3JAMC

Cryoem structure of 40s-eif1a-eif1 complex from yeast
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
217
structure length
217
Chain Sequence
GWVPVTKLGRLVKAGKISSIEEIFLHSLPVKEFQIIDQLLPNLKDEVMNIKPVQKQTRAGQRTRFKAVVVVGDSNGHVGLGIKTAKEVAGAIRAGIIIAKLSVIPIRRGYWGTNLGQPHSLATKTSGKCGSVSVRLIPAPRGSGIVASPAVKKLMQLAGVEDVYTSSTGSTRTLENTLKAAFVAIGNTYGFLTPNLWEVQALTPSPMDVYADYATAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational Differences between Open and Closed States of the Eukaryotic Translation Initiation Complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Translation
molecule keywords 18S rRNA
total genus 43
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
C PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.770 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3jamC01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 3jamC02
4X66E 4X62E 2ZM6E 4X65E 4FWDA 1Z0EA 4JI6E 1KKHA 4WUBA 5A2QQ 4R1FA 1FI4A 1Z5AA 5LL6R 3J80Q 4LF7I 2UUAE 1S4EA 4JV5I 2UXCE 4JYAE 2V8PA 4DV5I 4DPXA 4DPYA 4DR6I 4URLA 3ZKBA 1FJGI 5BR8I 4Z7CA 1MX0A 4JI8I 4FN5A 4DR1E 4LF8I 1N32E 5IT9Q 3B82A 4B3TE 4JI1I 2UXCI 1H7SA 1I94E 3PYDA 2UUAI 2BV3A 4DXLA 4JI0I 4LFCI 4KHPE 4LF8E 4NXME 4HACB 4AQYE 2HHHI 4DPTA 2VQEE 3J7AM 4XTJA 5FLXC 4DR3E 4JI6I 1DARA 2X36A 1IBME 3ZZUA 5LMUE 2F4VE 2HKEA 1ZM3A 3WU6A 2V2QA 3B78A 2WW4A 2NPFA 1XNRE 1HNZE 3K1JA 1Z5CA 2BM1A 4LF9I 2V34A 5GMEA 1WUUA 1ZXMA 4LFBI 4YY3E 4YHHE 3ZZ0A 5LMNI 1PIEA 4JI3I 4JI5I 4DR4I 2HFSA 4B3RE 3QT6A 1IBLI 2X7IA 1FKAE 4JI2I 4NXNI 4HYMA 3J7AG 3LTOA 1KTVA 2AJ4A 1ZXNA 4KHPI 4GKJE 2CZ9A 2UXDI 1MG7A 4K0KE 3LPSA 3ZM7A 3PYFA 3WU4A 1XMOE 4JI7E 4P52A 2HHHE 1IBKI 3OTOI 4DUYI 4B3MI 2E5LE 3F0NA 1Z0GA 4JV5E 2V2VA 1I94I 4X62I 4JI5E 3JAMQ 3CWVA 4LF5I 3HULA 4JI2E 5A2QC 2A2DA 4JI4E 4X66I 4JI3E 4I3HA 4FWHA 1N36I 4DUZI 4B3SE 4HACA 1EA6A 4X64I 4LF6E 1D6TA 1XNRI 2LJPA 2VQFI 1KIJA 4JYAI 4DV1E 2EFGA 1N0UA 3QT5A 4PRXA 1Z0BA 1Z0WA 1N0VC 5LMUI 2UUBI 1VISA 4USKA 4PRVA 1Z59A 2ZM6I 3T1HI 4HXZA 4DV7E 1H74A 4DV2I 4JI7I 4DR7E 1XMOI 2J7KA 3J81Q 4USMA 3H4LA 4ED4A 2Q2EB 4OX9I 4KQVA 3V5RA 2UXBE 2VF3A 2VQEI 1XHKA 4LF4I 1H72C 3T1YE 2UU9I 4LFAI 1NHHA 2HK3A 2VQFE 4NXNE 4DV6I 2V2ZA 1H7UA 1Z0CA 4DUYE 3JAMC 1IBKE 4LF4E 4DV7I 1N32I 4DR2I 5IWAI 1N34E 1HNXE 2DEJA 4YHHI 1Z0VA 4PU9A 4Z7YA 2ZITA 4DR4E 4WUDA 3V2UC 1HNWI 4DU7A 3K17A 1XMQE 3QT7A 4DV5E 1K47A 3LNUA 2DEIA 1UEKA 4WUCA 2UUBE 3GONA 4M1KA 2HKJA 4LF9E 4MYUA 4B3ME 1B63A 3PYGA 3QT8A 2R42A 5L3JA 4X65I 4EMDA 4DUZE 4B3SI 1XNQI 4LF5E 1EI1A 4DPWA 1N33E 2BM0A 2UXDE 1RR9A 4DV6E 4DV3I 4GKKI 2HK2A 4JI0E 1ZM9A 2A2CA 4NXMI 4B3TI 1HR0E 1RREA 4UTGA 4DV0I 1ZM2A 4P7AA 3PYEA 3OTOE 4B3RI 4FW9A 4DR2E 1N34I 1B62A 2F4VI 4UT4A 3J80C 4FWGA 1FWKA 4DV0E 4DR3I 3ZZTA 3D4JA 4RPFA 2UUCE 3ZKDA 4LF7E 4DV1I 1FNMA 1HR0I 5GMDA 4OX9E 1IBLE 4LF6I 4X64E 2UUCI 1PVGA 2HFUA 1NHJA 4DV3E 5LMNE 1FWLA 4MYTA 1ELOA 4JI8E 1Z0TA 3M6AA 4LFBE 1NHIA 4AQYI 4DR5E 1OJ4A 1MU5A 4LFCE 1NZ0A 1J5EE 1HNZI 4DPUA 2E1RA 5IWAE 1HNXI 1FJGE 1IBMI 4JI4I 1S16A 4HY1A 4ZVIA 1Z5BA 4K0KI 1KVKA 2E5LI 4LFAE 1H73A 3T1YI 2UU9E 4DV4I 4JI1E 4GKKE 2ZBKB 4DR1I 2R3VA 1XMQI 4DV4E 4DV2E 1ZM4A 4DR7I 5BR8E 1U2RA 4YY3I 2OI2A 4JG4A 3J81C 4GKJI 3Q1QA 5IT9C 2XEXA 4DR6E 3T1HE 1J5EI 4DU8A 4DR5I 3WU5A 2UXBI 1N36E 1HNWE 1XNQE 5FLXQ 1PKPA 1QZRA 1A6FA 3WU3A 1N33I 1BKNA 2GS8A 3B8HA
chains in the Genus database with same CATH superfamily
4X66E 4X62E 5EL9A 2ZM6E 4X65E 4FWDA 1Z0EA 3MSWA 2O1WA 2B7VA 2C39B 3U1YA 3LLHA 3HJCA 4BA1A 2C38A 4WSPA 4JI6E 1KKHA 2C38B 4WUBA 1Y4UA 5A2QQ 4R1FA 5LLQA 1FI4A 1Z5AA 1WHNA 2EOOA 5LL6R 3J80Q 4LF7I 2UUAE 2KOUA 2YWQA 1IQSA 1S4EA 4JV5I 2UXCE 3C4TA 4JYAE 2EOMA 1PJTA 5DRPA 1G2DC 2V8PA 2EMWA 4BC7A 4R8OA 4OKGA 2K4VA 2Z5CA 2EJ4A 4DPXA 4DV5I 1YFHA 3KZYA 4DPYA 3M99B 4DR6I 1BBOA 4URLA 4R2CA 1IMUA 3ZKBA 1FJGI 5KL4A 5BR8I 1RC7A 2YTFA 4Z7CA 1WHQA 1UILA 1MX0A 2EN3A 4JI8I 4TUIA 3B4TA 3F6GA 3EPKA 4FN5A 1DQ3A 4RH8A 2YTEA 4DR1E 4LF8I 2EM6A 1N32E 5IT9Q 4B3TE 3VYXA 3B82A 4U3BA 2MKDA 2EL4A 4JI1I 1I94E 1H7SA 3PYDA 2UXCI 2UUAI 2BV3A 5C0XF 3BF2A 4DXLA 4JI0I 4LFCI 5C0XB 4F54A 4OO1B 3HKMA 4KHPE 4LF8E 5AE2A 1P42A 3PS1A 4NXME 2GO4A 4BHCA 3HPZA 4HACB 3K6QA 3CDIA 4AQYE 5C0XD 2HHHI 2C39A 2VQEE 4DPTA 4WPYA 3J7AM 2O3ZA 4XTJA 5FLXC 4DR3E 2PNMA 4JI6I 1L4SA 2LTRA 4WYQB 1KYQA 1JK2A 2DMYA 4IFDE 2EORA 1DARA 2EN6A 2X36A 2BA0G 4ZYGA 2N3HA 1IBME 5LMUE 2F8BA 2BR2A 2F4VE 2ENHA 2K7IA 2YTDA 2HKEA 3ZZUA 1ZM3A 5KL5A 2NA2A 4L5NC 2EM7A 3WU6A 2V2QA 2LJHA 2PNZB 3B78A 2EQ0A 4BHBA 1TN9A 2WW4A 3MHHC 4IS9A 2YTOA 4IJDA 2ELYA 4M0VA 3ECRA 1X6EA 4MQYA 2NPFA 1G2FC 2EPUA 3IWBA 1XNRE 1HNZE 2FGGA 2IHR1 2EWLA 3K1JA 5JEAD 4MLQA 1Z5CA 4BS9A 2BM1A 4LTYA 4LF9I 2EM0A 2EPMX 2RTXA 2EPOA 3JTZA 2WBSA 2V34A 5GMEA 1WUUA 2GQ0A 1ZXMA 3M7NG 4LFBI 5K36D 2YTPA 4YY3E 2IOQA 1VI7A 2WBUA 2JE6B 3BGHA 5FWKA 2L2NA 4YHHE 4FW4A 4IFDA 3ZZ0A 5LMNI 2LMZA 5DROA 1EH8A 2MDRA 1PIEA 2EN4A 3DF6A 2NABA 2V89A 1UDNA 2IERA 4MU0A 4JI3I 4JI5I 2DSYA 2HFSA 4DR4I 5K36A 2L6MA 4B3RE 3QT6A 1IBLI 4QNKA 2X7IA 1FKAE 2EQ3A 3Q6MA 4JI2I 1KJKA 4NXNI 4ISAA 1AAYA 1USVA 2CGEA 4L8NA 4HYMA 1PJQA 3ADJA 1UDOA 2EPXA 5DNXA 2EPNA 2M4IA 1TF6A 3KZZA 2WCC3 3UK3C 3J7AG 1KTVA 3LTOA 1YYOA 2AJ4A 1R6MA 2EZ6A 1ZXNA 2EMXA 4KHPI 4GKJE 2LUPB 2ENAA 2EMKA 4R2PA 1UDQA 3GLLA 1YYKA 2DLQA 2CZ9A 4IZJB 2JOBA 2EOHA 2UXDI 4P7DA 1MG7A 1X47A 4WXCA 1PJSA 1P47A 4K0KE 2LUQA 3LPSA 2JVAA 2Z5BB 2YRHA 2B7TA 4IZJD 3ZM7A 1DGCA 3PYFA 4O43A 2EMLA 1XMOE 3WU4A 2PO1A 4JI7E 2EMIA 5DRQA 2M9AA 4GZNC 2WP8A 2EPLX 4P52A 2HHHE 1IBKI 4KZSA 1YHCA 1YPNA 3OTOI 4F2JC 3Q6NA 2B3TB 1NCSA 4DUYI 4B3MI 1E3PA 2LE2A 3EPLA 2EM8A 2E5LE 2WBTA 2BA1D 2EP3A 3F0NA 1UN6B 1PDAA 2VRDA 5KL3A 5KL2A 1Z0GA 2Z5BA 4JV5E 1WRJA 2V2VA 1I94I 4X62I 5A6BD 4JI5E 4ZYEA 4J8ZA 3JAMQ 3CWVA 2PO2A 2JEBA 2EOYA 2RS7A 5KL6A 2EL5A 4LF5I 1A1IA 2BR2B 3HULA 3VHTB 4ZYDA 4JI2E 1X6HA 5A2QC 1T39A 1OYRA 3FIGA 1O0WA 2A2DA 3L7ZA 3P3EA 4R2EA 4JI4E 5AC4A 2NUEA 4BA1B 4X66I 4JI3E 4I3HA 2ODRC 4FWHA 3HXLA 1N36I 2RPCA 3ZOQB 4FK5C 4B3SE 1USUA 4DUZI 4HACA 1Z1BA 4LF6E 1EA6A 2O1VA 3P3CA 4MDTA 4FW3A 4X64I 3M85G 1GQEA 2EMAA 4FW6A 2HJJA 2LJPA 1XNRI 4IFDF 5KL7A 1D6TA 2FTXB 2VQFI 3BBGA 1KIJA 4JYAI 4DV1E 5K36B 2EFGA 1STUA 4WSGA 1N0UA 2L2MA 3HQ1A 2GHFA 3QT5A 4PRXA 1Z0BA 2EN2A 1Z0WA 2IOPA 1N0VC 2GO3A 2Z5EA 2EMZA 5LMUI 3THOB 5JEAB 2UUBI 1TF3A 4TUGA 1A1JA 1VISA 4USKA 1A1KA 2E72A 2V86A 2YTJA 3P1XA 1Z59A 4OOGC 4PRVA 2ZM6I 1WJPA 3MHSC 4F9AB 2EPKX 1UBDC 3T1HI 2FV4B 1Y4SA 2HC5A 1XXEA 2EOJA 1UDSA 1AH5A 4HXZA 2V88A 4DV7E 1H74A 2EMGA 2L92A 2GPIA 4DR7E 4DV2I 4JI7I 1XMOI 1A1HA 2J7KA 2EMYA 2Z5CB 1T4LB 2YPNA 3L7ZB 3H4LA 4USMA 3J81Q 1N3GA 4X8WA 3EPJA 2Q2EB 4ED4A 2ODRD 1T4NA 4OX9I 2CG9A 3ADGA 4NHRA 2UXBE 4KQVA 2LCEA 3V5RA 4Q35B 2PO2B 2VF3A 2EN7A 4MU3A 5A69A 5C0XA 1A1LA 1XHKA 2VQEI 4LF4I 2EMFA 4IZKA 2JR1A 4M30A 5F3WA 1H72C 2EPPA 2EE8A 3T1YE 2UU9I 2EMHA 4LFAI 2RQLA 2EOIA 1NHHA 2WZOA 2HK3A 2VQFE 5A6AA 4NXNE 4AIMA 4DV6I 2V85A 2V2ZA 2L8TA 2C37B 4O5GA 4WX9A 1H7UA 3JU0A 4DUYE 1Z0CA 1BBGA 3JAMC 1IBKE 4LF4E 4DV7I 4WXDA 2GLIA 1N32I 1N34E 1HNXE 5IWAI 4DR2I 2DEJA 3PS3A 2G7HA 4U3DA 5A6KA 1Z0VA 4YHHI 2JT2A 2YZTA 4PU9A 4Z7YA 2JEAA 2N3GA 2ZITA 4DR4E 2VF1A 2HGHA 4WUDA 3V2UC 1HNWI 4DU7A 1YUIA 2L33A 4LCHA 3AV0A 3K17A 4AM3A 1XMQE 3VK6A 3QT7A 4DV5E 2LT7A 1K47A 2YTQA 2DEIA 3LNUA 2YT4A 2L3JA 2UUBE 1YZ9A 1UEKA 3GONA 4WUCA 5CFFE 2M1SA 3C6MA 2L3CA 2DRPA 2EPZA 4M1KA 5AASA 4AIDA 4O24A 2HKJA 5JEAC 2BBGA 3ADIA 1Y6ZA 2EPCA 4LF9E 4MYUA 2C37A 4B3ME 1RHYA 1BB8A 1WXRA 2RSMA 1B63A 3PYGA 3QT8A 2R42A 4X9JA 4N3OA 2DIXA 5DNYA 2BB8A 4R2AA 5L3JA 4X65I 4IZKB 4EMDA 2PNZA 1EH6A 4DUZE 4QNJA 4B3SI 1XNQI 2JEAB 2KHXA 4LF5E 3C6KA 4DKKA 1EH7A 1EI1A 2PO0B 4DPWA 3QG5C 5JEAF 5ELWA 4RHBB 1N33E 1OYPA 2EOSA 3P3GA 2BM0A 2J7JA 2UXDE 2JP9A 2ELZA 1RR9A 4F9BB 4DV6E 2YU5A 1T4OA 4DV3I 1GTKA 4R2RA 2CTDA 2Q8UA 4R03A 2V87A 4IS1C 1T38A 2NN6E 4GKKI 4OO1C 4JI0E 2HK2A 1ZM9A 3KWRA 2YTNA 2JOXA 2N8XA 2R76A 2A2CA 4OO1F 4R2DA 4NXMI 3HTXA 2CT1A 4B3TI 1MGTA 2PO0A 1HR0E 2JEBB 2F1DA 1RREA 3GCMA 4UTGA 4DV0I 1X49A 1ZM2A 4P7AA 3K85A 3PYEA 2JWOA 3OTOE 4B3RI 1NEIA 4HTGA 4FW9A 2BA1G 4DR2E 4LCFA 4OZEA 1N34I 1B62A 1SFEA 2JE6A 2F4VI 4UT4A 1Y60A 4NZVA 2EMBA 2RSIA 3J80C 2O1TA 1HK7A 3EPHA 4FWGA 5T6JA 1FWKA 4DV0E 4R2QA 2LVHA 3H1CA 2LRSA 2PRTA 1RMDA 4DR3I 2YSPA 2PNLA 5IXMB 1UHZA 2RS6A 3ADLA 3ZZTA 1DI2A 3D4JA 2UUCE 2EM3A 4RPFA 3ZKDA 2PO1B 3IWDA 4LF7E 4OO1D 3U1KA 4DV1I 1FNMA 4IFDD 1HR0I 1A1FA 2VE7C 2JPAA 4OX9E 4N4RB 2EOQA 2YSOA 5GMDA 4BA2B 1J26A 5K36F 4M2ZA 4KWYA 5AC5A 4X64E 1IBLE 4LF6I 2UUCI 1IQOA 1PVGA 1YUJA 4IFDB 2R1FA 2HFUA 2M7QA 2ADRA 1NHJA 4DV3E 5LMNE 1ZBQA 1FWLA 4GQUA 2NN6A 4MYTA 1ELOA 4JI8E 1Z0TA 2V8QB 2JY9A 4BMJA 3M6AA 4LFBE 1YYWA 4F6NA 1SR9A 1X3CA 1E3HA 1NHIA 3H09A 5JEAA 2DLKA 2V83A 4AQYI 1RQ0A 4DR5E 4MU4A 2VESA 1YSAC 4Q28A 4WFTA 4LCGA 2LJUA 3M7ND 2EM4A 3HPSA 1OJ4A 4LFCE 1MU5A 1NZ0A 2CVEA 2J65A 2IESA 4R2SA 4IZJA 2E1MA 4F6MA 1J5EE 3BIDA 3PRYA 2L2KB 2EM5A 2YRKA 2EPAA 4GEQB 1HNZI 1X5WA 4DPUA 2A25A 1X6FA 2EPRA 5C0XC 2E1RA 2EN1A 1MEYC 2EOXA 2NUFA 2NN6B 2EM9A 2EQ1A 2KONA 5AE3A 2LTSA 5IWAE 2EN8A 1HNXI 1FJGE 3GMEA 2I9IA 1IBMI 4JI4I 1S16A 4HY1A 5IV8B 4ZVIA 1JK1A 2DMIA 3THNA 2B9DA 5A6BA 2CPNA 1Z5BA 1KVKA 2NN6F 3UHMA 5A6JA 4K0KI 2E5LI 4LFAE 1H73A 2UU9E 1X48A 3T1YI 3P06A 4MLVA 4M9VC 4DV4I 3PS2A 1ZBTA 3KRNA 1EKZA 4JI1E 5C0XE 4IFDC 3RMPA 4ZYHA 5DRRA 4GKKE 4BC9A 2NN6D 2ZBKB 4P78A 4DR1I 2EOZA 2JYAA 2YTIA 5K36C 2EL6A 2LO3A 2MDGA 1A1GA 1OYSA 2R3VA 4DV4E 3EQ1A 4DV2E 1ZM4A 1XMQI 1GZ6A 4DR7I 2YTGA 2I13A 2MKNA 5DNLA 2NUGA 5BR8E 2EMCA 3M85D 2CSHA 4J3DA 4NBQA 3DD6A 3AUZA 4MU1A 2MC6A 2JXPA 1U2RA 5ADZA 4YY3I 2EM2A 3IWCA 3J81C 2OI2A 2LV2A 2WNRA 4JG4A 5AE1A 4F9CB 4GKJI 4BBYA 3Q1QA 2EOEA 1F2IG 5IT9C 4DR6E 2XEXA 3L00A 5JEAE 3T1HE 3CDJA 1ZAAC 2DGCA 4LOMA 3NZKA 3C4BA 4I8OA 2WP8B 5K36E 3VYYA 2EOFA 2BA0D 2H36X 3TQMA 1J5EI 4DMIA 2YU8A 2NN6C 5TSEA 2LBSB 1Y5YA 1ZR9A 4DU8A 4DR5I 2WNRB 4OO1E 3LMLA 2AE8A 1QNTA 2D9HA 3WU5A 1B69A 4OO1A 2UXBI 2YRMA 1N36E 1HNWE 1XNQE 2DB2A 2ENCA 4FW5A 4BCAA 5FLXQ 2MC5A 4BA2A 1LLMC 1YH8A 1PKPA 4FW7A 1QZRA 2O1UA 3J7Yp 1A6FA 3DJWA 4O4KA 1ZU1A 4LPFA 3WU3A 3F6HA 3P76A 5EKWA 1N33I 3OMLA 4HEIA 1BKNA 2GS8A 3B8HA 1R6LA 4LU9A 1QU6A
chains in the Genus database with same CATH topology
4X66E 4X62E 2ZM6E 4X65E 4FWDA 1Z0EA 3MSWA 2O1WA 2B7VA 3LLHA 3HJCA 4WSPA 4JI6E 1KKHA 4WUBA 5A2QQ 1Y4UA 4R1FA 1FI4A 1Z5AA 1WHNA 5LL6R 3J80Q 4LF7I 2UUAE 2KOUA 1S4EA 4JV5I 2UXCE 3C4TA 4JYAE 2V8PA 4BC7A 4R8OA 2K4VA 2Z5CA 4DV5I 4DPXA 4DPYA 4DR6I 4URLA 3ZKBA 1FJGI 5BR8I 1RC7A 4Z7CA 1WHQA 1UILA 1MX0A 4JI8I 4TUIA 3F6GA 4FN5A 1DQ3A 4DR1E 4LF8I 1N32E 5IT9Q 4B3TE 3VYXA 3B82A 4JI1I 2UXCI 1I94E 1H7SA 3PYDA 2UUAI 2BV3A 4DXLA 4JI0I 4LFCI 4F54A 4KHPE 4LF8E 5AE2A 4NXME 3HPZA 4HACB 3K6QA 4AQYE 2HHHI 4DPTA 2VQEE 4WPYA 3J7AM 4XTJA 5FLXC 4DR3E 2PNMA 4JI6I 2LTRA 4WYQB 2DMYA 1DARA 2X36A 2N3HA 1IBME 5LMUE 2F8BA 3ZZUA 2F4VE 2HKEA 1ZM3A 2NA2A 4L5NC 3WU6A 2V2QA 2LJHA 3B78A 2WW4A 4M0VA 2NPFA 3IWBA 1XNRE 1HNZE 2FGGA 2IHR1 2EWLA 3K1JA 1Z5CA 4BS9A 2BM1A 4LTYA 4LF9I 2RTXA 3JTZA 2V34A 5GMEA 1WUUA 2GQ0A 1ZXMA 4LFBI 4YY3E 2IOQA 5FWKA 2L2NA 4YHHE 3ZZ0A 5LMNI 2LMZA 2MDRA 1PIEA 3DF6A 2V89A 4JI3I 4JI5I 4DR4I 2DSYA 2HFSA 2L6MA 4B3RE 3QT6A 1IBLI 2X7IA 1FKAE 4JI2I 3Q6MA 4NXNI 1USVA 2CGEA 4L8NA 4HYMA 3ADJA 2M4IA 3J7AG 3LTOA 1KTVA 1YYOA 2AJ4A 2EZ6A 1ZXNA 4KHPI 4GKJE 2LUPB 1YYKA 2CZ9A 4IZJB 2JOBA 2UXDI 4P7DA 1MG7A 1X47A 4K0KE 2LUQA 3LPSA 2JVAA 2Z5BB 4IZJD 2B7TA 3ZM7A 3PYFA 3WU4A 1XMOE 4JI7E 4P52A 2HHHE 1IBKI 4KZSA 3OTOI 4DUYI 3Q6NA 4B3MI 2B3TB 2LE2A 2E5LE 3F0NA 1Z0GA 2Z5BA 4JV5E 2V2VA 1I94I 4X62I 4JI5E 4J8ZA 3JAMQ 3CWVA 2RS7A 4LF5I 3HULA 4JI2E 5A2QC 3FIGA 1O0WA 2A2DA 4JI4E 4X66I 2NUEA 4JI3E 4I3HA 2ODRC 4FWHA 3HXLA 1N36I 3ZOQB 1USUA 4B3SE 4DUZI 4HACA 4LF6E 1EA6A 2O1VA 4X64I 1GQEA 1D6TA 1XNRI 2LJPA 2FTXB 2VQFI 1KIJA 4JYAI 4DV1E 2EFGA 1STUA 1N0UA 2L2MA 3HQ1A 3QT5A 4PRXA 1Z0BA 1Z0WA 2IOPA 1N0VC 2Z5EA 5LMUI 2UUBI 1VISA 4TUGA 4USKA 4PRVA 2V86A 3P1XA 1Z59A 4OOGC 2ZM6I 3T1HI 4F9AB 2FV4B 1Y4SA 4HXZA 2V88A 4DV7E 1H74A 2L92A 4DR7E 4DV2I 4JI7I 1XMOI 2J7KA 3J81Q 2Z5CB 4USMA 1T4LB 3H4LA 4X8WA 4ED4A 2Q2EB 2ODRD 1T4NA 4OX9I 2CG9A 3ADGA 2UXBE 4KQVA 3V5RA 2VF3A 2VQEI 1XHKA 4LF4I 4IZKA 2JR1A 4M30A 5F3WA 1H72C 3T1YE 2UU9I 4LFAI 1NHHA 2WZOA 2HK3A 2VQFE 4NXNE 4DV6I 2V85A 2V2ZA 2L8TA 1H7UA 3JU0A 4DUYE 1Z0CA 3JAMC 1IBKE 4LF4E 4DV7I 1N32I 1N34E 1HNXE 5IWAI 4DR2I 2DEJA 2G7HA 4YHHI 1Z0VA 2YZTA 4PU9A 4Z7YA 2N3GA 2ZITA 4DR4E 2VF1A 4WUDA 3V2UC 1HNWI 4DU7A 2L33A 3AV0A 3K17A 1XMQE 3VK6A 3QT7A 4DV5E 1K47A 3LNUA 2DEIA 2YT4A 2L3JA 2UUBE 1YZ9A 1UEKA 3GONA 4WUCA 5CFFE 2M1SA 2L3CA 4M1KA 5AASA 2HKJA 3ADIA 1Y6ZA 4LF9E 4MYUA 4B3ME 1WXRA 2RSMA 1B63A 3PYGA 3QT8A 2R42A 4N3OA 2DIXA 5DNYA 5L3JA 4X65I 4IZKB 4EMDA 4DUZE 4B3SI 1XNQI 2KHXA 4LF5E 4DKKA 1EI1A 4DPWA 1N33E 2BM0A 2UXDE 1RR9A 4F9BB 4DV6E 1T4OA 4DV3I 4R03A 2V87A 4GKKI 4JI0E 2HK2A 1ZM9A 3KWRA 2JOXA 2A2CA 4NXMI 3HTXA 4B3TI 1HR0E 1RREA 4UTGA 4DV0I 1X49A 1ZM2A 4P7AA 3K85A 3PYEA 2JWOA 3OTOE 4B3RI 4FW9A 4DR2E 1N34I 1B62A 2F4VI 4UT4A 2O1TA 3J80C 1HK7A 4FWGA 5T6JA 1FWKA 4DV0E 2LRSA 4DR3I 2PNLA 1UHZA 2RS6A 3ADLA 3ZZTA 1DI2A 3D4JA 2UUCE 4RPFA 3ZKDA 3IWDA 4LF7E 4DV1I 1FNMA 1HR0I 2VE7C 5GMDA 4OX9E 1J26A 4M2ZA 1IBLE 4X64E 4LF6I 2UUCI 1PVGA 2HFUA 2M7QA 1NHJA 4DV3E 5LMNE 1FWLA 1ZBQA 4MYTA 1ELOA 4JI8E 1Z0TA 2V8QB 2JY9A 4BMJA 3M6AA 4LFBE 1YYWA 1SR9A 1NHIA 3H09A 2V83A 4AQYI 1RQ0A 4DR5E 4Q28A 4WFTA 3HPSA 1OJ4A 4LFCE 1MU5A 1NZ0A 4IZJA 2E1MA 1J5EE 3PRYA 2L2KB 1HNZI 4GEQB 4DPUA 2E1RA 2NUFA 2KONA 5AE3A 2LTSA 5IWAE 1HNXI 1FJGE 1IBMI 4JI4I 1S16A 4HY1A 4ZVIA 2B9DA 1Z5BA 2CPNA 4K0KI 1KVKA 2E5LI 4LFAE 1H73A 2UU9E 1X48A 3T1YI 3P06A 4DV4I 1ZBTA 1EKZA 4JI1E 3RMPA 4GKKE 4BC9A 2ZBKB 4P78A 4DR1I 2R3VA 1XMQI 4DV4E 4DV2E 1ZM4A 4DR7I 1GZ6A 2NUGA 5BR8E 3AUZA 2MC6A 1U2RA 5ADZA 4YY3I 2OI2A 3IWCA 3J81C 4JG4A 5AE1A 4F9CB 4GKJI 4BBYA 3Q1QA 5IT9C 4DR6E 2XEXA 3T1HE 3C4BA 4I8OA 3VYYA 2H36X 1J5EI 4DMIA 4DU8A 2LBSB 4DR5I 3LMLA 3WU5A 2UXBI 1N36E 1HNWE 1XNQE 2DB2A 4BCAA 5FLXQ 2MC5A 1PKPA 1QZRA 2O1UA 3J7Yp 1A6FA 3DJWA 3WU3A 1N33I 3F6HA 3OMLA 1BKNA 2GS8A 3B8HA 4LU9A 1QU6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X66 E;  4X62 E;  2ZM6 E;  4X65 E;  4FWD A;  1Z0E A;  4JI6 E;  1KKH A;  4WUB A;  5A2Q Q;  4R1F A;  1FI4 A;  1Z5A A;  5LL6 R;  3J80 Q;  4LF7 I;  2UUA E;  1S4E A;  4JV5 I;  2UXC E;  4JYA E;  2V8P A;  4DV5 I;  4DPX A;  4DPY A;  4DR6 I;  4URL A;  3ZKB A;  1FJG I;  5BR8 I;  4Z7C A;  1MX0 A;  4JI8 I;  4FN5 A;  4DR1 E;  4LF8 I;  1N32 E;  5IT9 Q;  3B82 A;  4B3T E;  4JI1 I;  2UXC I;  1H7S A;  1I94 E;  3PYD A;  2UUA I;  2BV3 A;  4DXL A;  4JI0 I;  4LFC I;  4KHP E;  4LF8 E;  4NXM E;  4HAC B;  4AQY E;  2HHH I;  4DPT A;  2VQE E;  3J7A M;  4XTJ A;  5FLX C;  4DR3 E;  4JI6 I;  1DAR A;  2X36 A;  1IBM E;  3ZZU A;  5LMU E;  2F4V E;  2HKE A;  1ZM3 A;  3WU6 A;  2V2Q A;  3B78 A;  2WW4 A;  2NPF A;  1XNR E;  1HNZ E;  3K1J A;  1Z5C A;  2BM1 A;  4LF9 I;  2V34 A;  5GME A;  1WUU A;  1ZXM A;  4LFB I;  4YY3 E;  4YHH E;  3ZZ0 A;  5LMN I;  1PIE A;  4JI3 I;  4JI5 I;  4DR4 I;  2HFS A;  4B3R E;  3QT6 A;  1IBL I;  2X7I A;  1FKA E;  4JI2 I;  4NXN I;  4HYM A;  3J7A G;  3LTO A;  1KTV A;  2AJ4 A;  1ZXN A;  4KHP I;  4GKJ E;  2CZ9 A;  2UXD I;  1MG7 A;  4K0K E;  3LPS A;  3ZM7 A;  3PYF A;  3WU4 A;  1XMO E;  4JI7 E;  4P52 A;  2HHH E;  1IBK I;  3OTO I;  4DUY I;  4B3M I;  2E5L E;  3F0N A;  1Z0G A;  4JV5 E;  2V2V A;  1I94 I;  4X62 I;  4JI5 E;  3JAM Q;  3CWV A;  4LF5 I;  3HUL A;  4JI2 E;  5A2Q C;  2A2D A;  4JI4 E;  4X66 I;  4JI3 E;  4I3H A;  4FWH A;  1N36 I;  4DUZ I;  4B3S E;  4HAC A;  1EA6 A;  4X64 I;  4LF6 E;  1D6T A;  1XNR I;  2LJP A;  2VQF I;  1KIJ A;  4JYA I;  4DV1 E;  2EFG A;  1N0U A;  3QT5 A;  4PRX A;  1Z0B A;  1Z0W A;  1N0V C;  5LMU I;  2UUB I;  1VIS A;  4USK A;  4PRV A;  1Z59 A;  2ZM6 I;  3T1H I;  4HXZ A;  4DV7 E;  1H74 A;  4DV2 I;  4JI7 I;  4DR7 E;  1XMO I;  2J7K A;  3J81 Q;  4USM A;  3H4L A;  4ED4 A;  2Q2E B;  4OX9 I;  4KQV A;  3V5R A;  2UXB E;  2VF3 A;  2VQE I;  1XHK A;  4LF4 I;  1H72 C;  3T1Y E;  2UU9 I;  4LFA I;  1NHH A;  2HK3 A;  2VQF E;  4NXN E;  4DV6 I;  2V2Z A;  1H7U A;  1Z0C A;  4DUY E;  3JAM C;  1IBK E;  4LF4 E;  4DV7 I;  1N32 I;  4DR2 I;  5IWA I;  1N34 E;  1HNX E;  2DEJ A;  4YHH I;  1Z0V A;  4PU9 A;  4Z7Y A;  2ZIT A;  4DR4 E;  4WUD A;  3V2U C;  1HNW I;  4DU7 A;  3K17 A;  1XMQ E;  3QT7 A;  4DV5 E;  1K47 A;  3LNU A;  2DEI A;  1UEK A;  4WUC A;  2UUB E;  3GON A;  4M1K A;  2HKJ A;  4LF9 E;  4MYU A;  4B3M E;  1B63 A;  3PYG A;  3QT8 A;  2R42 A;  5L3J A;  4X65 I;  4EMD A;  4DUZ E;  4B3S I;  1XNQ I;  4LF5 E;  1EI1 A;  4DPW A;  1N33 E;  2BM0 A;  2UXD E;  1RR9 A;  4DV6 E;  4DV3 I;  4GKK I;  2HK2 A;  4JI0 E;  1ZM9 A;  2A2C A;  4NXM I;  4B3T I;  1HR0 E;  1RRE A;  4UTG A;  4DV0 I;  1ZM2 A;  4P7A A;  3PYE A;  3OTO E;  4B3R I;  4FW9 A;  4DR2 E;  1N34 I;  1B62 A;  2F4V I;  4UT4 A;  3J80 C;  4FWG A;  1FWK A;  4DV0 E;  4DR3 I;  3ZZT A;  3D4J A;  4RPF A;  2UUC E;  3ZKD A;  4LF7 E;  4DV1 I;  1FNM A;  1HR0 I;  5GMD A;  4OX9 E;  1IBL E;  4LF6 I;  4X64 E;  2UUC I;  1PVG A;  2HFU A;  1NHJ A;  4DV3 E;  5LMN E;  1FWL A;  4MYT A;  1ELO A;  4JI8 E;  1Z0T A;  3M6A A;  4LFB E;  1NHI A;  4AQY I;  4DR5 E;  1OJ4 A;  1MU5 A;  4LFC E;  1NZ0 A;  1J5E E;  1HNZ I;  4DPU A;  2E1R A;  5IWA E;  1HNX I;  1FJG E;  1IBM I;  4JI4 I;  1S16 A;  4HY1 A;  4ZVI A;  1Z5B A;  4K0K I;  1KVK A;  2E5L I;  4LFA E;  1H73 A;  3T1Y I;  2UU9 E;  4DV4 I;  4JI1 E;  4GKK E;  2ZBK B;  4DR1 I;  2R3V A;  1XMQ I;  4DV4 E;  4DV2 E;  1ZM4 A;  4DR7 I;  5BR8 E;  1U2R A;  4YY3 I;  2OI2 A;  4JG4 A;  3J81 C;  4GKJ I;  3Q1Q A;  5IT9 C;  2XEX A;  4DR6 E;  3T1H E;  1J5E I;  4DU8 A;  4DR5 I;  3WU5 A;  2UXB I;  1N36 E;  1HNW E;  1XNQ E;  5FLX Q;  1PKP A;  1QZR A;  1A6F A;  3WU3 A;  1N33 I;  1BKN A;  2GS8 A;  3B8H A; 
#chains in the Genus database with same CATH topology
 4X66 E;  4X62 E;  5EL9 A;  2ZM6 E;  4X65 E;  4FWD A;  1Z0E A;  3MSW A;  2O1W A;  2B7V A;  2C39 B;  3U1Y A;  3LLH A;  3HJC A;  4BA1 A;  2C38 A;  4WSP A;  4JI6 E;  1KKH A;  2C38 B;  4WUB A;  1Y4U A;  5A2Q Q;  4R1F A;  5LLQ A;  1FI4 A;  1Z5A A;  1WHN A;  2EOO A;  5LL6 R;  3J80 Q;  4LF7 I;  2UUA E;  2KOU A;  2YWQ A;  1IQS A;  1S4E A;  4JV5 I;  2UXC E;  3C4T A;  4JYA E;  2EOM A;  1PJT A;  5DRP A;  1G2D C;  2V8P A;  2EMW A;  4BC7 A;  4R8O A;  4OKG A;  2K4V A;  2Z5C A;  2EJ4 A;  4DPX A;  4DV5 I;  1YFH A;  3KZY A;  4DPY A;  3M99 B;  4DR6 I;  1BBO A;  4URL A;  4R2C A;  1IMU A;  3ZKB A;  1FJG I;  5KL4 A;  5BR8 I;  1RC7 A;  2YTF A;  4Z7C A;  1WHQ A;  1UIL A;  1MX0 A;  2EN3 A;  4JI8 I;  4TUI A;  3B4T A;  3F6G A;  3EPK A;  4FN5 A;  1DQ3 A;  4RH8 A;  2YTE A;  4DR1 E;  4LF8 I;  2EM6 A;  1N32 E;  5IT9 Q;  4B3T E;  3VYX A;  3B82 A;  4U3B A;  2MKD A;  2EL4 A;  4JI1 I;  1I94 E;  1H7S A;  3PYD A;  2UXC I;  2UUA I;  2BV3 A;  5C0X F;  3BF2 A;  4DXL A;  4JI0 I;  4LFC I;  5C0X B;  4F54 A;  4OO1 B;  3HKM A;  4KHP E;  4LF8 E;  5AE2 A;  1P42 A;  3PS1 A;  4NXM E;  2GO4 A;  4BHC A;  3HPZ A;  4HAC B;  3K6Q A;  3CDI A;  4AQY E;  5C0X D;  2HHH I;  2C39 A;  2VQE E;  4DPT A;  4WPY A;  3J7A M;  2O3Z A;  4XTJ A;  5FLX C;  4DR3 E;  2PNM A;  4JI6 I;  1L4S A;  2LTR A;  4WYQ B;  1KYQ A;  1JK2 A;  2DMY A;  4IFD E;  2EOR A;  1DAR A;  2EN6 A;  2X36 A;  2BA0 G;  4ZYG A;  2N3H A;  1IBM E;  5LMU E;  2F8B A;  2BR2 A;  2F4V E;  2ENH A;  2K7I A;  2YTD A;  2HKE A;  3ZZU A;  1ZM3 A;  5KL5 A;  2NA2 A;  4L5N C;  2EM7 A;  3WU6 A;  2V2Q A;  2LJH A;  2PNZ B;  3B78 A;  2EQ0 A;  4BHB A;  1TN9 A;  2WW4 A;  3MHH C;  4IS9 A;  2YTO A;  4IJD A;  2ELY A;  4M0V A;  3ECR A;  1X6E A;  4MQY A;  2NPF A;  1G2F C;  2EPU A;  3IWB A;  1XNR E;  1HNZ E;  2FGG A;  2IHR 1;  2EWL A;  3K1J A;  5JEA D;  4MLQ A;  1Z5C A;  4BS9 A;  2BM1 A;  4LTY A;  4LF9 I;  2EM0 A;  2EPM X;  2RTX A;  2EPO A;  3JTZ A;  2WBS A;  2V34 A;  5GME A;  1WUU A;  2GQ0 A;  1ZXM A;  3M7N G;  4LFB I;  5K36 D;  2YTP A;  4YY3 E;  2IOQ A;  1VI7 A;  2WBU A;  2JE6 B;  3BGH A;  5FWK A;  2L2N A;  4YHH E;  4FW4 A;  4IFD A;  3ZZ0 A;  5LMN I;  2LMZ A;  5DRO A;  1EH8 A;  2MDR A;  1PIE A;  2EN4 A;  3DF6 A;  2NAB A;  2V89 A;  1UDN A;  2IER A;  4MU0 A;  4JI3 I;  4JI5 I;  2DSY A;  2HFS A;  4DR4 I;  5K36 A;  2L6M A;  4B3R E;  3QT6 A;  1IBL I;  4QNK A;  2X7I A;  1FKA E;  2EQ3 A;  3Q6M A;  4JI2 I;  1KJK A;  4NXN I;  4ISA A;  1AAY A;  1USV A;  2CGE A;  4L8N A;  4HYM A;  1PJQ A;  3ADJ A;  1UDO A;  2EPX A;  5DNX A;  2EPN A;  2M4I A;  1TF6 A;  3KZZ A;  2WCC 3;  3UK3 C;  3J7A G;  1KTV A;  3LTO A;  1YYO A;  2AJ4 A;  1R6M A;  2EZ6 A;  1ZXN A;  2EMX A;  4KHP I;  4GKJ E;  2LUP B;  2ENA A;  2EMK A;  4R2P A;  1UDQ A;  3GLL A;  1YYK A;  2DLQ A;  2CZ9 A;  4IZJ B;  2JOB A;  2EOH A;  2UXD I;  4P7D A;  1MG7 A;  1X47 A;  4WXC A;  1PJS A;  1P47 A;  4K0K E;  2LUQ A;  3LPS A;  2JVA A;  2Z5B B;  2YRH A;  2B7T A;  4IZJ D;  3ZM7 A;  1DGC A;  3PYF A;  4O43 A;  2EML A;  1XMO E;  3WU4 A;  2PO1 A;  4JI7 E;  2EMI A;  5DRQ A;  2M9A A;  4GZN C;  2WP8 A;  2EPL X;  4P52 A;  2HHH E;  1IBK I;  4KZS A;  1YHC A;  1YPN A;  3OTO I;  4F2J C;  3Q6N A;  2B3T B;  1NCS A;  4DUY I;  4B3M I;  1E3P A;  2LE2 A;  3EPL A;  2EM8 A;  2E5L E;  2WBT A;  2BA1 D;  2EP3 A;  3F0N A;  1UN6 B;  1PDA A;  2VRD A;  5KL3 A;  5KL2 A;  1Z0G A;  2Z5B A;  4JV5 E;  1WRJ A;  2V2V A;  1I94 I;  4X62 I;  5A6B D;  4JI5 E;  4ZYE A;  4J8Z A;  3JAM Q;  3CWV A;  2PO2 A;  2JEB A;  2EOY A;  2RS7 A;  5KL6 A;  2EL5 A;  4LF5 I;  1A1I A;  2BR2 B;  3HUL A;  3VHT B;  4ZYD A;  4JI2 E;  1X6H A;  5A2Q C;  1T39 A;  1OYR A;  3FIG A;  1O0W A;  2A2D A;  3L7Z A;  3P3E A;  4R2E A;  4JI4 E;  5AC4 A;  2NUE A;  4BA1 B;  4X66 I;  4JI3 E;  4I3H A;  2ODR C;  4FWH A;  3HXL A;  1N36 I;  2RPC A;  3ZOQ B;  4FK5 C;  4B3S E;  1USU A;  4DUZ I;  4HAC A;  1Z1B A;  4LF6 E;  1EA6 A;  2O1V A;  3P3C A;  4MDT A;  4FW3 A;  4X64 I;  3M85 G;  1GQE A;  2EMA A;  4FW6 A;  2HJJ A;  2LJP A;  1XNR I;  4IFD F;  5KL7 A;  1D6T A;  2FTX B;  2VQF I;  3BBG A;  1KIJ A;  4JYA I;  4DV1 E;  5K36 B;  2EFG A;  1STU A;  4WSG A;  1N0U A;  2L2M A;  3HQ1 A;  2GHF A;  3QT5 A;  4PRX A;  1Z0B A;  2EN2 A;  1Z0W A;  2IOP A;  1N0V C;  2GO3 A;  2Z5E A;  2EMZ A;  5LMU I;  3THO B;  5JEA B;  2UUB I;  1TF3 A;  4TUG A;  1A1J A;  1VIS A;  4USK A;  1A1K A;  2E72 A;  2V86 A;  2YTJ A;  3P1X A;  1Z59 A;  4OOG C;  4PRV A;  2ZM6 I;  1WJP A;  3MHS C;  4F9A B;  2EPK X;  1UBD C;  3T1H I;  2FV4 B;  1Y4S A;  2HC5 A;  1XXE A;  2EOJ A;  1UDS A;  1AH5 A;  4HXZ A;  2V88 A;  4DV7 E;  1H74 A;  2EMG A;  2L92 A;  2GPI A;  4DR7 E;  4DV2 I;  4JI7 I;  1XMO I;  1A1H A;  2J7K A;  2EMY A;  2Z5C B;  1T4L B;  2YPN A;  3L7Z B;  3H4L A;  4USM A;  3J81 Q;  1N3G A;  4X8W A;  3EPJ A;  2Q2E B;  4ED4 A;  2ODR D;  1T4N A;  4OX9 I;  2CG9 A;  3ADG A;  4NHR A;  2UXB E;  4KQV A;  2LCE A;  3V5R A;  4Q35 B;  2PO2 B;  2VF3 A;  2EN7 A;  4MU3 A;  5A69 A;  5C0X A;  1A1L A;  1XHK A;  2VQE I;  4LF4 I;  2EMF A;  4IZK A;  2JR1 A;  4M30 A;  5F3W A;  1H72 C;  2EPP A;  2EE8 A;  3T1Y E;  2UU9 I;  2EMH A;  4LFA I;  2RQL A;  2EOI A;  1NHH A;  2WZO A;  2HK3 A;  2VQF E;  5A6A A;  4NXN E;  4AIM A;  4DV6 I;  2V85 A;  2V2Z A;  2L8T A;  2C37 B;  4O5G A;  4WX9 A;  1H7U A;  3JU0 A;  4DUY E;  1Z0C A;  1BBG A;  3JAM C;  1IBK E;  4LF4 E;  4DV7 I;  4WXD A;  2GLI A;  1N32 I;  1N34 E;  1HNX E;  5IWA I;  4DR2 I;  2DEJ A;  3PS3 A;  2G7H A;  4U3D A;  5A6K A;  1Z0V A;  4YHH I;  2JT2 A;  2YZT A;  4PU9 A;  4Z7Y A;  2JEA A;  2N3G A;  2ZIT A;  4DR4 E;  2VF1 A;  2HGH A;  4WUD A;  3V2U C;  1HNW I;  4DU7 A;  1YUI A;  2L33 A;  4LCH A;  3AV0 A;  3K17 A;  4AM3 A;  1XMQ E;  3VK6 A;  3QT7 A;  4DV5 E;  2LT7 A;  1K47 A;  2YTQ A;  2DEI A;  3LNU A;  2YT4 A;  2L3J A;  2UUB E;  1YZ9 A;  1UEK A;  3GON A;  4WUC A;  5CFF E;  2M1S A;  3C6M A;  2L3C A;  2DRP A;  2EPZ A;  4M1K A;  5AAS A;  4AID A;  4O24 A;  2HKJ A;  5JEA C;  2BBG A;  3ADI A;  1Y6Z A;  2EPC A;  4LF9 E;  4MYU A;  2C37 A;  4B3M E;  1RHY A;  1BB8 A;  1WXR A;  2RSM A;  1B63 A;  3PYG A;  3QT8 A;  2R42 A;  4X9J A;  4N3O A;  2DIX A;  5DNY A;  2BB8 A;  4R2A A;  5L3J A;  4X65 I;  4IZK B;  4EMD A;  2PNZ A;  1EH6 A;  4DUZ E;  4QNJ A;  4B3S I;  1XNQ I;  2JEA B;  2KHX A;  4LF5 E;  3C6K A;  4DKK A;  1EH7 A;  1EI1 A;  2PO0 B;  4DPW A;  3QG5 C;  5JEA F;  5ELW A;  4RHB B;  1N33 E;  1OYP A;  2EOS A;  3P3G A;  2BM0 A;  2J7J A;  2UXD E;  2JP9 A;  2ELZ A;  1RR9 A;  4F9B B;  4DV6 E;  2YU5 A;  1T4O A;  4DV3 I;  1GTK A;  4R2R A;  2CTD A;  2Q8U A;  4R03 A;  2V87 A;  4IS1 C;  1T38 A;  2NN6 E;  4GKK I;  4OO1 C;  4JI0 E;  2HK2 A;  1ZM9 A;  3KWR A;  2YTN A;  2JOX A;  2N8X A;  2R76 A;  2A2C A;  4OO1 F;  4R2D A;  4NXM I;  3HTX A;  2CT1 A;  4B3T I;  1MGT A;  2PO0 A;  1HR0 E;  2JEB B;  2F1D A;  1RRE A;  3GCM A;  4UTG A;  4DV0 I;  1X49 A;  1ZM2 A;  4P7A A;  3K85 A;  3PYE A;  2JWO A;  3OTO E;  4B3R I;  1NEI A;  4HTG A;  4FW9 A;  2BA1 G;  4DR2 E;  4LCF A;  4OZE A;  1N34 I;  1B62 A;  1SFE A;  2JE6 A;  2F4V I;  4UT4 A;  1Y60 A;  4NZV A;  2EMB A;  2RSI A;  3J80 C;  2O1T A;  1HK7 A;  3EPH A;  4FWG A;  5T6J A;  1FWK A;  4DV0 E;  4R2Q A;  2LVH A;  3H1C A;  2LRS A;  2PRT A;  1RMD A;  4DR3 I;  2YSP A;  2PNL A;  5IXM B;  1UHZ A;  2RS6 A;  3ADL A;  3ZZT A;  1DI2 A;  3D4J A;  2UUC E;  2EM3 A;  4RPF A;  3ZKD A;  2PO1 B;  3IWD A;  4LF7 E;  4OO1 D;  3U1K A;  4DV1 I;  1FNM A;  4IFD D;  1HR0 I;  1A1F A;  2VE7 C;  2JPA A;  4OX9 E;  4N4R B;  2EOQ A;  2YSO A;  5GMD A;  4BA2 B;  1J26 A;  5K36 F;  4M2Z A;  4KWY A;  5AC5 A;  4X64 E;  1IBL E;  4LF6 I;  2UUC I;  1IQO A;  1PVG A;  1YUJ A;  4IFD B;  2R1F A;  2HFU A;  2M7Q A;  2ADR A;  1NHJ A;  4DV3 E;  5LMN E;  1ZBQ A;  1FWL A;  4GQU A;  2NN6 A;  4MYT A;  1ELO A;  4JI8 E;  1Z0T A;  2V8Q B;  2JY9 A;  4BMJ A;  3M6A A;  4LFB E;  1YYW A;  4F6N A;  1SR9 A;  1X3C A;  1E3H A;  1NHI A;  3H09 A;  5JEA A;  2DLK A;  2V83 A;  4AQY I;  1RQ0 A;  4DR5 E;  4MU4 A;  2VES A;  1YSA C;  4Q28 A;  4WFT A;  4LCG A;  2LJU A;  3M7N D;  2EM4 A;  3HPS A;  1OJ4 A;  4LFC E;  1MU5 A;  1NZ0 A;  2CVE A;  2J65 A;  2IES A;  4R2S A;  4IZJ A;  2E1M A;  4F6M A;  1J5E E;  3BID A;  3PRY A;  2L2K B;  2EM5 A;  2YRK A;  2EPA A;  4GEQ B;  1HNZ I;  1X5W A;  4DPU A;  2A25 A;  1X6F A;  2EPR A;  5C0X C;  2E1R A;  2EN1 A;  1MEY C;  2EOX A;  2NUF A;  2NN6 B;  2EM9 A;  2EQ1 A;  2KON A;  5AE3 A;  2LTS A;  5IWA E;  2EN8 A;  1HNX I;  1FJG E;  3GME A;  2I9I A;  1IBM I;  4JI4 I;  1S16 A;  4HY1 A;  5IV8 B;  4ZVI A;  1JK1 A;  2DMI A;  3THN A;  2B9D A;  5A6B A;  2CPN A;  1Z5B A;  1KVK A;  2NN6 F;  3UHM A;  5A6J A;  4K0K I;  2E5L I;  4LFA E;  1H73 A;  2UU9 E;  1X48 A;  3T1Y I;  3P06 A;  4MLV A;  4M9V C;  4DV4 I;  3PS2 A;  1ZBT A;  3KRN A;  1EKZ A;  4JI1 E;  5C0X E;  4IFD C;  3RMP A;  4ZYH A;  5DRR A;  4GKK E;  4BC9 A;  2NN6 D;  2ZBK B;  4P78 A;  4DR1 I;  2EOZ A;  2JYA A;  2YTI A;  5K36 C;  2EL6 A;  2LO3 A;  2MDG A;  1A1G A;  1OYS A;  2R3V A;  4DV4 E;  3EQ1 A;  4DV2 E;  1ZM4 A;  1XMQ I;  1GZ6 A;  4DR7 I;  2YTG A;  2I13 A;  2MKN A;  5DNL A;  2NUG A;  5BR8 E;  2EMC A;  3M85 D;  2CSH A;  4J3D A;  4NBQ A;  3DD6 A;  3AUZ A;  4MU1 A;  2MC6 A;  2JXP A;  1U2R A;  5ADZ A;  4YY3 I;  2EM2 A;  3IWC A;  3J81 C;  2OI2 A;  2LV2 A;  2WNR A;  4JG4 A;  5AE1 A;  4F9C B;  4GKJ I;  4BBY A;  3Q1Q A;  2EOE A;  1F2I G;  5IT9 C;  4DR6 E;  2XEX A;  3L00 A;  5JEA E;  3T1H E;  3CDJ A;  1ZAA C;  2DGC A;  4LOM A;  3NZK A;  3C4B A;  4I8O A;  2WP8 B;  5K36 E;  3VYY A;  2EOF A;  2BA0 D;  2H36 X;  3TQM A;  1J5E I;  4DMI A;  2YU8 A;  2NN6 C;  5TSE A;  2LBS B;  1Y5Y A;  1ZR9 A;  4DU8 A;  4DR5 I;  2WNR B;  4OO1 E;  3LML A;  2AE8 A;  1QNT A;  2D9H A;  3WU5 A;  1B69 A;  4OO1 A;  2UXB I;  2YRM A;  1N36 E;  1HNW E;  1XNQ E;  2DB2 A;  2ENC A;  4FW5 A;  4BCA A;  5FLX Q;  2MC5 A;  4BA2 A;  1LLM C;  1YH8 A;  1PKP A;  4FW7 A;  1QZR A;  2O1U A;  3J7Y p;  1A6F A;  3DJW A;  4O4K A;  1ZU1 A;  4LPF A;  3WU3 A;  3F6H A;  3P76 A;  5EKW A;  1N33 I;  3OML A;  4HEI A;  1BKN A;  2GS8 A;  3B8H A;  1R6L A;  4LU9 A;  1QU6 A; 
#chains in the Genus database with same CATH homology
 4X66 E;  4X62 E;  2ZM6 E;  4X65 E;  4FWD A;  1Z0E A;  3MSW A;  2O1W A;  2B7V A;  3LLH A;  3HJC A;  4WSP A;  4JI6 E;  1KKH A;  4WUB A;  5A2Q Q;  1Y4U A;  4R1F A;  1FI4 A;  1Z5A A;  1WHN A;  5LL6 R;  3J80 Q;  4LF7 I;  2UUA E;  2KOU A;  1S4E A;  4JV5 I;  2UXC E;  3C4T A;  4JYA E;  2V8P A;  4BC7 A;  4R8O A;  2K4V A;  2Z5C A;  4DV5 I;  4DPX A;  4DPY A;  4DR6 I;  4URL A;  3ZKB A;  1FJG I;  5BR8 I;  1RC7 A;  4Z7C A;  1WHQ A;  1UIL A;  1MX0 A;  4JI8 I;  4TUI A;  3F6G A;  4FN5 A;  1DQ3 A;  4DR1 E;  4LF8 I;  1N32 E;  5IT9 Q;  4B3T E;  3VYX A;  3B82 A;  4JI1 I;  2UXC I;  1I94 E;  1H7S A;  3PYD A;  2UUA I;  2BV3 A;  4DXL A;  4JI0 I;  4LFC I;  4F54 A;  4KHP E;  4LF8 E;  5AE2 A;  4NXM E;  3HPZ A;  4HAC B;  3K6Q A;  4AQY E;  2HHH I;  4DPT A;  2VQE E;  4WPY A;  3J7A M;  4XTJ A;  5FLX C;  4DR3 E;  2PNM A;  4JI6 I;  2LTR A;  4WYQ B;  2DMY A;  1DAR A;  2X36 A;  2N3H A;  1IBM E;  5LMU E;  2F8B A;  3ZZU A;  2F4V E;  2HKE A;  1ZM3 A;  2NA2 A;  4L5N C;  3WU6 A;  2V2Q A;  2LJH A;  3B78 A;  2WW4 A;  4M0V A;  2NPF A;  3IWB A;  1XNR E;  1HNZ E;  2FGG A;  2IHR 1;  2EWL A;  3K1J A;  1Z5C A;  4BS9 A;  2BM1 A;  4LTY A;  4LF9 I;  2RTX A;  3JTZ A;  2V34 A;  5GME A;  1WUU A;  2GQ0 A;  1ZXM A;  4LFB I;  4YY3 E;  2IOQ A;  5FWK A;  2L2N A;  4YHH E;  3ZZ0 A;  5LMN I;  2LMZ A;  2MDR A;  1PIE A;  3DF6 A;  2V89 A;  4JI3 I;  4JI5 I;  4DR4 I;  2DSY A;  2HFS A;  2L6M A;  4B3R E;  3QT6 A;  1IBL I;  2X7I A;  1FKA E;  4JI2 I;  3Q6M A;  4NXN I;  1USV A;  2CGE A;  4L8N A;  4HYM A;  3ADJ A;  2M4I A;  3J7A G;  3LTO A;  1KTV A;  1YYO A;  2AJ4 A;  2EZ6 A;  1ZXN A;  4KHP I;  4GKJ E;  2LUP B;  1YYK A;  2CZ9 A;  4IZJ B;  2JOB A;  2UXD I;  4P7D A;  1MG7 A;  1X47 A;  4K0K E;  2LUQ A;  3LPS A;  2JVA A;  2Z5B B;  4IZJ D;  2B7T A;  3ZM7 A;  3PYF A;  3WU4 A;  1XMO E;  4JI7 E;  4P52 A;  2HHH E;  1IBK I;  4KZS A;  3OTO I;  4DUY I;  3Q6N A;  4B3M I;  2B3T B;  2LE2 A;  2E5L E;  3F0N A;  1Z0G A;  2Z5B A;  4JV5 E;  2V2V A;  1I94 I;  4X62 I;  4JI5 E;  4J8Z A;  3JAM Q;  3CWV A;  2RS7 A;  4LF5 I;  3HUL A;  4JI2 E;  5A2Q C;  3FIG A;  1O0W A;  2A2D A;  4JI4 E;  4X66 I;  2NUE A;  4JI3 E;  4I3H A;  2ODR C;  4FWH A;  3HXL A;  1N36 I;  3ZOQ B;  1USU A;  4B3S E;  4DUZ I;  4HAC A;  4LF6 E;  1EA6 A;  2O1V A;  4X64 I;  1GQE A;  1D6T A;  1XNR I;  2LJP A;  2FTX B;  2VQF I;  1KIJ A;  4JYA I;  4DV1 E;  2EFG A;  1STU A;  1N0U A;  2L2M A;  3HQ1 A;  3QT5 A;  4PRX A;  1Z0B A;  1Z0W A;  2IOP A;  1N0V C;  2Z5E A;  5LMU I;  2UUB I;  1VIS A;  4TUG A;  4USK A;  4PRV A;  2V86 A;  3P1X A;  1Z59 A;  4OOG C;  2ZM6 I;  3T1H I;  4F9A B;  2FV4 B;  1Y4S A;  4HXZ A;  2V88 A;  4DV7 E;  1H74 A;  2L92 A;  4DR7 E;  4DV2 I;  4JI7 I;  1XMO I;  2J7K A;  3J81 Q;  2Z5C B;  4USM A;  1T4L B;  3H4L A;  4X8W A;  4ED4 A;  2Q2E B;  2ODR D;  1T4N A;  4OX9 I;  2CG9 A;  3ADG A;  2UXB E;  4KQV A;  3V5R A;  2VF3 A;  2VQE I;  1XHK A;  4LF4 I;  4IZK A;  2JR1 A;  4M30 A;  5F3W A;  1H72 C;  3T1Y E;  2UU9 I;  4LFA I;  1NHH A;  2WZO A;  2HK3 A;  2VQF E;  4NXN E;  4DV6 I;  2V85 A;  2V2Z A;  2L8T A;  1H7U A;  3JU0 A;  4DUY E;  1Z0C A;  3JAM C;  1IBK E;  4LF4 E;  4DV7 I;  1N32 I;  1N34 E;  1HNX E;  5IWA I;  4DR2 I;  2DEJ A;  2G7H A;  4YHH I;  1Z0V A;  2YZT A;  4PU9 A;  4Z7Y A;  2N3G A;  2ZIT A;  4DR4 E;  2VF1 A;  4WUD A;  3V2U C;  1HNW I;  4DU7 A;  2L33 A;  3AV0 A;  3K17 A;  1XMQ E;  3VK6 A;  3QT7 A;  4DV5 E;  1K47 A;  3LNU A;  2DEI A;  2YT4 A;  2L3J A;  2UUB E;  1YZ9 A;  1UEK A;  3GON A;  4WUC A;  5CFF E;  2M1S A;  2L3C A;  4M1K A;  5AAS A;  2HKJ A;  3ADI A;  1Y6Z A;  4LF9 E;  4MYU A;  4B3M E;  1WXR A;  2RSM A;  1B63 A;  3PYG A;  3QT8 A;  2R42 A;  4N3O A;  2DIX A;  5DNY A;  5L3J A;  4X65 I;  4IZK B;  4EMD A;  4DUZ E;  4B3S I;  1XNQ I;  2KHX A;  4LF5 E;  4DKK A;  1EI1 A;  4DPW A;  1N33 E;  2BM0 A;  2UXD E;  1RR9 A;  4F9B B;  4DV6 E;  1T4O A;  4DV3 I;  4R03 A;  2V87 A;  4GKK I;  4JI0 E;  2HK2 A;  1ZM9 A;  3KWR A;  2JOX A;  2A2C A;  4NXM I;  3HTX A;  4B3T I;  1HR0 E;  1RRE A;  4UTG A;  4DV0 I;  1X49 A;  1ZM2 A;  4P7A A;  3K85 A;  3PYE A;  2JWO A;  3OTO E;  4B3R I;  4FW9 A;  4DR2 E;  1N34 I;  1B62 A;  2F4V I;  4UT4 A;  2O1T A;  3J80 C;  1HK7 A;  4FWG A;  5T6J A;  1FWK A;  4DV0 E;  2LRS A;  4DR3 I;  2PNL A;  1UHZ A;  2RS6 A;  3ADL A;  3ZZT A;  1DI2 A;  3D4J A;  2UUC E;  4RPF A;  3ZKD A;  3IWD A;  4LF7 E;  4DV1 I;  1FNM A;  1HR0 I;  2VE7 C;  5GMD A;  4OX9 E;  1J26 A;  4M2Z A;  1IBL E;  4X64 E;  4LF6 I;  2UUC I;  1PVG A;  2HFU A;  2M7Q A;  1NHJ A;  4DV3 E;  5LMN E;  1FWL A;  1ZBQ A;  4MYT A;  1ELO A;  4JI8 E;  1Z0T A;  2V8Q B;  2JY9 A;  4BMJ A;  3M6A A;  4LFB E;  1YYW A;  1SR9 A;  1NHI A;  3H09 A;  2V83 A;  4AQY I;  1RQ0 A;  4DR5 E;  4Q28 A;  4WFT A;  3HPS A;  1OJ4 A;  4LFC E;  1MU5 A;  1NZ0 A;  4IZJ A;  2E1M A;  1J5E E;  3PRY A;  2L2K B;  1HNZ I;  4GEQ B;  4DPU A;  2E1R A;  2NUF A;  2KON A;  5AE3 A;  2LTS A;  5IWA E;  1HNX I;  1FJG E;  1IBM I;  4JI4 I;  1S16 A;  4HY1 A;  4ZVI A;  2B9D A;  1Z5B A;  2CPN A;  4K0K I;  1KVK A;  2E5L I;  4LFA E;  1H73 A;  2UU9 E;  1X48 A;  3T1Y I;  3P06 A;  4DV4 I;  1ZBT A;  1EKZ A;  4JI1 E;  3RMP A;  4GKK E;  4BC9 A;  2ZBK B;  4P78 A;  4DR1 I;  2R3V A;  1XMQ I;  4DV4 E;  4DV2 E;  1ZM4 A;  4DR7 I;  1GZ6 A;  2NUG A;  5BR8 E;  3AUZ A;  2MC6 A;  1U2R A;  5ADZ A;  4YY3 I;  2OI2 A;  3IWC A;  3J81 C;  4JG4 A;  5AE1 A;  4F9C B;  4GKJ I;  4BBY A;  3Q1Q A;  5IT9 C;  4DR6 E;  2XEX A;  3T1H E;  3C4B A;  4I8O A;  3VYY A;  2H36 X;  1J5E I;  4DMI A;  4DU8 A;  2LBS B;  4DR5 I;  3LML A;  3WU5 A;  2UXB I;  1N36 E;  1HNW E;  1XNQ E;  2DB2 A;  4BCA A;  5FLX Q;  2MC5 A;  1PKP A;  1QZR A;  2O1U A;  3J7Y p;  1A6F A;  3DJW A;  3WU3 A;  1N33 I;  3F6H A;  3OML A;  1BKN A;  2GS8 A;  3B8H A;  4LU9 A;  1QU6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...