3JAMC

Cryoem structure of 40s-eif1a-eif1 complex from yeast
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
217
structure length
217
Chain Sequence
b'GWVPVTKLGRLVKAGKISSIEEIFLHSLPVKEFQIIDQLLPNLKDEVMNIKPVQKQTRAGQRTRFKAVVVVGDSNGHVGLGIKTAKEVAGAIRAGIIIAKLSVIPIRRGYWGTNLGQPHSLATKTSGKCGSVSVRLIPAPRGSGIVASPAVKKLMQLAGVEDVYTSSTGSTRTLENTLKAAFVAIGNTYGFLTPNLWEVQALTPSPMDVYADYATAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 18S rRNA
publication title Conformational Differences between Open and Closed States of the Eukaryotic Translation Initiation Complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Translation
total genus 43
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
C PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.770 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3jamC01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 3jamC02
1XMQI 4FN5A 3ZZTA 3OTOI 4DV5I 4DR7E 5LMNI 2UUAI 3J7AG 1EI1A 4LF4I 5GMEA 2Q2EB 3JAMQ 4JG4A 1XNQI 1IBKE 5LL6R 2UXCE 4LF6I 4X64I 4KHPE 4FW9A 4DV3I 4M1KA 4B3TI 1NHHA 2A2DA 4NXME 4MYTA 4JI0E 4JI7I 4DR2I 1S4EA 1HNXI 3ZKBA 3H4LA 4PRXA 2ZM6I 4DV1I 2F4VI 1NHIA 5IWAI 1ELOA 4B3RI 4DPYA 4I3HA 3PYDA 4X62I 4JI3E 4HACA 4YY3I 3B82A 3PYGA 3K1JA 4X66I 4K0KE 1H73A 3T1YI 4JI8I 1MU5A 4AQYE 4DR1I 2HHHE 2V2QA 3B78A 1S16A 4DR5E 4LF7I 4Z7YA 1Z59A 4DU8A 5BR8I 1Z0TA 1H74A 5A2QQ 4DV2I 2E5LE 3K17A 4B3SE 3QT7A 4LFCI 1HNWE 2HFSA 4X65I 2DEJA 2E1RA 4LF9E 1D6TA 2VQEE 4HY1A 4DV4E 4JI5I 4JI2I 1N33E 4NXNI 2HK3A 3HULA 4DV7I 2UUCI 3T1HE 2BM1A 1ZM4A 1KIJA 3ZZ0A 1XMOE 4B3ME 4DR3E 1A6FA 4JYAE 2HKJA 4YHHE 4DUZE 4DR6I 3GONA 2BM0A 4JV5I 1NZ0A 3WU6A 1IBLE 1FJGI 1N0VC 1B63A 2VF3A 3WU5A 2BV3A 2UXCI 4KHPI 5LMUE 1Z0GA 2HKEA 4LFAE 1N34E 4LFBE 4DV0I 4DUYE 1Z0CA 2V34A 1XNRI 4JI6I 3PYEA 3CWVA 4NXMI 4FWDA 2ZITA 5FLXC 4LF5E 1IBMI 4HACB 3OTOE 2UUAE 4DV6E 5A2QC 2DEIA 2UU9I 4JI3I 2VQFE 4HXZA 1N0UA 1XNQE 4LF6E 4X64E 4K0KI 2HFUA 3QT5A 1N32E 1XHKA 2X36A 1RR9A 1FWKA 1MG7A 4DV3E 1N36E 1MX0A 4OX9E 4JI7E 2R3VA 1HNXE 1DARA 5FLXQ 2F4VE 3J7AM 4DR4I 4B3RE 4USMA 2XEXA 4B3SI 1ZXMA 4YY3E 1EA6A 4ED4A 2J7KA 1H72C 1Z0VA 5GMDA 4LF9I 3J81Q 4JI8E 4DV4I 1H7SA 3WU4A 1KKHA 3PYFA 3WU3A 1KVKA 4DR1E 1J5EI 3ZZUA 4WUDA 4GKKI 4B3MI 5IT9C 4WUBA 1WUUA 4XTJA 5BR8E 4DR3I 4JI1I 4LF8E 3F0NA 4DUZI 2UXDI 4LFCE 1Z0WA 2UUBI 4JI4E 1FI4A 2AJ4A 4WUCA 2LJPA 1I94I 4R1FA 4JI5E 4JI2E 4URLA 3LPSA 3Q1QA 4GKJI 2A2CA 4DV7E 4DR7I 1HR0E 4P7AA 1UEKA 3V5RA 5IT9Q 4DR6E 5LMUI 1IBKI 1ZXNA 4USKA 5L3JA 1N34I 1U2RA 2V2ZA 4JV5E 1HNZE 2UXBE 2OI2A 4LF5I 1FJGE 3M6AA 4JI0I 3D4JA 4UTGA 1PIEA 1VISA 2WW4A 1XMQE 4DV5E 4DV6I 1FKAE 2GS8A 5LMNE 2VQFI 2V8PA 4LF4E 1K47A 4RPFA 3ZM7A 4DU7A 1N32I 3J81C 4PU9A 3LTOA 1H7UA 4DV0E 1Z5CA 1XNRE 2CZ9A 4JI6E 4AQYI 4DPTA 1OJ4A 1N36I 4MYUA 4OX9I 1PKPA 4B3TE 2HHHI 1IBME 3J80Q 4ZVIA 4DR5I 4DR2E 2ZM6E 4DV1E 1PVGA 2NPFA 3LNUA 5IWAE 2UU9E 4DXLA 4X62E 2E5LI 4DPWA 4DPUA 1HNWI 4HYMA 3V2UC 1Z5BA 1QZRA 4X66E 3QT6A 1KTVA 3B8HA 2VQEI 3T1YE 1Z0EA 1N33I 4FWGA 4KQVA 4UT4A 3T1HI 4LF7E 4DR4E 1NHJA 4LF8I 1B62A 1Z5AA 2EFGA 3QT8A 1XMOI 4FWHA 4P52A 4DV2E 4JI4I 4JYAI 4YHHI 1FNMA 4X65E 4Z7CA 2HK2A 4DPXA 2X7IA 1J5EE 2ZBKB 1IBLI 4NXNE 1ZM3A 3ZKDA 4PRVA 1ZM9A 1HR0I 1BKNA 4GKKE 2UUCE 3JAMC 1FWLA 1ZM2A 4JI1E 2V2VA 2UXDE 2UUBE 1RREA 4LFAI 4LFBI 1I94E 1HNZI 1Z0BA 4EMDA 2UXBI 2R42A 4DUYI 3J80C 4GKJE
chains in the Genus database with same CATH superfamily
1QNTA 5AASA 1UDQA 4FN5A 3ZZTA 1XMQI 3OTOI 4DR7E 4DV5I 1A1FA 5LMNI 2EPRA 4M30A 2UUAI 2DRPA 3J7AG 2YU8A 2J7JA 5JEAC 1EI1A 4LF4I 2G7HA 5GMEA 2DLKA 1YSAC 4HEIA 2Q2EB 3JAMQ 4JG4A 2BBGA 2EOQA 4WPYA 2LT7A 1R6MA 1Y4SA 3KRNA 1XNQI 1IBKE 3CDIA 4FW5A 2YTOA 5LL6R 2UXCE 1USVA 1EH8A 2BA1G 4X64I 2RS7A 3THOB 4KHPE 4LF6I 1YZ9A 1BB8A 2YTIA 3M85G 5JEAB 2YSOA 4AM3A 1RQ0A 1EKZA 1UN6B 2JEBA 4FW9A 2PO1B 2EPLX 2EPNA 4FW6A 4DV3I 2ENCA 4M1KA 4KWYA 4F9BB 1NHHA 1AH5A 1UDNA 4F2JC 2A2DA 4B3TI 4NXME 2EL5A 4MYTA 2EZ6A 2WCC3 2DLQA 4JI0E 4WSPA 5KL4A 2EMCA 4JI7I 4DR2I 2EP3A 1S4EA 2FGGA 1WHNA 5EKWA 3ZKBA 2EL4A 1JK2A 3AUZA 2WP8B 3H4LA 4PRXA 2ZM6I 4DV1I 5TSEA 4MU1A 2F4VI 2GHFA 4BC7A 1NHIA 5IWAI 5C0XF 1ELOA 5K36E 4B3RI 4DPYA 4I3HA 2PNLA 3PYDA 4IS1C 2EMXA 4X62I 2ADRA 1GTKA 2YRHA 4JI3E 4HACA 4YY3I 3B82A 2LJUA 5K36D 4LCFA 4Q35B 3J7Yp 3PYGA 2DSYA 3K1JA 4X66I 4R2QA 4K0KE 2NN6C 2EMLA 1H73A 4LPFA 3KZYA 3ADGA 3T1YI 4JI8I 4IZJD 2VE7C 2JWOA 3L00A 1MU5A 4WXDA 4AQYE 3ECRA 2EOMA 5AE1A 1UHZA 4DR1I 2HHHE 3C6KA 1L4SA 1DQ3A 2V2QA 3B78A 2V83A 1S16A 5K36A 4DR5E 2NN6B 3THNA 1UDOA 4LF7I 2EPKX 2I13A 4Q28A 4Z7YA 4IZJA 1UBDC 1Z59A 5JEAF 2EPMX 3UHMA 4WX9A 2PO2A 2M4IA 4DU8A 4BA1A 5BR8I 1Z0TA 1H74A 5A2QQ 4DV2I 2ELZA 2E5LE 3K17A 4B3SE 4IFDD 3AV0A 4OO1E 2EN4A 3QT7A 4LFCI 5DNYA 2C37A 1HNWE 2HFSA 4X65I 2GO4A 2EMYA 1TF3A 3EPLA 1XXEA 2JY9A 2EM0A 2EQ1A 2RPCA 1WJPA 4LF9E 2DEJA 5LLQA 2E1RA 2IERA 2EM6A 5AC5A 3Q6NA 1D6TA 2VQEE 4HY1A 2YZTA 4DV4E 4AIMA 2MC5A 5KL7A 4JI5I 2O1WA 4IFDA 1RC7A 4ZYGA 3VYYA 4JI2I 2CSHA 1N33E 2KOUA 3VK6A 4NXNI 4BHBA 2HK3A 1A1JA 4O24A 1R6LA 3HULA 2YPNA 4DV7I 2UUCI 3T1HE 2BM1A 2EPAA 1ZM4A 1PDAA 3K6QA 1KIJA 3ZZ0A 2YTEA 1XMOE 2L6MA 2JEAB 4B3ME 1SR9A 2M9AA 3FIGA 4DR3E 1A6FA 5IXMB 4R03A 4BS9A 2V88A 4JYAE 2HKJA 4YHHE 4DUZE 4DR6I 4LU9A 2K4VA 3CDJA 2BA1D 1TF6A 4LOMA 2YTPA 3M85D 2EOXA 3GONA 2ODRD 4P7DA 3K85A 2BM0A 4R2PA 2JYAA 2LRSA 2LV2A 4TUIA 4IZKA 4JV5I 1NZ0A 4DKKA 3U1YA 1X49A 1DI2A 1X48A 3WU6A 1T39A 3P76A 5KL2A 1IBLE 3MHSC 2JPAA 3C4BA 1FJGI 2EPUA 1HNXI 2J65A 4M9VC 3HKMA 2MKDA 2YRKA 5C0XE 3IWDA 5IV8B 4R2DA 1N0VC 4FW3A 1NEIA 1B63A 2EMAA 2V85A 2ENAA 2JXPA 1UDSA 1BBGA 1PJTA 5AE2A 3Q6MA 2EPCA 2AE8A 3PS2A 2VF3A 2MDRA 3WU5A 5C0XD 2BV3A 4I8OA 4RH8A 2PRTA 2UXCI 3QG5C 4OKGA 4KHPI 2RSMA 5LMUE 1Z0GA 2HKEA 2NUFA 2EOIA 2M7QA 4LFAE 2CT1A 2GO3A 1N34E 4GQUA 4LFBE 1ZBTA 2Z5EA 3PS1A 2Z5CB 1N3GA 1Y60A 3VHTB 2FTXB 3HQ1A 4ZYDA 2EJ4A 4DUYE 1Z0CA 2V34A 2PNZB 1G2DC 4FK5C 3CWVA 3PYEA 4JI6I 4NXMI 3RMPA 4FWDA 2ZITA 2F8BA 3DJWA 5FLXC 4N3OA 4LF5E 3HXLA 5C0XA 2LTSA 2V89A 1IQOA 2YTQA 4WFTA 4F6NA 1IBMI 2EM7A 3P1XA 2JOBA 3OTOE 4LTYA 1KJKA 3P3GA 4HACB 1IMUA 1JK1A 2UUAE 4QNKA 2EM2A 4R2SA 3ADIA 3GLLA 3KZZA 4DV6E 5A2QC 1X6HA 2DEIA 1X3CA 2UU9I 4JI3I 1GQEA 2VQFE 4HXZA 1N0UA 1XNQE 5JEAD 2NUGA 1YYWA 4J8ZA 4LF6E 4X64E 2ENHA 4K0KI 2B3TB 1X47A 3BBGA 2HFUA 1N32E 2EM4A 1XHKA 3QT5A 2X36A 2KHXA 1RR9A 4WYQB 5K36B 4L8NA 4BMJA 4P78A 3L7ZB 4WXCA 5AC4A 1FWKA 3EPHA 1MG7A 4DV3E 2JE6A 1IQSA 1GZ6A 2YRMA 3BF2A 3H09A 4F9CB 1F2IG 1YYOA 4MDTA 5DRQA 5JEAA 1N36E 4OX9E 1MX0A 4JI7E 2R3VA 1T4NA 1B69A 4BA1B 1HNXE 3H1CA 1DARA 3F6GA 5ELWA 5FLXQ 3MSWA 2F4VE 4LCHA 1YFHA 3J7AM 2Q8UA 2BA0G 4IFDE 4TUGA 2YWQA 2L2MA 4DR4I 3F6HA 4B3RE 1TN9A 2C38B 2WP8A 4USMA 2XEXA 1O0WA 4B3SI 5FWKA 1ZXMA 4YY3E 2YTNA 1EA6A 4OO1C 2EN6A 4ED4A 2J7KA 1H72C 2RS6A 2YTDA 1Z0VA 4MU0A 2EPPA 5GMDA 4LF9I 3U1KA 3J81Q 1A1HA 4RHBB 2EL6A 4JI8E 4DV4I 2VRDA 1H7SA 3HPSA 2EOYA 3WU4A 4MU4A 1KKHA 5A6BD 3PYFA 1KVKA 4DR1E 3WU3A 4BBYA 4OO1B 1YH8A 1J5EI 2O1UA 2R76A 2O1TA 5A6KA 2L3JA 2EORA 4BC9A 5DNLA 1Z1BA 2V8QB 5AE3A 1Y6ZA 3ZZUA 3GMEA 2L33A 2B7VA 4GZNC 4BA2B 1P42A 4WUDA 2DB2A 4GKKI 1SFEA 5DNXA 4B3MI 1T38A 2BR2A 2WBSA 5IT9C 1WUUA 4WUBA 5A6BA 5BR8E 4XTJA 4DR3I 4JI1I 4LF8E 1QU6A 3OMLA 2EMKA 2ELYA 2FV4B 2MC6A 3F0NA 4DUZI 2UXDI 4ZYEA 2LJHA 4LFCE 1Z0WA 2YSPA 2C39A 2UUBI 1USUA 4JI4E 4J3DA 2LO3A 2EMWA 2EOJA 5A6JA 2IESA 2PO0B 2R1FA 4ZYHA 1FI4A 2AJ4A 4WUCA 2LJPA 1WXRA 1YYKA 2NN6F 1I94I 4R1FA 4JI5E 2EOSA 4R2AA 4JI2E 2PNMA 4O43A 2EN3A 4URLA 5ADZA 3LPSA 3Q1QA 4GKJI 2LVHA 3KWRA 4F9AB 4LCGA 4GEQB 1ZU1A 4DMIA 4DV7E 1OYRA 2A2CA 4MU3A 3IWBA 1NCSA 5C0XC 4DR7I 1HR0E 4O5GA 2I9IA 2L8TA 4P7AA 2JP9A 4WSGA 2EQ3A 1KYQA 1UEKA 4OO1F 3V5RA 2YTGA 5IT9Q 2B7TA 2DIXA 2RTXA 4DR6E 1YPNA 5LMUI 4F54A 2JEBB 1IBKI 1ZXNA 2JEAA 5C0XB 4USKA 5L3JA 1N34I 1YUJA 2WZOA 2O3ZA 1E3PA 4X9JA 4GKJE 3HPZA 1U2RA 5F3WA 2LCEA 1T4LB 4IS9A 4IJDA 2V2ZA 4JV5E 2M1SA 2RSIA 1A1LA 1HNZE 3M7ND 1X6EA 2UXBE 2OI2A 4LF5I 3EPJA 2EM3A 2YTJA 1FJGE 2LUQA 3M6AA 4JI0I 2LTRA 3UK3C 3ZOQB 3D4JA 4UTGA 1PIEA 1Y5YA 2KONA 1Y4UA 2CGEA 1VISA 2WNRA 2WW4A 2Z5BA 3MHHC 1XMQE 2EOHA 4R2CA 4DV5E 2BA0D 4DV6I 1FKAE 2GS8A 5LMNE 1X5WA 2MKNA 5JEAE 2VQFI 2V8PA 5K36C 2LBSB 4LF4E 2JR1A 1WHQA 2F1DA 1RMDA 1K47A 2CVEA 2JE6B 2EM8A 4RPFA 3ZM7A 4DU7A 2EN2A 2IHR1 2EOEA 1N32I 2L2KB 3J81C 2E1MA 4PU9A 2EWLA 3LTOA 2CPNA 1A1KA 3PRYA 2GQ0A 3BIDA 2EN7A 1H7UA 2CG9A 4DV0E 4FW4A 2LE2A 1Z5CA 1XNRE 4JI6E 1PJQA 2CZ9A 5EL9A 2L92A 5T6JA 4AQYI 2WBUA 1OJ4A 4DPTA 4MYUA 1N36I 4OX9I 1PKPA 1EH6A 2LUPB 4B3TE 2O1VA 5DRPA 2EMZA 4QNJA 2NA2A 4U3DA 2HHHI 2Z5CA 4IZJB 3M7NG 1IBME 3J80Q 2EN1A 2DMYA 2CTDA 2PNZA 4N4RB 4ZVIA 2PO2B 4DR5I 4DR2E 2IOPA 4NBQA 2PO1A 5CFFE 3LMLA 2EMFA 2ZM6E 2EOOA 1T4OA 4DV1E 4IFDC 4R2EA 1PVGA 2NPFA 3LNUA 5IWAE 2V86A 2UU9E 2C37B 4DXLA 2DGCA 4U3BA 5DRRA 2GPIA 3C6MA 2YT4A 3HTXA 4ISAA 4X62E 2E5LI 1HK7A 4DPWA 1X6FA 4AIDA 1OYPA 4DPUA 1HNWI 2H36X 2N8XA 2YU5A 4HYMA 3ADJA 3TQMA 4IFDB 1E3HA 3V2UC 2NN6E 1Z5BA 1QZRA 4MLQA 4BHCA 4X66E 3DF6A 1UILA 3QT6A 2NABA 1KTVA 4HTGA 2E72A 4NHRA 3B8HA 4KZSA 3T1YE 1MGTA 2VQEI 3M99B 1ZAAC 4LF8I 1ZR9A 2JT2A 3DD6A 3EQ1A 4DV0I 1Z0EA 2JVAA 2BR2B 2NN6D 3L7ZA 1N33I 1BBOA 4OZEA 2EPOA 4FWGA 2B9DA 1G2FC 4R2RA 2EM5A 2EOFA 4KQVA 2C39B 2YTFA 2VESA 2EE8A 2DMIA 3P3EA 3JTZA 4UT4A 3ADLA 3T1HI 4LF7E 3C4TA 5KL6A 4DR4E 4OOGC 4FW7A 1NHJA 2BB8A 2EM9A 2HC5A 5A6AA 1LLMC 1B62A 1Z5AA 2EFGA 3QT8A 1XMOI 5K36F 2EN8A 1VI7A 4FWHA 2NN6A 4P52A 4L5NC 4DV2E 2LMZA 4JI4I 1YUIA 4M0VA 5KL5A 1P47A 2C38A 4JYAI 2ODRC 4YHHI 4IZKB 2VF1A 4O4KA 3IWCA 1WRJA 4X65E 1FNMA 4OO1D 4Z7CA 1A1IA 2HK2A 2HGHA 4DPXA 1RHYA 4M2ZA 2EMBA 2X7IA 3JU0A 1J5EE 4MLVA 1A1GA 3B4TA 1STUA 2N3HA 4NZVA 1J26A 2ZBKB 1IBLI 4NXNE 2HJJA 1AAYA 1ZM3A 3PS3A 3ZKDA 4PRVA 1ZM9A 4OO1A 1OYSA 2L2NA 3VYXA 1HR0I 4IFDF 2WBTA 4GKKE 1BKNA 2UUCE 3EPKA 3JAMC 1FWLA 2EMIA 2EPZA 3P3CA 3BGHA 2K7IA 4F6MA 1ZM2A 3GCMA 3NZKA 4MQYA 2A25A 2GLIA 4JI1E 4R8OA 2EOZA 2V2VA 2UXDE 4X8WA 1EH7A 2V87A 4BA2A 1MEYC 2UUBE 1ZBQA 1RREA 3HJCA 2N3GA 5A69A 2L3CA 2EPXA 1PJSA 4BCAA 1DGCA 2D9HA 1YHCA 4LFAI 4LFBI 2EQ0A 2EMGA 1I94E 2IOQA 2WNRB 1HNZI 2NUEA 3LLHA 5KL3A 1Z0BA 2Z5BB 4EMDA 1XNRI 2UXBI 2R42A 4DUYI 2PO0A 2JOXA 2RQLA 3J80C 2EMHA 2MDGA 5DROA 3P06A
chains in the Genus database with same CATH topology
5AASA 1XMQI 4FN5A 3ZZTA 3OTOI 4DR7E 4DV5I 5LMNI 4M30A 2UUAI 3J7AG 1EI1A 4LF4I 2G7HA 5GMEA 2Q2EB 3JAMQ 4JG4A 4WPYA 1Y4SA 1XNQI 1IBKE 5LL6R 2UXCE 1USVA 4LF6I 4X64I 2RS7A 4KHPE 1YZ9A 1RQ0A 1EKZA 4FW9A 4DV3I 4M1KA 4F9BB 4B3TI 1NHHA 2A2DA 4NXME 4MYTA 2EZ6A 4JI0E 4WSPA 4JI7I 4DR2I 1S4EA 2FGGA 1WHNA 1HNXI 3ZKBA 3H4LA 3AUZA 4PRXA 2ZM6I 4DV1I 2F4VI 4BC7A 1NHIA 5IWAI 1ELOA 4B3RI 4DPYA 4I3HA 2PNLA 3PYDA 4X62I 4JI3E 4HACA 4YY3I 3B82A 3PYGA 3J7Yp 2DSYA 3K1JA 4X66I 4K0KE 1H73A 3ADGA 3T1YI 4JI8I 4IZJD 2VE7C 2JWOA 1MU5A 4AQYE 5AE1A 1UHZA 4DR1I 2HHHE 1DQ3A 2V2QA 3B78A 2V83A 1S16A 4DR5E 4LF7I 4Q28A 4Z7YA 4IZJA 1Z59A 2M4IA 4DU8A 5BR8I 1Z0TA 1H74A 5A2QQ 4DV2I 2E5LE 3K17A 4B3SE 3AV0A 3QT7A 4LFCI 5DNYA 1HNWE 2HFSA 4X65I 2JY9A 2DEJA 2E1RA 4LF9E 3Q6NA 1D6TA 2VQEE 4HY1A 2YZTA 4DV4E 2MC5A 4JI5I 2O1WA 1RC7A 3VYYA 4JI2I 1N33E 2KOUA 3VK6A 4NXNI 2HK3A 3HULA 4DV7I 2UUCI 3T1HE 2BM1A 1ZM4A 3K6QA 1KIJA 3ZZ0A 1XMOE 2L6MA 4B3ME 1SR9A 3FIGA 4DR3E 1A6FA 4R03A 4BS9A 2V88A 4JYAE 2HKJA 4YHHE 4DUZE 4DR6I 4LU9A 2K4VA 3GONA 2ODRD 4P7DA 3K85A 2BM0A 2LRSA 4TUIA 4IZKA 4JV5I 1NZ0A 4DKKA 1X49A 1DI2A 1X48A 3WU6A 1IBLE 1FJGI 3C4BA 3IWDA 1N0VC 1B63A 2V85A 5AE2A 3Q6MA 2VF3A 2MDRA 3WU5A 2BV3A 4I8OA 2UXCI 4KHPI 2RSMA 5LMUE 1Z0GA 2HKEA 2NUFA 2M7QA 4LFAE 1N34E 4LFBE 1ZBTA 2Z5EA 2Z5CB 4DV0I 2FTXB 3HQ1A 4DUYE 1Z0CA 2V34A 1XNRI 4JI6I 3PYEA 3CWVA 4NXMI 3RMPA 4FWDA 2ZITA 2F8BA 3DJWA 5FLXC 4N3OA 4LF5E 3HXLA 2LTSA 2V89A 4WFTA 1IBMI 3P1XA 2JOBA 3OTOE 4LTYA 4HACB 2UUAE 3ADIA 4DV6E 5A2QC 2DEIA 2UU9I 4JI3I 1GQEA 2VQFE 4HXZA 1N0UA 1XNQE 2NUGA 1YYWA 4J8ZA 4LF6E 4X64E 4K0KI 2B3TB 1X47A 2HFUA 1N32E 3QT5A 1XHKA 2X36A 2KHXA 1RR9A 4WYQB 4L8NA 4BMJA 4P78A 1FWKA 1MG7A 4DV3E 1GZ6A 3H09A 4F9CB 1YYOA 1N36E 4OX9E 1MX0A 4JI7E 2R3VA 1T4NA 1HNXE 1DARA 3F6GA 5FLXQ 3MSWA 2F4VE 3J7AM 4TUGA 2L2MA 4DR4I 3F6HA 4B3RE 4USMA 2XEXA 1O0WA 4B3SI 5FWKA 1ZXMA 4YY3E 1EA6A 4ED4A 2J7KA 1H72C 2RS6A 1Z0VA 5GMDA 4LF9I 3J81Q 4JI8E 4DV4I 1H7SA 3HPSA 3WU4A 1KKHA 3PYFA 3WU3A 1KVKA 4DR1E 4BBYA 1J5EI 2O1UA 2O1TA 2L3JA 4BC9A 1Y6ZA 2V8QB 5AE3A 3ZZUA 2L33A 2B7VA 4WUDA 2DB2A 4GKKI 4B3MI 5IT9C 4WUBA 1WUUA 4XTJA 5BR8E 4DR3I 4JI1I 4LF8E 1QU6A 3OMLA 3F0NA 2FV4B 2MC6A 4DUZI 2UXDI 2LJHA 4LFCE 1Z0WA 2UUBI 1USUA 4JI4E 1FI4A 2AJ4A 4WUCA 2LJPA 1WXRA 1YYKA 1I94I 4R1FA 4JI5E 4JI2E 2PNMA 4URLA 5ADZA 3LPSA 3Q1QA 4GKJI 3KWRA 4F9AB 4GEQB 4DMIA 4DV7E 2A2CA 3IWBA 4DR7I 1HR0E 2L8TA 4P7AA 1UEKA 3V5RA 5IT9Q 2B7TA 2DIXA 2RTXA 4DR6E 5LMUI 1IBKI 4F54A 1ZXNA 4USKA 5L3JA 1N34I 2WZOA 3HPZA 1U2RA 5F3WA 1T4LB 2V2ZA 4JV5E 2M1SA 1HNZE 2UXBE 2OI2A 4LF5I 1FJGE 2LUQA 3M6AA 4JI0I 2LTRA 3D4JA 3ZOQB 4UTGA 1PIEA 2KONA 1Y4UA 2CGEA 1VISA 2WW4A 2Z5BA 1XMQE 4DV5E 4DV6I 1FKAE 2GS8A 5LMNE 2VQFI 2V8PA 2LBSB 4LF4E 2JR1A 1WHQA 1K47A 4RPFA 3ZM7A 4DU7A 2IHR1 1N32I 2L2KB 3J81C 2E1MA 4PU9A 2EWLA 3LTOA 2CPNA 3PRYA 2GQ0A 1H7UA 2CG9A 4DV0E 2LE2A 1Z5CA 1XNRE 4JI6E 2CZ9A 2L92A 5T6JA 4AQYI 4DPTA 1OJ4A 1N36I 4MYUA 4OX9I 1PKPA 2LUPB 4B3TE 2O1VA 2HHHI 2NA2A 2Z5CA 4IZJB 1IBME 3J80Q 2DMYA 4ZVIA 4DR5I 4DR2E 2IOPA 5CFFE 3LMLA 2ZM6E 4DV1E 1T4OA 1PVGA 2NPFA 3LNUA 5IWAE 2V86A 2UU9E 4DXLA 3HTXA 2YT4A 4X62E 2E5LI 1HK7A 4DPWA 4DPUA 1HNWI 2H36X 4HYMA 3ADJA 3V2UC 1Z5BA 1QZRA 4X66E 3DF6A 1UILA 3QT6A 1KTVA 3B8HA 4KZSA 3T1YE 2VQEI 1Z0EA 2JVAA 1N33I 4FWGA 2B9DA 4KQVA 4UT4A 3JTZA 3ADLA 3T1HI 4LF7E 3C4TA 4DR4E 4OOGC 1NHJA 4LF8I 1B62A 1Z5AA 2EFGA 3QT8A 1XMOI 4FWHA 4P52A 4L5NC 4DV2E 2LMZA 4JI4I 4M0VA 4JYAI 2ODRC 4YHHI 4IZKB 2VF1A 3IWCA 4X65E 1FNMA 4Z7CA 2HK2A 4DPXA 4M2ZA 2X7IA 3JU0A 1J5EE 1STUA 2N3HA 1J26A 2ZBKB 1IBLI 4NXNE 1ZM3A 3ZKDA 4PRVA 1ZM9A 2L2NA 3VYXA 1HR0I 4GKKE 1BKNA 2UUCE 3JAMC 1FWLA 1ZM2A 4JI1E 4R8OA 2V2VA 2UXDE 4X8WA 2V87A 2UUBE 1RREA 1ZBQA 3HJCA 2N3GA 2L3CA 4BCAA 4LFAI 4LFBI 1I94E 2IOQA 1HNZI 2NUEA 3LLHA 1Z0BA 2Z5BB 4EMDA 2UXBI 2R42A 4DUYI 2JOXA 3J80C 4GKJE 3P06A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XMQ I;  4FN5 A;  3ZZT A;  3OTO I;  4DV5 I;  4DR7 E;  5LMN I;  2UUA I;  3J7A G;  1EI1 A;  4LF4 I;  5GME A;  2Q2E B;  3JAM Q;  4JG4 A;  1XNQ I;  1IBK E;  5LL6 R;  2UXC E;  4LF6 I;  4X64 I;  4KHP E;  4FW9 A;  4DV3 I;  4M1K A;  4B3T I;  1NHH A;  2A2D A;  4NXM E;  4MYT A;  4JI0 E;  4JI7 I;  4DR2 I;  1S4E A;  1HNX I;  3ZKB A;  3H4L A;  4PRX A;  2ZM6 I;  4DV1 I;  2F4V I;  1NHI A;  5IWA I;  1ELO A;  4B3R I;  4DPY A;  4I3H A;  3PYD A;  4X62 I;  4JI3 E;  4HAC A;  4YY3 I;  3B82 A;  3PYG A;  3K1J A;  4X66 I;  4K0K E;  1H73 A;  3T1Y I;  4JI8 I;  1MU5 A;  4AQY E;  4DR1 I;  2HHH E;  2V2Q A;  3B78 A;  1S16 A;  4DR5 E;  4LF7 I;  4Z7Y A;  1Z59 A;  4DU8 A;  5BR8 I;  1Z0T A;  1H74 A;  5A2Q Q;  4DV2 I;  2E5L E;  3K17 A;  4B3S E;  3QT7 A;  4LFC I;  1HNW E;  2HFS A;  4X65 I;  2DEJ A;  2E1R A;  4LF9 E;  1D6T A;  2VQE E;  4HY1 A;  4DV4 E;  4JI5 I;  4JI2 I;  1N33 E;  4NXN I;  2HK3 A;  3HUL A;  4DV7 I;  2UUC I;  3T1H E;  2BM1 A;  1ZM4 A;  1KIJ A;  3ZZ0 A;  1XMO E;  4B3M E;  4DR3 E;  1A6F A;  4JYA E;  2HKJ A;  4YHH E;  4DUZ E;  4DR6 I;  3GON A;  2BM0 A;  4JV5 I;  1NZ0 A;  3WU6 A;  1IBL E;  1FJG I;  1N0V C;  1B63 A;  2VF3 A;  3WU5 A;  2BV3 A;  2UXC I;  4KHP I;  5LMU E;  1Z0G A;  2HKE A;  4LFA E;  1N34 E;  4LFB E;  4DV0 I;  4DUY E;  1Z0C A;  2V34 A;  1XNR I;  4JI6 I;  3PYE A;  3CWV A;  4NXM I;  4FWD A;  2ZIT A;  5FLX C;  4LF5 E;  1IBM I;  4HAC B;  3OTO E;  2UUA E;  4DV6 E;  5A2Q C;  2DEI A;  2UU9 I;  4JI3 I;  2VQF E;  4HXZ A;  1N0U A;  1XNQ E;  4LF6 E;  4X64 E;  4K0K I;  2HFU A;  3QT5 A;  1N32 E;  1XHK A;  2X36 A;  1RR9 A;  1FWK A;  1MG7 A;  4DV3 E;  1N36 E;  1MX0 A;  4OX9 E;  4JI7 E;  2R3V A;  1HNX E;  1DAR A;  5FLX Q;  2F4V E;  3J7A M;  4DR4 I;  4B3R E;  4USM A;  2XEX A;  4B3S I;  1ZXM A;  4YY3 E;  1EA6 A;  4ED4 A;  2J7K A;  1H72 C;  1Z0V A;  5GMD A;  4LF9 I;  3J81 Q;  4JI8 E;  4DV4 I;  1H7S A;  3WU4 A;  1KKH A;  3PYF A;  3WU3 A;  1KVK A;  4DR1 E;  1J5E I;  3ZZU A;  4WUD A;  4GKK I;  4B3M I;  5IT9 C;  4WUB A;  1WUU A;  4XTJ A;  5BR8 E;  4DR3 I;  4JI1 I;  4LF8 E;  3F0N A;  4DUZ I;  2UXD I;  4LFC E;  1Z0W A;  2UUB I;  4JI4 E;  1FI4 A;  2AJ4 A;  4WUC A;  2LJP A;  1I94 I;  4R1F A;  4JI5 E;  4JI2 E;  4URL A;  3LPS A;  3Q1Q A;  4GKJ I;  2A2C A;  4DV7 E;  4DR7 I;  1HR0 E;  4P7A A;  1UEK A;  3V5R A;  5IT9 Q;  4DR6 E;  5LMU I;  1IBK I;  1ZXN A;  4USK A;  5L3J A;  1N34 I;  1U2R A;  2V2Z A;  4JV5 E;  1HNZ E;  2UXB E;  2OI2 A;  4LF5 I;  1FJG E;  3M6A A;  4JI0 I;  3D4J A;  4UTG A;  1PIE A;  1VIS A;  2WW4 A;  1XMQ E;  4DV5 E;  4DV6 I;  1FKA E;  2GS8 A;  5LMN E;  2VQF I;  2V8P A;  4LF4 E;  1K47 A;  4RPF A;  3ZM7 A;  4DU7 A;  1N32 I;  3J81 C;  4PU9 A;  3LTO A;  1H7U A;  4DV0 E;  1Z5C A;  1XNR E;  2CZ9 A;  4JI6 E;  4AQY I;  4DPT A;  1OJ4 A;  1N36 I;  4MYU A;  4OX9 I;  1PKP A;  4B3T E;  2HHH I;  1IBM E;  3J80 Q;  4ZVI A;  4DR5 I;  4DR2 E;  2ZM6 E;  4DV1 E;  1PVG A;  2NPF A;  3LNU A;  5IWA E;  2UU9 E;  4DXL A;  4X62 E;  2E5L I;  4DPW A;  4DPU A;  1HNW I;  4HYM A;  3V2U C;  1Z5B A;  1QZR A;  4X66 E;  3QT6 A;  1KTV A;  3B8H A;  2VQE I;  3T1Y E;  1Z0E A;  1N33 I;  4FWG A;  4KQV A;  4UT4 A;  3T1H I;  4LF7 E;  4DR4 E;  1NHJ A;  4LF8 I;  1B62 A;  1Z5A A;  2EFG A;  3QT8 A;  1XMO I;  4FWH A;  4P52 A;  4DV2 E;  4JI4 I;  4JYA I;  4YHH I;  1FNM A;  4X65 E;  4Z7C A;  2HK2 A;  4DPX A;  2X7I A;  1J5E E;  2ZBK B;  1IBL I;  4NXN E;  1ZM3 A;  3ZKD A;  4PRV A;  1ZM9 A;  1HR0 I;  1BKN A;  4GKK E;  2UUC E;  3JAM C;  1FWL A;  1ZM2 A;  4JI1 E;  2V2V A;  2UXD E;  2UUB E;  1RRE A;  4LFA I;  4LFB I;  1I94 E;  1HNZ I;  1Z0B A;  4EMD A;  2UXB I;  2R42 A;  4DUY I;  3J80 C;  4GKJ E; 
#chains in the Genus database with same CATH topology
 1QNT A;  5AAS A;  1UDQ A;  4FN5 A;  3ZZT A;  1XMQ I;  3OTO I;  4DR7 E;  4DV5 I;  1A1F A;  5LMN I;  2EPR A;  4M30 A;  2UUA I;  2DRP A;  3J7A G;  2YU8 A;  2J7J A;  5JEA C;  1EI1 A;  4LF4 I;  2G7H A;  5GME A;  2DLK A;  1YSA C;  4HEI A;  2Q2E B;  3JAM Q;  4JG4 A;  2BBG A;  2EOQ A;  4WPY A;  2LT7 A;  1R6M A;  1Y4S A;  3KRN A;  1XNQ I;  1IBK E;  3CDI A;  4FW5 A;  2YTO A;  5LL6 R;  2UXC E;  1USV A;  1EH8 A;  2BA1 G;  4X64 I;  2RS7 A;  3THO B;  4KHP E;  4LF6 I;  1YZ9 A;  1BB8 A;  2YTI A;  3M85 G;  5JEA B;  2YSO A;  4AM3 A;  1RQ0 A;  1EKZ A;  1UN6 B;  2JEB A;  4FW9 A;  2PO1 B;  2EPL X;  2EPN A;  4FW6 A;  4DV3 I;  2ENC A;  4M1K A;  4KWY A;  4F9B B;  1NHH A;  1AH5 A;  1UDN A;  4F2J C;  2A2D A;  4B3T I;  4NXM E;  2EL5 A;  4MYT A;  2EZ6 A;  2WCC 3;  2DLQ A;  4JI0 E;  4WSP A;  5KL4 A;  2EMC A;  4JI7 I;  4DR2 I;  2EP3 A;  1S4E A;  2FGG A;  1WHN A;  5EKW A;  3ZKB A;  2EL4 A;  1JK2 A;  3AUZ A;  2WP8 B;  3H4L A;  4PRX A;  2ZM6 I;  4DV1 I;  5TSE A;  4MU1 A;  2F4V I;  2GHF A;  4BC7 A;  1NHI A;  5IWA I;  5C0X F;  1ELO A;  5K36 E;  4B3R I;  4DPY A;  4I3H A;  2PNL A;  3PYD A;  4IS1 C;  2EMX A;  4X62 I;  2ADR A;  1GTK A;  2YRH A;  4JI3 E;  4HAC A;  4YY3 I;  3B82 A;  2LJU A;  5K36 D;  4LCF A;  4Q35 B;  3J7Y p;  3PYG A;  2DSY A;  3K1J A;  4X66 I;  4R2Q A;  4K0K E;  2NN6 C;  2EML A;  1H73 A;  4LPF A;  3KZY A;  3ADG A;  3T1Y I;  4JI8 I;  4IZJ D;  2VE7 C;  2JWO A;  3L00 A;  1MU5 A;  4WXD A;  4AQY E;  3ECR A;  2EOM A;  5AE1 A;  1UHZ A;  4DR1 I;  2HHH E;  3C6K A;  1L4S A;  1DQ3 A;  2V2Q A;  3B78 A;  2V83 A;  1S16 A;  5K36 A;  4DR5 E;  2NN6 B;  3THN A;  1UDO A;  4LF7 I;  2EPK X;  2I13 A;  4Q28 A;  4Z7Y A;  4IZJ A;  1UBD C;  1Z59 A;  5JEA F;  2EPM X;  3UHM A;  4WX9 A;  2PO2 A;  2M4I A;  4DU8 A;  4BA1 A;  5BR8 I;  1Z0T A;  1H74 A;  5A2Q Q;  4DV2 I;  2ELZ A;  2E5L E;  3K17 A;  4B3S E;  4IFD D;  3AV0 A;  4OO1 E;  2EN4 A;  3QT7 A;  4LFC I;  5DNY A;  2C37 A;  1HNW E;  2HFS A;  4X65 I;  2GO4 A;  2EMY A;  1TF3 A;  3EPL A;  1XXE A;  2JY9 A;  2EM0 A;  2EQ1 A;  2RPC A;  1WJP A;  4LF9 E;  2DEJ A;  5LLQ A;  2E1R A;  2IER A;  2EM6 A;  5AC5 A;  3Q6N A;  1D6T A;  2VQE E;  4HY1 A;  2YZT A;  4DV4 E;  4AIM A;  2MC5 A;  5KL7 A;  4JI5 I;  2O1W A;  4IFD A;  1RC7 A;  4ZYG A;  3VYY A;  4JI2 I;  2CSH A;  1N33 E;  2KOU A;  3VK6 A;  4NXN I;  4BHB A;  2HK3 A;  1A1J A;  4O24 A;  1R6L A;  3HUL A;  2YPN A;  4DV7 I;  2UUC I;  3T1H E;  2BM1 A;  2EPA A;  1ZM4 A;  1PDA A;  3K6Q A;  1KIJ A;  3ZZ0 A;  2YTE A;  1XMO E;  2L6M A;  2JEA B;  4B3M E;  1SR9 A;  2M9A A;  3FIG A;  4DR3 E;  1A6F A;  5IXM B;  4R03 A;  4BS9 A;  2V88 A;  4JYA E;  2HKJ A;  4YHH E;  4DUZ E;  4DR6 I;  4LU9 A;  2K4V A;  3CDJ A;  2BA1 D;  1TF6 A;  4LOM A;  2YTP A;  3M85 D;  2EOX A;  3GON A;  2ODR D;  4P7D A;  3K85 A;  2BM0 A;  4R2P A;  2JYA A;  2LRS A;  2LV2 A;  4TUI A;  4IZK A;  4JV5 I;  1NZ0 A;  4DKK A;  3U1Y A;  1X49 A;  1DI2 A;  1X48 A;  3WU6 A;  1T39 A;  3P76 A;  5KL2 A;  1IBL E;  3MHS C;  2JPA A;  3C4B A;  1FJG I;  2EPU A;  1HNX I;  2J65 A;  4M9V C;  3HKM A;  2MKD A;  2YRK A;  5C0X E;  3IWD A;  5IV8 B;  4R2D A;  1N0V C;  4FW3 A;  1NEI A;  1B63 A;  2EMA A;  2V85 A;  2ENA A;  2JXP A;  1UDS A;  1BBG A;  1PJT A;  5AE2 A;  3Q6M A;  2EPC A;  2AE8 A;  3PS2 A;  2VF3 A;  2MDR A;  3WU5 A;  5C0X D;  2BV3 A;  4I8O A;  4RH8 A;  2PRT A;  2UXC I;  3QG5 C;  4OKG A;  4KHP I;  2RSM A;  5LMU E;  1Z0G A;  2HKE A;  2NUF A;  2EOI A;  2M7Q A;  4LFA E;  2CT1 A;  2GO3 A;  1N34 E;  4GQU A;  4LFB E;  1ZBT A;  2Z5E A;  3PS1 A;  2Z5C B;  1N3G A;  1Y60 A;  3VHT B;  2FTX B;  3HQ1 A;  4ZYD A;  2EJ4 A;  4DUY E;  1Z0C A;  2V34 A;  2PNZ B;  1G2D C;  4FK5 C;  3CWV A;  3PYE A;  4JI6 I;  4NXM I;  3RMP A;  4FWD A;  2ZIT A;  2F8B A;  3DJW A;  5FLX C;  4N3O A;  4LF5 E;  3HXL A;  5C0X A;  2LTS A;  2V89 A;  1IQO A;  2YTQ A;  4WFT A;  4F6N A;  1IBM I;  2EM7 A;  3P1X A;  2JOB A;  3OTO E;  4LTY A;  1KJK A;  3P3G A;  4HAC B;  1IMU A;  1JK1 A;  2UUA E;  4QNK A;  2EM2 A;  4R2S A;  3ADI A;  3GLL A;  3KZZ A;  4DV6 E;  5A2Q C;  1X6H A;  2DEI A;  1X3C A;  2UU9 I;  4JI3 I;  1GQE A;  2VQF E;  4HXZ A;  1N0U A;  1XNQ E;  5JEA D;  2NUG A;  1YYW A;  4J8Z A;  4LF6 E;  4X64 E;  2ENH A;  4K0K I;  2B3T B;  1X47 A;  3BBG A;  2HFU A;  1N32 E;  2EM4 A;  1XHK A;  3QT5 A;  2X36 A;  2KHX A;  1RR9 A;  4WYQ B;  5K36 B;  4L8N A;  4BMJ A;  4P78 A;  3L7Z B;  4WXC A;  5AC4 A;  1FWK A;  3EPH A;  1MG7 A;  4DV3 E;  2JE6 A;  1IQS A;  1GZ6 A;  2YRM A;  3BF2 A;  3H09 A;  4F9C B;  1F2I G;  1YYO A;  4MDT A;  5DRQ A;  5JEA A;  1N36 E;  4OX9 E;  1MX0 A;  4JI7 E;  2R3V A;  1T4N A;  1B69 A;  4BA1 B;  1HNX E;  3H1C A;  1DAR A;  3F6G A;  5ELW A;  5FLX Q;  3MSW A;  2F4V E;  4LCH A;  1YFH A;  3J7A M;  2Q8U A;  2BA0 G;  4IFD E;  4TUG A;  2YWQ A;  2L2M A;  4DR4 I;  3F6H A;  4B3R E;  1TN9 A;  2C38 B;  2WP8 A;  4USM A;  2XEX A;  1O0W A;  4B3S I;  5FWK A;  1ZXM A;  4YY3 E;  2YTN A;  1EA6 A;  4OO1 C;  2EN6 A;  4ED4 A;  2J7K A;  1H72 C;  2RS6 A;  2YTD A;  1Z0V A;  4MU0 A;  2EPP A;  5GMD A;  4LF9 I;  3U1K A;  3J81 Q;  1A1H A;  4RHB B;  2EL6 A;  4JI8 E;  4DV4 I;  2VRD A;  1H7S A;  3HPS A;  2EOY A;  3WU4 A;  4MU4 A;  1KKH A;  5A6B D;  3PYF A;  1KVK A;  4DR1 E;  3WU3 A;  4BBY A;  4OO1 B;  1YH8 A;  1J5E I;  2O1U A;  2R76 A;  2O1T A;  5A6K A;  2L3J A;  2EOR A;  4BC9 A;  5DNL A;  1Z1B A;  2V8Q B;  5AE3 A;  1Y6Z A;  3ZZU A;  3GME A;  2L33 A;  2B7V A;  4GZN C;  4BA2 B;  1P42 A;  4WUD A;  2DB2 A;  4GKK I;  1SFE A;  5DNX A;  4B3M I;  1T38 A;  2BR2 A;  2WBS A;  5IT9 C;  1WUU A;  4WUB A;  5A6B A;  5BR8 E;  4XTJ A;  4DR3 I;  4JI1 I;  4LF8 E;  1QU6 A;  3OML A;  2EMK A;  2ELY A;  2FV4 B;  2MC6 A;  3F0N A;  4DUZ I;  2UXD I;  4ZYE A;  2LJH A;  4LFC E;  1Z0W A;  2YSP A;  2C39 A;  2UUB I;  1USU A;  4JI4 E;  4J3D A;  2LO3 A;  2EMW A;  2EOJ A;  5A6J A;  2IES A;  2PO0 B;  2R1F A;  4ZYH A;  1FI4 A;  2AJ4 A;  4WUC A;  2LJP A;  1WXR A;  1YYK A;  2NN6 F;  1I94 I;  4R1F A;  4JI5 E;  2EOS A;  4R2A A;  4JI2 E;  2PNM A;  4O43 A;  2EN3 A;  4URL A;  5ADZ A;  3LPS A;  3Q1Q A;  4GKJ I;  2LVH A;  3KWR A;  4F9A B;  4LCG A;  4GEQ B;  1ZU1 A;  4DMI A;  4DV7 E;  1OYR A;  2A2C A;  4MU3 A;  3IWB A;  1NCS A;  5C0X C;  4DR7 I;  1HR0 E;  4O5G A;  2I9I A;  2L8T A;  4P7A A;  2JP9 A;  4WSG A;  2EQ3 A;  1KYQ A;  1UEK A;  4OO1 F;  3V5R A;  2YTG A;  5IT9 Q;  2B7T A;  2DIX A;  2RTX A;  4DR6 E;  1YPN A;  5LMU I;  4F54 A;  2JEB B;  1IBK I;  1ZXN A;  2JEA A;  5C0X B;  4USK A;  5L3J A;  1N34 I;  1YUJ A;  2WZO A;  2O3Z A;  1E3P A;  4X9J A;  4GKJ E;  3HPZ A;  1U2R A;  5F3W A;  2LCE A;  1T4L B;  4IS9 A;  4IJD A;  2V2Z A;  4JV5 E;  2M1S A;  2RSI A;  1A1L A;  1HNZ E;  3M7N D;  1X6E A;  2UXB E;  2OI2 A;  4LF5 I;  3EPJ A;  2EM3 A;  2YTJ A;  1FJG E;  2LUQ A;  3M6A A;  4JI0 I;  2LTR A;  3UK3 C;  3ZOQ B;  3D4J A;  4UTG A;  1PIE A;  1Y5Y A;  2KON A;  1Y4U A;  2CGE A;  1VIS A;  2WNR A;  2WW4 A;  2Z5B A;  3MHH C;  1XMQ E;  2EOH A;  4R2C A;  4DV5 E;  2BA0 D;  4DV6 I;  1FKA E;  2GS8 A;  5LMN E;  1X5W A;  2MKN A;  5JEA E;  2VQF I;  2V8P A;  5K36 C;  2LBS B;  4LF4 E;  2JR1 A;  1WHQ A;  2F1D A;  1RMD A;  1K47 A;  2CVE A;  2JE6 B;  2EM8 A;  4RPF A;  3ZM7 A;  4DU7 A;  2EN2 A;  2IHR 1;  2EOE A;  1N32 I;  2L2K B;  3J81 C;  2E1M A;  4PU9 A;  2EWL A;  3LTO A;  2CPN A;  1A1K A;  3PRY A;  2GQ0 A;  3BID A;  2EN7 A;  1H7U A;  2CG9 A;  4DV0 E;  4FW4 A;  2LE2 A;  1Z5C A;  1XNR E;  4JI6 E;  1PJQ A;  2CZ9 A;  5EL9 A;  2L92 A;  5T6J A;  4AQY I;  2WBU A;  1OJ4 A;  4DPT A;  4MYU A;  1N36 I;  4OX9 I;  1PKP A;  1EH6 A;  2LUP B;  4B3T E;  2O1V A;  5DRP A;  2EMZ A;  4QNJ A;  2NA2 A;  4U3D A;  2HHH I;  2Z5C A;  4IZJ B;  3M7N G;  1IBM E;  3J80 Q;  2EN1 A;  2DMY A;  2CTD A;  2PNZ A;  4N4R B;  4ZVI A;  2PO2 B;  4DR5 I;  4DR2 E;  2IOP A;  4NBQ A;  2PO1 A;  5CFF E;  3LML A;  2EMF A;  2ZM6 E;  2EOO A;  1T4O A;  4DV1 E;  4IFD C;  4R2E A;  1PVG A;  2NPF A;  3LNU A;  5IWA E;  2V86 A;  2UU9 E;  2C37 B;  4DXL A;  2DGC A;  4U3B A;  5DRR A;  2GPI A;  3C6M A;  2YT4 A;  3HTX A;  4ISA A;  4X62 E;  2E5L I;  1HK7 A;  4DPW A;  1X6F A;  4AID A;  1OYP A;  4DPU A;  1HNW I;  2H36 X;  2N8X A;  2YU5 A;  4HYM A;  3ADJ A;  3TQM A;  4IFD B;  1E3H A;  3V2U C;  2NN6 E;  1Z5B A;  1QZR A;  4MLQ A;  4BHC A;  4X66 E;  3DF6 A;  1UIL A;  3QT6 A;  2NAB A;  1KTV A;  4HTG A;  2E72 A;  4NHR A;  3B8H A;  4KZS A;  3T1Y E;  1MGT A;  2VQE I;  3M99 B;  1ZAA C;  4LF8 I;  1ZR9 A;  2JT2 A;  3DD6 A;  3EQ1 A;  4DV0 I;  1Z0E A;  2JVA A;  2BR2 B;  2NN6 D;  3L7Z A;  1N33 I;  1BBO A;  4OZE A;  2EPO A;  4FWG A;  2B9D A;  1G2F C;  4R2R A;  2EM5 A;  2EOF A;  4KQV A;  2C39 B;  2YTF A;  2VES A;  2EE8 A;  2DMI A;  3P3E A;  3JTZ A;  4UT4 A;  3ADL A;  3T1H I;  4LF7 E;  3C4T A;  5KL6 A;  4DR4 E;  4OOG C;  4FW7 A;  1NHJ A;  2BB8 A;  2EM9 A;  2HC5 A;  5A6A A;  1LLM C;  1B62 A;  1Z5A A;  2EFG A;  3QT8 A;  1XMO I;  5K36 F;  2EN8 A;  1VI7 A;  4FWH A;  2NN6 A;  4P52 A;  4L5N C;  4DV2 E;  2LMZ A;  4JI4 I;  1YUI A;  4M0V A;  5KL5 A;  1P47 A;  2C38 A;  4JYA I;  2ODR C;  4YHH I;  4IZK B;  2VF1 A;  4O4K A;  3IWC A;  1WRJ A;  4X65 E;  1FNM A;  4OO1 D;  4Z7C A;  1A1I A;  2HK2 A;  2HGH A;  4DPX A;  1RHY A;  4M2Z A;  2EMB A;  2X7I A;  3JU0 A;  1J5E E;  4MLV A;  1A1G A;  3B4T A;  1STU A;  2N3H A;  4NZV A;  1J26 A;  2ZBK B;  1IBL I;  4NXN E;  2HJJ A;  1AAY A;  1ZM3 A;  3PS3 A;  3ZKD A;  4PRV A;  1ZM9 A;  4OO1 A;  1OYS A;  2L2N A;  3VYX A;  1HR0 I;  4IFD F;  2WBT A;  4GKK E;  1BKN A;  2UUC E;  3EPK A;  3JAM C;  1FWL A;  2EMI A;  2EPZ A;  3P3C A;  3BGH A;  2K7I A;  4F6M A;  1ZM2 A;  3GCM A;  3NZK A;  4MQY A;  2A25 A;  2GLI A;  4JI1 E;  4R8O A;  2EOZ A;  2V2V A;  2UXD E;  4X8W A;  1EH7 A;  2V87 A;  4BA2 A;  1MEY C;  2UUB E;  1ZBQ A;  1RRE A;  3HJC A;  2N3G A;  5A69 A;  2L3C A;  2EPX A;  1PJS A;  4BCA A;  1DGC A;  2D9H A;  1YHC A;  4LFA I;  4LFB I;  2EQ0 A;  2EMG A;  1I94 E;  2IOQ A;  2WNR B;  1HNZ I;  2NUE A;  3LLH A;  5KL3 A;  1Z0B A;  2Z5B B;  4EMD A;  1XNR I;  2UXB I;  2R42 A;  4DUY I;  2PO0 A;  2JOX A;  2RQL A;  3J80 C;  2EMH A;  2MDG A;  5DRO A;  3P06 A; 
#chains in the Genus database with same CATH homology
 5AAS A;  1XMQ I;  4FN5 A;  3ZZT A;  3OTO I;  4DR7 E;  4DV5 I;  5LMN I;  4M30 A;  2UUA I;  3J7A G;  1EI1 A;  4LF4 I;  2G7H A;  5GME A;  2Q2E B;  3JAM Q;  4JG4 A;  4WPY A;  1Y4S A;  1XNQ I;  1IBK E;  5LL6 R;  2UXC E;  1USV A;  4LF6 I;  4X64 I;  2RS7 A;  4KHP E;  1YZ9 A;  1RQ0 A;  1EKZ A;  4FW9 A;  4DV3 I;  4M1K A;  4F9B B;  4B3T I;  1NHH A;  2A2D A;  4NXM E;  4MYT A;  2EZ6 A;  4JI0 E;  4WSP A;  4JI7 I;  4DR2 I;  1S4E A;  2FGG A;  1WHN A;  1HNX I;  3ZKB A;  3H4L A;  3AUZ A;  4PRX A;  2ZM6 I;  4DV1 I;  2F4V I;  4BC7 A;  1NHI A;  5IWA I;  1ELO A;  4B3R I;  4DPY A;  4I3H A;  2PNL A;  3PYD A;  4X62 I;  4JI3 E;  4HAC A;  4YY3 I;  3B82 A;  3PYG A;  3J7Y p;  2DSY A;  3K1J A;  4X66 I;  4K0K E;  1H73 A;  3ADG A;  3T1Y I;  4JI8 I;  4IZJ D;  2VE7 C;  2JWO A;  1MU5 A;  4AQY E;  5AE1 A;  1UHZ A;  4DR1 I;  2HHH E;  1DQ3 A;  2V2Q A;  3B78 A;  2V83 A;  1S16 A;  4DR5 E;  4LF7 I;  4Q28 A;  4Z7Y A;  4IZJ A;  1Z59 A;  2M4I A;  4DU8 A;  5BR8 I;  1Z0T A;  1H74 A;  5A2Q Q;  4DV2 I;  2E5L E;  3K17 A;  4B3S E;  3AV0 A;  3QT7 A;  4LFC I;  5DNY A;  1HNW E;  2HFS A;  4X65 I;  2JY9 A;  2DEJ A;  2E1R A;  4LF9 E;  3Q6N A;  1D6T A;  2VQE E;  4HY1 A;  2YZT A;  4DV4 E;  2MC5 A;  4JI5 I;  2O1W A;  1RC7 A;  3VYY A;  4JI2 I;  1N33 E;  2KOU A;  3VK6 A;  4NXN I;  2HK3 A;  3HUL A;  4DV7 I;  2UUC I;  3T1H E;  2BM1 A;  1ZM4 A;  3K6Q A;  1KIJ A;  3ZZ0 A;  1XMO E;  2L6M A;  4B3M E;  1SR9 A;  3FIG A;  4DR3 E;  1A6F A;  4R03 A;  4BS9 A;  2V88 A;  4JYA E;  2HKJ A;  4YHH E;  4DUZ E;  4DR6 I;  4LU9 A;  2K4V A;  3GON A;  2ODR D;  4P7D A;  3K85 A;  2BM0 A;  2LRS A;  4TUI A;  4IZK A;  4JV5 I;  1NZ0 A;  4DKK A;  1X49 A;  1DI2 A;  1X48 A;  3WU6 A;  1IBL E;  1FJG I;  3C4B A;  3IWD A;  1N0V C;  1B63 A;  2V85 A;  5AE2 A;  3Q6M A;  2VF3 A;  2MDR A;  3WU5 A;  2BV3 A;  4I8O A;  2UXC I;  4KHP I;  2RSM A;  5LMU E;  1Z0G A;  2HKE A;  2NUF A;  2M7Q A;  4LFA E;  1N34 E;  4LFB E;  1ZBT A;  2Z5E A;  2Z5C B;  4DV0 I;  2FTX B;  3HQ1 A;  4DUY E;  1Z0C A;  2V34 A;  1XNR I;  4JI6 I;  3PYE A;  3CWV A;  4NXM I;  3RMP A;  4FWD A;  2ZIT A;  2F8B A;  3DJW A;  5FLX C;  4N3O A;  4LF5 E;  3HXL A;  2LTS A;  2V89 A;  4WFT A;  1IBM I;  3P1X A;  2JOB A;  3OTO E;  4LTY A;  4HAC B;  2UUA E;  3ADI A;  4DV6 E;  5A2Q C;  2DEI A;  2UU9 I;  4JI3 I;  1GQE A;  2VQF E;  4HXZ A;  1N0U A;  1XNQ E;  2NUG A;  1YYW A;  4J8Z A;  4LF6 E;  4X64 E;  4K0K I;  2B3T B;  1X47 A;  2HFU A;  1N32 E;  3QT5 A;  1XHK A;  2X36 A;  2KHX A;  1RR9 A;  4WYQ B;  4L8N A;  4BMJ A;  4P78 A;  1FWK A;  1MG7 A;  4DV3 E;  1GZ6 A;  3H09 A;  4F9C B;  1YYO A;  1N36 E;  4OX9 E;  1MX0 A;  4JI7 E;  2R3V A;  1T4N A;  1HNX E;  1DAR A;  3F6G A;  5FLX Q;  3MSW A;  2F4V E;  3J7A M;  4TUG A;  2L2M A;  4DR4 I;  3F6H A;  4B3R E;  4USM A;  2XEX A;  1O0W A;  4B3S I;  5FWK A;  1ZXM A;  4YY3 E;  1EA6 A;  4ED4 A;  2J7K A;  1H72 C;  2RS6 A;  1Z0V A;  5GMD A;  4LF9 I;  3J81 Q;  4JI8 E;  4DV4 I;  1H7S A;  3HPS A;  3WU4 A;  1KKH A;  3PYF A;  3WU3 A;  1KVK A;  4DR1 E;  4BBY A;  1J5E I;  2O1U A;  2O1T A;  2L3J A;  4BC9 A;  1Y6Z A;  2V8Q B;  5AE3 A;  3ZZU A;  2L33 A;  2B7V A;  4WUD A;  2DB2 A;  4GKK I;  4B3M I;  5IT9 C;  4WUB A;  1WUU A;  4XTJ A;  5BR8 E;  4DR3 I;  4JI1 I;  4LF8 E;  1QU6 A;  3OML A;  3F0N A;  2FV4 B;  2MC6 A;  4DUZ I;  2UXD I;  2LJH A;  4LFC E;  1Z0W A;  2UUB I;  1USU A;  4JI4 E;  1FI4 A;  2AJ4 A;  4WUC A;  2LJP A;  1WXR A;  1YYK A;  1I94 I;  4R1F A;  4JI5 E;  4JI2 E;  2PNM A;  4URL A;  5ADZ A;  3LPS A;  3Q1Q A;  4GKJ I;  3KWR A;  4F9A B;  4GEQ B;  4DMI A;  4DV7 E;  2A2C A;  3IWB A;  4DR7 I;  1HR0 E;  2L8T A;  4P7A A;  1UEK A;  3V5R A;  5IT9 Q;  2B7T A;  2DIX A;  2RTX A;  4DR6 E;  5LMU I;  1IBK I;  4F54 A;  1ZXN A;  4USK A;  5L3J A;  1N34 I;  2WZO A;  3HPZ A;  1U2R A;  5F3W A;  1T4L B;  2V2Z A;  4JV5 E;  2M1S A;  1HNZ E;  2UXB E;  2OI2 A;  4LF5 I;  1FJG E;  2LUQ A;  3M6A A;  4JI0 I;  2LTR A;  3D4J A;  3ZOQ B;  4UTG A;  1PIE A;  2KON A;  1Y4U A;  2CGE A;  1VIS A;  2WW4 A;  2Z5B A;  1XMQ E;  4DV5 E;  4DV6 I;  1FKA E;  2GS8 A;  5LMN E;  2VQF I;  2V8P A;  2LBS B;  4LF4 E;  2JR1 A;  1WHQ A;  1K47 A;  4RPF A;  3ZM7 A;  4DU7 A;  2IHR 1;  1N32 I;  2L2K B;  3J81 C;  2E1M A;  4PU9 A;  2EWL A;  3LTO A;  2CPN A;  3PRY A;  2GQ0 A;  1H7U A;  2CG9 A;  4DV0 E;  2LE2 A;  1Z5C A;  1XNR E;  4JI6 E;  2CZ9 A;  2L92 A;  5T6J A;  4AQY I;  4DPT A;  1OJ4 A;  1N36 I;  4MYU A;  4OX9 I;  1PKP A;  2LUP B;  4B3T E;  2O1V A;  2HHH I;  2NA2 A;  2Z5C A;  4IZJ B;  1IBM E;  3J80 Q;  2DMY A;  4ZVI A;  4DR5 I;  4DR2 E;  2IOP A;  5CFF E;  3LML A;  2ZM6 E;  4DV1 E;  1T4O A;  1PVG A;  2NPF A;  3LNU A;  5IWA E;  2V86 A;  2UU9 E;  4DXL A;  3HTX A;  2YT4 A;  4X62 E;  2E5L I;  1HK7 A;  4DPW A;  4DPU A;  1HNW I;  2H36 X;  4HYM A;  3ADJ A;  3V2U C;  1Z5B A;  1QZR A;  4X66 E;  3DF6 A;  1UIL A;  3QT6 A;  1KTV A;  3B8H A;  4KZS A;  3T1Y E;  2VQE I;  1Z0E A;  2JVA A;  1N33 I;  4FWG A;  2B9D A;  4KQV A;  4UT4 A;  3JTZ A;  3ADL A;  3T1H I;  4LF7 E;  3C4T A;  4DR4 E;  4OOG C;  1NHJ A;  4LF8 I;  1B62 A;  1Z5A A;  2EFG A;  3QT8 A;  1XMO I;  4FWH A;  4P52 A;  4L5N C;  4DV2 E;  2LMZ A;  4JI4 I;  4M0V A;  4JYA I;  2ODR C;  4YHH I;  4IZK B;  2VF1 A;  3IWC A;  4X65 E;  1FNM A;  4Z7C A;  2HK2 A;  4DPX A;  4M2Z A;  2X7I A;  3JU0 A;  1J5E E;  1STU A;  2N3H A;  1J26 A;  2ZBK B;  1IBL I;  4NXN E;  1ZM3 A;  3ZKD A;  4PRV A;  1ZM9 A;  2L2N A;  3VYX A;  1HR0 I;  4GKK E;  1BKN A;  2UUC E;  3JAM C;  1FWL A;  1ZM2 A;  4JI1 E;  4R8O A;  2V2V A;  2UXD E;  4X8W A;  2V87 A;  2UUB E;  1RRE A;  1ZBQ A;  3HJC A;  2N3G A;  2L3C A;  4BCA A;  4LFA I;  4LFB I;  1I94 E;  2IOQ A;  1HNZ I;  2NUE A;  3LLH A;  1Z0B A;  2Z5B B;  4EMD A;  2UXB I;  2R42 A;  4DUY I;  2JOX A;  3J80 C;  4GKJ E;  3P06 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...