 4BS9A 4LF7I 4F54A 1Z0EA 3H4LA 4IZJA 3MSWA 3F0NA 4FN5A 4JI8E 4DMIA 2MC5A 2EFGA 1GZ6A 3PYFA 1NHJA 2V8QB 4TUIA 2R42A 4LFAE 4P7DA 2GQ0A 4M0VA 2V88A 3ADLA 3QT5A 3VK6A 4B3SE 3LLHA 1S4EA 1EI1A 4BMJA 3HTXA 5AE2A 4PRVA 2HHHI 2V2VA 2NUEA 4B3SI 2B9DA 1N0UA 1RR9A 2G7HA 3J7AG 4KHPE 5GMDA 4JI3I 4HACA 4K0KI 4DR6E 2IHR1 4X8WA 2H36X 2FGGA 4DR1I 3ZZTA 2L3CA 2DB2A 4USMA 1ELOA 1N32E 2LTRA 4LF7E 2LMZA 4DV4I 1Z0CA 3J81Q 2FTXB 4YHHE 2E1MA 4HY1A 2ODRC 4DV0I 4ED4A 4GKKI 4JI2I 2Q2EB 2Z5EA 2LRSA 4JI1I 2UXCI 1FJGE 2O1WA 4DV2I 2CGEA 2NUFA 3IWBA 4URLA 4OX9E 4DV3I 2IOPA 2WW4A 2JOBA 1ZXMA 4DR4I 4BC7A 2B7VA 4DV3E 3B82A 4LFBI 3RMPA 5FLXC 2UU9E 4DR3I 4Q28A 3PYGA 4DUZI 1I94E 4YHHI 4KZSA 3AUZA 4X64I 1USVA 4DV4E 2DSYA 4JI0E 3OTOI 4X65E 1ZXNA 2Z5BB 4JI6I 3VYYA 2UUCI 2ZBKB 1H73A 4GKJE 1T4LB 1N36E 2J7KA 4LU9A 2V86A 3H09A 4M2ZA 5IT9C 3GONA 4KHPI 3PYDA 4HYMA 1H7UA 4WPYA 1J5EI 5T6JA 4LF9E 1KIJA 2HKEA 4B3MI 1XNQE 2JY9A 3DF6A 3ADJA 1HNZE 4DV6I 1IBME 2L8TA 2WZOA 1HNWE 1Y4SA 4DR2I 4JYAI 1K47A 3ADIA 4MYUA 1RREA 2DEJA 4DPTA 4JYAE 4DV1E 2X36A 4X66I 3LPSA 3J80C 4LFCI 2L6MA 4DPWA 4LF4E 4LTYA 2VQFE 3J81C 4XTJA 3J7AM 2UUAI 1H74A 2LUPB 4JV5E 2L2MA 1N33I 1O0WA 3AV0A 2L2NA 4DPXA 1DI2A 2V8PA 2JVAA 1XNQI 2MC6A 2Z5BA 1PIEA 5BR8I 4JI4I 5IWAI 4DU8A 2F4VE 2ZM6I 2KHXA 4DV7E 1HR0I 2UXBI 1WUUA 3ZKDA 5LMNI 4DR7I 4P78A 2XEXA 2B7TA 2L3JA 3PYEA 1N36I 4JI5I 3K1JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MG7 A;  4WUD A;  4AQY E;  2E5L E;  1UEK A;  1A6F A;  4WUB A;  2UUB I;  3T1Y I;  2A2D A;  4X65 I;  4JI0 I;  3OTO E;  4HXZ A;  4UTG A;  1IBL I;  4X64 E;  4Z7C A;  4LF6 E;  4DUZ E;  1HR0 E;  4DV7 I;  2UXB E;  1BKN A;  2VQE I;  1FI4 A;  1FNM A;  4JI4 E;  5BR8 E;  5IT9 Q;  2V2Z A;  4NXN E;  3HUL A;  4LF8 I;  4DR4 E;  2UXD I;  4EMD A;  1HNX E;  1XMQ E;  1XMO I;  3JAM C;  1IBK I;  1KVK A;  4NXM I;  4DV1 I;  3QT7 A;  4B3T E;  5LL6 R;  1N32 I;  5L3J A;  1KKH A;  2GS8 A;  1Z59 A;  4JI7 I;  2HKJ A;  1IBM I;  4R1F A;  4P52 A;  4DV6 E;  1HNZ I;  4M1K A;  1MX0 A;  2HK3 A;  4LF5 I;  4DR6 I;  4K0K E;  3ZZU A;  1H72 C;  4B3M E;  4JI3 E;  3WU5 A;  4LF9 I;  2VF3 A;  3WU4 A;  4FWH A;  4X62 E;  1N34 I;  2A2C A;  4LFA I;  2R3V A;  1MU5 A;  4PRX A;  4GKJ I;  1ZM2 A;  4DPU A;  2CZ9 A;  1FWL A;  1U2R A;  1I94 I;  2X7I A;  4B3T I;  4DR3 E;  2UU9 I;  1QZR A;  4USK A;  1OJ4 A;  4LFB E;  3WU6 A;  4NXM E;  1IBK E;  1Z0W A;  5GME A;  1XMO E;  1XNR E;  3JAM Q;  1XNR I;  1NHH A;  4DU7 A;  3T1H E;  3ZKB A;  1N0V C;  4OX9 I;  4FW9 A;  4NXN I;  2ZIT A;  4DV2 E;  3B8H A;  4FWD A;  1XHK A;  1NHI A;  2VQE E;  4GKK E;  3D4J A;  4DPY A;  4DV0 E;  1ZM4 A;  2DEI A;  1Z0T A;  5A2Q Q;  1EA6 A;  3J80 Q;  4DV5 E;  3LTO A;  5A2Q C;  4DUY I;  2UUB E;  4AQY I;  1ZM9 A;  1S16 A;  3ZM7 A;  4DR1 E;  1H7S A;  2HFU A;  1ZM3 A;  4ZVI A;  1N34 E;  4X62 I;  2AJ4 A;  5LMN E;  1Z5A A;  2HHH E;  2ZM6 E;  2F4V I;  5IWA E;  1PVG A;  3CWV A;  2HFS A;  3V2U C;  2HK2 A;  4LF5 E;  4JI7 E;  4KQV A;  4JI8 I;  2VQF I;  4LF4 I;  3K17 A;  3M6A A;  4LFC E;  2BV3 A;  4X66 E;  3ZZ0 A;  4DXL A;  2NPF A;  1FWK A;  4DR5 E;  1FKA E;  4UT4 A;  2V34 A;  4DR5 I;  1Z0B A;  3V5R A;  3WU3 A;  1HNW I;  1XMQ I;  1HNX I;  2UXD E;  1B62 A;  4LF8 E;  3QT6 A;  3Q1Q A;  1KTV A;  4B3R I;  4YY3 E;  3B78 A;  4JG4 A;  1J5E E;  5LMU I;  4FWG A;  4LF6 I;  3LNU A;  2OI2 A;  4RPF A;  1IBL E;  3T1Y E;  2E1R A;  1Z5C A;  2E5L I;  2UUC E;  4JI5 E;  1DAR A;  4DUY E;  4JI6 E;  1PKP A;  4DR7 E;  4WUC A;  4DV5 I;  1B63 A;  4P7A A;  1VIS A;  4Z7Y A;  5LMU E;  1NZ0 A;  4HAC B;  2BM0 A;  4YY3 I;  4B3R E;  4PU9 A;  1D6T A;  1Z0V A;  3T1H I;  2BM1 A;  1Z0G A;  1N33 E;  5FLX Q;  4JV5 I;  2UUA E;  4MYT A;  1FJG I;  4JI1 E;  2UXC E;  2V2Q A;  4JI2 E;  2LJP A;  1Z5B A;  3QT8 A;  4I3H A;  4DR2 E;  4LF7 I;  1Z0E A;  3H4L A;  3F0N A;  4FN5 A;  4JI8 E;  2EFG A;  3PYF A;  1NHJ A;  2R42 A;  4LFA E;  3QT5 A;  4B3S E;  1S4E A;  1EI1 A;  4PRV A;  2HHH I;  2V2V A;  4B3S I;  1N0U A;  1RR9 A;  4KHP E;  3J7A G;  5GMD A;  4JI3 I;  4HAC A;  4K0K I;  4DR6 E;  4DR1 I;  3ZZT A;  4USM A;  1ELO A;  1N32 E;  4LF7 E;  4DV4 I;  1Z0C A;  3J81 Q;  4YHH E;  4HY1 A;  4DV0 I;  4ED4 A;  4GKK I;  4JI2 I;  2Q2E B;  4JI1 I;  2UXC I;  1FJG E;  4DV2 I;  4URL A;  4OX9 E;  4DV3 I;  2WW4 A;  1ZXM A;  4DR4 I;  4DV3 E;  3B82 A;  4LFB I;  5FLX C;  2UU9 E;  4DR3 I;  3PYG A;  4DUZ I;  1I94 E;  4YHH I;  4X64 I;  4DV4 E;  3OTO I;  4JI0 E;  4X65 E;  1ZXN A;  4JI6 I;  2UUC I;  2ZBK B;  1H73 A;  4GKJ E;  1N36 E;  2J7K A;  4KHP I;  5IT9 C;  3GON A;  3PYD A;  4HYM A;  1H7U A;  1J5E I;  4LF9 E;  1KIJ A;  2HKE A;  4B3M I;  1XNQ E;  4DV6 I;  1HNZ E;  1IBM E;  1HNW E;  4DR2 I;  4JYA I;  1K47 A;  4MYU A;  1RRE A;  2DEJ A;  4DPT A;  4JYA E;  4DV1 E;  2X36 A;  4X66 I;  3LPS A;  3J80 C;  4LFC I;  4DPW A;  4LF4 E;  2VQF E;  3J81 C;  4XTJ A;  3J7A M;  2UUA I;  1H74 A;  4JV5 E;  1N33 I;  4DPX A;  2V8P A;  1XNQ I;  5BR8 I;  1PIE A;  4JI4 I;  5IWA I;  4DU8 A;  2F4V E;  2ZM6 I;  4DV7 E;  1HR0 I;  2UXB I;  1WUU A;  3ZKD A;  5LMN I;  4DR7 I;  2XEX A;  3PYE A;  1N36 I;  4JI5 I;  3K1J A; 
#chains in the Genus database with same CATH topology
 4IZJ B;  1RQ0 A;  5AC5 A;  2L33 A;  1EH6 A;  2EPZ A;  4F2J C;  2RQL A;  2V89 A;  1MG7 A;  4WUD A;  5DNX A;  2O3Z A;  1B69 A;  4AIM A;  4AQY E;  2E5L E;  1UEK A;  1A6F A;  4WUB A;  2UUB I;  3T1Y I;  4GQU A;  2F8B A;  2A2D A;  4MU3 A;  4R2Q A;  2CVE A;  1YPN A;  3OTO E;  1J26 A;  3Q6N A;  4HXZ A;  4UTG A;  4JI0 I;  2EQ3 A;  5FWK A;  1IBL I;  4BA2 A;  4O5G A;  2NA2 A;  3JU0 A;  4X64 E;  2EN1 A;  4LF6 E;  1PDA A;  3C6M A;  4Z7C A;  4DUZ E;  5JEA E;  1HR0 E;  2UXB E;  2NAB A;  2EM7 A;  4DV7 I;  1BKN A;  3BID A;  5DRO A;  4F9A B;  2VQE I;  1FI4 A;  2LTS A;  1FNM A;  5DRQ A;  2EPK X;  4JI4 E;  5BR8 E;  2C39 A;  5IT9 Q;  1UIL A;  2V2Z A;  2AE8 A;  4NXN E;  1STU A;  5DNY A;  3HUL A;  1SR9 A;  4NZV A;  1ZBQ A;  1QNT A;  5ADZ A;  4LF8 I;  2ENH A;  4DR4 E;  2UXD I;  3M85 G;  4O4K A;  4EMD A;  2R1F A;  1HNX E;  1XMQ E;  2NN6 B;  4LCH A;  1XMO I;  4IZK B;  1UHZ A;  2L92 A;  2LE2 A;  1T4O A;  3JAM C;  4L8N A;  4WXD A;  4BHB A;  3Q6M A;  1IBK I;  1KVK A;  2BBG A;  4NXM I;  2BB8 A;  2MDG A;  4DV1 I;  3QT7 A;  3M85 D;  4B3T E;  5LL6 R;  5AE1 A;  4R2R A;  1A1L A;  1N32 I;  2EOR A;  5L3J A;  2EN7 A;  1HK7 A;  1KKH A;  2GS8 A;  1USU A;  1Z59 A;  1YYO A;  3F6H A;  4JI7 I;  2HKJ A;  1IBM I;  4R1F A;  4P52 A;  4DV6 E;  3NZK A;  1IMU A;  2EMH A;  1MX0 A;  4M1K A;  3P3G A;  1ZAA C;  4OO1 A;  1HNZ I;  2HK3 A;  4LF5 I;  1XXE A;  2J65 A;  1AAY A;  2PO2 A;  2DMY A;  4MLQ A;  4ZYH A;  3EQ1 A;  2C38 A;  4K0K E;  4FW6 A;  4DR6 I;  3ZZU A;  4B3M E;  1H72 C;  2MKD A;  4JI3 E;  2Q8U A;  4IS9 A;  1R6L A;  3WU5 A;  4LF9 I;  4MDT A;  2VF3 A;  2Z5C B;  3WU4 A;  3C4B A;  4MU1 A;  3UHM A;  5JEA F;  4WSG A;  3HJC A;  3QG5 C;  4FWH A;  2ENA A;  3OML A;  4DKK A;  2O1V A;  4X62 E;  2LUQ A;  4R2C A;  4N3O A;  4BA1 B;  1N34 I;  2O1T A;  1YYK A;  2A2C A;  3K1J A;  4LFA I;  2R3V A;  2L2K B;  2YWQ A;  1MU5 A;  2PNL A;  4PRX A;  1YSA C;  5K36 F;  4AM3 A;  4GKJ I;  4N4R B;  2YZT A;  3JTZ A;  2M7Q A;  1ZM2 A;  2WNR A;  4R03 A;  1WHN A;  2YRK A;  2KON A;  2LT7 A;  2C38 B;  4DPU A;  5K36 E;  1GTK A;  2MDR A;  1X47 A;  2YTF A;  2YPN A;  5KL4 A;  4IZJ D;  2JT2 A;  1UBD C;  1FWL A;  2CZ9 A;  5C0X D;  5C0X C;  4BC9 A;  3M7N D;  2EM4 A;  3DJW A;  1A1J A;  4J8Z A;  1U2R A;  3HPS A;  1ZBT A;  2BA0 D;  4RH8 A;  1I94 I;  2X7I A;  4B3T I;  2LBS B;  4DR3 E;  5F3W A;  2UU9 I;  4X9J A;  1QZR A;  2C37 B;  4USK A;  4R8O A;  5K36 B;  3FIG A;  1MGT A;  2JOX A;  1WXR A;  4LFB E;  1OJ4 A;  3M7N G;  3WU6 A;  4NXM E;  2JEA B;  1X49 A;  1IBK E;  1Z0W A;  2RS7 A;  3L00 A;  2EMF A;  2CTD A;  5DRP A;  5EL9 A;  5GME A;  4ZYE A;  2ADR A;  4OO1 E;  4MU0 A;  2CT1 A;  1XMO E;  1YH8 A;  1XNR E;  4KWY A;  2GHF A;  3JAM Q;  2DGC A;  1XNR I;  1NHH A;  4DU7 A;  2EMG A;  3T1H E;  3ZKB A;  1N0V C;  3CDJ A;  4OX9 I;  4FW9 A;  4NXN I;  2V87 A;  1RMD A;  4M30 A;  2ZIT A;  4DV2 E;  1ZU1 A;  3B8H A;  2B3T B;  1T4N A;  1YUJ A;  4FWD A;  2YSP A;  1XHK A;  1A1F A;  1PJS A;  2EN6 A;  2VQE E;  1NHI A;  5A69 A;  3GME A;  4GKK E;  3U1K A;  5CFF E;  4BA1 A;  2DIX A;  3D4J A;  4DPY A;  4DV0 E;  3H1C A;  1ZM4 A;  2DEI A;  2PO1 A;  2EJ4 A;  1Z0T A;  1EA6 A;  5A2Q Q;  2DLQ A;  1TF3 A;  2N3H A;  2WNR B;  4DV5 E;  3LTO A;  2WP8 B;  3J80 Q;  4R2A A;  5C0X B;  2EN4 A;  2EWL A;  1DQ3 A;  5A2Q C;  2LJH A;  4DUY I;  4F9B B;  2UUB E;  3C4T A;  2RS6 A;  1ZM9 A;  1QU6 A;  2EZ6 A;  1A1I A;  1S16 A;  3GLL A;  1TN9 A;  3ZM7 A;  3F6G A;  4DR1 E;  1BB8 A;  4R2P A;  2NN6 A;  1H7S A;  1X48 A;  2EL6 A;  3K6Q A;  4LOM A;  5A6K A;  1RC7 A;  2EMI A;  2DMI A;  1E3P A;  1OYP A;  1ZM3 A;  2HFU A;  3LML A;  4FW3 A;  4LCG A;  4R2S A;  2CG9 A;  4ZVI A;  1N34 E;  4X62 I;  2BA1 D;  5LMN E;  2AJ4 A;  5JEA A;  1Z5A A;  2EQ0 A;  2EM6 A;  5A6B D;  3PS1 A;  2HHH E;  2ZM6 E;  2DRP A;  2NN6 C;  5ELW A;  2F4V I;  5IV8 B;  5IWA E;  1PVG A;  3CWV A;  2ENC A;  2HFS A;  3V2U C;  2GO3 A;  2ELZ A;  2WBT A;  4O24 A;  2HK2 A;  1X6E A;  1DGC A;  4LF5 E;  1IQO A;  2BA0 G;  1Z1B A;  4GEQ B;  2EN2 A;  2J7J A;  3ZOQ B;  2EMZ A;  1UN6 B;  4JI7 E;  2VRD A;  4KQV A;  4JI8 I;  1E3H A;  2VQF I;  4LF4 I;  3HPZ A;  3K17 A;  3M6A A;  4LFC E;  2BV3 A;  2MKN A;  2IOQ A;  1G2D C;  3CDI A;  2EMY A;  4X66 E;  1T38 A;  3ZZ0 A;  2LO3 A;  3IWD A;  4DXL A;  2NPF A;  4FW7 A;  2EOY A;  2K4V A;  2JP9 A;  1FWK A;  2YTE A;  4DR5 E;  2EPX A;  1UDO A;  2JWO A;  2VF1 A;  1FKA E;  4UT4 A;  2HC5 A;  1X5W A;  1A1G A;  2V34 A;  4NBQ A;  2EOQ A;  2EPC A;  1UDQ A;  5C0X A;  4DR5 I;  4IZK A;  2KOU A;  3HXL A;  4LCF A;  1Z0B A;  4RHB B;  1SFE A;  3BBG A;  1T39 A;  3V5R A;  2EOZ A;  2PO2 B;  2PNM A;  2EE8 A;  2NN6 D;  4LPF A;  3WU3 A;  2EOX A;  1HNW I;  2PRT A;  2EMK A;  4IJD A;  1XMQ I;  3ECR A;  3K85 A;  1HNX I;  2JPA A;  1YZ9 A;  2UXD E;  5EKW A;  1B62 A;  2YTQ A;  4LF8 E;  1PJQ A;  3QT6 A;  4IFD B;  3Q1Q A;  3ADG A;  3P3E A;  2Z5C A;  2YT4 A;  1Y6Z A;  3THO B;  1KTV A;  4B3R I;  3P1X A;  4YY3 E;  5KL3 A;  3B78 A;  4X65 I;  4JG4 A;  1J5E E;  5LMU I;  2NUG A;  4FWG A;  4L5N C;  5DNL A;  4LF6 I;  3LNU A;  5JEA D;  2PO1 B;  4TUG A;  2OI2 A;  4RPF A;  1TF6 A;  2RTX A;  1IBL E;  1EKZ A;  4F6N A;  4I8O A;  1X6F A;  4ZYG A;  3T1Y E;  2E1R A;  4WSP A;  2EPO A;  4BBY A;  1Z5C A;  2E5L I;  2ODR D;  2LCE A;  2BA1 G;  2JYA A;  4WYQ B;  2WCC 3;  2D9H A;  2CPN A;  4ZYD A;  2UUC E;  5AC4 A;  4JI5 E;  1DAR A;  1EH8 A;  1Y4U A;  4DUY E;  3MHH C;  2JR1 A;  2V83 A;  4JI6 E;  2EP3 A;  4MQY A;  5DRR A;  1PKP A;  2EM0 A;  4DR7 E;  4WUC A;  4DV5 I;  1JK2 A;  1YYW A;  4R2E A;  2EM8 A;  3KWR A;  1B63 A;  4P7A A;  1VIS A;  2C37 A;  4HEI A;  3IWC A;  2JE6 B;  3HKM A;  3PRY A;  4AQY I;  4Z7Y A;  5LMU E;  2M4I A;  1NZ0 A;  4HAC B;  4OO1 D;  4F9C B;  2BM0 A;  2RSM A;  3B4T A;  2EOE A;  2F1D A;  4OZE A;  4YY3 I;  2EM3 A;  3P76 A;  4B3R E;  5AE3 A;  2VE7 C;  4BCA A;  4IFD D;  2EPU A;  4PU9 A;  2FV4 B;  1D6T A;  3HQ1 A;  1Z0V A;  2O1U A;  3T1H I;  2BM1 A;  1Z0G A;  5KL7 A;  1N33 E;  5FLX Q;  1Y5Y A;  2PO0 A;  4JV5 I;  1JK1 A;  2JXP A;  1GQE A;  4WFT A;  5A6A A;  3VYX A;  3P06 A;  2UUA E;  1WRJ A;  4MYT A;  4OOG C;  5AAS A;  3J7Y p;  1AH5 A;  3L7Z B;  2N3G A;  1FJG I;  2V85 A;  4JI1 E;  2UXC E;  2V2Q A;  2N8X A;  2M1S A;  3EPJ A;  4JI2 E;  3KZY A;  5A6B A;  2EOH A;  2NN6 F;  1WHQ A;  2LJP A;  1Z5B A;  5K36 A;  2NN6 E;  2YU5 A;  1P42 A;  1PJT A;  1L4S A;  3QT8 A;  4I3H A;  4DR2 E;  2YTO A;  4BS9 A;  4LF7 I;  2YTP A;  4F54 A;  1Z0E A;  3H4L A;  4IZJ A;  3MSW A;  1YFH A;  3F0N A;  2K7I A;  4FN5 A;  4JI8 E;  2LJU A;  4DMI A;  2MC5 A;  5IXM B;  1F2I G;  2EFG A;  2DLK A;  2I9I A;  1GZ6 A;  3PYF A;  2A25 A;  1NEI A;  4OKG A;  1NHJ A;  4R2D A;  4M9V C;  5KL2 A;  2YTJ A;  2V8Q B;  4TUI A;  2R42 A;  2EPR A;  4LFA E;  4P7D A;  2GQ0 A;  4FK5 C;  4M0V A;  2WP8 A;  2M9A A;  2EPL X;  2V88 A;  3ADL A;  3QT5 A;  3VK6 A;  4B3S E;  3THN A;  3LLH A;  2IER A;  1S4E A;  1EI1 A;  1YUI A;  2EPP A;  2EQ1 A;  4MLV A;  4BMJ A;  5AE2 A;  3HTX A;  2RSI A;  4PRV A;  2HHH I;  1UDS A;  4GZN C;  2V2V A;  2EMC A;  2NUE A;  4B3S I;  3EPK A;  2B9D A;  2EOS A;  1N0U A;  1RR9 A;  2G7H A;  3J7A G;  4KHP E;  2BR2 A;  5GMD A;  4JI3 I;  4IFD E;  4HAC A;  2HJJ A;  4K0K I;  1KYQ A;  1BBG A;  4DR6 E;  3L7Z A;  2JE6 A;  2IHR 1;  1X3C A;  4X8W A;  2H36 X;  2FGG A;  4DR1 I;  1ZR9 A;  3ZZT A;  3KRN A;  1NCS A;  4OO1 F;  2JEA A;  2L3C A;  2DB2 A;  4Q35 B;  4USM A;  1ELO A;  1N32 E;  2LTR A;  4LF7 E;  4IFD F;  2LMZ A;  4DV4 I;  1Z0C A;  3J81 Q;  2RPC A;  2FTX B;  4YHH E;  4QNK A;  2E1M A;  4HY1 A;  1MEY C;  2ODR C;  4DV0 I;  4ED4 A;  4GKK I;  2PNZ A;  4JI2 I;  1YHC A;  1R6M A;  2Q2E B;  2YRH A;  2LRS A;  2Z5E A;  3U1Y A;  4JI1 I;  2UXC I;  4IS1 C;  1FJG E;  2O1W A;  4DV2 I;  2CGE A;  2NUF A;  3IWB A;  4URL A;  4OX9 E;  4DV3 I;  2EMB A;  2IOP A;  4U3B A;  2VES A;  2WW4 A;  2EN8 A;  5A6J A;  2JOB A;  1ZXM A;  2EMX A;  2YTD A;  4DR4 I;  4BC7 A;  2B7V A;  4DV3 E;  1KJK A;  3B82 A;  2YSO A;  4ISA A;  5KL6 A;  4NHR A;  3EPL A;  4FW4 A;  2HGH A;  4LFB I;  4HTG A;  2LV2 A;  2CSH A;  3RMP A;  2IES A;  5FLX C;  2UU9 E;  2LVH A;  4DR3 I;  4Q28 A;  5JEA C;  3PYG A;  4DUZ I;  1I94 E;  4YHH I;  1P47 A;  4KZS A;  3AUZ A;  4X64 I;  4J3D A;  1USV A;  3KZZ A;  2DSY A;  4DV4 E;  4JI0 E;  3OTO I;  4X65 E;  1ZXN A;  1A1H A;  3EPH A;  1N3G A;  3GCM A;  2Z5B B;  4JI6 I;  1EH7 A;  3VYY A;  1OYS A;  2UUC I;  2ZBK B;  4BA2 B;  2BR2 B;  1H73 A;  2EM2 A;  4GKJ E;  2YTG A;  3MHS C;  4AID A;  2WBU A;  1T4L B;  1N36 E;  2J7K A;  3UK3 C;  4LU9 A;  2V86 A;  2WBS A;  5LLQ A;  3H09 A;  4M2Z A;  5IT9 C;  3GON A;  3PS3 A;  1X6H A;  4KHP I;  3PYD A;  4HYM A;  4WX9 A;  2EPN A;  1H7U A;  2EPA A;  2R76 A;  4WPY A;  2ELY A;  1RHY A;  1J5E I;  5KL5 A;  1VI7 A;  5T6J A;  1UDN A;  4LF9 E;  1KIJ A;  3TQM A;  2HKE A;  4B3M I;  1XNQ E;  2EOF A;  2JY9 A;  3P3C A;  3DF6 A;  2EMA A;  4U3D A;  5K36 D;  2EOO A;  1A1K A;  3ADJ A;  1IQS A;  5JEA B;  3BGH A;  2EN3 A;  2PO0 B;  1HNZ E;  4DV6 I;  2GO4 A;  1IBM E;  2L8T A;  2EL4 A;  2WZO A;  4F6M A;  1HNW E;  2PNZ B;  1Y4S A;  4IFD A;  1LLM C;  2YTN A;  4QNJ A;  4O43 A;  4DR2 I;  4JYA I;  2YTI A;  1K47 A;  2EMW A;  3ADI A;  4MYU A;  2EL5 A;  2EOI A;  4MU4 A;  2JEB A;  2YRM A;  1RRE A;  2DEJ A;  4JYA E;  4DPT A;  4DV1 E;  2EOM A;  2X36 A;  4IFD C;  4X66 I;  3LPS A;  3M99 B;  3J80 C;  3VHT B;  3DD6 A;  1OYR A;  2L6M A;  4LFC I;  4DPW A;  1BBO A;  4LF4 E;  4LTY A;  2VQF E;  3J81 C;  4XTJ A;  3J7A M;  4OO1 B;  2C39 B;  1H74 A;  2UUA I;  2LUP B;  4JV5 E;  2L2M A;  1N33 I;  1O0W A;  3PS2 A;  2I13 A;  5K36 C;  2E72 A;  3AV0 A;  5TSE A;  2L2N A;  4DPX A;  1WJP A;  2YU8 A;  1DI2 A;  2V8P A;  4BHC A;  2JVA A;  1XNQ I;  3BF2 A;  2MC6 A;  2Z5B A;  1PIE A;  4WXC A;  2EOJ A;  1G2F C;  4FW5 A;  5C0X E;  5BR8 I;  4JI4 I;  3C6K A;  5IWA I;  4DU8 A;  2GPI A;  2F4V E;  2JEB B;  2ZM6 I;  2KHX A;  4DV7 E;  1HR0 I;  2UXB I;  1WUU A;  3ZKD A;  5LMN I;  2GLI A;  4DR7 I;  4P78 A;  5C0X F;  2EPM X;  2EM5 A;  2EM9 A;  2XEX A;  2B7T A;  2L3J A;  1Y60 A;  4OO1 C;  3PYE A;  1N36 I;  4JI5 I;  2EML A; 
#chains in the Genus database with same CATH homology
 4IZJ B;  1RQ0 A;  2L33 A;  2V89 A;  1MG7 A;  4WUD A;  4AQY E;  2E5L E;  1UEK A;  1A6F A;  4WUB A;  2UUB I;  3T1Y I;  2F8B A;  2A2D A;  5FWK A;  4X65 I;  3OTO E;  1J26 A;  3Q6N A;  4HXZ A;  4UTG A;  4JI0 I;  1IBL I;  4X64 E;  2NA2 A;  3JU0 A;  4Z7C A;  4LF6 E;  4DUZ E;  1HR0 E;  2UXB E;  4DV7 I;  1BKN A;  4F9A B;  2VQE I;  1FI4 A;  2LTS A;  1FNM A;  4JI4 E;  5BR8 E;  5IT9 Q;  1UIL A;  2V2Z A;  4NXN E;  1STU A;  5DNY A;  3HUL A;  1SR9 A;  1ZBQ A;  5ADZ A;  4LF8 I;  4DR4 E;  2UXD I;  4EMD A;  1HNX E;  1XMQ E;  1XMO I;  4IZK B;  1UHZ A;  2L92 A;  2LE2 A;  1T4O A;  3JAM C;  4L8N A;  3Q6M A;  1IBK I;  1KVK A;  4NXM I;  4DV1 I;  3QT7 A;  4B3T E;  5LL6 R;  5AE1 A;  1N32 I;  5L3J A;  1HK7 A;  1KKH A;  2GS8 A;  1USU A;  1Z59 A;  1YYO A;  3F6H A;  4JI7 I;  2HKJ A;  1IBM I;  4R1F A;  4P52 A;  4DV6 E;  1HNZ I;  4M1K A;  1MX0 A;  2HK3 A;  4LF5 I;  2DMY A;  4DR6 I;  4K0K E;  3ZZU A;  4B3M E;  1H72 C;  4JI3 E;  3WU5 A;  4LF9 I;  2VF3 A;  2Z5C B;  3WU4 A;  3C4B A;  3HJC A;  4FWH A;  3OML A;  4DKK A;  2O1V A;  4X62 E;  2LUQ A;  4N3O A;  1N34 I;  2O1T A;  1YYK A;  2A2C A;  4LFA I;  2R3V A;  2L2K B;  1MU5 A;  2PNL A;  4PRX A;  4GKJ I;  2YZT A;  3JTZ A;  2M7Q A;  1ZM2 A;  4R03 A;  1WHN A;  2KON A;  4DPU A;  2MDR A;  1X47 A;  4IZJ D;  2CZ9 A;  1FWL A;  4BC9 A;  3DJW A;  1U2R A;  4J8Z A;  3HPS A;  1ZBT A;  1I94 I;  2X7I A;  4B3T I;  2LBS B;  4DR3 E;  5F3W A;  2UU9 I;  1QZR A;  4USK A;  4R8O A;  3FIG A;  2JOX A;  1WXR A;  4LFB E;  1OJ4 A;  3WU6 A;  4NXM E;  1X49 A;  1IBK E;  1Z0W A;  2RS7 A;  5GME A;  1XMO E;  1XNR E;  3JAM Q;  1XNR I;  1NHH A;  4DU7 A;  3T1H E;  3ZKB A;  1N0V C;  4OX9 I;  4FW9 A;  4NXN I;  2V87 A;  4M30 A;  2ZIT A;  4DV2 E;  3B8H A;  2B3T B;  1T4N A;  4FWD A;  1XHK A;  1NHI A;  2VQE E;  4GKK E;  5CFF E;  2DIX A;  3D4J A;  4DPY A;  4DV0 E;  1ZM4 A;  2DEI A;  1Z0T A;  5A2Q Q;  1EA6 A;  2N3H A;  3J80 Q;  4DV5 E;  3LTO A;  2EWL A;  1DQ3 A;  5A2Q C;  2LJH A;  4DUY I;  4F9B B;  2UUB E;  3C4T A;  2RS6 A;  1ZM9 A;  1QU6 A;  2EZ6 A;  1S16 A;  4AQY I;  3ZM7 A;  3F6G A;  4DR1 E;  1H7S A;  1X48 A;  3K6Q A;  1RC7 A;  2HFU A;  1ZM3 A;  3LML A;  2CG9 A;  4ZVI A;  1N34 E;  4X62 I;  5LMN E;  2AJ4 A;  1Z5A A;  2HHH E;  2ZM6 E;  2F4V I;  5IWA E;  1PVG A;  3CWV A;  2HFS A;  3V2U C;  2HK2 A;  4LF5 E;  4GEQ B;  3ZOQ B;  4JI7 E;  4KQV A;  4JI8 I;  2VQF I;  4LF4 I;  3HPZ A;  3K17 A;  3M6A A;  4LFC E;  2BV3 A;  2IOQ A;  4X66 E;  3ZZ0 A;  3IWD A;  4DXL A;  2NPF A;  2K4V A;  1FWK A;  4DR5 E;  2JWO A;  2VF1 A;  1FKA E;  4UT4 A;  2V34 A;  4DR5 I;  4IZK A;  2KOU A;  3HXL A;  1Z0B A;  3V5R A;  2PNM A;  3WU3 A;  1HNW I;  1XMQ I;  3K85 A;  1HNX I;  1YZ9 A;  2UXD E;  1B62 A;  4LF8 E;  3QT6 A;  3Q1Q A;  3ADG A;  2Z5C A;  2YT4 A;  1Y6Z A;  1KTV A;  4B3R I;  3P1X A;  4YY3 E;  3B78 A;  4JG4 A;  1J5E E;  5LMU I;  2NUG A;  4FWG A;  4L5N C;  4LF6 I;  3LNU A;  4TUG A;  2OI2 A;  4RPF A;  2RTX A;  1IBL E;  1EKZ A;  4I8O A;  3T1Y E;  2E1R A;  4WSP A;  4BBY A;  1Z5C A;  2E5L I;  2ODR D;  4WYQ B;  2CPN A;  2UUC E;  4JI5 E;  1DAR A;  1Y4U A;  4DUY E;  2JR1 A;  2V83 A;  4JI6 E;  1PKP A;  4DR7 E;  4WUC A;  4DV5 I;  1YYW A;  3KWR A;  1B63 A;  4P7A A;  1VIS A;  3IWC A;  3PRY A;  4Z7Y A;  5LMU E;  2M4I A;  1NZ0 A;  4HAC B;  4F9C B;  2BM0 A;  2RSM A;  4YY3 I;  4B3R E;  5AE3 A;  2VE7 C;  4BCA A;  4PU9 A;  2FV4 B;  1D6T A;  3HQ1 A;  1Z0V A;  2O1U A;  3T1H I;  2BM1 A;  1Z0G A;  1N33 E;  5FLX Q;  4JV5 I;  4WFT A;  1GQE A;  3VYX A;  3P06 A;  2UUA E;  4MYT A;  4OOG C;  5AAS A;  3J7Y p;  1FJG I;  2N3G A;  2V85 A;  4JI1 E;  2UXC E;  2V2Q A;  2M1S A;  4JI2 E;  1WHQ A;  2LJP A;  1Z5B A;  3QT8 A;  4I3H A;  4DR2 E;  4BS9 A;  4LF7 I;  4F54 A;  1Z0E A;  3H4L A;  4IZJ A;  3MSW A;  3F0N A;  4FN5 A;  4JI8 E;  4DMI A;  2MC5 A;  2EFG A;  1GZ6 A;  3PYF A;  1NHJ A;  2V8Q B;  4TUI A;  2R42 A;  4LFA E;  4P7D A;  2GQ0 A;  4M0V A;  2V88 A;  3ADL A;  3QT5 A;  3VK6 A;  4B3S E;  3LLH A;  1S4E A;  1EI1 A;  4BMJ A;  3HTX A;  5AE2 A;  4PRV A;  2HHH I;  2V2V A;  2NUE A;  4B3S I;  2B9D A;  1N0U A;  1RR9 A;  2G7H A;  3J7A G;  4KHP E;  5GMD A;  4JI3 I;  4HAC A;  4K0K I;  4DR6 E;  2IHR 1;  4X8W A;  2H36 X;  2FGG A;  4DR1 I;  3ZZT A;  2L3C A;  2DB2 A;  4USM A;  1ELO A;  1N32 E;  2LTR A;  4LF7 E;  2LMZ A;  4DV4 I;  1Z0C A;  3J81 Q;  2FTX B;  4YHH E;  2E1M A;  4HY1 A;  2ODR C;  4DV0 I;  4ED4 A;  4GKK I;  4JI2 I;  2Q2E B;  2Z5E A;  2LRS A;  4JI1 I;  2UXC I;  1FJG E;  2O1W A;  4DV2 I;  2CGE A;  2NUF A;  3IWB A;  4URL A;  4OX9 E;  4DV3 I;  2IOP A;  2WW4 A;  2JOB A;  1ZXM A;  4DR4 I;  4BC7 A;  2B7V A;  4DV3 E;  3B82 A;  4LFB I;  3RMP A;  5FLX C;  2UU9 E;  4DR3 I;  4Q28 A;  3PYG A;  4DUZ I;  1I94 E;  4YHH I;  4KZS A;  3AUZ A;  4X64 I;  1USV A;  4DV4 E;  2DSY A;  4JI0 E;  3OTO I;  4X65 E;  1ZXN A;  2Z5B B;  4JI6 I;  3VYY A;  2UUC I;  2ZBK B;  1H73 A;  4GKJ E;  1T4L B;  1N36 E;  2J7K A;  4LU9 A;  2V86 A;  3H09 A;  4M2Z A;  5IT9 C;  3GON A;  4KHP I;  3PYD A;  4HYM A;  1H7U A;  4WPY A;  1J5E I;  5T6J A;  4LF9 E;  1KIJ A;  2HKE A;  4B3M I;  1XNQ E;  2JY9 A;  3DF6 A;  3ADJ A;  1HNZ E;  4DV6 I;  1IBM E;  2L8T A;  2WZO A;  1HNW E;  1Y4S A;  4DR2 I;  4JYA I;  1K47 A;  3ADI A;  4MYU A;  1RRE A;  2DEJ A;  4DPT A;  4JYA E;  4DV1 E;  2X36 A;  4X66 I;  3LPS A;  3J80 C;  4LFC I;  2L6M A;  4DPW A;  4LF4 E;  4LTY A;  2VQF E;  3J81 C;  4XTJ A;  3J7A M;  2UUA I;  1H74 A;  2LUP B;  4JV5 E;  2L2M A;  1N33 I;  1O0W A;  3AV0 A;  2L2N A;  4DPX A;  1DI2 A;  2V8P A;  2JVA A;  1XNQ I;  2MC6 A;  2Z5B A;  1PIE A;  5BR8 I;  4JI4 I;  5IWA I;  4DU8 A;  2F4V E;  2ZM6 I;  2KHX A;  4DV7 E;  1HR0 I;  2UXB I;  1WUU A;  3ZKD A;  5LMN I;  4DR7 I;  4P78 A;  2XEX A;  2B7T A;  2L3J A;  3PYE A;  1N36 I;  4JI5 I;  3K1J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...