3JAMK

Cryoem structure of 40s-eif1a-eif1 complex from yeast
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
96
structure length
96
Chain Sequence
MLIPKEDRKKIYQHLFQEGVLVAKKDFNQPKHEEIDTKNLFVIKALQSLTSKGFVKTQFSWQYYYYTLTEEGVVYLREYLNLPEHIFPATYLAGQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational Differences between Open and Closed States of the Eukaryotic Translation Initiation Complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Translation
molecule keywords 18S rRNA
total genus 20
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF03501 S10_plectin Plectin/S10 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3jamK00
2FNPA 2HTJA 2PMUA 1XGOA 3EYYA 3ISPA 5AIQA 1LQ1A 1I1SA 5D8LB 4KT5C 4GYIA 5EEGA 1W7PA 4OMZA 2RKHA 4HDUA 1UHWA 2JRTA 2NRAC 2MA3A 4HLYA 4NHJA 2BE5F 2FF4A 4MTDA 2QQAA 5DCMA 3E6DA 1OMIA 1J7KA 3DV8A 3KP2A 1R1VA 3PQKA 4P96A 2KIMA 5LRSA 2L4MA 3RIRA 2IRFG 4WF2A 3LAJA 2A6EF 2RC4A 1SD6A 4LD5A 1KQ8A 1HQCA 3QOPA 4A6DA 1W5SA 1W7PD 5EEHA 1T39A 4B8XA 1MD0A 1RI7A 1HSJA 3WTUC 3JW4A 2YR2A 2EFNA 1XB4A 5HDNA 2W24A 1YQAA 1EH8A 4K2EA 4ENJA 3O6BB 1EH7A 2QENA 1P2FA 3TQNA 1F4KA 2JTVA 4HOBA 2DO7A 2K7LA 3RTRA 3VOEA 4KNYA 1IW7F 4UVAA 3IRRA 4U88A 1IRFA 2E7WA 4OIPF 4NQWA 1R23A 1BI1A 2ZCWA 2OA4A 3J81K 4OIRF 1YLFA 3ZMTA 3ZMZA 5ILSA 3T8TA 2HQNA 3C7JA 5JR3A 2RDPA 1YG2A 4WK8F 1ZGAA 4LG0A 1IZ1A 1P4AA 4U0WA 2LDUA 5D5UB 5ED4A 4U0YA 5LRRA 1ZHFA 1ON1A 1D8JA 5ICGA 2M5WA 2Z9OA 2PG4A 1CF7A 2XROA 5E8IA 3ZN1A 2HKXA 5L3FA 4HYEA 2D45A 2ACJA 1BC7C 1R36A 1O57A 1HBXG 4L9JA 3GW2A 1Y0UA 4A6EA 1P92A 2FBIA 3V7CA 5J8CA 2FA5A 2P8TA 1QBJA 1HW5A 3ZMUA 1BBYA 1FWZA 4MEYF 2BV6A 5HVQC 2DT5A 2P6TA 5K5RA 3J80K 3QRFF 2KKOA 2OAZA 2XKOA 4XBFA 2DFIA 2W84A 3GO5A 3V7SA 1BOAA 3KFWX 5HS7A 3E3VA 1RZ4A 1ZYRF 4S05A 1IRGA 3U2RA 1V3FA 1SMTA 2M1BA 3K1NA 2WV0A 3WTYC 5BQTA 4A2UA 3I64A 4HX7A 2FEZA 2FOKA 4I98B 3H3UA 2OZUA 4OIQF 4CICA 3WE3A 2A3SA 2K4JA 4G6QA 3P9IA 4WXDA 2QQBA 1DPRA 2FBKA 3BZ6A 3DQVC 5FFXA 3TO7A 1XD7A 2ZNZA 5JVTA 4I0AA 4AIKA 1O3TA 1YW9A 2AXLA 4FT8A 3COAC 3WTSC 3VB2A 1FX7A 4ESFA 5D5WB 4BHCA 5CYVA 5E20A 4G7HF 4EM1A 3TOAA 4M71A 3FF5A 2HTSA 1OYWA 1B9MA 2AS5F 2OQRA 2P5VA 1SFXA 4WXCA 4GYGA 5HS9A 3CJNA 1KQ0A 4UUVA 4A5MA 4U7BA 4AD9A 4HLXA 1I6XA 2PI0A 2VE8A 3NEUA 2G7UA 3F3XA 4EJOA 4MHGA 4QWQA 1XDUA 3KETA 3PFIA 4UXNA 2D1VA 5FGMA 1S6LA 1XSXA 6PAXA 3MFKA 1XDSA 2GZWA 2GA2A 1ULYA 1FBSA 2DTRA 3GX4X 5LHIA 3H3ZA 3RPQA 1MJBA 5LEKA 1U6GA 4IHTA 1O3RA 3ROUA 3JAMZ 2FSWA 3SHFA 5BS6A 2M30A 1PDNC 1LDJA 2P4WA 1K7AA 4N9HA 4Y15A 3T1BA 2R7FA 4WXHA 1I1GA 4MNUA 5FO5A 4CXFA 1U5TA 1H0MA 2GXGA 3TO9A 4IRIA 4PDKA 5DUKA 4HAMA 1R1TA 5LGTA 4LB5A 2EFOA 1LEAA 3LAPA 4M6YA 1RIOH 1A04A 3JTGA 1WI9A 1AWCA 4M9XA 4EQQA 4LMYA 1J2XA 5LHHA 4HF2A 4AIJA 1W4MA 2OZ6A 1P4XA 4H0EA 4WX9A 5DCFA 2CYYA 2Z99A 3CUQA 4PGGA 1IUYA 1FLIA 2DQRA 4P5OA 1F1ZA 2V6CA 1S7AA 2EA4A 3U9GA 4RAYA 5K5QA 1KU2A 3BY6A 1USTA 2FNAA 2F5CA 3KP4A 5LHGA 3GFIA 1E2XA 3MAJA 5FLXZ 3KLNA 4JK1X 1FNNA 4XLNF 3E5UA 1LDKB 1JE8A 1IN7A 1XGNA 3ML6A 5E1ZB 2F2EA 1JGSA 3R61A 3F72A 4PCQA 3DF8A 2GXBA 3C3WA 3QPTA 4OIOF 1TNSA 1D3YA 4PZJA 1NHAA 3ZMSA 2ZXJA 3L9FA 5CVUA 4BHPA 4HV5A 1RNLA 4M9ZA 2JSCA 4ZZLA 1ZLJA 2O03A 2EV5A 4P9FA 1G3SA 1R5GA 2HGCA 2XGXA 4KMFA 2HR3A 2NYXA 3D0SA 3F6VA 2PN6A 1ZREA 4LG0B 4M74A 1I5ZA 1USSA 1T6SA 1C0WA 5JFRA 1YIOA 5ILVA 2EFWA 1YW8A 4AIHA 3T5XA 1BI0A 1Q1HA 4IHSA 1I27A 1HSTA 2ZMEB 1Z05A 2OU2A 1T0FA 5ICCA 2Q2EA 3G3ZA 2KRFA 1T38A 2HWVA 5D6FA 1R1UA 4YIFA 5L3CA 4KIBA 4RGSA 1U5TC 1KU3A 2R3SA 1Z6TA 1J59A 1MJ9A 3KLOA 1T2KA 3N4MA 4D0PA 1IN6A 4HQMA 5HDGA 3GZ6A 2K4BA 1G3TA 4HF0A 4BXUA 5HS8A 2VE9A 3BROA 2H09A 4FX0A 4EJTA 4MQVA 3K9TA 1XCVA 1CGPA 4LK0F 1YS7A 3LWFA 2QZ8A 3CUQC 4I01A 3GWZA 3K1MA 4ZZDA 3WU0A 2IJLA 3TOBA 1QNTA 5J6XA 2DK8A 2IA2A 2O61A 4EJUA 3K69A 3U1DA 4YFNF 2J5PA 3BJ6A 1PP7U 4ETSA 5FLXK 3KZZA 3O3KA 3TGNA 3P9KA 2IA1A 2EB7A 3MZYA 1W5TA 2FU4A 2FE3A 1D8KA 3HTUA 1K78A 4KICA 3HRSA 1TTYA 1REPC 3WODF 2E1NA 3CO7C 1BN5A 4XLPF 3Q9SA 3BWGA 4EGZA 3HYIA 2Q8KA 2EV6A 2PQ8A 3HOSA 1MJAA 2Z3YA 2F5EA 1FBQA 2ZO4A 3LA2A 4ESBA 1FPQA 1MKMA 5KVRA 3OV8A 5E17F 2DU9A 3HRMA 2KIUA 1U5TB 2GQQA 1SD4A 3BDDA 4N0BA 2O8XA 4ENNA 2LSOA 2W57A 3L09A 4CYDA 4U0VA 3ERED 2UXXA 1ONVA 4ZH4F 4O5VA 4CHUA 3E97A 1TQIA 3RKXA 2YX7A 1FY7A 1QQIA 3D5LA 4MEXF 2UWMA 3IC7A 3C1DA 3VFZA 2FQ3A 2RQPA 4IRHA 2VODA 5FFZA 1KA8A 4E70A 4Q48A 4CGZA 2CG4A 2MLKA 2EWNA 2RGVA 2IVMA 3DP7A 2DLLA 3CTAA 3Q5FA 3WG9A 4LFUA 3CO6C 4HF1A 4A0ZA 1KU9A 2K27A 2VC0A 3OOPA 4O6JA 4FHTA 5TRDA 4BAYA 2P5KA 3FXRA 1GXPA 3WU1B 4ASNA 5DV5A 4HA8A 1Z91A 1ZG1A 5CVIA 1V4RA 5A2QZ 2BYVE 3ULQB 1X3UA 4L0ZB 1ZH5A 2K86A 3B02A 1FBUA 3WGHA 3GF2A 3HSFA 2ESHA 3WE2A 3RKWA 2OD5A 2YPRA 4LLLA 3H92A 4CZZA 4LJZF 4HX8A 2Z33A 1U3EM 3REOA 3R0AA 3RYPA 5D5VB 2UXNA 4KIGA 2VT3A 1L0OC 1KGSA 2KJCA 2PJPA 2GWRA 1IN5A 2K02A 1QZZA 4G7ZF 5J8FA 4FX4A 4KDPA 4N9IA 5LBQA 1FZPB 4F7ZA 4HQEA 2FBHA 1OYYA 5F6FA 2WTEA 1G4DA 2Y75A 3JSPA 1B4AA 2ZMEA 3TDUC 1ZN2A 4YFKF 2ISYA 4RGRA 1MDMB 2L01A 2VN2A 3CLOA 4AWXB 1R58A 3S2WA 3ABTA 3G73A 1HKQA 1PUEE 3V8KA 2FRHA 1STZA 2XHKA 3F6OA 5E18F 3T8RA 2EA2A 3BJAA 4EMSA 3DKWA 1LJ9A 4WCGA 2MC3A 4OU0A 3QPHA 1P4WA 1CF7B 4GCVA 3FXQA 4HW0A 2QBYA 3ECOA 2XAFA 2KJBA 2CW0F 2EV0A 4IF4A 4RGXA 3HTSB 2Q0OA 1Z1DA 3GVAA 1B59A 5JHUA 3FM3A 1YW7A 2XAJA 3GFJA 4Z2YA 4S04A 4BH9A 3IHUA 4MQ9F 3LQQA 5D4RA 5CVRA 3FX3A 1BI3A 1FSEA 1ZARA 3QAHA 2MD5A 2A5YB 4A0YA 3TO6A 1FYLA 2W85A 4YG2F 2GA1A 4L9VA 4XSXF 1R00A 2WC2A 3GLXA 3CUOA 5BPIA 1SD5A 3F23A 1YO5C 1VTNC 4G94A 2IP2A 4YIIA 1UB9A 2QUFA 3I58A 2DAOA 1W7PB 1OR7A 1SD7A 1FC3A 3F8MA 5HOOA 4JBAA 1DP7P 3KCCA 3J81Z 4EM2A 1H9GA 3EETA 3O2PE 4IJAA 2DK5A 1BI2A 1QO0D 1B9NA 3BPVA 3BOQA 4KMUX 3P9CA 4R1HA 2UZKA 1QGPA 3PQJA 2DPDA 4G7OF 3ZP5A 4HV6A 2JPCA 2P7VB 5D4SA 4B09A 4UVCA 3N97A 2D2WA 2RNJA 1WQ2A 1SFUA 2GIVA 2IPQX 2LNBA 2NS0A 4KUMA 4ZYDA 1LDDA 2IW5A 3I0TA 3VODA 2ZJ2A 4EJVA 3FMSA 2XV4S 4A5NA 3KP3A 5ICEA 4L5IA 3ABUA 3HIFA 4I2OA 1K78B 5HLIA 4RGUA 2XRNA 2A61A 3L2CA 5BOXA 3K1PA 1G6NA 3SZTA 2GAUA 1Z9CA 4KFCA 3R4KA 5CVJA 3J80Z 1G3YA 5DCMB 3LSTA 4Q5SF 2J5OA 2V9VA 3HOTA 4Q4ZF 1KYZA 3FZVA 2ESNA 2JT1A 4I0BA 3RJPA 2FMLA 2A68F 1XGSA 4U7DA 2ELHA 1WWXA 4EGYA 5H6RA 1ZRDA 5L3EA 1S3JA 3CDHA 5KK1A 3EUHA 5K1YA 1K79A 5A2QK 1XN7A 5D8KB 5L3DA 1J9IA 5ICFA 4OOIA 4UHTA 3R6SA 3FMRA 4EVIA 3ZPLA 3E6MA 2QBYB 2BGCA 2HKOA 2MLGA 4EJWA 4A0XA 2QM3A 1J0RA 1XMAA 3E5QA 4WWCA 4GXOA 2ZNYA 4LGWA 4LLNA 1ZAOA 1BC8C 2HOEA 1TNTA 2OQGA 1XMKA 2V79A 2WWYA 1E17A 3IL2A 2RVCA 4G8XA 1J5YA 2X4HA 2CQKA 4DQ2A 1T98A 3HRTA 2VBYA 1MDMA 5IT9K 5CVVA 2B0LA 1XCBA 3R0JA 4XSZF 3SQNA 1IXCA 3QP6A 5H20A 2VC1A 3R60A 2PEXA 3MCZA 2H6BA 1DPUA 3EQLF 3DEUA 3SZPA 3I5UA 4BHBA 1P6RA 3M8EA 1KYWA 2YX4A 2XASA 5L3GA 2ADUA 5DD8A 2HS5A 1XSVA 4M6XA 4UV8A 2EJRA 3FM5A 1U8RA 1LEBA 3HSEA 3WTXC 3W6JB 5HLHA 4RB1A 4RB2C 3RDIA 2CSOA 1TQMA 1LVAA 2DPUA 4RB3C 3KP6A 4MTEA 4ENKA 2L54A 1D5VA 3F8NA 4Q47A 1BIAA 1K6OA 1IXRC 4I09A 5E1XA 1ZG3A 4JQFA 4L18B 1IN4A 4L9NA 2H27A 2JZYA 3GEZA 1TBXA 1F5TA 3ZMVA 1EH6A 2COMA 1IXSB 1HXDA 5TJJA 2M45A 4UNOA 5DYMA 2XAQA 5JI6A 3MEXA 1L3LA 3TDZC 1KU7A 2EFQA 4LLGF 1FOKA 4TV7A 5FD5A 5LGUA 3NQOA 1H9TA 3SFZA 1O7LA 2MH9A 2HZTA 3HRUA 3V8LA 4UVBA 3I59A 2RV8A 3IRQA 2VOOA 3W6KB 4IVNA 3KP5A 2TDXA 4KN7X 4IXAA 5ILUA 1UCRA 1F9NA 3M7GA 1BJAA 3WTZA 1FP2A 2L3DA 3GZ5A 5IT9Z 3EYIA 1B1BA 3LA7A 3LFKA 1SAXA 1U78A 4R79A 3F8FA 2NNNA 2CO5A 2FXAA 2VOPA 2EK5A 4M9SA 4RS8A 1FT9A 1KQ9A 3KE2A 5AIPA 4ZYGA 1BM9A 3FXUA 1IN8A 2ETHA 1RUNA 4L9TA 3WTVC 3GUDA 4R8HA 1R5HA 2IT0A 1PP8F 2G9WA 3T0YA 5FB2A 1S8NA 2MBFA 3HSRA 2V1XA 1GXQA 2PBIA 1LB2A 2C6YA 3MWMA 3M9AA 2ZKZA 4YFXF 3RPUA 3ZN0A 2LF7A 3AAFA 1HKTA 5CJ9A 5F64A 3I59B 1DDNA 4CDGA 4GO1A 3JAMK 5L3BA 2H94A 1O3SA 2ZBKA 1GVJA 2ISZA 2LF8A 2NAZA 1U2WA 1HW1A 2OBPA 2P5LC 2HFHA 1QZYA 1R22A 4KIFA 4UV9A 1YFHA 1LNWA 4O3MA 4P55A 4LB6B 4LK1F 4XRFA 1OPCA 2YU3A 2XKPA 5DEQA 1S29A 3FWEA 3K2ZA 1DUXC 3FHZA 3ZQ7A 1ZRFA 2MH2A 2BBYA 1Z7UA 2XAGA 4EM0B 4I02A 4BQAA 2IA0A 3WTTC 3GYHX 1AOYA 2E1CA 2F5FA 2HYFA 3V7RA 5DD4A 1Z6RA 1ON2A 1QPMA 3JTHA 1TQPA 4KN4X 1XGMA 5LLQA 3FMQA 2XVCA 4P9UA 4ESJA 4QLCU 3ELKA 4IRGA 3QU3A 2P6SA 5AONA 1ZRCA 3ECHA 2DI3A 2QVOA 4BNCA 2XAHA 5DDGA 1SMYF 2ZFWA 2Z5UA 2H6CA 3MZHA 2EFPA 2L02A 3F21A 2XIGA 5E8GA 4A12A 5LGNA 1XSDA 2XUBA 4Y13A 1JXSA 1ZLKA 4DNCA 3M8FA 3DPTA 5LEJA 3IWFA 5H6QA 4M72A 1MGTA 1GHCA 3GFMA 2HYGD 2BEOA 3RI4A 3E6BA 3VEPA 3LQRA 3WTWC 1IF1A 3HHHA 4KYWA 1FYKA 2A69F 3F8CA 2PLYA 1BIBA 2QLZA 5HDKA 3P7NA 2CWEA 3Q9VA 1FSHA 2VBXA 2M8EA 5HLGA 2HEOA 4ZYEA 4HBLA 4L5JA 2DQLA 2STWA 2R7DA 4M73A 4G9YA 3WGGA 1J75A 3HHGA 2HDCA 2YSRA 4BYYA 5ERIA 2V1DA 3GFLA 1UFMA 1ZG5A 2KIFA 4PGHA 4EV0A 1G3WA 3KZYA 4GGGA 5IT3A 1B6AA 3RKYA 3BJOA 3K0LA 5D5XB 1OYIA 2LKPA 2QQ9A 3NRVA 5E1WA 1OKRA 1ODDA 2CFXA 3SXYA 3V4GA 4ON0A 2HQRA 3L7WA 4RAZA 5FD6A 4HDVA 2DBBA 3KEQA 3IWZA 3HUGA 5DUIA 2Y48A 2A6HF 4HZFA 2QWWA 3GXOA 5BPDA 2D1HA 2QYOA 1S7OA 1JHHA 3QP5A 4ZYHA 5D6EA 1O7FA 1YTYA 4MGRA 1FP1D 3IKVA 3I71A 3F22A 1WKMA 3E5XA 4G6DA 3L00A 3J7AO 1IAWA 3RYRA 2L4AA 1HKSA 3ZMDA 1MZBA 1FYMA 2RN7A 2E7XA 2STTA 5BMZA 3I4PA 3DPLC 3DFGA 1TW3A 2M87A 2VBWA 2Y0MA 1YYVA 3B73A 3BPXA 2O6GE 2P7CB 2PFBA 3MQ0A 5F1RA 4CO8A 2PMHA 3V8JA 3C18A 2VT2A 3BP8A 3IKTA 3WGIA 4RB0A 2W25A 1TW2A 2V1UA 3QU6A 3DXJF 2CGPA 2FMYA 3JSOA 3TKYA 1RUOA 2JPBA 3I54A 1WRJA 1JHFA 2O3FA 4Y17A 3CUQB 2VONA 2VBZA 2A07F 3EDPA 2X0LA 3LA3A 4L0YB 4IPAA 3I53A 3KEOA 1TLHB 2F5DA 2DW4A 3KP7A 1R7JA 5K5OA 1HW2A 1EV7A 4OINF 1UHMA 1YS6A 4NB5A 4HX4A 1ZGJA 2O0YA 4OMYA 3E6CC 1O3QA 5CLSA 2VXZA 4I7HA 1WSUA 4KA4A 2G7HA 4ENMA 4AVPA 3F8BA 3M1EA 2NNYA 1SFEA
chains in the Genus database with same CATH superfamily
2FNPA 2HTJA 2HVQA 2PMUA 2WAQA 1XGOA 2LD5A 4OAYA 3VYRB 3EYYA 2VKHA 3ISPA 5AIQA 4XK4A 1LQ1A 1I1SA 1FEXA 3MKLA 5D8LB 4KT5C 1MNMC 4QIWN 3WG7H 4GYIA 5EEGA 1W7PA 2LH9A 4OMZA 2RKHA 4HDUA 1UHWA 1T56A 4IEJA 3ZQGA 4BXFA 2JRTA 3LSGA 4NDLA 2XPVA 2Z16A 1Y1WJ 2NRAC 4II3A 4RMNA 2E71A 2MA3A 4HLYA 1XC5A 3FKJA 4NHJA 2BE5F 3QQAA 2FF4A 4MTDA 1ZR4A 1AA7A 1YX5A 2QQAA 2Y30A 4UB8C 1KONA 5DCMA 3E6DA 1OMIA 1J7KA 3DV8A 3KP2A 1R1VA 3PQKA 1VQ4I 2IEKA 3I3LA 1F43A 1B8IA 2OTLI 1WJBA 4P96A 2AXTC 4XLAA 2KIMA 5LRSA 2XC7A 3RZOJ 2L4MA 3MZ8A 3RIRA 1OQYA 2WA0A 2IRFG 4WF2A 3LAJA 5B5EC 2OCEA 2A6EF 1YJNI 2RC4A 1VQLI 1FOWA 3O8GA 3S3MA 1SD6A 1S72I 2M34A 3H5NA 4LD5A 1W36D 1KQ8A 1HQCA 3QOPA 1ACIA 3TW6A 4A6DA 1FMWA 5EG0B 5JVGF 2XB5A 1W5SA 1W7PD 2I10A 5EEHA 1T39A 3ZRGA 4B8XA 4HNVA 1RKWA 1XPXA 1MD0A 1RI7A 3BTJA 4NC8A 1HSJA 2VJ4A 3A4CA 3JW4A 2YR2A 3WTUC 2EFNA 1XB4A 4I6ZA 3KPHA 2DA1A 5M5WJ 5HDNA 2W24A 3FHNA 4F91B 2E36A 1YQAA 2R7WA 1JI8A 2HXIA 5EF6A 1AKHA 1EH8A 5DM6F 4A3JJ 4K2EA 2R7XA 4ENJA 4JX5A 1YJWI 1VQ7I 1ZTRA 3PSFA 3O6BB 4XOPA 1EH7A 2QENA 4RDUA 1P2FA 2JJ7A 3H5RA 3TQNA 3DLLF 2RAEA 1F4KA 1V55H 1ETQA 2JTVA 1OCCH 4HOBA 1P7JA 2DO7A 2K7LA 4LOCA 3RTRA 3VOEA 4BACA 3HUGB 3H3VK 1Y39A 1X4OA 1W0UA 3GTGJ 4KNYA 1IW7F 4UVAA 5IP9J 3IRRA 4U88A 1IRFA 3KZIC 3JRFA 2E7WA 3Q0VA 4XNFA 1OCPA 4OIPF 2R93J 4NQWA 4IOCF 1BR2A 2VJIA 3S1QJ 1R23A 1BI1A 2M2EA 2ZCWA 1HLVA 2JVHA 2OA4A 1GV2A 3OL3A 4OIRF 3J81K 2CW8A 1JUSA 4BQQA 1X3WB 1YLFA 5C4XJ 2VQCA 5C4JJ 1VI0A 3A2KA 1JGGA 2HPMA 5KAIC 3ZMTA 3ZMZA 4B48A 5ILSA 3T8TA 2HQNA 5J1RA 3S93A 4BBRJ 3C7JA 5JR3A 2JN6A 2RDPA 1YG2A 3CP8A 1A6QA 4WK8F 1ZGAA 4LG0A 4X0GA 1JKPC 1IZ1A 2X6YA 5J47A 1P4AA 4U0WA 1V5GA 2LDUA 5D5UB 1U9OA 5ED4A 4U0YA 5LRRA 3ZCOA 4DGWB 3OYJA 3SJMA 2W7NA 3E0JB 5J1UA 1ZHFA 3OSFA 2H1LA 3FK7A 1D0XA 4HSTA 1ON1A 5CQEA 1D8JA 1O4XA 2N8GA 5ICGA 3LSKA 2M5WA 2PG4A 1CF7A 2Z9OA 4ITVA 2XROA 2DOEA 5E8IA 5JLWA 3ZN1A 1VFCA 2HKXA 3HJEA 1D0YA 1RC9A 4UUSB 5L3FA 2L0KA 4HYEA 4E7LA 1ETKA 4PK4A 2Q2EB 1ZELA 5B3SH 3KYDB 2D45A 2ACJA 1BC7C 1R36A 4A3IJ 1O57A 2W00A 2NVXJ 3ASOH 1HBXG 4L9JA 3GW2A 1DU0A 1Y0UA 4CCJA 4ZTFA 4A6EA 4E7HA 1P92A 2FBIA 3V7CA 5J8CA 2FA5A 2KHMA 2P8TA 3BG7A 1HW5A 3H36A 3ZMUA 1QBJA 1IG7A 3I56I 2M7AA 2E19A 5GAHJ 3OYNA 1BBYA 1FWZA 4MEYF 2BV6A 5HVQC 5M3FJ 2DT5A 2P6TA 4J19A 1KZHA 5K5RA 1GV5A 3J80K 1WZ2A 3QRFF 2KKOA 2OAZA 1SANA 1TP4A 1XG1A 3DKYA 2GLOA 2XKOA 3AG3H 4CCKA 2DA6A 4XBFA 3OYBA 3K4NA 1X1DA 2DFIA 2W84A 3GO5A 3V7SA 1BOAA 3HEFA 5DS9A 3KFWX 5HS7A 2HVSA 2VKVA 3M3YJ 3E3VA 1RZ4A 4IOAF 2EZKA 4QPQA 2XGCA 2R5ZA 2LC2A 2WBMA 2QSGX 1ZYRF 4S05A 1MSFC 1IRGA 3U2RA 1V3FA 1SMTA 2M1BA 3K1NA 2R7OA 3G2BA 2WV0A 3ZQIA 4C3HJ 4ZDOA 3WTYC 1X1BA 5BQTA 2QKMB 1YX3A 4A2UA 3I64A 4HX7A 2FEZA 3JRCA 2VJJA 2FOKA 4I98B 1K6YA 2V1NA 3H3UA 2ZXHA 3OIOA 2OZUA 3DTIA 1WFXA 4OIQF 2EIMH 4FQGA 3WE3A 2A3SA 2K4JA 4G6QA 4CICA 3P9IA 4WXDA 2CFOA 2QQBA 1DPRA 2KISA 2FBKA 4BU2A 3BZ6A 3CLQA 3DQVC 5FFXA 3TO7A 1XD7A 2LLKA 2H8RA 2ZNZA 5JVTA 3CCJI 1FOXA 1JT0A 3IUOA 3FIWA 4I0AA 2MD0A 5CQGA 4AIKA 3PNTA 1O3TA 1YW9A 2AXLA 4FT8A 3COAC 2RNGA 3H9GA 2VQGA 3WTSC 4B43A 4PUSA 2KP6A 3VB2A 3HOYJ 4BQNA 1FX7A 2X51A 4ESFA 5D5WB 4BHCA 2E5ZA 5CYVA 5E20A 4G7HF 4EM1A 3OYGA 3TOAA 4M71A 2CV1A 1Z77A 2CQXA 3FF5A 2HTSA 3CCYA 5C3EJ 1OYWA 4BGDA 1B9MA 2AS5F 2OQRA 3GLLA 1UHSA 2P5VA 1SFXA 3ERMA 4WXCA 1A5JA 1D0ZA 4GYGA 5HS9A 5LFAA 2Y9YA 2O7OA 1R9TJ 2NVTJ 3CJNA 1KQ0A 3GTOJ 4UUVA 3F9KA 4A5MA 4OWRB 1LPQA 2KL4A 4U7BA 4AD9A 4E7JA 4HLXA 1X58A 1D1AA 2W4SA 1I6XA 2PI0A 2EIKH 2VE8A 3NEUA 2G7UA 3F3XA 3BG5A 4EJOA 4MHGA 4QWQA 1XDUA 2NVYJ 2BY0A 3KETA 3PFIA 4UXNA 2D1VA 5FGMA 2HOTA 2VUMJ 1MIJA 1S6LA 5IYBJ 1XSXA 4XIDA 3L2QA 1I3AA 6PAXA 3OYHA 3MFKA 1XDSA 2HDWA 5HNFA 3BR5A 1WVRA 2GZWA 2GA2A 1ULYA 2KZGA 1FBSA 2Y0SA 4ZDPA 2DTRA 3ONQA 3GX4X 3CD6I 5LHIA 3H3ZA 1YOVB 3RPQA 5IY5H 2KZVA 2LREA 4E7KA 1MJBA 5LEKA 1U6GA 4IHTA 1MBGA 1O3RA 3KIOA 4I99C 4F52A 3ROUA 3JAMZ 2FSWA 4AIDA 5GAGJ 3SHFA 5BS6A 2M30A 4FISA 3U1KA 2Y9ZA 3F0CA 2CJJA 1PDNC 2R7SA 3AG2H 1LDJA 2ECBA 2P4WA 2PMZA 3Q0WA 4XN3A 1H8AC 4B3AA 2VASA 4I76A 4GFBA 1Y6IA 1K7AA 2WADA 1MBEA 4N9HA 4Y15A 1PUFA 2IS6A 3T1BA 2R7FA 4WXHA 3I55I 1ETWA 3G1OA 1I1GA 1ZKGA 3QYFA 4MNUA 3DEWA 5FO5A 5BNGA 4CXFA 1ETYA 1SFOJ 1U5TA 5FROA 4DYCA 3D1NI 1H0MA 2GXGA 2DA4A 3K4JA 1K4SA 1YIJI 2JVGA 3TO9A 2AQEA 4IRIA 1LUJB 4PDKA 1QU3A 1IC8A 5DUKA 4HAMA 1R1TA 3HL2A 4YELA 3G1LA 5LGTA 2JSPA 1I6HJ 4LB5A 1OR7C 1MMNA 3EUHC 2EFOA 5CPRB 1LEAA 5FKOA 3LAPA 4M6YA 2DODA 5EZHA 2DA2A 1RIOH 1A04A 3JTGA 2R7UA 1WI9A 3OYMA 3OYFA 1AWCA 2DYSH 4M9XA 4EQQA 1MBHA 2LYCA 1J2XA 4LMYA 3MN2A 3VYUB 5LHHA 4HF2A 4AIJA 5F0FA 5FJ8J 1W4MA 2OZ6A 1P4XA 4JX6A 1UELB 2E2IJ 4WX9A 4H0EA 2M7BA 4PFOA 1I39A 2CYYA 5DCFA 2Z99A 4Y52J 5EZGA 3CUQA 4PGGA 1IUYA 1FLIA 3A03A 2DQRA 3DWLE 2VL8A 1DGWY 4E7ZA 1SEUA 4P5OA 3JRAA 4XKWA 1F1ZA 2V6CA 1S7AA 2X6WA 3LSRA 4M3DA 4XKVA 2EA4A 3U9GA 5IOYA 4RAYA 4YIRX 5K5QA 1KU2A 3HXLA 3SEQA 3BY6A 1TT5B 1USTA 2FNAA 2MFZA 2ZXWH 2F5CA 2X6OA 5K7ZA 3KP4A 5LHGA 3GFIA 2WV1A 2K9MA 4ZC3A 1HA8A 1E2XA 2WAQN 3MAJA 4HNTA 5FLXZ 1VQ5I 3KLNA 2EILH 5M5XJ 4JK1X 1FNNA 3NWSA 3OMYA 1BA5A 3OOUA 4XLNF 3E5UA 2L9SA 1X1CA 1LDKB 2R0QC 3W2AA 1JE8A 1IN7A 1XGNA 3ML6A 1XTAA 1QRYA 2F2EA 5E1ZB 1JGSA 1BJZA 1S7EA 1WJ5A 2PX9A 3LOCA 5FLVA 4XLHA 5GPAA 2R7VA 3BCAA 3R61A 3F72A 4PCQA 4CCLA 3DF8A 5KCMA 2GXBA 3C3WA 3FBNB 3QPTA 4OIOF 2DTZA 1SFKA 1TNSA 1IDYA 1D3YA 2V9PA 4PZJA 4OAZA 1NHAA 1I50J 3SYTA 5F0HA 3ZMSA 2ZXJA 3HC7A 4XLEA 3L9FA 1HDPA 2R92J 5CVUA 2EH3A 4BHPA 5IYDJ 4HV5A 1RNLA 3DKXA 4M9ZA 2JSCA 1EF4A 4ZZLA 2JA8J 1ZLJA 2O03A 2EV5A 3K4MA 1G3SA 1R5GA 2HGCA 4P9FA 2B63J 2XGXA 1IJWC 3HZJA 4AYBN 4AVZA 3DLAA 3A0BC 4M3GA 1HOMA 4KMFA 2Y69H 3BQYA 2HR3A 2L7MP 2NYXA 3D0SA 3F6VA 3JR9A 3G6EI 4XOTA 2PN6A 2K5CA 1ZREA 4LG0B 1WJAA 1X2MA 2D5VA 1WJDA 2BY2A 1DGRM 4M74A 3M8JA 1I5ZA 1USSA 1T6SA 2AO9A 4F3QA 1JTYA 2QGUA 2CUJA 4CA0A 2DT7B 1T8IA 1C0WA 5JFRA 4BE2A 2BZTA 1YIOA 5ILVA 3KYLA 2EFWA 3FK6A 2EQRA 1YW8A 4PFPA 4G6TB 4AIHA 2K40A 3T5XA 1BI0A 4UUSA 4A3MJ 1Q1HA 4IHSA 4D1QA 1I27A 3A01A 3AG4H 1HSTA 2ZMEB 4XICA 3TW7A 1Z05A 1D5YA 2OU2A 1T0FA 4V2GA 5ICCA 2Q2EA 3G3ZA 2KRFA 1T38A 2HWVA 2DMQA 5D6FA 1R1UA 4YIFA 3OYCA 5L3CA 4KIBA 2IGOA 4RGSA 1LFUP 1MMAA 2CV2A 1U5TC 5E79C 1Z3XA 1KU3A 9ANTA 3BG6A 2CU7A 1BR4A 2E1OA 1SVMA 2R3SA 2ME6A 1Z6TA 2KPMA 1IRZA 3TEDA 3B6AA 4D9JA 1J59A 1MJ9A 2E1MC 3KLOA 3CQZJ 4FTHA 4IHWA 1MMDA 1RPWA 4XLCA 1T2KA 3CZ6A 3N4MA 2K9QA 4D0PA 1IN6A 4HQMA 3ZGKA 5K7HA 5HDGA 3GZ6A 4E6KG 2K4BA 1IRXA 1G3TA 4HF0A 5F0CA 4BXUA 5HS8A 4CYCA 4CCOA 2VE9A 3BROA 3SDGA 2H09A 4FX0A 4RAFA 4EJTA 3C2GA 3HBLA 4MQVA 3CMYA 3K9TA 4NQWB 4BE1A 1XCVA 1CGPA 1B72A 4LK0F 1QHGA 1YS7A 2FQ4A 3LWFA 1JUMA 2QZ8A 2NOGA 1NG7A 3CUQC 4NC6A 4I01A 3GWZA 1NH3A 3K4LA 3K1MA 4ZZDA 3WU0A 2DJNA 1NG6A 2IJLA 3JRIA 5DTDA 2MABA 3TOBA 1QNTA 5J6XA 2DK8A 1G2HA 4JP0A 1LE8B 2IA2A 4S0HB 3DTEA 2ELKA 2O61A 4EJUA 3K69A 3U1DA 4YFNF 2J5PA 2O5RA 3BJ6A 1PP7U 4ETSA 3MD2A 2MG4A 5FLXK 1QVUA 3JREA 1AKHB 2EPFA 3LMMA 1TWHJ 3KZZA 3O3KA 2R5YB 3TGNA 3P9KA 2IA1A 4DYQA 3CCLI 5IYCJ 2EB7A 2MC4A 3MZYA 1W5TA 2FU4A 2FE3A 3DEEA 1D8KA 2BVMA 3HTUA 4XKCA 1K78A 1R6RA 4KICA 2MSYA 4EEFG 3HRSA 3LSHA 2ZMEC 1TTYA 1REPC 4M3EA 1X2NA 3WODF 3TMOA 2E1NA 3CO7C 2JUGA 3GTKJ 1BN5A 4XLPF 3Q9SA 3DU6A 2QA4I 3BWGA 4EGZA 3AFHA 1XMXA 3HYIA 3S1NJ 2I8DA 2WAEA 2Q8KA 2EV6A 2PQ8A 3HOSA 1D1BA 4BEHA 1JKQC 4G12A 1SAUA 1MJAA 2Z3YA 3HPHA 2F5EA 1FBQA 2IGMA 2VB6A 2Z2SB 2ZO4A 3LA2A 1ZGWA 2K9SA 4ESBA 1FPQA 1V5FA 1ERDA 1MKMA 4ZYAA 3HGYA 4XL9A 5J4VA 5KVRA 3OV8A 5E17F 2DU9A 3HRMA 2KIUA 1U5TB 2GQQA 1SD4A 3BDDA 4N0BA 2O8XA 1RRJA 4ENNA 2LSOA 1MBJA 2W57A 2CW7A 2K3PA 2P0WA 4A3DJ 3M1CA 1DP3A 3L09A 4CYDA 2QEXI 4U0VA 3ERED 2UXXA 1ONVA 4ZH4F 1SVLA 4O5VA 4CHUA 3E97A 1TQIA 3H9QA 3RKXA 2K85A 2YX7A 4C2UA 1FY7A 1TC3C 4YEJA 3IAM2 3OR2C 2HYJA 2DCEA 3RPUD 1QQIA 3D5LA 4MEXF 3AL0B 2UWMA 3IC7A 3C1DA 3H0GJ 3VFZA 4MLOA 2FQ3A 2RQPA 4IRHA 2VODA 5FFZA 4D5FA 2LTPA 1KA8A 4E70A 3JRBA 4Q48A 2ME0A 4MIMA 3A02A 4Y33A 4CGZA 2CG4A 2MLKA 2EWNA 5IP6A 2RGVA 4ZDLA 4W1UA 2IVMA 3DP7A 2DLLA 2QF7A 3CTAA 2E34A 3Q5FA 1EKEA 3WG9A 4LFUA 3CO6C 1RKTA 4HF1A 1E3HA 2M0CA 4A0ZA 1KU9A 4E7SA 5FKMA 2K27A 2ZSHB 2DA5A 2EZLA 3PIOF 2VC0A 3OOPA 1VZ0A 3SDBA 3VSLA 4BEHB 3B6CA 4O6JA 4HNUA 4NUBA 4FHTA 3DU5A 1B8IB 5TRDA 4BAYA 2A05A 2RREA 3AG1H 2P5KA 3FXRA 1GXPA 3AL0C 3WU1B 4ASNA 5DV5A 4LIVA 4HA8A 1Z91A 1R4NB 1ZG1A 5CVIA 1V4RA 2CH0A 5A2QZ 2BYVE 3ULQB 1X3UA 3I9V2 4L0ZB 1ZH5A 2K86A 3B02A 1GT0C 1FBUA 3ESWB 5B1AH 3BLYA 2GBYA 3WGHA 3OYKA 2ZJPF 4BDZA 3GF2A 3HSFA 4CYCB 1VQOI 2E35A 2ESHA 3WE2A 3EPZA 3RKWA 2R7TA 1GLNA 1YHQI 2OD5A 2YPRA 4HG2A 4LLLA 3MKWB 3H92A 4CZZA 4LJZF 2ECCA 1FTTA 2DA3A 1B72B 1PJRA 4HX8A 2Z33A 1U3EM 2HOAA 1QZEA 3PO2J 3REOA 2WAFA 3GBGA 3R0AA 1MSEC 3RYPA 3VPRA 5D5VB 5J3LA 2X1DA 1I3QJ 2LR8A 2UXNA 3CDIA 2JWTA 2P81A 2HZDA 4KIGA 1Z21A 5EGOA 2VT3A 2NXNB 1L0OC 1KGSA 2LK2A 3RQIA 3ZR8X 2KJCA 2PJPA 2GWRA 1IN5A 2K02A 1E3OC 1QZZA 4G7ZF 3CC4I 5J8FA 4FX4A 4KDPA 4N9IA 3MKYB 5LBQA 1FZPB 4LG3A 2HI3A 2KLOA 3MKZA 3HOZJ 4F7ZA 4PJLA 2DA7A 4HQEA 4DW6A 2FBHA 2JK3A 1OYYA 3OS1A 5F6FA 3O8HA 2WTEA 4Y4RA 1G4DA 2GIZA 2IXSA 2Y75A 3JSPA 1B4AA 2YU9J 3QOEA 2ZMEA 3TDUC 4AUXA 1ZN2A 3SZGA 4YFKF 1G8XA 1LFBA 2ISYA 4RGRA 1MDMB 1ORKA 4CUGA 3CMMA 2M4KA 4J00A 5LD2C 1Z67A 4F93B 3RZDJ 4N4OB 3E1SA 2L01A 2VN2A 3CLOA 1MMGA 3G4SI 2XPUA 4AWXB 3IV5A 1R58A 2KRCA 3S2WA 2XRLA 3ABTA 3G73A 1VQPI 3IP4B 1HKQA 2GOMA 4CSWA 1W5CC 4NBQA 1PUEE 3V8KA 3CESA 1JJ6C 2FRHA 4MFDA 1STZA 2XHKA 3F6OA 2OUMA 2IGKA 5E18F 3T8RA 4CH7A 2K3FA 4HPQA 4UUTA 2EA2A 3OS0A 5C44J 4E4HA 1WPKA 3BJAA 4EMSA 4PJMA 3DKWA 1OFCX 3PJRA 1LJ9A 2R4GA 4WCGA 2MC3A 2I5UA 4OU0A 3QPHA 1YRNB 1P4WA 1CF7B 4GCVA 4HSRA 5HNHA 3FXQA 4HW0A 2QBYA 3ECOA 4PSWA 4A3KJ 1N77A 4A3FJ 2XAFA 2KJBA 1Z7LA 3CMAI 2CW0F 1T95A 1BW6A 3X2QH 1X19A 2NVUB 3AKZA 2EV0A 4IF4A 4RGXA 1FJLA 4NC7A 3HTSB 3GTPJ 2Q0OA 1Z1DA 2TRTA 3DCFA 3GVAA 1JT6A 2B9SA 2XF5A 3HKZN 1B59A 3VYTB 1MNDA 5JHUA 3FM3A 1X4PA 4PJNA 1MH4A 3RQ4A 1QPIA 1YW7A 2XAJA 3GFJA 4Z2YA 2KT0A 3MVPA 4S04A 4BH9A 3IHUA 3WHBA 4MQ9F 2JQ7A 3LQQA 5D4RA 1YITI 1POGA 1UJ8A 5CVRA 3FX3A 1BI3A 1FSEA 1YE9A 1ZARA 1R5ID 3QAHA 2HU9A 2MD5A 2A5YB 4A0YA 3TO6A 1FYLA 2TCTA 2W85A 4YG2F 3J7AY 2GA1A 3I4NJ 4L9VA 4XSXF 2VPLA 1R00A 2K9LA 4ZJZA 1ETOA 2WC2A 3GLXA 3QYEA 2QKLB 3CUOA 2V26A 3DBHB 1UZCA 5BPIA 2LOOA 1SD5A 3K10A 3F23A 1YO5C 1VTNC 4G94A 5F04A 2R7RA 2IP2A 3S15J 5FKNA 2E5NA 3S17J 1WJEA 3OIPA 2HQ5A 4YIIA 2LP0A 1OCZH 1UB9A 2QUFA 3OWTA 1OISA 1TT0A 2V7FA 3I58A 1K4TA 4N4NB 3OYDA 1H89C 2DAOA 4DYRA 2LY2A 2NS7A 1W7PB 1OR7A 1VQ8I 3I4MJ 1SD7A 2JA5J 1W1WE 1WH5A 2NOJB 1FC3A 1HDDC 1VQKI 3F8MA 5EG0A 1PUFB 5HOOA 4JBAA 3G71I 1DP7P 2A5WA 3KEYA 3VDXA 5DM7F 3DBLB 3KCCA 5F27A 3J81Z 2KQRA 4II2A 1DU6A 3PO3J 2DMTA 1WJCA 4EM2A 1H9GA 3EETA 3O2PE 1T0FC 4IJAA 2DK5A 1BI2A 1VQNI 1QO0D 1FOYA 3PUFA 1B9NA 3BPVA 2L9RA 3BOQA 2CQ7A 3CC2I 5HODA 4KMUX 3P9CA 1WGXA 1GVDA 4RA2A 3L2VA 4RBOA 1BW5A 4R1HA 4BY7J 2UZKA 1QGPA 3PQJA 3QPLA 5FKLA 2DPDA 4G7OF 2FD5A 5J4YA 3HOWJ 3ZP5A 4DZPA 1VQ9I 4HV6A 3H1CA 3WHCA 2DDBA 4NNJA 2R7ZJ 2JPCA 2P7VB 5D4SA 4B09A 1OLTA 4UVCA 2R7QA 3N97A 2D2WA 1MBKA 5IP7J 2RNJA 1WQ2A 1HF0A 1SFUA 4YRVA 3Q0UA 2GIVA 4XN0A 2DT6A 2IPQX 1Z0XA 5GTIC 2CUEA 2LNBA 1S5LC 2NS0A 4KUMA 4ZYDA 1LDDA 2IW5A 1UMQA 2GOXB 3I0TA 4LIUA 3VODA 2NS8A 2ZJ2A 4EJVA 3FMSA 1UG0A 3JRDA 2XV4S 1SC7A 4A5NA 3KP3A 4A3EJ 5EJCA 5ICEA 2BOLA 4L5IA 3J7YJ 4AYBA 3ABUA 2ZJQF 3HIFA 3EUAA 4I2OA 4IQ4A 5EDNA 1K78B 4IQJA 5HLIA 3LSPA 3GCMA 4RGUA 2IAIA 2JA2A 2LBFB 3FISA 2HNHA 1DQUA 2XRNA 4XKBA 2A61A 1Y0NA 3BTLA 3L2CA 5BOXA 4BJTA 3K1PA 1G6NA 3SZTA 1MNEA 3ZQFA 2RQQA 2GAUA 2E2JJ 1Z9CA 4KFCA 3R4KA 2ZJRF 5CVJA 3WU2C 4IKFA 3J80Z 1G3YA 1TWCJ 5DCMB 3LSTA 3OYLA 4IZZA 2LKSA 1FTZA 4BJ5C 3BG9A 1BOBA 2J5OA 4Q5SF 2V9VA 3HOTA 1TWGJ 3PSIA 4Q4ZF 1KYZA 3FZVA 2ESNA 2JT1A 4I0BA 3PIPF 2ZXIA 3RJPA 2FMLA 2A68F 1U0JA 1XGSA 2ID3A 2HQAA 4U7DA 3GTMJ 2ELHA 3CCEI 3FXOA 1WWXA 4EGYA 4Y3OA 4XQFA 1FIPA 5KNLA 3QODA 2CQQA 5H6RA 4XORA 1TZLA 5L3EA 1S3JA 3CDHA 1ZRDA 3D5SC 5KK1A 5HLTA 2OCCH 1R4MB 3EUHA 5K1YA 1YJ9I 1IV8A 1K79A 5A2QK 1XN7A 5D8KB 1Y1VJ 1FMVA 5L3DA 1S9HA 2LMDA 3K4KA 1J9IA 5ICFA 4OOIA 3GTJJ 2NVQJ 3EUKL 4UHTA 3R6SA 3FMRA 1MMSA 5GADJ 4XMYA 4EVIA 3ZPLA 3E6MA 2BY1A 2BGCA 5F1JA 2QBYB 2HKOA 2XB0X 4XM3A 2MLGA 2E60A 4A0XA 4EJWA 2QM3A 1N25A 2L7ZA 1J0RA 2OF7A 3BR0A 1XMAA 2DFFA 1PYVA 2CMPA 3E5QA 4WWCA 2PJRA 4GXOA 2ZNYA 1EA3A 2WB1N 4LGWA 4LLNA 1ZAOA 2VQLA 4GDFA 3IH3A 1NTCA 4QPOA 3CC7I 4DBRA 4A3BJ 1BC8C 2F5VA 2HOEA 1TNTA 2OQGA 3V42A 1XMKA 3CMEI 3QWLA 3OS2A 2V79A 2WWYA 1E17A 5FRNA 3LSIA 2ID6A 3IL2A 3K70C 1Y56A 2RVCA 4G8XA 3RCOA 1JUPA 2FJ1A 1J5YA 4V2FA 2KDZA 2X4HA 4BE0A 2CQKA 1H88C 4DQ2A 2L2OA 1ETXA 1T98A 2OJED 4B44A 3HRTA 2VBYA 2H8WA 1MDMA 5IT9K 1U8BA 5CVVA 1TWAJ 2WY7Q 3S1MJ 2B0LA 1OCOH 2OV7A 2L9NA 2JA6J 3S32A 5IPAA 1XCBA 3R0JA 4XSZF 3SQNA 2IS1A 2M8GX 1IXCA 3QP6A 5H20A 2VC1A 2DDAA 3R60A 2F4IA 2HPIA 2PEXA 3MCZA 2H6BA 1T33A 4RM2A 3C2BA 1DPUA 3BCBA 2AHQA 3FKIJ 3EQLF 3DEUA 3SZPA 3I5UA 4BHBA 3GTQJ 1X1AA 1P6RA 3M8EA 1KYWA 2K9NA 2FUG2 1JJ8C 2YX4A 1LE8A 2XASA 5TGTA 4X6AJ 1X1PA 4BQOA 5L3GA 2ADUA 2CRGA 4W97A 4BY1J 5DD8A 3CJQB 3KX2A 2HS5A 1XSVA 1W36C 3HDDA 3UNGC 2DXIA 4M6XA 1RESA 2Y0SN 3OYIA 4UV8A 2EJRA 3FM5A 4AU7A 2ELJA 1U8RA 1YRNA 3SFIA 1LEBA 3HSEA 3CCMI 2R5ZB 3ZQQA 1YI2I 3WTXC 3CJRB 3W6JB 2EBIA 5HLHA 4FASD 4RB1A 3IH2A 4XONA 4BJ6C 4RB2C 3W3CA 3RDIA 2CSOA 3K4BA 1TQMA 2X48A 3NARA 4C3JJ 2COBA 1LVAA 2F48A 2DPUA 3S2HJ 1VQ6I 2ZC2A 4RB3C 3PNYA 3S3NA 3KP6A 1N78A 3NAUA 1G59A 3S2DJ 2ZB9A 3BZCA 4MTEA 4HRIA 2VXDA 4ENKA 4B47A 2L54A 2G0EA 5M5YJ 2XPWA 1LFPA 3G1MA 1D5VA 3F8NA 4XRMA 1JKOC 2LY9A 4Q47A 1BIAA 2HOSA 1K6OA 1A36A 1IXRC 1D1CA 4I09A 5E1XA 1ZG3A 4JQFA 4IHYA 1M1EB 1MH3A 2DFHA 2MYSA 2VLAA 1IN4A 3CF5F 4L18B 4L9NA 2H27A 2JZYA 3GEZA 1TBXA 3OY9A 3BG3A 1F5TA 1IDZA 4ANJA 5J40A 3ZMVA 4PSXA 1EH6A 2DN0A 2COMA 4XR6A 2QSHX 2YUSA 2VJ5A 3D5RC 1IXSB 2CQNA 1HXDA 5TJJA 2M45A 4UNOA 5DYMA 2XAQA 3S3OA 2V4JC 5JI6A 3OYEA 3MEXA 1V54H 1L3LA 3TDZC 1KU7A 4EATA 4LITA 2EFQA 4LLGF 1FOKA 1X3ZB 4TV7A 3CCQI 5FD5A 2KMUA 5LGUA 3NQOA 2ICWG 3PFYA 1H9TA 2JUCA 1Y8RB 3SFZA 1O7LA 2MH9A 2F6CA 2HZTA 3HRUA 3V8LA 5GAEJ 3JRGA 4H4KC 4UVBA 3I59A 4KITB 5M3MJ 2LFBA 2L5QA 2RV8A 3IRQA 3K6GA 2GM4A 2VOOA 3W6KB 5EEAA 4IL6C 1WJFA 4IVNA 3KP5A 5J1YA 2MW8A 1K61A 3HB9A 3A0HC 4MO7A 2TDXA 2XF6A 2B7EA 3FXLA 4AC0A 3HOXJ 1NK3P 4KN7X 1Y8QB 4IXAA 4KISA 3W2WA 5ILUA 1QA6A 1UCRA 4A3GJ 1F9NA 3M7GA 1BJAA 3WTZA 3DTKA 5GPCA 5CKTA 1FP2A 2L3DA 4L5EA 3BR6A 3GZ5A 5IT9Z 3EYIA 1IV6A 3QPSA 2XGEA 3JRHA 4D5CA 1B1BA 3LA7A 4U87A 3LFKA 2XDVA 1SAXA 2MGQA 1U78A 4IHXA 3PL8A 4R79A 3F8FA 2NNNA 5B1BH 2CO5A 2FXAA 2VOPA 2EK5A 3ASNH 4M9SA 5F08A 4RS8A 2O8KA 1FT9A 1U9NA 1KQ9A 3KE2A 5AIPA 4ZYGA 1BM9A 3FXUA 4FE7A 1IN8A 2M9HA 2CUZA 2ETHA 2CS3A 3MMYB 3ABKH 1RUNA 4L9TA 4BBSJ 3WTVC 3GUDA 4R8HA 2ZFUA 3FXJA 1R5HA 2IT0A 2XSJC 1PP8F 2VIXA 2G9WA 3OSGA 2M0MA 3T0YA 5FB2A 1S8NA 2MBFA 1N75A 3BZKA 3HSRA 2V1XA 2VKEA 1GXQA 2PBIA 2BHYA 1LB2A 2C6YA 3L2UA 2E2HJ 2X1EA 3MWMA 3M9AA 3H9JA 1CQTA 2ZKZA 1LVKA 3VSKA 4YFXF 3RPUA 3ZN0A 2LF7A 3AAFA 1HKTA 5CJ9A 5F64A 3I59B 3ZOBA 1DDNA 4CDGA 3PNVA 4KT6A 4GO1A 3Q3SA 1APLC 1Q1VA 3JAMK 4JX4A 5E3MA 5L3BA 2H94A 2HVRA 1O3SA 2EIJH 2ZBKA 1WI3A 3OL4A 2OTJI 1GVJA 2ISZA 1OCRH 2LF8A 2NAZA 2KFDA 1U2WA 1HW1A 4C9YA 2OBPA 4IHVA 2P5LC 2HFHA 3FDYA 1VF9A 2BXYA 4FCYA 2H1KA 1QZYA 1R22A 2DYRH 4KIFA 4UV9A 2Q1ZB 1YFHA 4DZJA 1LNWA 2DFEA 4O3MA 4P55A 4RLQA 4LB6B 4KJZA 3BT9A 2W82A 3BTCA 1SVOA 4LK1F 4XRFA 1OPCA 2YU3A 2XKPA 4JYKA 3C2HA 5DEQA 2X9DA 1S29A 1ITYA 3FWEA 4M6VA 2OPTA 1E0EA 3K2ZA 1DUXC 2JMWA 3IH4A 3FHZA 3ZQ7A 2W1OA 1ZRFA 4RM3A 1R49A 2MH2A 2BBYA 1Z7UA 2XAGA 4EM0B 4I02A 1ZK8A 3GMEA 3L2RA 4BQAA 5KAFC 4IX7A 4PJ0C 3TP3A 2IA0A 3WTTC 3CCVI 3UKGA 4B3XA 1MW7A 2IGNA 4C2MJ 1QVTA 3GYHX 3K2AA 1JTXA 1AOYA 4JOMA 2E1CA 3CCRI 2F5FA 4J01A 4E7IA 3CCUI 2HYFA 3V7RA 5DD4A 1Z6RA 2DOAA 1ON2A 1QPMA 3HGGA 2W48A 3UR3C 2LY1A 2OC6A 3JTHA 3BTIA 2LG4A 1TQPA 4KN4X 1T08B 1XGMA 5LLQA 4RLFA 3FMQA 2XVCA 3ZXSA 4P9UA 4ESJA 1EJ9A 2FX0A 4M3FA 2VI6A 3ABMH 4DJAA 4QLCU 2HXOA 2A6TA 5GP9A 4UY8I 1K83J 3DBRB 3ELKA 4IRGA 3QU3A 2P6SA 4MFEA 1AHDP 5AONA 2BHZA 1ZRCA 4BXXJ 3ECHA 2DI3A 2QVOA 2Y2ZA 4BNCA 1MBFA 1Z3YA 2L7KA 2XAHA 4XRSG 5DDGA 3ABLH 1SMYF 3OR1C 2ZFWA 2Z5UA 4CCNA 2H6CA 3MZHA 2EFPA 2L02A 2YS9A 3F21A 2XIGA 5E8GA 4A93J 3FXKA 1OJLA 1XX5A 3K70D 1TWFJ 4A12A 1BR1A 5LGNA 1XSDA 2XUBA 4Y13A 2X1CA 1A31A 1ZLKA 1JXSA 4DNCA 3M8FA 3DPTA 5LEJA 4Y7NJ 3IWFA 1GDTA 1UAAA 5H6QA 4M72A 2KDOA 1MGTA 2L9VA 3K7AJ 2F4OB 4AM3A 4B1RA 2PMZN 1GHCA 4BS9A 3GFMA 2E1MB 4A69C 2HYGD 3VWBA 2BXZA 2BEOA 3RI4A 3E6BA 3S8PA 2LVSA 4CCMA 4CZCA 4BDYA 1OCTC 3VEPA 3LQRA 2HDDA 1IO2A 3WTWC 3L1PA 3LSMA 1IF1A 2VKDA 3HHHA 1VQMI 4KYWA 2WY8Q 3GZNB 2V6EA 1FYKA 2A69F 3F8CA 1VNDA 4D7NA 2PLYA 4X1EA 1BIBA 1WH7A 2QLZA 3A1YA 3BC8A 4ABZA 1ETVA 3P7NA 2CWEA 3BR2A 5HDKA 4IO9F 1W0TA 1UG2A 2L7FP 2XAUA 5JHFA 3Q9VA 2O9LA 1FSHA 3OIQA 5IOZA 3ZQCA 2VBXA 2M8EA 4RAGA 1P7IA 5HLGA 4F92B 3N05A 4ZYEA 2HEOA 4HBLA 2UUZA 4L5JA 3GTLJ 2DQLA 1XS9A 2STWA 2R7DA 4QTRA 4UB6C 4C30A 4M73A 4G9YA 3WGGA 1LKXA 1J75A 3HHGA 2CV0A 3IAS2 2HDCA 4D7MA 2YSRA 4BYYA 5EGOB 4FE4A 5ERIA 2V1DA 3H5AA 1P9QC 1UFMA 3GFLA 3RKQA 1ZG5A 2GXAA 1WCMJ 2X6XA 2QSFX 2KIFA 4PGHA 2M3AA 3W6VA 2EZIA 4EV0A 1G3WA 3K4CA 3KZYA 4GGGA 5IT3A 1B6AA 3RKYA 3BJOA 4FETA 2JA7J 3K0LA 1NK2P 3HOUJ 1A35A 3PM1A 5D5XB 3CCSI 4A3CJ 2IS2A 1OYIA 5FLMJ 2XSDC 2LKPA 2QQ9A 2PJRB 3A01B 3J7ZI 3TL4X 2XF7A 3NRVA 1GUUA 3TBIA 5E1WA 2Y31A 2IBDA 1OKRA 5H2FC 1ODDA 5K7FA 2CFXA 2AQFA 2KIQA 3SXYA 3V4GA 4ON0A 5FRMA 2WB1A 3OYAA 2HQRA 3BR1A 3L7WA 4RAZA 3LFUA 5FD6A 4HDVA 2DBBA 2LKXA 1HC8A 3KEQA 3IWZA 2QCOA 3HUGA 4C3IJ 2DMNA 5DUIA 1AU7A 1V5EA 2Y48A 1FIAA 2A6HF 3FXMA 4HZFA 2QWWA 3GXOA 1RR8C 4DIQA 5BPDA 2D1HA 4DBQA 2QYOA 3E7LA 1S7OA 4M3BA 3L2WA 1JHHA 4PJJA 3QP5A 4ZYHA 5D6EA 4QSHA 1TL8A 4C2TA 1O7FA 1YTYA 1QHHD 1PVEA 4MGRA 3M07A 1FP1D 5E3OA 1BL0A 3IKVA 3I71A 3F22A 1WKMA 4HEA2 3E5XA 3FBIB 2DJIA 4BUPA 3CDLA 4XLFA 4G6DA 3L00A 3S14J 1E3PA 2VQHA 3J7AO 1IAWA 4V19K 5FKKA 3RYRA 2L4AA 3VYSB 1HKSA 2DOFA 3ZMDA 2DMPA 1MZBA 1FYMA 2RN7A 2E7XA 2STTA 1RR7A 5BMZA 4DOZA 1WHUA 3I4PA 1ENHA 2FOWA 1RETA 3DPLC 5B66C 3DFGA 1TW3A 3HOVJ 2M87A 3P5JA 2VBWA 2Y0MA 1YYVA 3B73A 2BVLA 2KRHA 4A3LJ 3RSNA 3BPXA 3BR3A 2O6GE 2P7CB 2PFBA 3MQ0A 5F1RA 4CO8A 3HPGA 4F55A 1F36A 3JCUC 2PMHA 3ZQHA 2M4GA 3LSJA 1IGNA 4P1WA 3V8JA 3C18A 2VT2A 3BP8A 3IKTA 3U21A 3LL7A 5KHDA 3QYBA 3WGIA 2V9KA 4RB0A 2W25A 2EINH 2UV1A 4XRSA 1TW2A 2V1UA 3QU6A 4ZTJA 3DXJF 3S1RJ 3CF2A 2CGPA 2FMYA 2BW3A 1IUFA 3JSOA 4BKXA 2EZHA 3TKYA 2XGDA 5JLXA 3HG9A 4BL0B 3ZQLA 1RUOA 2JPBA 3I54A 2X85A 3LNQA 1WRJA 3HKZA 2LRDA 2QQ8A 3BQZA 2BW3B 1JHFA 2O3FA 1ZQ3P 4GRIA 4Y17A 3SEZA 3CUQB 2VONA 2VBZA 2A07F 3EDPA 3M4OJ 2X0LA 3LA3A 2VPRA 4L0YB 4IPAA 3H35A 1HCRA 2ZSIB 1J09A 5TISC 3I53A 3KEOA 5GTHC 1TLHB 2F5DA 5E3LA 2DW4A 3KP7A 1R7JA 2DMUA 3TP0A 2IS4A 5K5OA 1HW2A 3HM5A 1EV7A 4Z6YA 2JRMA 3NWTA 1ZR2A 4OINF 1UHMA 1YS6A 2BY3A 4NB5A 4HX4A 1JKRC 3S16J 1ZGJA 2O0YA 2R5YA 3KYCB 4OMYA 3E6CC 3CJTB 2LBFA 1O3QA 5CLSA 3W2VA 2VXZA 3DPUA 4I7HA 2F4MB 3CP2A 5EYRA 3PUBA 4B4CA 1WSUA 4KA4A 1A6IA 2G7HA 4ENMA 3H0DA 4AVPA 3F8BA 1R71A 5E3NA 3M1EA 2Z1DA 2CUFA 2NNYA 1SFEA
chains in the Genus database with same CATH topology
2FNPA 2HTJA 2PMUA 1XGOA 3EYYA 3ISPA 5AIQA 1LQ1A 1I1SA 5D8LB 4KT5C 4GYIA 5EEGA 1W7PA 4OMZA 2RKHA 4HDUA 1UHWA 2JRTA 2NRAC 2MA3A 4HLYA 4NHJA 2BE5F 2FF4A 4MTDA 2QQAA 5DCMA 3E6DA 1OMIA 1J7KA 3DV8A 3KP2A 1R1VA 3PQKA 4P96A 2KIMA 5LRSA 2L4MA 3RIRA 2IRFG 4WF2A 3LAJA 2A6EF 2RC4A 1SD6A 4LD5A 1KQ8A 1HQCA 3QOPA 4A6DA 1W5SA 1W7PD 5EEHA 1T39A 4B8XA 1MD0A 1RI7A 1HSJA 3WTUC 3JW4A 2YR2A 2EFNA 1XB4A 5HDNA 2W24A 1YQAA 1EH8A 4K2EA 4ENJA 3O6BB 1EH7A 2QENA 1P2FA 3TQNA 1F4KA 2JTVA 4HOBA 2DO7A 2K7LA 3RTRA 3VOEA 4KNYA 1IW7F 4UVAA 3IRRA 4U88A 1IRFA 2E7WA 4OIPF 4NQWA 1R23A 1BI1A 2ZCWA 2OA4A 3J81K 4OIRF 1YLFA 3ZMTA 3ZMZA 5ILSA 3T8TA 2HQNA 3C7JA 5JR3A 2RDPA 1YG2A 4WK8F 1ZGAA 4LG0A 1IZ1A 1P4AA 4U0WA 2LDUA 5D5UB 5ED4A 4U0YA 5LRRA 1ZHFA 1ON1A 1D8JA 5ICGA 2M5WA 2Z9OA 2PG4A 1CF7A 2XROA 5E8IA 3ZN1A 2HKXA 5L3FA 4HYEA 2D45A 2ACJA 1BC7C 1R36A 1O57A 1HBXG 4L9JA 3GW2A 1Y0UA 4A6EA 1P92A 2FBIA 3V7CA 5J8CA 2FA5A 2P8TA 1QBJA 1HW5A 3ZMUA 1BBYA 1FWZA 4MEYF 2BV6A 5HVQC 2DT5A 2P6TA 5K5RA 3J80K 3QRFF 2KKOA 2OAZA 2XKOA 4XBFA 2DFIA 2W84A 3GO5A 3V7SA 1BOAA 3KFWX 5HS7A 3E3VA 1RZ4A 1ZYRF 4S05A 1IRGA 3U2RA 1V3FA 1SMTA 2M1BA 3K1NA 2WV0A 3WTYC 5BQTA 4A2UA 3I64A 4HX7A 2FEZA 2FOKA 4I98B 3H3UA 2OZUA 4OIQF 4CICA 3WE3A 2A3SA 2K4JA 4G6QA 3P9IA 4WXDA 2QQBA 1DPRA 2FBKA 3BZ6A 3DQVC 5FFXA 3TO7A 1XD7A 2ZNZA 5JVTA 4I0AA 4AIKA 1O3TA 1YW9A 2AXLA 4FT8A 3COAC 3WTSC 3VB2A 1FX7A 4ESFA 5D5WB 4BHCA 5CYVA 5E20A 4G7HF 4EM1A 3TOAA 4M71A 3FF5A 2HTSA 1OYWA 1B9MA 2AS5F 2OQRA 2P5VA 1SFXA 4WXCA 4GYGA 5HS9A 3CJNA 1KQ0A 4UUVA 4A5MA 4U7BA 4AD9A 4HLXA 1I6XA 2PI0A 2VE8A 3NEUA 2G7UA 3F3XA 4EJOA 4MHGA 4QWQA 1XDUA 3KETA 3PFIA 4UXNA 2D1VA 5FGMA 1S6LA 1XSXA 6PAXA 3MFKA 1XDSA 2GZWA 2GA2A 1ULYA 1FBSA 2DTRA 3GX4X 5LHIA 3H3ZA 3RPQA 1MJBA 5LEKA 1U6GA 4IHTA 1O3RA 3ROUA 3JAMZ 2FSWA 3SHFA 5BS6A 2M30A 1PDNC 1LDJA 2P4WA 1K7AA 4N9HA 4Y15A 3T1BA 2R7FA 4WXHA 1I1GA 4MNUA 5FO5A 4CXFA 1U5TA 1H0MA 2GXGA 3TO9A 4IRIA 4PDKA 5DUKA 4HAMA 1R1TA 5LGTA 4LB5A 2EFOA 1LEAA 3LAPA 4M6YA 1RIOH 1A04A 3JTGA 1WI9A 1AWCA 4M9XA 4EQQA 4LMYA 1J2XA 5LHHA 4HF2A 4AIJA 1W4MA 2OZ6A 1P4XA 4H0EA 4WX9A 5DCFA 2CYYA 2Z99A 3CUQA 4PGGA 1IUYA 1FLIA 2DQRA 4P5OA 1F1ZA 2V6CA 1S7AA 2EA4A 3U9GA 4RAYA 5K5QA 1KU2A 3BY6A 1USTA 2FNAA 2F5CA 3KP4A 5LHGA 3GFIA 1E2XA 3MAJA 5FLXZ 3KLNA 4JK1X 1FNNA 4XLNF 3E5UA 1LDKB 1JE8A 1IN7A 1XGNA 3ML6A 5E1ZB 2F2EA 1JGSA 3R61A 3F72A 4PCQA 3DF8A 2GXBA 3C3WA 3QPTA 4OIOF 1TNSA 1D3YA 4PZJA 1NHAA 3ZMSA 2ZXJA 3L9FA 5CVUA 4BHPA 4HV5A 1RNLA 4M9ZA 2JSCA 4ZZLA 1ZLJA 2O03A 2EV5A 4P9FA 1G3SA 1R5GA 2HGCA 2XGXA 4KMFA 2HR3A 2NYXA 3D0SA 3F6VA 2PN6A 1ZREA 4LG0B 4M74A 1I5ZA 1USSA 1T6SA 1C0WA 5JFRA 1YIOA 5ILVA 2EFWA 1YW8A 4AIHA 3T5XA 1BI0A 1Q1HA 4IHSA 1I27A 1HSTA 2ZMEB 1Z05A 2OU2A 1T0FA 5ICCA 2Q2EA 3G3ZA 2KRFA 1T38A 2HWVA 5D6FA 1R1UA 4YIFA 5L3CA 4KIBA 4RGSA 1U5TC 1KU3A 2R3SA 1Z6TA 1J59A 1MJ9A 3KLOA 1T2KA 3N4MA 4D0PA 1IN6A 4HQMA 5HDGA 3GZ6A 2K4BA 1G3TA 4HF0A 4BXUA 5HS8A 2VE9A 3BROA 2H09A 4FX0A 4EJTA 4MQVA 3K9TA 1XCVA 1CGPA 4LK0F 1YS7A 3LWFA 2QZ8A 3CUQC 4I01A 3GWZA 3K1MA 4ZZDA 3WU0A 2IJLA 3TOBA 1QNTA 5J6XA 2DK8A 2IA2A 2O61A 4EJUA 3K69A 3U1DA 4YFNF 2J5PA 3BJ6A 1PP7U 4ETSA 5FLXK 3KZZA 3O3KA 3TGNA 3P9KA 2IA1A 2EB7A 3MZYA 1W5TA 2FU4A 2FE3A 1D8KA 3HTUA 1K78A 4KICA 3HRSA 1TTYA 1REPC 3WODF 2E1NA 3CO7C 1BN5A 4XLPF 3Q9SA 3BWGA 4EGZA 3HYIA 2Q8KA 2EV6A 2PQ8A 3HOSA 1MJAA 2Z3YA 2F5EA 1FBQA 2ZO4A 3LA2A 4ESBA 1FPQA 1MKMA 5KVRA 3OV8A 5E17F 2DU9A 3HRMA 2KIUA 1U5TB 2GQQA 1SD4A 3BDDA 4N0BA 2O8XA 4ENNA 2LSOA 2W57A 3L09A 4CYDA 4U0VA 3ERED 2UXXA 1ONVA 4ZH4F 4O5VA 4CHUA 3E97A 1TQIA 3RKXA 2YX7A 1FY7A 1QQIA 3D5LA 4MEXF 2UWMA 3IC7A 3C1DA 3VFZA 2FQ3A 2RQPA 4IRHA 2VODA 5FFZA 1KA8A 4E70A 4Q48A 4CGZA 2CG4A 2MLKA 2EWNA 2RGVA 2IVMA 3DP7A 2DLLA 3CTAA 3Q5FA 3WG9A 4LFUA 3CO6C 4HF1A 4A0ZA 1KU9A 2K27A 2VC0A 3OOPA 4O6JA 4FHTA 5TRDA 4BAYA 2P5KA 3FXRA 1GXPA 3WU1B 4ASNA 5DV5A 4HA8A 1Z91A 1ZG1A 5CVIA 1V4RA 5A2QZ 2BYVE 3ULQB 1X3UA 4L0ZB 1ZH5A 2K86A 3B02A 1FBUA 3WGHA 3GF2A 3HSFA 2ESHA 3WE2A 3RKWA 2OD5A 2YPRA 4LLLA 3H92A 4CZZA 4LJZF 4HX8A 2Z33A 1U3EM 3REOA 3R0AA 3RYPA 5D5VB 2UXNA 4KIGA 2VT3A 1L0OC 1KGSA 2KJCA 2PJPA 2GWRA 1IN5A 2K02A 1QZZA 4G7ZF 5J8FA 4FX4A 4KDPA 4N9IA 5LBQA 1FZPB 4F7ZA 4HQEA 2FBHA 1OYYA 5F6FA 2WTEA 1G4DA 2Y75A 3JSPA 1B4AA 2ZMEA 3TDUC 1ZN2A 4YFKF 2ISYA 4RGRA 1MDMB 2L01A 2VN2A 3CLOA 4AWXB 1R58A 3S2WA 3ABTA 3G73A 1HKQA 1PUEE 3V8KA 2FRHA 1STZA 2XHKA 3F6OA 5E18F 3T8RA 2EA2A 3BJAA 4EMSA 3DKWA 1LJ9A 4WCGA 2MC3A 4OU0A 3QPHA 1P4WA 1CF7B 4GCVA 3FXQA 4HW0A 2QBYA 3ECOA 2XAFA 2KJBA 2CW0F 2EV0A 4IF4A 4RGXA 3HTSB 2Q0OA 1Z1DA 3GVAA 1B59A 5JHUA 3FM3A 1YW7A 2XAJA 3GFJA 4Z2YA 4S04A 4BH9A 3IHUA 4MQ9F 3LQQA 5D4RA 5CVRA 3FX3A 1BI3A 1FSEA 1ZARA 3QAHA 2MD5A 2A5YB 4A0YA 3TO6A 1FYLA 2W85A 4YG2F 2GA1A 4L9VA 4XSXF 1R00A 2WC2A 3GLXA 3CUOA 5BPIA 1SD5A 3F23A 1YO5C 1VTNC 4G94A 2IP2A 4YIIA 1UB9A 2QUFA 3I58A 2DAOA 1W7PB 1OR7A 1SD7A 1FC3A 3F8MA 5HOOA 4JBAA 1DP7P 3KCCA 3J81Z 4EM2A 1H9GA 3EETA 3O2PE 4IJAA 2DK5A 1BI2A 1QO0D 1B9NA 3BPVA 3BOQA 4KMUX 3P9CA 4R1HA 2UZKA 1QGPA 3PQJA 2DPDA 4G7OF 3ZP5A 4HV6A 2JPCA 2P7VB 5D4SA 4B09A 4UVCA 3N97A 2D2WA 2RNJA 1WQ2A 1SFUA 2GIVA 2IPQX 2LNBA 2NS0A 4KUMA 4ZYDA 1LDDA 2IW5A 3I0TA 3VODA 2ZJ2A 4EJVA 3FMSA 2XV4S 4A5NA 3KP3A 5ICEA 4L5IA 3ABUA 3HIFA 4I2OA 1K78B 5HLIA 4RGUA 2XRNA 2A61A 3L2CA 5BOXA 3K1PA 1G6NA 3SZTA 2GAUA 1Z9CA 4KFCA 3R4KA 5CVJA 3J80Z 1G3YA 5DCMB 3LSTA 4Q5SF 2J5OA 2V9VA 3HOTA 4Q4ZF 1KYZA 3FZVA 2ESNA 2JT1A 4I0BA 3RJPA 2FMLA 2A68F 1XGSA 4U7DA 2ELHA 1WWXA 4EGYA 5H6RA 1ZRDA 5L3EA 1S3JA 3CDHA 5KK1A 3EUHA 5K1YA 1K79A 5A2QK 1XN7A 5D8KB 5L3DA 1J9IA 5ICFA 4OOIA 4UHTA 3R6SA 3FMRA 4EVIA 3ZPLA 3E6MA 2QBYB 2BGCA 2HKOA 2MLGA 4EJWA 4A0XA 2QM3A 1J0RA 1XMAA 3E5QA 4WWCA 4GXOA 2ZNYA 4LGWA 4LLNA 1ZAOA 1BC8C 2HOEA 1TNTA 2OQGA 1XMKA 2V79A 2WWYA 1E17A 3IL2A 2RVCA 4G8XA 1J5YA 2X4HA 2CQKA 4DQ2A 1T98A 3HRTA 2VBYA 1MDMA 5IT9K 5CVVA 2B0LA 1XCBA 3R0JA 4XSZF 3SQNA 1IXCA 3QP6A 5H20A 2VC1A 3R60A 2PEXA 3MCZA 2H6BA 1DPUA 3EQLF 3DEUA 3SZPA 3I5UA 4BHBA 1P6RA 3M8EA 1KYWA 2YX4A 2XASA 5L3GA 2ADUA 5DD8A 2HS5A 1XSVA 4M6XA 4UV8A 2EJRA 3FM5A 1U8RA 1LEBA 3HSEA 3WTXC 3W6JB 5HLHA 4RB1A 4RB2C 3RDIA 2CSOA 1TQMA 1LVAA 2DPUA 4RB3C 3KP6A 4MTEA 4ENKA 2L54A 1D5VA 3F8NA 4Q47A 1BIAA 1K6OA 1IXRC 4I09A 5E1XA 1ZG3A 4JQFA 4L18B 1IN4A 4L9NA 2H27A 2JZYA 3GEZA 1TBXA 1F5TA 3ZMVA 1EH6A 2COMA 1IXSB 1HXDA 5TJJA 2M45A 4UNOA 5DYMA 2XAQA 5JI6A 3MEXA 1L3LA 3TDZC 1KU7A 2EFQA 4LLGF 1FOKA 4TV7A 5FD5A 5LGUA 3NQOA 1H9TA 3SFZA 1O7LA 2MH9A 2HZTA 3HRUA 3V8LA 4UVBA 3I59A 2RV8A 3IRQA 2VOOA 3W6KB 4IVNA 3KP5A 2TDXA 4KN7X 4IXAA 5ILUA 1UCRA 1F9NA 3M7GA 1BJAA 3WTZA 1FP2A 2L3DA 3GZ5A 5IT9Z 3EYIA 1B1BA 3LA7A 3LFKA 1SAXA 1U78A 4R79A 3F8FA 2NNNA 2CO5A 2FXAA 2VOPA 2EK5A 4M9SA 4RS8A 1FT9A 1KQ9A 3KE2A 5AIPA 4ZYGA 1BM9A 3FXUA 1IN8A 2ETHA 1RUNA 4L9TA 3WTVC 3GUDA 4R8HA 1R5HA 2IT0A 1PP8F 2G9WA 3T0YA 5FB2A 1S8NA 2MBFA 3HSRA 2V1XA 1GXQA 2PBIA 1LB2A 2C6YA 3MWMA 3M9AA 2ZKZA 4YFXF 3RPUA 3ZN0A 2LF7A 3AAFA 1HKTA 5CJ9A 5F64A 3I59B 1DDNA 4CDGA 4GO1A 3JAMK 5L3BA 2H94A 1O3SA 2ZBKA 1GVJA 2ISZA 2LF8A 2NAZA 1U2WA 1HW1A 2OBPA 2P5LC 2HFHA 1QZYA 1R22A 4KIFA 4UV9A 1YFHA 1LNWA 4O3MA 4P55A 4LB6B 4LK1F 4XRFA 1OPCA 2YU3A 2XKPA 5DEQA 1S29A 3FWEA 3K2ZA 1DUXC 3FHZA 3ZQ7A 1ZRFA 2MH2A 2BBYA 1Z7UA 2XAGA 4EM0B 4I02A 4BQAA 2IA0A 3WTTC 3GYHX 1AOYA 2E1CA 2F5FA 2HYFA 3V7RA 5DD4A 1Z6RA 1ON2A 1QPMA 3JTHA 1TQPA 4KN4X 1XGMA 5LLQA 3FMQA 2XVCA 4P9UA 4ESJA 4QLCU 3ELKA 4IRGA 3QU3A 2P6SA 5AONA 1ZRCA 3ECHA 2DI3A 2QVOA 4BNCA 2XAHA 5DDGA 1SMYF 2ZFWA 2Z5UA 2H6CA 3MZHA 2EFPA 2L02A 3F21A 2XIGA 5E8GA 4A12A 5LGNA 1XSDA 2XUBA 4Y13A 1JXSA 1ZLKA 4DNCA 3M8FA 3DPTA 5LEJA 3IWFA 5H6QA 4M72A 1MGTA 1GHCA 3GFMA 2HYGD 2BEOA 3RI4A 3E6BA 3VEPA 3LQRA 3WTWC 1IF1A 3HHHA 4KYWA 1FYKA 2A69F 3F8CA 2PLYA 1BIBA 2QLZA 5HDKA 3P7NA 2CWEA 3Q9VA 1FSHA 2VBXA 2M8EA 5HLGA 2HEOA 4ZYEA 4HBLA 4L5JA 2DQLA 2STWA 2R7DA 4M73A 4G9YA 3WGGA 1J75A 3HHGA 2HDCA 2YSRA 4BYYA 5ERIA 2V1DA 3GFLA 1UFMA 1ZG5A 2KIFA 4PGHA 4EV0A 1G3WA 3KZYA 4GGGA 5IT3A 1B6AA 3RKYA 3BJOA 3K0LA 5D5XB 1OYIA 2LKPA 2QQ9A 3NRVA 5E1WA 1OKRA 1ODDA 2CFXA 3SXYA 3V4GA 4ON0A 2HQRA 3L7WA 4RAZA 5FD6A 4HDVA 2DBBA 3KEQA 3IWZA 3HUGA 5DUIA 2Y48A 2A6HF 4HZFA 2QWWA 3GXOA 5BPDA 2D1HA 2QYOA 1S7OA 1JHHA 3QP5A 4ZYHA 5D6EA 1O7FA 1YTYA 4MGRA 1FP1D 3IKVA 3I71A 3F22A 1WKMA 3E5XA 4G6DA 3L00A 3J7AO 1IAWA 3RYRA 2L4AA 1HKSA 3ZMDA 1MZBA 1FYMA 2RN7A 2E7XA 2STTA 5BMZA 3I4PA 3DPLC 3DFGA 1TW3A 2M87A 2VBWA 2Y0MA 1YYVA 3B73A 3BPXA 2O6GE 2P7CB 2PFBA 3MQ0A 5F1RA 4CO8A 2PMHA 3V8JA 3C18A 2VT2A 3BP8A 3IKTA 3WGIA 4RB0A 2W25A 1TW2A 2V1UA 3QU6A 3DXJF 2CGPA 2FMYA 3JSOA 3TKYA 1RUOA 2JPBA 3I54A 1WRJA 1JHFA 2O3FA 4Y17A 3CUQB 2VONA 2VBZA 2A07F 3EDPA 2X0LA 3LA3A 4L0YB 4IPAA 3I53A 3KEOA 1TLHB 2F5DA 2DW4A 3KP7A 1R7JA 5K5OA 1HW2A 1EV7A 4OINF 1UHMA 1YS6A 4NB5A 4HX4A 1ZGJA 2O0YA 4OMYA 3E6CC 1O3QA 5CLSA 2VXZA 4I7HA 1WSUA 4KA4A 2G7HA 4ENMA 4AVPA 3F8BA 3M1EA 2NNYA 1SFEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FNP A;  2HTJ A;  2PMU A;  1XGO A;  3EYY A;  3ISP A;  5AIQ A;  1LQ1 A;  1I1S A;  5D8L B;  4KT5 C;  4GYI A;  5EEG A;  1W7P A;  4OMZ A;  2RKH A;  4HDU A;  1UHW A;  2JRT A;  2NRA C;  2MA3 A;  4HLY A;  4NHJ A;  2BE5 F;  2FF4 A;  4MTD A;  2QQA A;  5DCM A;  3E6D A;  1OMI A;  1J7K A;  3DV8 A;  3KP2 A;  1R1V A;  3PQK A;  4P96 A;  2KIM A;  5LRS A;  2L4M A;  3RIR A;  2IRF G;  4WF2 A;  3LAJ A;  2A6E F;  2RC4 A;  1SD6 A;  4LD5 A;  1KQ8 A;  1HQC A;  3QOP A;  4A6D A;  1W5S A;  1W7P D;  5EEH A;  1T39 A;  4B8X A;  1MD0 A;  1RI7 A;  1HSJ A;  3WTU C;  3JW4 A;  2YR2 A;  2EFN A;  1XB4 A;  5HDN A;  2W24 A;  1YQA A;  1EH8 A;  4K2E A;  4ENJ A;  3O6B B;  1EH7 A;  2QEN A;  1P2F A;  3TQN A;  1F4K A;  2JTV A;  4HOB A;  2DO7 A;  2K7L A;  3RTR A;  3VOE A;  4KNY A;  1IW7 F;  4UVA A;  3IRR A;  4U88 A;  1IRF A;  2E7W A;  4OIP F;  4NQW A;  1R23 A;  1BI1 A;  2ZCW A;  2OA4 A;  3J81 K;  4OIR F;  1YLF A;  3ZMT A;  3ZMZ A;  5ILS A;  3T8T A;  2HQN A;  3C7J A;  5JR3 A;  2RDP A;  1YG2 A;  4WK8 F;  1ZGA A;  4LG0 A;  1IZ1 A;  1P4A A;  4U0W A;  2LDU A;  5D5U B;  5ED4 A;  4U0Y A;  5LRR A;  1ZHF A;  1ON1 A;  1D8J A;  5ICG A;  2M5W A;  2Z9O A;  2PG4 A;  1CF7 A;  2XRO A;  5E8I A;  3ZN1 A;  2HKX A;  5L3F A;  4HYE A;  2D45 A;  2ACJ A;  1BC7 C;  1R36 A;  1O57 A;  1HBX G;  4L9J A;  3GW2 A;  1Y0U A;  4A6E A;  1P92 A;  2FBI A;  3V7C A;  5J8C A;  2FA5 A;  2P8T A;  1QBJ A;  1HW5 A;  3ZMU A;  1BBY A;  1FWZ A;  4MEY F;  2BV6 A;  5HVQ C;  2DT5 A;  2P6T A;  5K5R A;  3J80 K;  3QRF F;  2KKO A;  2OAZ A;  2XKO A;  4XBF A;  2DFI A;  2W84 A;  3GO5 A;  3V7S A;  1BOA A;  3KFW X;  5HS7 A;  3E3V A;  1RZ4 A;  1ZYR F;  4S05 A;  1IRG A;  3U2R A;  1V3F A;  1SMT A;  2M1B A;  3K1N A;  2WV0 A;  3WTY C;  5BQT A;  4A2U A;  3I64 A;  4HX7 A;  2FEZ A;  2FOK A;  4I98 B;  3H3U A;  2OZU A;  4OIQ F;  4CIC A;  3WE3 A;  2A3S A;  2K4J A;  4G6Q A;  3P9I A;  4WXD A;  2QQB A;  1DPR A;  2FBK A;  3BZ6 A;  3DQV C;  5FFX A;  3TO7 A;  1XD7 A;  2ZNZ A;  5JVT A;  4I0A A;  4AIK A;  1O3T A;  1YW9 A;  2AXL A;  4FT8 A;  3COA C;  3WTS C;  3VB2 A;  1FX7 A;  4ESF A;  5D5W B;  4BHC A;  5CYV A;  5E20 A;  4G7H F;  4EM1 A;  3TOA A;  4M71 A;  3FF5 A;  2HTS A;  1OYW A;  1B9M A;  2AS5 F;  2OQR A;  2P5V A;  1SFX A;  4WXC A;  4GYG A;  5HS9 A;  3CJN A;  1KQ0 A;  4UUV A;  4A5M A;  4U7B A;  4AD9 A;  4HLX A;  1I6X A;  2PI0 A;  2VE8 A;  3NEU A;  2G7U A;  3F3X A;  4EJO A;  4MHG A;  4QWQ A;  1XDU A;  3KET A;  3PFI A;  4UXN A;  2D1V A;  5FGM A;  1S6L A;  1XSX A;  6PAX A;  3MFK A;  1XDS A;  2GZW A;  2GA2 A;  1ULY A;  1FBS A;  2DTR A;  3GX4 X;  5LHI A;  3H3Z A;  3RPQ A;  1MJB A;  5LEK A;  1U6G A;  4IHT A;  1O3R A;  3ROU A;  3JAM Z;  2FSW A;  3SHF A;  5BS6 A;  2M30 A;  1PDN C;  1LDJ A;  2P4W A;  1K7A A;  4N9H A;  4Y15 A;  3T1B A;  2R7F A;  4WXH A;  1I1G A;  4MNU A;  5FO5 A;  4CXF A;  1U5T A;  1H0M A;  2GXG A;  3TO9 A;  4IRI A;  4PDK A;  5DUK A;  4HAM A;  1R1T A;  5LGT A;  4LB5 A;  2EFO A;  1LEA A;  3LAP A;  4M6Y A;  1RIO H;  1A04 A;  3JTG A;  1WI9 A;  1AWC A;  4M9X A;  4EQQ A;  4LMY A;  1J2X A;  5LHH A;  4HF2 A;  4AIJ A;  1W4M A;  2OZ6 A;  1P4X A;  4H0E A;  4WX9 A;  5DCF A;  2CYY A;  2Z99 A;  3CUQ A;  4PGG A;  1IUY A;  1FLI A;  2DQR A;  4P5O A;  1F1Z A;  2V6C A;  1S7A A;  2EA4 A;  3U9G A;  4RAY A;  5K5Q A;  1KU2 A;  3BY6 A;  1UST A;  2FNA A;  2F5C A;  3KP4 A;  5LHG A;  3GFI A;  1E2X A;  3MAJ A;  5FLX Z;  3KLN A;  4JK1 X;  1FNN A;  4XLN F;  3E5U A;  1LDK B;  1JE8 A;  1IN7 A;  1XGN A;  3ML6 A;  5E1Z B;  2F2E A;  1JGS A;  3R61 A;  3F72 A;  4PCQ A;  3DF8 A;  2GXB A;  3C3W A;  3QPT A;  4OIO F;  1TNS A;  1D3Y A;  4PZJ A;  1NHA A;  3ZMS A;  2ZXJ A;  3L9F A;  5CVU A;  4BHP A;  4HV5 A;  1RNL A;  4M9Z A;  2JSC A;  4ZZL A;  1ZLJ A;  2O03 A;  2EV5 A;  4P9F A;  1G3S A;  1R5G A;  2HGC A;  2XGX A;  4KMF A;  2HR3 A;  2NYX A;  3D0S A;  3F6V A;  2PN6 A;  1ZRE A;  4LG0 B;  4M74 A;  1I5Z A;  1USS A;  1T6S A;  1C0W A;  5JFR A;  1YIO A;  5ILV A;  2EFW A;  1YW8 A;  4AIH A;  3T5X A;  1BI0 A;  1Q1H A;  4IHS A;  1I27 A;  1HST A;  2ZME B;  1Z05 A;  2OU2 A;  1T0F A;  5ICC A;  2Q2E A;  3G3Z A;  2KRF A;  1T38 A;  2HWV A;  5D6F A;  1R1U A;  4YIF A;  5L3C A;  4KIB A;  4RGS A;  1U5T C;  1KU3 A;  2R3S A;  1Z6T A;  1J59 A;  1MJ9 A;  3KLO A;  1T2K A;  3N4M A;  4D0P A;  1IN6 A;  4HQM A;  5HDG A;  3GZ6 A;  2K4B A;  1G3T A;  4HF0 A;  4BXU A;  5HS8 A;  2VE9 A;  3BRO A;  2H09 A;  4FX0 A;  4EJT A;  4MQV A;  3K9T A;  1XCV A;  1CGP A;  4LK0 F;  1YS7 A;  3LWF A;  2QZ8 A;  3CUQ C;  4I01 A;  3GWZ A;  3K1M A;  4ZZD A;  3WU0 A;  2IJL A;  3TOB A;  1QNT A;  5J6X A;  2DK8 A;  2IA2 A;  2O61 A;  4EJU A;  3K69 A;  3U1D A;  4YFN F;  2J5P A;  3BJ6 A;  1PP7 U;  4ETS A;  5FLX K;  3KZZ A;  3O3K A;  3TGN A;  3P9K A;  2IA1 A;  2EB7 A;  3MZY A;  1W5T A;  2FU4 A;  2FE3 A;  1D8K A;  3HTU A;  1K78 A;  4KIC A;  3HRS A;  1TTY A;  1REP C;  3WOD F;  2E1N A;  3CO7 C;  1BN5 A;  4XLP F;  3Q9S A;  3BWG A;  4EGZ A;  3HYI A;  2Q8K A;  2EV6 A;  2PQ8 A;  3HOS A;  1MJA A;  2Z3Y A;  2F5E A;  1FBQ A;  2ZO4 A;  3LA2 A;  4ESB A;  1FPQ A;  1MKM A;  5KVR A;  3OV8 A;  5E17 F;  2DU9 A;  3HRM A;  2KIU A;  1U5T B;  2GQQ A;  1SD4 A;  3BDD A;  4N0B A;  2O8X A;  4ENN A;  2LSO A;  2W57 A;  3L09 A;  4CYD A;  4U0V A;  3ERE D;  2UXX A;  1ONV A;  4ZH4 F;  4O5V A;  4CHU A;  3E97 A;  1TQI A;  3RKX A;  2YX7 A;  1FY7 A;  1QQI A;  3D5L A;  4MEX F;  2UWM A;  3IC7 A;  3C1D A;  3VFZ A;  2FQ3 A;  2RQP A;  4IRH A;  2VOD A;  5FFZ A;  1KA8 A;  4E70 A;  4Q48 A;  4CGZ A;  2CG4 A;  2MLK A;  2EWN A;  2RGV A;  2IVM A;  3DP7 A;  2DLL A;  3CTA A;  3Q5F A;  3WG9 A;  4LFU A;  3CO6 C;  4HF1 A;  4A0Z A;  1KU9 A;  2K27 A;  2VC0 A;  3OOP A;  4O6J A;  4FHT A;  5TRD A;  4BAY A;  2P5K A;  3FXR A;  1GXP A;  3WU1 B;  4ASN A;  5DV5 A;  4HA8 A;  1Z91 A;  1ZG1 A;  5CVI A;  1V4R A;  5A2Q Z;  2BYV E;  3ULQ B;  1X3U A;  4L0Z B;  1ZH5 A;  2K86 A;  3B02 A;  1FBU A;  3WGH A;  3GF2 A;  3HSF A;  2ESH A;  3WE2 A;  3RKW A;  2OD5 A;  2YPR A;  4LLL A;  3H92 A;  4CZZ A;  4LJZ F;  4HX8 A;  2Z33 A;  1U3E M;  3REO A;  3R0A A;  3RYP A;  5D5V B;  2UXN A;  4KIG A;  2VT3 A;  1L0O C;  1KGS A;  2KJC A;  2PJP A;  2GWR A;  1IN5 A;  2K02 A;  1QZZ A;  4G7Z F;  5J8F A;  4FX4 A;  4KDP A;  4N9I A;  5LBQ A;  1FZP B;  4F7Z A;  4HQE A;  2FBH A;  1OYY A;  5F6F A;  2WTE A;  1G4D A;  2Y75 A;  3JSP A;  1B4A A;  2ZME A;  3TDU C;  1ZN2 A;  4YFK F;  2ISY A;  4RGR A;  1MDM B;  2L01 A;  2VN2 A;  3CLO A;  4AWX B;  1R58 A;  3S2W A;  3ABT A;  3G73 A;  1HKQ A;  1PUE E;  3V8K A;  2FRH A;  1STZ A;  2XHK A;  3F6O A;  5E18 F;  3T8R A;  2EA2 A;  3BJA A;  4EMS A;  3DKW A;  1LJ9 A;  4WCG A;  2MC3 A;  4OU0 A;  3QPH A;  1P4W A;  1CF7 B;  4GCV A;  3FXQ A;  4HW0 A;  2QBY A;  3ECO A;  2XAF A;  2KJB A;  2CW0 F;  2EV0 A;  4IF4 A;  4RGX A;  3HTS B;  2Q0O A;  1Z1D A;  3GVA A;  1B59 A;  5JHU A;  3FM3 A;  1YW7 A;  2XAJ A;  3GFJ A;  4Z2Y A;  4S04 A;  4BH9 A;  3IHU A;  4MQ9 F;  3LQQ A;  5D4R A;  5CVR A;  3FX3 A;  1BI3 A;  1FSE A;  1ZAR A;  3QAH A;  2MD5 A;  2A5Y B;  4A0Y A;  3TO6 A;  1FYL A;  2W85 A;  4YG2 F;  2GA1 A;  4L9V A;  4XSX F;  1R00 A;  2WC2 A;  3GLX A;  3CUO A;  5BPI A;  1SD5 A;  3F23 A;  1YO5 C;  1VTN C;  4G94 A;  2IP2 A;  4YII A;  1UB9 A;  2QUF A;  3I58 A;  2DAO A;  1W7P B;  1OR7 A;  1SD7 A;  1FC3 A;  3F8M A;  5HOO A;  4JBA A;  1DP7 P;  3KCC A;  3J81 Z;  4EM2 A;  1H9G A;  3EET A;  3O2P E;  4IJA A;  2DK5 A;  1BI2 A;  1QO0 D;  1B9N A;  3BPV A;  3BOQ A;  4KMU X;  3P9C A;  4R1H A;  2UZK A;  1QGP A;  3PQJ A;  2DPD A;  4G7O F;  3ZP5 A;  4HV6 A;  2JPC A;  2P7V B;  5D4S A;  4B09 A;  4UVC A;  3N97 A;  2D2W A;  2RNJ A;  1WQ2 A;  1SFU A;  2GIV A;  2IPQ X;  2LNB A;  2NS0 A;  4KUM A;  4ZYD A;  1LDD A;  2IW5 A;  3I0T A;  3VOD A;  2ZJ2 A;  4EJV A;  3FMS A;  2XV4 S;  4A5N A;  3KP3 A;  5ICE A;  4L5I A;  3ABU A;  3HIF A;  4I2O A;  1K78 B;  5HLI A;  4RGU A;  2XRN A;  2A61 A;  3L2C A;  5BOX A;  3K1P A;  1G6N A;  3SZT A;  2GAU A;  1Z9C A;  4KFC A;  3R4K A;  5CVJ A;  3J80 Z;  1G3Y A;  5DCM B;  3LST A;  4Q5S F;  2J5O A;  2V9V A;  3HOT A;  4Q4Z F;  1KYZ A;  3FZV A;  2ESN A;  2JT1 A;  4I0B A;  3RJP A;  2FML A;  2A68 F;  1XGS A;  4U7D A;  2ELH A;  1WWX A;  4EGY A;  5H6R A;  1ZRD A;  5L3E A;  1S3J A;  3CDH A;  5KK1 A;  3EUH A;  5K1Y A;  1K79 A;  5A2Q K;  1XN7 A;  5D8K B;  5L3D A;  1J9I A;  5ICF A;  4OOI A;  4UHT A;  3R6S A;  3FMR A;  4EVI A;  3ZPL A;  3E6M A;  2QBY B;  2BGC A;  2HKO A;  2MLG A;  4EJW A;  4A0X A;  2QM3 A;  1J0R A;  1XMA A;  3E5Q A;  4WWC A;  4GXO A;  2ZNY A;  4LGW A;  4LLN A;  1ZAO A;  1BC8 C;  2HOE A;  1TNT A;  2OQG A;  1XMK A;  2V79 A;  2WWY A;  1E17 A;  3IL2 A;  2RVC A;  4G8X A;  1J5Y A;  2X4H A;  2CQK A;  4DQ2 A;  1T98 A;  3HRT A;  2VBY A;  1MDM A;  5IT9 K;  5CVV A;  2B0L A;  1XCB A;  3R0J A;  4XSZ F;  3SQN A;  1IXC A;  3QP6 A;  5H20 A;  2VC1 A;  3R60 A;  2PEX A;  3MCZ A;  2H6B A;  1DPU A;  3EQL F;  3DEU A;  3SZP A;  3I5U A;  4BHB A;  1P6R A;  3M8E A;  1KYW A;  2YX4 A;  2XAS A;  5L3G A;  2ADU A;  5DD8 A;  2HS5 A;  1XSV A;  4M6X A;  4UV8 A;  2EJR A;  3FM5 A;  1U8R A;  1LEB A;  3HSE A;  3WTX C;  3W6J B;  5HLH A;  4RB1 A;  4RB2 C;  3RDI A;  2CSO A;  1TQM A;  1LVA A;  2DPU A;  4RB3 C;  3KP6 A;  4MTE A;  4ENK A;  2L54 A;  1D5V A;  3F8N A;  4Q47 A;  1BIA A;  1K6O A;  1IXR C;  4I09 A;  5E1X A;  1ZG3 A;  4JQF A;  4L18 B;  1IN4 A;  4L9N A;  2H27 A;  2JZY A;  3GEZ A;  1TBX A;  1F5T A;  3ZMV A;  1EH6 A;  2COM A;  1IXS B;  1HXD A;  5TJJ A;  2M45 A;  4UNO A;  5DYM A;  2XAQ A;  5JI6 A;  3MEX A;  1L3L A;  3TDZ C;  1KU7 A;  2EFQ A;  4LLG F;  1FOK A;  4TV7 A;  5FD5 A;  5LGU A;  3NQO A;  1H9T A;  3SFZ A;  1O7L A;  2MH9 A;  2HZT A;  3HRU A;  3V8L A;  4UVB A;  3I59 A;  2RV8 A;  3IRQ A;  2VOO A;  3W6K B;  4IVN A;  3KP5 A;  2TDX A;  4KN7 X;  4IXA A;  5ILU A;  1UCR A;  1F9N A;  3M7G A;  1BJA A;  3WTZ A;  1FP2 A;  2L3D A;  3GZ5 A;  5IT9 Z;  3EYI A;  1B1B A;  3LA7 A;  3LFK A;  1SAX A;  1U78 A;  4R79 A;  3F8F A;  2NNN A;  2CO5 A;  2FXA A;  2VOP A;  2EK5 A;  4M9S A;  4RS8 A;  1FT9 A;  1KQ9 A;  3KE2 A;  5AIP A;  4ZYG A;  1BM9 A;  3FXU A;  1IN8 A;  2ETH A;  1RUN A;  4L9T A;  3WTV C;  3GUD A;  4R8H A;  1R5H A;  2IT0 A;  1PP8 F;  2G9W A;  3T0Y A;  5FB2 A;  1S8N A;  2MBF A;  3HSR A;  2V1X A;  1GXQ A;  2PBI A;  1LB2 A;  2C6Y A;  3MWM A;  3M9A A;  2ZKZ A;  4YFX F;  3RPU A;  3ZN0 A;  2LF7 A;  3AAF A;  1HKT A;  5CJ9 A;  5F64 A;  3I59 B;  1DDN A;  4CDG A;  4GO1 A;  3JAM K;  5L3B A;  2H94 A;  1O3S A;  2ZBK A;  1GVJ A;  2ISZ A;  2LF8 A;  2NAZ A;  1U2W A;  1HW1 A;  2OBP A;  2P5L C;  2HFH A;  1QZY A;  1R22 A;  4KIF A;  4UV9 A;  1YFH A;  1LNW A;  4O3M A;  4P55 A;  4LB6 B;  4LK1 F;  4XRF A;  1OPC A;  2YU3 A;  2XKP A;  5DEQ A;  1S29 A;  3FWE A;  3K2Z A;  1DUX C;  3FHZ A;  3ZQ7 A;  1ZRF A;  2MH2 A;  2BBY A;  1Z7U A;  2XAG A;  4EM0 B;  4I02 A;  4BQA A;  2IA0 A;  3WTT C;  3GYH X;  1AOY A;  2E1C A;  2F5F A;  2HYF A;  3V7R A;  5DD4 A;  1Z6R A;  1ON2 A;  1QPM A;  3JTH A;  1TQP A;  4KN4 X;  1XGM A;  5LLQ A;  3FMQ A;  2XVC A;  4P9U A;  4ESJ A;  4QLC U;  3ELK A;  4IRG A;  3QU3 A;  2P6S A;  5AON A;  1ZRC A;  3ECH A;  2DI3 A;  2QVO A;  4BNC A;  2XAH A;  5DDG A;  1SMY F;  2ZFW A;  2Z5U A;  2H6C A;  3MZH A;  2EFP A;  2L02 A;  3F21 A;  2XIG A;  5E8G A;  4A12 A;  5LGN A;  1XSD A;  2XUB A;  4Y13 A;  1JXS A;  1ZLK A;  4DNC A;  3M8F A;  3DPT A;  5LEJ A;  3IWF A;  5H6Q A;  4M72 A;  1MGT A;  1GHC A;  3GFM A;  2HYG D;  2BEO A;  3RI4 A;  3E6B A;  3VEP A;  3LQR A;  3WTW C;  1IF1 A;  3HHH A;  4KYW A;  1FYK A;  2A69 F;  3F8C A;  2PLY A;  1BIB A;  2QLZ A;  5HDK A;  3P7N A;  2CWE A;  3Q9V A;  1FSH A;  2VBX A;  2M8E A;  5HLG A;  2HEO A;  4ZYE A;  4HBL A;  4L5J A;  2DQL A;  2STW A;  2R7D A;  4M73 A;  4G9Y A;  3WGG A;  1J75 A;  3HHG A;  2HDC A;  2YSR A;  4BYY A;  5ERI A;  2V1D A;  3GFL A;  1UFM A;  1ZG5 A;  2KIF A;  4PGH A;  4EV0 A;  1G3W A;  3KZY A;  4GGG A;  5IT3 A;  1B6A A;  3RKY A;  3BJO A;  3K0L A;  5D5X B;  1OYI A;  2LKP A;  2QQ9 A;  3NRV A;  5E1W A;  1OKR A;  1ODD A;  2CFX A;  3SXY A;  3V4G A;  4ON0 A;  2HQR A;  3L7W A;  4RAZ A;  5FD6 A;  4HDV A;  2DBB A;  3KEQ A;  3IWZ A;  3HUG A;  5DUI A;  2Y48 A;  2A6H F;  4HZF A;  2QWW A;  3GXO A;  5BPD A;  2D1H A;  2QYO A;  1S7O A;  1JHH A;  3QP5 A;  4ZYH A;  5D6E A;  1O7F A;  1YTY A;  4MGR A;  1FP1 D;  3IKV A;  3I71 A;  3F22 A;  1WKM A;  3E5X A;  4G6D A;  3L00 A;  3J7A O;  1IAW A;  3RYR A;  2L4A A;  1HKS A;  3ZMD A;  1MZB A;  1FYM A;  2RN7 A;  2E7X A;  2STT A;  5BMZ A;  3I4P A;  3DPL C;  3DFG A;  1TW3 A;  2M87 A;  2VBW A;  2Y0M A;  1YYV A;  3B73 A;  3BPX A;  2O6G E;  2P7C B;  2PFB A;  3MQ0 A;  5F1R A;  4CO8 A;  2PMH A;  3V8J A;  3C18 A;  2VT2 A;  3BP8 A;  3IKT A;  3WGI A;  4RB0 A;  2W25 A;  1TW2 A;  2V1U A;  3QU6 A;  3DXJ F;  2CGP A;  2FMY A;  3JSO A;  3TKY A;  1RUO A;  2JPB A;  3I54 A;  1WRJ A;  1JHF A;  2O3F A;  4Y17 A;  3CUQ B;  2VON A;  2VBZ A;  2A07 F;  3EDP A;  2X0L A;  3LA3 A;  4L0Y B;  4IPA A;  3I53 A;  3KEO A;  1TLH B;  2F5D A;  2DW4 A;  3KP7 A;  1R7J A;  5K5O A;  1HW2 A;  1EV7 A;  4OIN F;  1UHM A;  1YS6 A;  4NB5 A;  4HX4 A;  1ZGJ A;  2O0Y A;  4OMY A;  3E6C C;  1O3Q A;  5CLS A;  2VXZ A;  4I7H A;  1WSU A;  4KA4 A;  2G7H A;  4ENM A;  4AVP A;  3F8B A;  3M1E A;  2NNY A;  1SFE A; 
#chains in the Genus database with same CATH topology
 2FNP A;  2HTJ A;  2HVQ A;  2PMU A;  2WAQ A;  1XGO A;  2LD5 A;  4OAY A;  3VYR B;  3EYY A;  2VKH A;  3ISP A;  5AIQ A;  4XK4 A;  1LQ1 A;  1I1S A;  1FEX A;  3MKL A;  5D8L B;  4KT5 C;  1MNM C;  4QIW N;  3WG7 H;  4GYI A;  5EEG A;  1W7P A;  2LH9 A;  4OMZ A;  2RKH A;  4HDU A;  1UHW A;  1T56 A;  4IEJ A;  3ZQG A;  4BXF A;  2JRT A;  3LSG A;  4NDL A;  2XPV A;  2Z16 A;  1Y1W J;  2NRA C;  4II3 A;  4RMN A;  2E71 A;  2MA3 A;  4HLY A;  1XC5 A;  3FKJ A;  4NHJ A;  2BE5 F;  3QQA A;  2FF4 A;  4MTD A;  1ZR4 A;  1AA7 A;  1YX5 A;  2QQA A;  2Y30 A;  4UB8 C;  1KON A;  5DCM A;  3E6D A;  1OMI A;  1J7K A;  3DV8 A;  3KP2 A;  1R1V A;  3PQK A;  1VQ4 I;  2IEK A;  3I3L A;  1F43 A;  1B8I A;  2OTL I;  1WJB A;  4P96 A;  2AXT C;  4XLA A;  2KIM A;  5LRS A;  2XC7 A;  3RZO J;  2L4M A;  3MZ8 A;  3RIR A;  1OQY A;  2WA0 A;  2IRF G;  4WF2 A;  3LAJ A;  5B5E C;  2OCE A;  2A6E F;  1YJN I;  2RC4 A;  1VQL I;  1FOW A;  3O8G A;  3S3M A;  1SD6 A;  1S72 I;  2M34 A;  3H5N A;  4LD5 A;  1W36 D;  1KQ8 A;  1HQC A;  3QOP A;  1ACI A;  3TW6 A;  4A6D A;  1FMW A;  5EG0 B;  5JVG F;  2XB5 A;  1W5S A;  1W7P D;  2I10 A;  5EEH A;  1T39 A;  3ZRG A;  4B8X A;  4HNV A;  1RKW A;  1XPX A;  1MD0 A;  1RI7 A;  3BTJ A;  4NC8 A;  1HSJ A;  2VJ4 A;  3A4C A;  3JW4 A;  2YR2 A;  3WTU C;  2EFN A;  1XB4 A;  4I6Z A;  3KPH A;  2DA1 A;  5M5W J;  5HDN A;  2W24 A;  3FHN A;  4F91 B;  2E36 A;  1YQA A;  2R7W A;  1JI8 A;  2HXI A;  5EF6 A;  1AKH A;  1EH8 A;  5DM6 F;  4A3J J;  4K2E A;  2R7X A;  4ENJ A;  4JX5 A;  1YJW I;  1VQ7 I;  1ZTR A;  3PSF A;  3O6B B;  4XOP A;  1EH7 A;  2QEN A;  4RDU A;  1P2F A;  2JJ7 A;  3H5R A;  3TQN A;  3DLL F;  2RAE A;  1F4K A;  1V55 H;  1ETQ A;  2JTV A;  1OCC H;  4HOB A;  1P7J A;  2DO7 A;  2K7L A;  4LOC A;  3RTR A;  3VOE A;  4BAC A;  3HUG B;  3H3V K;  1Y39 A;  1X4O A;  1W0U A;  3GTG J;  4KNY A;  1IW7 F;  4UVA A;  5IP9 J;  3IRR A;  4U88 A;  1IRF A;  3KZI C;  3JRF A;  2E7W A;  3Q0V A;  4XNF A;  1OCP A;  4OIP F;  2R93 J;  4NQW A;  4IOC F;  1BR2 A;  2VJI A;  3S1Q J;  1R23 A;  1BI1 A;  2M2E A;  2ZCW A;  1HLV A;  2JVH A;  2OA4 A;  1GV2 A;  3OL3 A;  4OIR F;  3J81 K;  2CW8 A;  1JUS A;  4BQQ A;  1X3W B;  1YLF A;  5C4X J;  2VQC A;  5C4J J;  1VI0 A;  3A2K A;  1JGG A;  2HPM A;  5KAI C;  3ZMT A;  3ZMZ A;  4B48 A;  5ILS A;  3T8T A;  2HQN A;  5J1R A;  3S93 A;  4BBR J;  3C7J A;  5JR3 A;  2JN6 A;  2RDP A;  1YG2 A;  3CP8 A;  1A6Q A;  4WK8 F;  1ZGA A;  4LG0 A;  4X0G A;  1JKP C;  1IZ1 A;  2X6Y A;  5J47 A;  1P4A A;  4U0W A;  1V5G A;  2LDU A;  5D5U B;  1U9O A;  5ED4 A;  4U0Y A;  5LRR A;  3ZCO A;  4DGW B;  3OYJ A;  3SJM A;  2W7N A;  3E0J B;  5J1U A;  1ZHF A;  3OSF A;  2H1L A;  3FK7 A;  1D0X A;  4HST A;  1ON1 A;  5CQE A;  1D8J A;  1O4X A;  2N8G A;  5ICG A;  3LSK A;  2M5W A;  2PG4 A;  1CF7 A;  2Z9O A;  4ITV A;  2XRO A;  2DOE A;  5E8I A;  5JLW A;  3ZN1 A;  1VFC A;  2HKX A;  3HJE A;  1D0Y A;  1RC9 A;  4UUS B;  5L3F A;  2L0K A;  4HYE A;  4E7L A;  1ETK A;  4PK4 A;  2Q2E B;  1ZEL A;  5B3S H;  3KYD B;  2D45 A;  2ACJ A;  1BC7 C;  1R36 A;  4A3I J;  1O57 A;  2W00 A;  2NVX J;  3ASO H;  1HBX G;  4L9J A;  3GW2 A;  1DU0 A;  1Y0U A;  4CCJ A;  4ZTF A;  4A6E A;  4E7H A;  1P92 A;  2FBI A;  3V7C A;  5J8C A;  2FA5 A;  2KHM A;  2P8T A;  3BG7 A;  1HW5 A;  3H36 A;  3ZMU A;  1QBJ A;  1IG7 A;  3I56 I;  2M7A A;  2E19 A;  5GAH J;  3OYN A;  1BBY A;  1FWZ A;  4MEY F;  2BV6 A;  5HVQ C;  5M3F J;  2DT5 A;  2P6T A;  4J19 A;  1KZH A;  5K5R A;  1GV5 A;  3J80 K;  1WZ2 A;  3QRF F;  2KKO A;  2OAZ A;  1SAN A;  1TP4 A;  1XG1 A;  3DKY A;  2GLO A;  2XKO A;  3AG3 H;  4CCK A;  2DA6 A;  4XBF A;  3OYB A;  3K4N A;  1X1D A;  2DFI A;  2W84 A;  3GO5 A;  3V7S A;  1BOA A;  3HEF A;  5DS9 A;  3KFW X;  5HS7 A;  2HVS A;  2VKV A;  3M3Y J;  3E3V A;  1RZ4 A;  4IOA F;  2EZK A;  4QPQ A;  2XGC A;  2R5Z A;  2LC2 A;  2WBM A;  2QSG X;  1ZYR F;  4S05 A;  1MSF C;  1IRG A;  3U2R A;  1V3F A;  1SMT A;  2M1B A;  3K1N A;  2R7O A;  3G2B A;  2WV0 A;  3ZQI A;  4C3H J;  4ZDO A;  3WTY C;  1X1B A;  5BQT A;  2QKM B;  1YX3 A;  4A2U A;  3I64 A;  4HX7 A;  2FEZ A;  3JRC A;  2VJJ A;  2FOK A;  4I98 B;  1K6Y A;  2V1N A;  3H3U A;  2ZXH A;  3OIO A;  2OZU A;  3DTI A;  1WFX A;  4OIQ F;  2EIM H;  4FQG A;  3WE3 A;  2A3S A;  2K4J A;  4G6Q A;  4CIC A;  3P9I A;  4WXD A;  2CFO A;  2QQB A;  1DPR A;  2KIS A;  2FBK A;  4BU2 A;  3BZ6 A;  3CLQ A;  3DQV C;  5FFX A;  3TO7 A;  1XD7 A;  2LLK A;  2H8R A;  2ZNZ A;  5JVT A;  3CCJ I;  1FOX A;  1JT0 A;  3IUO A;  3FIW A;  4I0A A;  2MD0 A;  5CQG A;  4AIK A;  3PNT A;  1O3T A;  1YW9 A;  2AXL A;  4FT8 A;  3COA C;  2RNG A;  3H9G A;  2VQG A;  3WTS C;  4B43 A;  4PUS A;  2KP6 A;  3VB2 A;  3HOY J;  4BQN A;  1FX7 A;  2X51 A;  4ESF A;  5D5W B;  4BHC A;  2E5Z A;  5CYV A;  5E20 A;  4G7H F;  4EM1 A;  3OYG A;  3TOA A;  4M71 A;  2CV1 A;  1Z77 A;  2CQX A;  3FF5 A;  2HTS A;  3CCY A;  5C3E J;  1OYW A;  4BGD A;  1B9M A;  2AS5 F;  2OQR A;  3GLL A;  1UHS A;  2P5V A;  1SFX A;  3ERM A;  4WXC A;  1A5J A;  1D0Z A;  4GYG A;  5HS9 A;  5LFA A;  2Y9Y A;  2O7O A;  1R9T J;  2NVT J;  3CJN A;  1KQ0 A;  3GTO J;  4UUV A;  3F9K A;  4A5M A;  4OWR B;  1LPQ A;  2KL4 A;  4U7B A;  4AD9 A;  4E7J A;  4HLX A;  1X58 A;  1D1A A;  2W4S A;  1I6X A;  2PI0 A;  2EIK H;  2VE8 A;  3NEU A;  2G7U A;  3F3X A;  3BG5 A;  4EJO A;  4MHG A;  4QWQ A;  1XDU A;  2NVY J;  2BY0 A;  3KET A;  3PFI A;  4UXN A;  2D1V A;  5FGM A;  2HOT A;  2VUM J;  1MIJ A;  1S6L A;  5IYB J;  1XSX A;  4XID A;  3L2Q A;  1I3A A;  6PAX A;  3OYH A;  3MFK A;  1XDS A;  2HDW A;  5HNF A;  3BR5 A;  1WVR A;  2GZW A;  2GA2 A;  1ULY A;  2KZG A;  1FBS A;  2Y0S A;  4ZDP A;  2DTR A;  3ONQ A;  3GX4 X;  3CD6 I;  5LHI A;  3H3Z A;  1YOV B;  3RPQ A;  5IY5 H;  2KZV A;  2LRE A;  4E7K A;  1MJB A;  5LEK A;  1U6G A;  4IHT A;  1MBG A;  1O3R A;  3KIO A;  4I99 C;  4F52 A;  3ROU A;  3JAM Z;  2FSW A;  4AID A;  5GAG J;  3SHF A;  5BS6 A;  2M30 A;  4FIS A;  3U1K A;  2Y9Z A;  3F0C A;  2CJJ A;  1PDN C;  2R7S A;  3AG2 H;  1LDJ A;  2ECB A;  2P4W A;  2PMZ A;  3Q0W A;  4XN3 A;  1H8A C;  4B3A A;  2VAS A;  4I76 A;  4GFB A;  1Y6I A;  1K7A A;  2WAD A;  1MBE A;  4N9H A;  4Y15 A;  1PUF A;  2IS6 A;  3T1B A;  2R7F A;  4WXH A;  3I55 I;  1ETW A;  3G1O A;  1I1G A;  1ZKG A;  3QYF A;  4MNU A;  3DEW A;  5FO5 A;  5BNG A;  4CXF A;  1ETY A;  1SFO J;  1U5T A;  5FRO A;  4DYC A;  3D1N I;  1H0M A;  2GXG A;  2DA4 A;  3K4J A;  1K4S A;  1YIJ I;  2JVG A;  3TO9 A;  2AQE A;  4IRI A;  1LUJ B;  4PDK A;  1QU3 A;  1IC8 A;  5DUK A;  4HAM A;  1R1T A;  3HL2 A;  4YEL A;  3G1L A;  5LGT A;  2JSP A;  1I6H J;  4LB5 A;  1OR7 C;  1MMN A;  3EUH C;  2EFO A;  5CPR B;  1LEA A;  5FKO A;  3LAP A;  4M6Y A;  2DOD A;  5EZH A;  2DA2 A;  1RIO H;  1A04 A;  3JTG A;  2R7U A;  1WI9 A;  3OYM A;  3OYF A;  1AWC A;  2DYS H;  4M9X A;  4EQQ A;  1MBH A;  2LYC A;  1J2X A;  4LMY A;  3MN2 A;  3VYU B;  5LHH A;  4HF2 A;  4AIJ A;  5F0F A;  5FJ8 J;  1W4M A;  2OZ6 A;  1P4X A;  4JX6 A;  1UEL B;  2E2I J;  4WX9 A;  4H0E A;  2M7B A;  4PFO A;  1I39 A;  2CYY A;  5DCF A;  2Z99 A;  4Y52 J;  5EZG A;  3CUQ A;  4PGG A;  1IUY A;  1FLI A;  3A03 A;  2DQR A;  3DWL E;  2VL8 A;  1DGW Y;  4E7Z A;  1SEU A;  4P5O A;  3JRA A;  4XKW A;  1F1Z A;  2V6C A;  1S7A A;  2X6W A;  3LSR A;  4M3D A;  4XKV A;  2EA4 A;  3U9G A;  5IOY A;  4RAY A;  4YIR X;  5K5Q A;  1KU2 A;  3HXL A;  3SEQ A;  3BY6 A;  1TT5 B;  1UST A;  2FNA A;  2MFZ A;  2ZXW H;  2F5C A;  2X6O A;  5K7Z A;  3KP4 A;  5LHG A;  3GFI A;  2WV1 A;  2K9M A;  4ZC3 A;  1HA8 A;  1E2X A;  2WAQ N;  3MAJ A;  4HNT A;  5FLX Z;  1VQ5 I;  3KLN A;  2EIL H;  5M5X J;  4JK1 X;  1FNN A;  3NWS A;  3OMY A;  1BA5 A;  3OOU A;  4XLN F;  3E5U A;  2L9S A;  1X1C A;  1LDK B;  2R0Q C;  3W2A A;  1JE8 A;  1IN7 A;  1XGN A;  3ML6 A;  1XTA A;  1QRY A;  2F2E A;  5E1Z B;  1JGS A;  1BJZ A;  1S7E A;  1WJ5 A;  2PX9 A;  3LOC A;  5FLV A;  4XLH A;  5GPA A;  2R7V A;  3BCA A;  3R61 A;  3F72 A;  4PCQ A;  4CCL A;  3DF8 A;  5KCM A;  2GXB A;  3C3W A;  3FBN B;  3QPT A;  4OIO F;  2DTZ A;  1SFK A;  1TNS A;  1IDY A;  1D3Y A;  2V9P A;  4PZJ A;  4OAZ A;  1NHA A;  1I50 J;  3SYT A;  5F0H A;  3ZMS A;  2ZXJ A;  3HC7 A;  4XLE A;  3L9F A;  1HDP A;  2R92 J;  5CVU A;  2EH3 A;  4BHP A;  5IYD J;  4HV5 A;  1RNL A;  3DKX A;  4M9Z A;  2JSC A;  1EF4 A;  4ZZL A;  2JA8 J;  1ZLJ A;  2O03 A;  2EV5 A;  3K4M A;  1G3S A;  1R5G A;  2HGC A;  4P9F A;  2B63 J;  2XGX A;  1IJW C;  3HZJ A;  4AYB N;  4AVZ A;  3DLA A;  3A0B C;  4M3G A;  1HOM A;  4KMF A;  2Y69 H;  3BQY A;  2HR3 A;  2L7M P;  2NYX A;  3D0S A;  3F6V A;  3JR9 A;  3G6E I;  4XOT A;  2PN6 A;  2K5C A;  1ZRE A;  4LG0 B;  1WJA A;  1X2M A;  2D5V A;  1WJD A;  2BY2 A;  1DGR M;  4M74 A;  3M8J A;  1I5Z A;  1USS A;  1T6S A;  2AO9 A;  4F3Q A;  1JTY A;  2QGU A;  2CUJ A;  4CA0 A;  2DT7 B;  1T8I A;  1C0W A;  5JFR A;  4BE2 A;  2BZT A;  1YIO A;  5ILV A;  3KYL A;  2EFW A;  3FK6 A;  2EQR A;  1YW8 A;  4PFP A;  4G6T B;  4AIH A;  2K40 A;  3T5X A;  1BI0 A;  4UUS A;  4A3M J;  1Q1H A;  4IHS A;  4D1Q A;  1I27 A;  3A01 A;  3AG4 H;  1HST A;  2ZME B;  4XIC A;  3TW7 A;  1Z05 A;  1D5Y A;  2OU2 A;  1T0F A;  4V2G A;  5ICC A;  2Q2E A;  3G3Z A;  2KRF A;  1T38 A;  2HWV A;  2DMQ A;  5D6F A;  1R1U A;  4YIF A;  3OYC A;  5L3C A;  4KIB A;  2IGO A;  4RGS A;  1LFU P;  1MMA A;  2CV2 A;  1U5T C;  5E79 C;  1Z3X A;  1KU3 A;  9ANT A;  3BG6 A;  2CU7 A;  1BR4 A;  2E1O A;  1SVM A;  2R3S A;  2ME6 A;  1Z6T A;  2KPM A;  1IRZ A;  3TED A;  3B6A A;  4D9J A;  1J59 A;  1MJ9 A;  2E1M C;  3KLO A;  3CQZ J;  4FTH A;  4IHW A;  1MMD A;  1RPW A;  4XLC A;  1T2K A;  3CZ6 A;  3N4M A;  2K9Q A;  4D0P A;  1IN6 A;  4HQM A;  3ZGK A;  5K7H A;  5HDG A;  3GZ6 A;  4E6K G;  2K4B A;  1IRX A;  1G3T A;  4HF0 A;  5F0C A;  4BXU A;  5HS8 A;  4CYC A;  4CCO A;  2VE9 A;  3BRO A;  3SDG A;  2H09 A;  4FX0 A;  4RAF A;  4EJT A;  3C2G A;  3HBL A;  4MQV A;  3CMY A;  3K9T A;  4NQW B;  4BE1 A;  1XCV A;  1CGP A;  1B72 A;  4LK0 F;  1QHG A;  1YS7 A;  2FQ4 A;  3LWF A;  1JUM A;  2QZ8 A;  2NOG A;  1NG7 A;  3CUQ C;  4NC6 A;  4I01 A;  3GWZ A;  1NH3 A;  3K4L A;  3K1M A;  4ZZD A;  3WU0 A;  2DJN A;  1NG6 A;  2IJL A;  3JRI A;  5DTD A;  2MAB A;  3TOB A;  1QNT A;  5J6X A;  2DK8 A;  1G2H A;  4JP0 A;  1LE8 B;  2IA2 A;  4S0H B;  3DTE A;  2ELK A;  2O61 A;  4EJU A;  3K69 A;  3U1D A;  4YFN F;  2J5P A;  2O5R A;  3BJ6 A;  1PP7 U;  4ETS A;  3MD2 A;  2MG4 A;  5FLX K;  1QVU A;  3JRE A;  1AKH B;  2EPF A;  3LMM A;  1TWH J;  3KZZ A;  3O3K A;  2R5Y B;  3TGN A;  3P9K A;  2IA1 A;  4DYQ A;  3CCL I;  5IYC J;  2EB7 A;  2MC4 A;  3MZY A;  1W5T A;  2FU4 A;  2FE3 A;  3DEE A;  1D8K A;  2BVM A;  3HTU A;  4XKC A;  1K78 A;  1R6R A;  4KIC A;  2MSY A;  4EEF G;  3HRS A;  3LSH A;  2ZME C;  1TTY A;  1REP C;  4M3E A;  1X2N A;  3WOD F;  3TMO A;  2E1N A;  3CO7 C;  2JUG A;  3GTK J;  1BN5 A;  4XLP F;  3Q9S A;  3DU6 A;  2QA4 I;  3BWG A;  4EGZ A;  3AFH A;  1XMX A;  3HYI A;  3S1N J;  2I8D A;  2WAE A;  2Q8K A;  2EV6 A;  2PQ8 A;  3HOS A;  1D1B A;  4BEH A;  1JKQ C;  4G12 A;  1SAU A;  1MJA A;  2Z3Y A;  3HPH A;  2F5E A;  1FBQ A;  2IGM A;  2VB6 A;  2Z2S B;  2ZO4 A;  3LA2 A;  1ZGW A;  2K9S A;  4ESB A;  1FPQ A;  1V5F A;  1ERD A;  1MKM A;  4ZYA A;  3HGY A;  4XL9 A;  5J4V A;  5KVR A;  3OV8 A;  5E17 F;  2DU9 A;  3HRM A;  2KIU A;  1U5T B;  2GQQ A;  1SD4 A;  3BDD A;  4N0B A;  2O8X A;  1RRJ A;  4ENN A;  2LSO A;  1MBJ A;  2W57 A;  2CW7 A;  2K3P A;  2P0W A;  4A3D J;  3M1C A;  1DP3 A;  3L09 A;  4CYD A;  2QEX I;  4U0V A;  3ERE D;  2UXX A;  1ONV A;  4ZH4 F;  1SVL A;  4O5V A;  4CHU A;  3E97 A;  1TQI A;  3H9Q A;  3RKX A;  2K85 A;  2YX7 A;  4C2U A;  1FY7 A;  1TC3 C;  4YEJ A;  3IAM 2;  3OR2 C;  2HYJ A;  2DCE A;  3RPU D;  1QQI A;  3D5L A;  4MEX F;  3AL0 B;  2UWM A;  3IC7 A;  3C1D A;  3H0G J;  3VFZ A;  4MLO A;  2FQ3 A;  2RQP A;  4IRH A;  2VOD A;  5FFZ A;  4D5F A;  2LTP A;  1KA8 A;  4E70 A;  3JRB A;  4Q48 A;  2ME0 A;  4MIM A;  3A02 A;  4Y33 A;  4CGZ A;  2CG4 A;  2MLK A;  2EWN A;  5IP6 A;  2RGV A;  4ZDL A;  4W1U A;  2IVM A;  3DP7 A;  2DLL A;  2QF7 A;  3CTA A;  2E34 A;  3Q5F A;  1EKE A;  3WG9 A;  4LFU A;  3CO6 C;  1RKT A;  4HF1 A;  1E3H A;  2M0C A;  4A0Z A;  1KU9 A;  4E7S A;  5FKM A;  2K27 A;  2ZSH B;  2DA5 A;  2EZL A;  3PIO F;  2VC0 A;  3OOP A;  1VZ0 A;  3SDB A;  3VSL A;  4BEH B;  3B6C A;  4O6J A;  4HNU A;  4NUB A;  4FHT A;  3DU5 A;  1B8I B;  5TRD A;  4BAY A;  2A05 A;  2RRE A;  3AG1 H;  2P5K A;  3FXR A;  1GXP A;  3AL0 C;  3WU1 B;  4ASN A;  5DV5 A;  4LIV A;  4HA8 A;  1Z91 A;  1R4N B;  1ZG1 A;  5CVI A;  1V4R A;  2CH0 A;  5A2Q Z;  2BYV E;  3ULQ B;  1X3U A;  3I9V 2;  4L0Z B;  1ZH5 A;  2K86 A;  3B02 A;  1GT0 C;  1FBU A;  3ESW B;  5B1A H;  3BLY A;  2GBY A;  3WGH A;  3OYK A;  2ZJP F;  4BDZ A;  3GF2 A;  3HSF A;  4CYC B;  1VQO I;  2E35 A;  2ESH A;  3WE2 A;  3EPZ A;  3RKW A;  2R7T A;  1GLN A;  1YHQ I;  2OD5 A;  2YPR A;  4HG2 A;  4LLL A;  3MKW B;  3H92 A;  4CZZ A;  4LJZ F;  2ECC A;  1FTT A;  2DA3 A;  1B72 B;  1PJR A;  4HX8 A;  2Z33 A;  1U3E M;  2HOA A;  1QZE A;  3PO2 J;  3REO A;  2WAF A;  3GBG A;  3R0A A;  1MSE C;  3RYP A;  3VPR A;  5D5V B;  5J3L A;  2X1D A;  1I3Q J;  2LR8 A;  2UXN A;  3CDI A;  2JWT A;  2P81 A;  2HZD A;  4KIG A;  1Z21 A;  5EGO A;  2VT3 A;  2NXN B;  1L0O C;  1KGS A;  2LK2 A;  3RQI A;  3ZR8 X;  2KJC A;  2PJP A;  2GWR A;  1IN5 A;  2K02 A;  1E3O C;  1QZZ A;  4G7Z F;  3CC4 I;  5J8F A;  4FX4 A;  4KDP A;  4N9I A;  3MKY B;  5LBQ A;  1FZP B;  4LG3 A;  2HI3 A;  2KLO A;  3MKZ A;  3HOZ J;  4F7Z A;  4PJL A;  2DA7 A;  4HQE A;  4DW6 A;  2FBH A;  2JK3 A;  1OYY A;  3OS1 A;  5F6F A;  3O8H A;  2WTE A;  4Y4R A;  1G4D A;  2GIZ A;  2IXS A;  2Y75 A;  3JSP A;  1B4A A;  2YU9 J;  3QOE A;  2ZME A;  3TDU C;  4AUX A;  1ZN2 A;  3SZG A;  4YFK F;  1G8X A;  1LFB A;  2ISY A;  4RGR A;  1MDM B;  1ORK A;  4CUG A;  3CMM A;  2M4K A;  4J00 A;  5LD2 C;  1Z67 A;  4F93 B;  3RZD J;  4N4O B;  3E1S A;  2L01 A;  2VN2 A;  3CLO A;  1MMG A;  3G4S I;  2XPU A;  4AWX B;  3IV5 A;  1R58 A;  2KRC A;  3S2W A;  2XRL A;  3ABT A;  3G73 A;  1VQP I;  3IP4 B;  1HKQ A;  2GOM A;  4CSW A;  1W5C C;  4NBQ A;  1PUE E;  3V8K A;  3CES A;  1JJ6 C;  2FRH A;  4MFD A;  1STZ A;  2XHK A;  3F6O A;  2OUM A;  2IGK A;  5E18 F;  3T8R A;  4CH7 A;  2K3F A;  4HPQ A;  4UUT A;  2EA2 A;  3OS0 A;  5C44 J;  4E4H A;  1WPK A;  3BJA A;  4EMS A;  4PJM A;  3DKW A;  1OFC X;  3PJR A;  1LJ9 A;  2R4G A;  4WCG A;  2MC3 A;  2I5U A;  4OU0 A;  3QPH A;  1YRN B;  1P4W A;  1CF7 B;  4GCV A;  4HSR A;  5HNH A;  3FXQ A;  4HW0 A;  2QBY A;  3ECO A;  4PSW A;  4A3K J;  1N77 A;  4A3F J;  2XAF A;  2KJB A;  1Z7L A;  3CMA I;  2CW0 F;  1T95 A;  1BW6 A;  3X2Q H;  1X19 A;  2NVU B;  3AKZ A;  2EV0 A;  4IF4 A;  4RGX A;  1FJL A;  4NC7 A;  3HTS B;  3GTP J;  2Q0O A;  1Z1D A;  2TRT A;  3DCF A;  3GVA A;  1JT6 A;  2B9S A;  2XF5 A;  3HKZ N;  1B59 A;  3VYT B;  1MND A;  5JHU A;  3FM3 A;  1X4P A;  4PJN A;  1MH4 A;  3RQ4 A;  1QPI A;  1YW7 A;  2XAJ A;  3GFJ A;  4Z2Y A;  2KT0 A;  3MVP A;  4S04 A;  4BH9 A;  3IHU A;  3WHB A;  4MQ9 F;  2JQ7 A;  3LQQ A;  5D4R A;  1YIT I;  1POG A;  1UJ8 A;  5CVR A;  3FX3 A;  1BI3 A;  1FSE A;  1YE9 A;  1ZAR A;  1R5I D;  3QAH A;  2HU9 A;  2MD5 A;  2A5Y B;  4A0Y A;  3TO6 A;  1FYL A;  2TCT A;  2W85 A;  4YG2 F;  3J7A Y;  2GA1 A;  3I4N J;  4L9V A;  4XSX F;  2VPL A;  1R00 A;  2K9L A;  4ZJZ A;  1ETO A;  2WC2 A;  3GLX A;  3QYE A;  2QKL B;  3CUO A;  2V26 A;  3DBH B;  1UZC A;  5BPI A;  2LOO A;  1SD5 A;  3K10 A;  3F23 A;  1YO5 C;  1VTN C;  4G94 A;  5F04 A;  2R7R A;  2IP2 A;  3S15 J;  5FKN A;  2E5N A;  3S17 J;  1WJE A;  3OIP A;  2HQ5 A;  4YII A;  2LP0 A;  1OCZ H;  1UB9 A;  2QUF A;  3OWT A;  1OIS A;  1TT0 A;  2V7F A;  3I58 A;  1K4T A;  4N4N B;  3OYD A;  1H89 C;  2DAO A;  4DYR A;  2LY2 A;  2NS7 A;  1W7P B;  1OR7 A;  1VQ8 I;  3I4M J;  1SD7 A;  2JA5 J;  1W1W E;  1WH5 A;  2NOJ B;  1FC3 A;  1HDD C;  1VQK I;  3F8M A;  5EG0 A;  1PUF B;  5HOO A;  4JBA A;  3G71 I;  1DP7 P;  2A5W A;  3KEY A;  3VDX A;  5DM7 F;  3DBL B;  3KCC A;  5F27 A;  3J81 Z;  2KQR A;  4II2 A;  1DU6 A;  3PO3 J;  2DMT A;  1WJC A;  4EM2 A;  1H9G A;  3EET A;  3O2P E;  1T0F C;  4IJA A;  2DK5 A;  1BI2 A;  1VQN I;  1QO0 D;  1FOY A;  3PUF A;  1B9N A;  3BPV A;  2L9R A;  3BOQ A;  2CQ7 A;  3CC2 I;  5HOD A;  4KMU X;  3P9C A;  1WGX A;  1GVD A;  4RA2 A;  3L2V A;  4RBO A;  1BW5 A;  4R1H A;  4BY7 J;  2UZK A;  1QGP A;  3PQJ A;  3QPL A;  5FKL A;  2DPD A;  4G7O F;  2FD5 A;  5J4Y A;  3HOW J;  3ZP5 A;  4DZP A;  1VQ9 I;  4HV6 A;  3H1C A;  3WHC A;  2DDB A;  4NNJ A;  2R7Z J;  2JPC A;  2P7V B;  5D4S A;  4B09 A;  1OLT A;  4UVC A;  2R7Q A;  3N97 A;  2D2W A;  1MBK A;  5IP7 J;  2RNJ A;  1WQ2 A;  1HF0 A;  1SFU A;  4YRV A;  3Q0U A;  2GIV A;  4XN0 A;  2DT6 A;  2IPQ X;  1Z0X A;  5GTI C;  2CUE A;  2LNB A;  1S5L C;  2NS0 A;  4KUM A;  4ZYD A;  1LDD A;  2IW5 A;  1UMQ A;  2GOX B;  3I0T A;  4LIU A;  3VOD A;  2NS8 A;  2ZJ2 A;  4EJV A;  3FMS A;  1UG0 A;  3JRD A;  2XV4 S;  1SC7 A;  4A5N A;  3KP3 A;  4A3E J;  5EJC A;  5ICE A;  2BOL A;  4L5I A;  3J7Y J;  4AYB A;  3ABU A;  2ZJQ F;  3HIF A;  3EUA A;  4I2O A;  4IQ4 A;  5EDN A;  1K78 B;  4IQJ A;  5HLI A;  3LSP A;  3GCM A;  4RGU A;  2IAI A;  2JA2 A;  2LBF B;  3FIS A;  2HNH A;  1DQU A;  2XRN A;  4XKB A;  2A61 A;  1Y0N A;  3BTL A;  3L2C A;  5BOX A;  4BJT A;  3K1P A;  1G6N A;  3SZT A;  1MNE A;  3ZQF A;  2RQQ A;  2GAU A;  2E2J J;  1Z9C A;  4KFC A;  3R4K A;  2ZJR F;  5CVJ A;  3WU2 C;  4IKF A;  3J80 Z;  1G3Y A;  1TWC J;  5DCM B;  3LST A;  3OYL A;  4IZZ A;  2LKS A;  1FTZ A;  4BJ5 C;  3BG9 A;  1BOB A;  2J5O A;  4Q5S F;  2V9V A;  3HOT A;  1TWG J;  3PSI A;  4Q4Z F;  1KYZ A;  3FZV A;  2ESN A;  2JT1 A;  4I0B A;  3PIP F;  2ZXI A;  3RJP A;  2FML A;  2A68 F;  1U0J A;  1XGS A;  2ID3 A;  2HQA A;  4U7D A;  3GTM J;  2ELH A;  3CCE I;  3FXO A;  1WWX A;  4EGY A;  4Y3O A;  4XQF A;  1FIP A;  5KNL A;  3QOD A;  2CQQ A;  5H6R A;  4XOR A;  1TZL A;  5L3E A;  1S3J A;  3CDH A;  1ZRD A;  3D5S C;  5KK1 A;  5HLT A;  2OCC H;  1R4M B;  3EUH A;  5K1Y A;  1YJ9 I;  1IV8 A;  1K79 A;  5A2Q K;  1XN7 A;  5D8K B;  1Y1V J;  1FMV A;  5L3D A;  1S9H A;  2LMD A;  3K4K A;  1J9I A;  5ICF A;  4OOI A;  3GTJ J;  2NVQ J;  3EUK L;  4UHT A;  3R6S A;  3FMR A;  1MMS A;  5GAD J;  4XMY A;  4EVI A;  3ZPL A;  3E6M A;  2BY1 A;  2BGC A;  5F1J A;  2QBY B;  2HKO A;  2XB0 X;  4XM3 A;  2MLG A;  2E60 A;  4A0X A;  4EJW A;  2QM3 A;  1N25 A;  2L7Z A;  1J0R A;  2OF7 A;  3BR0 A;  1XMA A;  2DFF A;  1PYV A;  2CMP A;  3E5Q A;  4WWC A;  2PJR A;  4GXO A;  2ZNY A;  1EA3 A;  2WB1 N;  4LGW A;  4LLN A;  1ZAO A;  2VQL A;  4GDF A;  3IH3 A;  1NTC A;  4QPO A;  3CC7 I;  4DBR A;  4A3B J;  1BC8 C;  2F5V A;  2HOE A;  1TNT A;  2OQG A;  3V42 A;  1XMK A;  3CME I;  3QWL A;  3OS2 A;  2V79 A;  2WWY A;  1E17 A;  5FRN A;  3LSI A;  2ID6 A;  3IL2 A;  3K70 C;  1Y56 A;  2RVC A;  4G8X A;  3RCO A;  1JUP A;  2FJ1 A;  1J5Y A;  4V2F A;  2KDZ A;  2X4H A;  4BE0 A;  2CQK A;  1H88 C;  4DQ2 A;  2L2O A;  1ETX A;  1T98 A;  2OJE D;  4B44 A;  3HRT A;  2VBY A;  2H8W A;  1MDM A;  5IT9 K;  1U8B A;  5CVV A;  1TWA J;  2WY7 Q;  3S1M J;  2B0L A;  1OCO H;  2OV7 A;  2L9N A;  2JA6 J;  3S32 A;  5IPA A;  1XCB A;  3R0J A;  4XSZ F;  3SQN A;  2IS1 A;  2M8G X;  1IXC A;  3QP6 A;  5H20 A;  2VC1 A;  2DDA A;  3R60 A;  2F4I A;  2HPI A;  2PEX A;  3MCZ A;  2H6B A;  1T33 A;  4RM2 A;  3C2B A;  1DPU A;  3BCB A;  2AHQ A;  3FKI J;  3EQL F;  3DEU A;  3SZP A;  3I5U A;  4BHB A;  3GTQ J;  1X1A A;  1P6R A;  3M8E A;  1KYW A;  2K9N A;  2FUG 2;  1JJ8 C;  2YX4 A;  1LE8 A;  2XAS A;  5TGT A;  4X6A J;  1X1P A;  4BQO A;  5L3G A;  2ADU A;  2CRG A;  4W97 A;  4BY1 J;  5DD8 A;  3CJQ B;  3KX2 A;  2HS5 A;  1XSV A;  1W36 C;  3HDD A;  3UNG C;  2DXI A;  4M6X A;  1RES A;  2Y0S N;  3OYI A;  4UV8 A;  2EJR A;  3FM5 A;  4AU7 A;  2ELJ A;  1U8R A;  1YRN A;  3SFI A;  1LEB A;  3HSE A;  3CCM I;  2R5Z B;  3ZQQ A;  1YI2 I;  3WTX C;  3CJR B;  3W6J B;  2EBI A;  5HLH A;  4FAS D;  4RB1 A;  3IH2 A;  4XON A;  4BJ6 C;  4RB2 C;  3W3C A;  3RDI A;  2CSO A;  3K4B A;  1TQM A;  2X48 A;  3NAR A;  4C3J J;  2COB A;  1LVA A;  2F48 A;  2DPU A;  3S2H J;  1VQ6 I;  2ZC2 A;  4RB3 C;  3PNY A;  3S3N A;  3KP6 A;  1N78 A;  3NAU A;  1G59 A;  3S2D J;  2ZB9 A;  3BZC A;  4MTE A;  4HRI A;  2VXD A;  4ENK A;  4B47 A;  2L54 A;  2G0E A;  5M5Y J;  2XPW A;  1LFP A;  3G1M A;  1D5V A;  3F8N A;  4XRM A;  1JKO C;  2LY9 A;  4Q47 A;  1BIA A;  2HOS A;  1K6O A;  1A36 A;  1IXR C;  1D1C A;  4I09 A;  5E1X A;  1ZG3 A;  4JQF A;  4IHY A;  1M1E B;  1MH3 A;  2DFH A;  2MYS A;  2VLA A;  1IN4 A;  3CF5 F;  4L18 B;  4L9N A;  2H27 A;  2JZY A;  3GEZ A;  1TBX A;  3OY9 A;  3BG3 A;  1F5T A;  1IDZ A;  4ANJ A;  5J40 A;  3ZMV A;  4PSX A;  1EH6 A;  2DN0 A;  2COM A;  4XR6 A;  2QSH X;  2YUS A;  2VJ5 A;  3D5R C;  1IXS B;  2CQN A;  1HXD A;  5TJJ A;  2M45 A;  4UNO A;  5DYM A;  2XAQ A;  3S3O A;  2V4J C;  5JI6 A;  3OYE A;  3MEX A;  1V54 H;  1L3L A;  3TDZ C;  1KU7 A;  4EAT A;  4LIT A;  2EFQ A;  4LLG F;  1FOK A;  1X3Z B;  4TV7 A;  3CCQ I;  5FD5 A;  2KMU A;  5LGU A;  3NQO A;  2ICW G;  3PFY A;  1H9T A;  2JUC A;  1Y8R B;  3SFZ A;  1O7L A;  2MH9 A;  2F6C A;  2HZT A;  3HRU A;  3V8L A;  5GAE J;  3JRG A;  4H4K C;  4UVB A;  3I59 A;  4KIT B;  5M3M J;  2LFB A;  2L5Q A;  2RV8 A;  3IRQ A;  3K6G A;  2GM4 A;  2VOO A;  3W6K B;  5EEA A;  4IL6 C;  1WJF A;  4IVN A;  3KP5 A;  5J1Y A;  2MW8 A;  1K61 A;  3HB9 A;  3A0H C;  4MO7 A;  2TDX A;  2XF6 A;  2B7E A;  3FXL A;  4AC0 A;  3HOX J;  1NK3 P;  4KN7 X;  1Y8Q B;  4IXA A;  4KIS A;  3W2W A;  5ILU A;  1QA6 A;  1UCR A;  4A3G J;  1F9N A;  3M7G A;  1BJA A;  3WTZ A;  3DTK A;  5GPC A;  5CKT A;  1FP2 A;  2L3D A;  4L5E A;  3BR6 A;  3GZ5 A;  5IT9 Z;  3EYI A;  1IV6 A;  3QPS A;  2XGE A;  3JRH A;  4D5C A;  1B1B A;  3LA7 A;  4U87 A;  3LFK A;  2XDV A;  1SAX A;  2MGQ A;  1U78 A;  4IHX A;  3PL8 A;  4R79 A;  3F8F A;  2NNN A;  5B1B H;  2CO5 A;  2FXA A;  2VOP A;  2EK5 A;  3ASN H;  4M9S A;  5F08 A;  4RS8 A;  2O8K A;  1FT9 A;  1U9N A;  1KQ9 A;  3KE2 A;  5AIP A;  4ZYG A;  1BM9 A;  3FXU A;  4FE7 A;  1IN8 A;  2M9H A;  2CUZ A;  2ETH A;  2CS3 A;  3MMY B;  3ABK H;  1RUN A;  4L9T A;  4BBS J;  3WTV C;  3GUD A;  4R8H A;  2ZFU A;  3FXJ A;  1R5H A;  2IT0 A;  2XSJ C;  1PP8 F;  2VIX A;  2G9W A;  3OSG A;  2M0M A;  3T0Y A;  5FB2 A;  1S8N A;  2MBF A;  1N75 A;  3BZK A;  3HSR A;  2V1X A;  2VKE A;  1GXQ A;  2PBI A;  2BHY A;  1LB2 A;  2C6Y A;  3L2U A;  2E2H J;  2X1E A;  3MWM A;  3M9A A;  3H9J A;  1CQT A;  2ZKZ A;  1LVK A;  3VSK A;  4YFX F;  3RPU A;  3ZN0 A;  2LF7 A;  3AAF A;  1HKT A;  5CJ9 A;  5F64 A;  3I59 B;  3ZOB A;  1DDN A;  4CDG A;  3PNV A;  4KT6 A;  4GO1 A;  3Q3S A;  1APL C;  1Q1V A;  3JAM K;  4JX4 A;  5E3M A;  5L3B A;  2H94 A;  2HVR A;  1O3S A;  2EIJ H;  2ZBK A;  1WI3 A;  3OL4 A;  2OTJ I;  1GVJ A;  2ISZ A;  1OCR H;  2LF8 A;  2NAZ A;  2KFD A;  1U2W A;  1HW1 A;  4C9Y A;  2OBP A;  4IHV A;  2P5L C;  2HFH A;  3FDY A;  1VF9 A;  2BXY A;  4FCY A;  2H1K A;  1QZY A;  1R22 A;  2DYR H;  4KIF A;  4UV9 A;  2Q1Z B;  1YFH A;  4DZJ A;  1LNW A;  2DFE A;  4O3M A;  4P55 A;  4RLQ A;  4LB6 B;  4KJZ A;  3BT9 A;  2W82 A;  3BTC A;  1SVO A;  4LK1 F;  4XRF A;  1OPC A;  2YU3 A;  2XKP A;  4JYK A;  3C2H A;  5DEQ A;  2X9D A;  1S29 A;  1ITY A;  3FWE A;  4M6V A;  2OPT A;  1E0E A;  3K2Z A;  1DUX C;  2JMW A;  3IH4 A;  3FHZ A;  3ZQ7 A;  2W1O A;  1ZRF A;  4RM3 A;  1R49 A;  2MH2 A;  2BBY A;  1Z7U A;  2XAG A;  4EM0 B;  4I02 A;  1ZK8 A;  3GME A;  3L2R A;  4BQA A;  5KAF C;  4IX7 A;  4PJ0 C;  3TP3 A;  2IA0 A;  3WTT C;  3CCV I;  3UKG A;  4B3X A;  1MW7 A;  2IGN A;  4C2M J;  1QVT A;  3GYH X;  3K2A A;  1JTX A;  1AOY A;  4JOM A;  2E1C A;  3CCR I;  2F5F A;  4J01 A;  4E7I A;  3CCU I;  2HYF A;  3V7R A;  5DD4 A;  1Z6R A;  2DOA A;  1ON2 A;  1QPM A;  3HGG A;  2W48 A;  3UR3 C;  2LY1 A;  2OC6 A;  3JTH A;  3BTI A;  2LG4 A;  1TQP A;  4KN4 X;  1T08 B;  1XGM A;  5LLQ A;  4RLF A;  3FMQ A;  2XVC A;  3ZXS A;  4P9U A;  4ESJ A;  1EJ9 A;  2FX0 A;  4M3F A;  2VI6 A;  3ABM H;  4DJA A;  4QLC U;  2HXO A;  2A6T A;  5GP9 A;  4UY8 I;  1K83 J;  3DBR B;  3ELK A;  4IRG A;  3QU3 A;  2P6S A;  4MFE A;  1AHD P;  5AON A;  2BHZ A;  1ZRC A;  4BXX J;  3ECH A;  2DI3 A;  2QVO A;  2Y2Z A;  4BNC A;  1MBF A;  1Z3Y A;  2L7K A;  2XAH A;  4XRS G;  5DDG A;  3ABL H;  1SMY F;  3OR1 C;  2ZFW A;  2Z5U A;  4CCN A;  2H6C A;  3MZH A;  2EFP A;  2L02 A;  2YS9 A;  3F21 A;  2XIG A;  5E8G A;  4A93 J;  3FXK A;  1OJL A;  1XX5 A;  3K70 D;  1TWF J;  4A12 A;  1BR1 A;  5LGN A;  1XSD A;  2XUB A;  4Y13 A;  2X1C A;  1A31 A;  1ZLK A;  1JXS A;  4DNC A;  3M8F A;  3DPT A;  5LEJ A;  4Y7N J;  3IWF A;  1GDT A;  1UAA A;  5H6Q A;  4M72 A;  2KDO A;  1MGT A;  2L9V A;  3K7A J;  2F4O B;  4AM3 A;  4B1R A;  2PMZ N;  1GHC A;  4BS9 A;  3GFM A;  2E1M B;  4A69 C;  2HYG D;  3VWB A;  2BXZ A;  2BEO A;  3RI4 A;  3E6B A;  3S8P A;  2LVS A;  4CCM A;  4CZC A;  4BDY A;  1OCT C;  3VEP A;  3LQR A;  2HDD A;  1IO2 A;  3WTW C;  3L1P A;  3LSM A;  1IF1 A;  2VKD A;  3HHH A;  1VQM I;  4KYW A;  2WY8 Q;  3GZN B;  2V6E A;  1FYK A;  2A69 F;  3F8C A;  1VND A;  4D7N A;  2PLY A;  4X1E A;  1BIB A;  1WH7 A;  2QLZ A;  3A1Y A;  3BC8 A;  4ABZ A;  1ETV A;  3P7N A;  2CWE A;  3BR2 A;  5HDK A;  4IO9 F;  1W0T A;  1UG2 A;  2L7F P;  2XAU A;  5JHF A;  3Q9V A;  2O9L A;  1FSH A;  3OIQ A;  5IOZ A;  3ZQC A;  2VBX A;  2M8E A;  4RAG A;  1P7I A;  5HLG A;  4F92 B;  3N05 A;  4ZYE A;  2HEO A;  4HBL A;  2UUZ A;  4L5J A;  3GTL J;  2DQL A;  1XS9 A;  2STW A;  2R7D A;  4QTR A;  4UB6 C;  4C30 A;  4M73 A;  4G9Y A;  3WGG A;  1LKX A;  1J75 A;  3HHG A;  2CV0 A;  3IAS 2;  2HDC A;  4D7M A;  2YSR A;  4BYY A;  5EGO B;  4FE4 A;  5ERI A;  2V1D A;  3H5A A;  1P9Q C;  1UFM A;  3GFL A;  3RKQ A;  1ZG5 A;  2GXA A;  1WCM J;  2X6X A;  2QSF X;  2KIF A;  4PGH A;  2M3A A;  3W6V A;  2EZI A;  4EV0 A;  1G3W A;  3K4C A;  3KZY A;  4GGG A;  5IT3 A;  1B6A A;  3RKY A;  3BJO A;  4FET A;  2JA7 J;  3K0L A;  1NK2 P;  3HOU J;  1A35 A;  3PM1 A;  5D5X B;  3CCS I;  4A3C J;  2IS2 A;  1OYI A;  5FLM J;  2XSD C;  2LKP A;  2QQ9 A;  2PJR B;  3A01 B;  3J7Z I;  3TL4 X;  2XF7 A;  3NRV A;  1GUU A;  3TBI A;  5E1W A;  2Y31 A;  2IBD A;  1OKR A;  5H2F C;  1ODD A;  5K7F A;  2CFX A;  2AQF A;  2KIQ A;  3SXY A;  3V4G A;  4ON0 A;  5FRM A;  2WB1 A;  3OYA A;  2HQR A;  3BR1 A;  3L7W A;  4RAZ A;  3LFU A;  5FD6 A;  4HDV A;  2DBB A;  2LKX A;  1HC8 A;  3KEQ A;  3IWZ A;  2QCO A;  3HUG A;  4C3I J;  2DMN A;  5DUI A;  1AU7 A;  1V5E A;  2Y48 A;  1FIA A;  2A6H F;  3FXM A;  4HZF A;  2QWW A;  3GXO A;  1RR8 C;  4DIQ A;  5BPD A;  2D1H A;  4DBQ A;  2QYO A;  3E7L A;  1S7O A;  4M3B A;  3L2W A;  1JHH A;  4PJJ A;  3QP5 A;  4ZYH A;  5D6E A;  4QSH A;  1TL8 A;  4C2T A;  1O7F A;  1YTY A;  1QHH D;  1PVE A;  4MGR A;  3M07 A;  1FP1 D;  5E3O A;  1BL0 A;  3IKV A;  3I71 A;  3F22 A;  1WKM A;  4HEA 2;  3E5X A;  3FBI B;  2DJI A;  4BUP A;  3CDL A;  4XLF A;  4G6D A;  3L00 A;  3S14 J;  1E3P A;  2VQH A;  3J7A O;  1IAW A;  4V19 K;  5FKK A;  3RYR A;  2L4A A;  3VYS B;  1HKS A;  2DOF A;  3ZMD A;  2DMP A;  1MZB A;  1FYM A;  2RN7 A;  2E7X A;  2STT A;  1RR7 A;  5BMZ A;  4DOZ A;  1WHU A;  3I4P A;  1ENH A;  2FOW A;  1RET A;  3DPL C;  5B66 C;  3DFG A;  1TW3 A;  3HOV J;  2M87 A;  3P5J A;  2VBW A;  2Y0M A;  1YYV A;  3B73 A;  2BVL A;  2KRH A;  4A3L J;  3RSN A;  3BPX A;  3BR3 A;  2O6G E;  2P7C B;  2PFB A;  3MQ0 A;  5F1R A;  4CO8 A;  3HPG A;  4F55 A;  1F36 A;  3JCU C;  2PMH A;  3ZQH A;  2M4G A;  3LSJ A;  1IGN A;  4P1W A;  3V8J A;  3C18 A;  2VT2 A;  3BP8 A;  3IKT A;  3U21 A;  3LL7 A;  5KHD A;  3QYB A;  3WGI A;  2V9K A;  4RB0 A;  2W25 A;  2EIN H;  2UV1 A;  4XRS A;  1TW2 A;  2V1U A;  3QU6 A;  4ZTJ A;  3DXJ F;  3S1R J;  3CF2 A;  2CGP A;  2FMY A;  2BW3 A;  1IUF A;  3JSO A;  4BKX A;  2EZH A;  3TKY A;  2XGD A;  5JLX A;  3HG9 A;  4BL0 B;  3ZQL A;  1RUO A;  2JPB A;  3I54 A;  2X85 A;  3LNQ A;  1WRJ A;  3HKZ A;  2LRD A;  2QQ8 A;  3BQZ A;  2BW3 B;  1JHF A;  2O3F A;  1ZQ3 P;  4GRI A;  4Y17 A;  3SEZ A;  3CUQ B;  2VON A;  2VBZ A;  2A07 F;  3EDP A;  3M4O J;  2X0L A;  3LA3 A;  2VPR A;  4L0Y B;  4IPA A;  3H35 A;  1HCR A;  2ZSI B;  1J09 A;  5TIS C;  3I53 A;  3KEO A;  5GTH C;  1TLH B;  2F5D A;  5E3L A;  2DW4 A;  3KP7 A;  1R7J A;  2DMU A;  3TP0 A;  2IS4 A;  5K5O A;  1HW2 A;  3HM5 A;  1EV7 A;  4Z6Y A;  2JRM A;  3NWT A;  1ZR2 A;  4OIN F;  1UHM A;  1YS6 A;  2BY3 A;  4NB5 A;  4HX4 A;  1JKR C;  3S16 J;  1ZGJ A;  2O0Y A;  2R5Y A;  3KYC B;  4OMY A;  3E6C C;  3CJT B;  2LBF A;  1O3Q A;  5CLS A;  3W2V A;  2VXZ A;  3DPU A;  4I7H A;  2F4M B;  3CP2 A;  5EYR A;  3PUB A;  4B4C A;  1WSU A;  4KA4 A;  1A6I A;  2G7H A;  4ENM A;  3H0D A;  4AVP A;  3F8B A;  1R71 A;  5E3N A;  3M1E A;  2Z1D A;  2CUF A;  2NNY A;  1SFE A; 
#chains in the Genus database with same CATH homology
 2FNP A;  2HTJ A;  2PMU A;  1XGO A;  3EYY A;  3ISP A;  5AIQ A;  1LQ1 A;  1I1S A;  5D8L B;  4KT5 C;  4GYI A;  5EEG A;  1W7P A;  4OMZ A;  2RKH A;  4HDU A;  1UHW A;  2JRT A;  2NRA C;  2MA3 A;  4HLY A;  4NHJ A;  2BE5 F;  2FF4 A;  4MTD A;  2QQA A;  5DCM A;  3E6D A;  1OMI A;  1J7K A;  3DV8 A;  3KP2 A;  1R1V A;  3PQK A;  4P96 A;  2KIM A;  5LRS A;  2L4M A;  3RIR A;  2IRF G;  4WF2 A;  3LAJ A;  2A6E F;  2RC4 A;  1SD6 A;  4LD5 A;  1KQ8 A;  1HQC A;  3QOP A;  4A6D A;  1W5S A;  1W7P D;  5EEH A;  1T39 A;  4B8X A;  1MD0 A;  1RI7 A;  1HSJ A;  3WTU C;  3JW4 A;  2YR2 A;  2EFN A;  1XB4 A;  5HDN A;  2W24 A;  1YQA A;  1EH8 A;  4K2E A;  4ENJ A;  3O6B B;  1EH7 A;  2QEN A;  1P2F A;  3TQN A;  1F4K A;  2JTV A;  4HOB A;  2DO7 A;  2K7L A;  3RTR A;  3VOE A;  4KNY A;  1IW7 F;  4UVA A;  3IRR A;  4U88 A;  1IRF A;  2E7W A;  4OIP F;  4NQW A;  1R23 A;  1BI1 A;  2ZCW A;  2OA4 A;  3J81 K;  4OIR F;  1YLF A;  3ZMT A;  3ZMZ A;  5ILS A;  3T8T A;  2HQN A;  3C7J A;  5JR3 A;  2RDP A;  1YG2 A;  4WK8 F;  1ZGA A;  4LG0 A;  1IZ1 A;  1P4A A;  4U0W A;  2LDU A;  5D5U B;  5ED4 A;  4U0Y A;  5LRR A;  1ZHF A;  1ON1 A;  1D8J A;  5ICG A;  2M5W A;  2Z9O A;  2PG4 A;  1CF7 A;  2XRO A;  5E8I A;  3ZN1 A;  2HKX A;  5L3F A;  4HYE A;  2D45 A;  2ACJ A;  1BC7 C;  1R36 A;  1O57 A;  1HBX G;  4L9J A;  3GW2 A;  1Y0U A;  4A6E A;  1P92 A;  2FBI A;  3V7C A;  5J8C A;  2FA5 A;  2P8T A;  1QBJ A;  1HW5 A;  3ZMU A;  1BBY A;  1FWZ A;  4MEY F;  2BV6 A;  5HVQ C;  2DT5 A;  2P6T A;  5K5R A;  3J80 K;  3QRF F;  2KKO A;  2OAZ A;  2XKO A;  4XBF A;  2DFI A;  2W84 A;  3GO5 A;  3V7S A;  1BOA A;  3KFW X;  5HS7 A;  3E3V A;  1RZ4 A;  1ZYR F;  4S05 A;  1IRG A;  3U2R A;  1V3F A;  1SMT A;  2M1B A;  3K1N A;  2WV0 A;  3WTY C;  5BQT A;  4A2U A;  3I64 A;  4HX7 A;  2FEZ A;  2FOK A;  4I98 B;  3H3U A;  2OZU A;  4OIQ F;  4CIC A;  3WE3 A;  2A3S A;  2K4J A;  4G6Q A;  3P9I A;  4WXD A;  2QQB A;  1DPR A;  2FBK A;  3BZ6 A;  3DQV C;  5FFX A;  3TO7 A;  1XD7 A;  2ZNZ A;  5JVT A;  4I0A A;  4AIK A;  1O3T A;  1YW9 A;  2AXL A;  4FT8 A;  3COA C;  3WTS C;  3VB2 A;  1FX7 A;  4ESF A;  5D5W B;  4BHC A;  5CYV A;  5E20 A;  4G7H F;  4EM1 A;  3TOA A;  4M71 A;  3FF5 A;  2HTS A;  1OYW A;  1B9M A;  2AS5 F;  2OQR A;  2P5V A;  1SFX A;  4WXC A;  4GYG A;  5HS9 A;  3CJN A;  1KQ0 A;  4UUV A;  4A5M A;  4U7B A;  4AD9 A;  4HLX A;  1I6X A;  2PI0 A;  2VE8 A;  3NEU A;  2G7U A;  3F3X A;  4EJO A;  4MHG A;  4QWQ A;  1XDU A;  3KET A;  3PFI A;  4UXN A;  2D1V A;  5FGM A;  1S6L A;  1XSX A;  6PAX A;  3MFK A;  1XDS A;  2GZW A;  2GA2 A;  1ULY A;  1FBS A;  2DTR A;  3GX4 X;  5LHI A;  3H3Z A;  3RPQ A;  1MJB A;  5LEK A;  1U6G A;  4IHT A;  1O3R A;  3ROU A;  3JAM Z;  2FSW A;  3SHF A;  5BS6 A;  2M30 A;  1PDN C;  1LDJ A;  2P4W A;  1K7A A;  4N9H A;  4Y15 A;  3T1B A;  2R7F A;  4WXH A;  1I1G A;  4MNU A;  5FO5 A;  4CXF A;  1U5T A;  1H0M A;  2GXG A;  3TO9 A;  4IRI A;  4PDK A;  5DUK A;  4HAM A;  1R1T A;  5LGT A;  4LB5 A;  2EFO A;  1LEA A;  3LAP A;  4M6Y A;  1RIO H;  1A04 A;  3JTG A;  1WI9 A;  1AWC A;  4M9X A;  4EQQ A;  4LMY A;  1J2X A;  5LHH A;  4HF2 A;  4AIJ A;  1W4M A;  2OZ6 A;  1P4X A;  4H0E A;  4WX9 A;  5DCF A;  2CYY A;  2Z99 A;  3CUQ A;  4PGG A;  1IUY A;  1FLI A;  2DQR A;  4P5O A;  1F1Z A;  2V6C A;  1S7A A;  2EA4 A;  3U9G A;  4RAY A;  5K5Q A;  1KU2 A;  3BY6 A;  1UST A;  2FNA A;  2F5C A;  3KP4 A;  5LHG A;  3GFI A;  1E2X A;  3MAJ A;  5FLX Z;  3KLN A;  4JK1 X;  1FNN A;  4XLN F;  3E5U A;  1LDK B;  1JE8 A;  1IN7 A;  1XGN A;  3ML6 A;  5E1Z B;  2F2E A;  1JGS A;  3R61 A;  3F72 A;  4PCQ A;  3DF8 A;  2GXB A;  3C3W A;  3QPT A;  4OIO F;  1TNS A;  1D3Y A;  4PZJ A;  1NHA A;  3ZMS A;  2ZXJ A;  3L9F A;  5CVU A;  4BHP A;  4HV5 A;  1RNL A;  4M9Z A;  2JSC A;  4ZZL A;  1ZLJ A;  2O03 A;  2EV5 A;  4P9F A;  1G3S A;  1R5G A;  2HGC A;  2XGX A;  4KMF A;  2HR3 A;  2NYX A;  3D0S A;  3F6V A;  2PN6 A;  1ZRE A;  4LG0 B;  4M74 A;  1I5Z A;  1USS A;  1T6S A;  1C0W A;  5JFR A;  1YIO A;  5ILV A;  2EFW A;  1YW8 A;  4AIH A;  3T5X A;  1BI0 A;  1Q1H A;  4IHS A;  1I27 A;  1HST A;  2ZME B;  1Z05 A;  2OU2 A;  1T0F A;  5ICC A;  2Q2E A;  3G3Z A;  2KRF A;  1T38 A;  2HWV A;  5D6F A;  1R1U A;  4YIF A;  5L3C A;  4KIB A;  4RGS A;  1U5T C;  1KU3 A;  2R3S A;  1Z6T A;  1J59 A;  1MJ9 A;  3KLO A;  1T2K A;  3N4M A;  4D0P A;  1IN6 A;  4HQM A;  5HDG A;  3GZ6 A;  2K4B A;  1G3T A;  4HF0 A;  4BXU A;  5HS8 A;  2VE9 A;  3BRO A;  2H09 A;  4FX0 A;  4EJT A;  4MQV A;  3K9T A;  1XCV A;  1CGP A;  4LK0 F;  1YS7 A;  3LWF A;  2QZ8 A;  3CUQ C;  4I01 A;  3GWZ A;  3K1M A;  4ZZD A;  3WU0 A;  2IJL A;  3TOB A;  1QNT A;  5J6X A;  2DK8 A;  2IA2 A;  2O61 A;  4EJU A;  3K69 A;  3U1D A;  4YFN F;  2J5P A;  3BJ6 A;  1PP7 U;  4ETS A;  5FLX K;  3KZZ A;  3O3K A;  3TGN A;  3P9K A;  2IA1 A;  2EB7 A;  3MZY A;  1W5T A;  2FU4 A;  2FE3 A;  1D8K A;  3HTU A;  1K78 A;  4KIC A;  3HRS A;  1TTY A;  1REP C;  3WOD F;  2E1N A;  3CO7 C;  1BN5 A;  4XLP F;  3Q9S A;  3BWG A;  4EGZ A;  3HYI A;  2Q8K A;  2EV6 A;  2PQ8 A;  3HOS A;  1MJA A;  2Z3Y A;  2F5E A;  1FBQ A;  2ZO4 A;  3LA2 A;  4ESB A;  1FPQ A;  1MKM A;  5KVR A;  3OV8 A;  5E17 F;  2DU9 A;  3HRM A;  2KIU A;  1U5T B;  2GQQ A;  1SD4 A;  3BDD A;  4N0B A;  2O8X A;  4ENN A;  2LSO A;  2W57 A;  3L09 A;  4CYD A;  4U0V A;  3ERE D;  2UXX A;  1ONV A;  4ZH4 F;  4O5V A;  4CHU A;  3E97 A;  1TQI A;  3RKX A;  2YX7 A;  1FY7 A;  1QQI A;  3D5L A;  4MEX F;  2UWM A;  3IC7 A;  3C1D A;  3VFZ A;  2FQ3 A;  2RQP A;  4IRH A;  2VOD A;  5FFZ A;  1KA8 A;  4E70 A;  4Q48 A;  4CGZ A;  2CG4 A;  2MLK A;  2EWN A;  2RGV A;  2IVM A;  3DP7 A;  2DLL A;  3CTA A;  3Q5F A;  3WG9 A;  4LFU A;  3CO6 C;  4HF1 A;  4A0Z A;  1KU9 A;  2K27 A;  2VC0 A;  3OOP A;  4O6J A;  4FHT A;  5TRD A;  4BAY A;  2P5K A;  3FXR A;  1GXP A;  3WU1 B;  4ASN A;  5DV5 A;  4HA8 A;  1Z91 A;  1ZG1 A;  5CVI A;  1V4R A;  5A2Q Z;  2BYV E;  3ULQ B;  1X3U A;  4L0Z B;  1ZH5 A;  2K86 A;  3B02 A;  1FBU A;  3WGH A;  3GF2 A;  3HSF A;  2ESH A;  3WE2 A;  3RKW A;  2OD5 A;  2YPR A;  4LLL A;  3H92 A;  4CZZ A;  4LJZ F;  4HX8 A;  2Z33 A;  1U3E M;  3REO A;  3R0A A;  3RYP A;  5D5V B;  2UXN A;  4KIG A;  2VT3 A;  1L0O C;  1KGS A;  2KJC A;  2PJP A;  2GWR A;  1IN5 A;  2K02 A;  1QZZ A;  4G7Z F;  5J8F A;  4FX4 A;  4KDP A;  4N9I A;  5LBQ A;  1FZP B;  4F7Z A;  4HQE A;  2FBH A;  1OYY A;  5F6F A;  2WTE A;  1G4D A;  2Y75 A;  3JSP A;  1B4A A;  2ZME A;  3TDU C;  1ZN2 A;  4YFK F;  2ISY A;  4RGR A;  1MDM B;  2L01 A;  2VN2 A;  3CLO A;  4AWX B;  1R58 A;  3S2W A;  3ABT A;  3G73 A;  1HKQ A;  1PUE E;  3V8K A;  2FRH A;  1STZ A;  2XHK A;  3F6O A;  5E18 F;  3T8R A;  2EA2 A;  3BJA A;  4EMS A;  3DKW A;  1LJ9 A;  4WCG A;  2MC3 A;  4OU0 A;  3QPH A;  1P4W A;  1CF7 B;  4GCV A;  3FXQ A;  4HW0 A;  2QBY A;  3ECO A;  2XAF A;  2KJB A;  2CW0 F;  2EV0 A;  4IF4 A;  4RGX A;  3HTS B;  2Q0O A;  1Z1D A;  3GVA A;  1B59 A;  5JHU A;  3FM3 A;  1YW7 A;  2XAJ A;  3GFJ A;  4Z2Y A;  4S04 A;  4BH9 A;  3IHU A;  4MQ9 F;  3LQQ A;  5D4R A;  5CVR A;  3FX3 A;  1BI3 A;  1FSE A;  1ZAR A;  3QAH A;  2MD5 A;  2A5Y B;  4A0Y A;  3TO6 A;  1FYL A;  2W85 A;  4YG2 F;  2GA1 A;  4L9V A;  4XSX F;  1R00 A;  2WC2 A;  3GLX A;  3CUO A;  5BPI A;  1SD5 A;  3F23 A;  1YO5 C;  1VTN C;  4G94 A;  2IP2 A;  4YII A;  1UB9 A;  2QUF A;  3I58 A;  2DAO A;  1W7P B;  1OR7 A;  1SD7 A;  1FC3 A;  3F8M A;  5HOO A;  4JBA A;  1DP7 P;  3KCC A;  3J81 Z;  4EM2 A;  1H9G A;  3EET A;  3O2P E;  4IJA A;  2DK5 A;  1BI2 A;  1QO0 D;  1B9N A;  3BPV A;  3BOQ A;  4KMU X;  3P9C A;  4R1H A;  2UZK A;  1QGP A;  3PQJ A;  2DPD A;  4G7O F;  3ZP5 A;  4HV6 A;  2JPC A;  2P7V B;  5D4S A;  4B09 A;  4UVC A;  3N97 A;  2D2W A;  2RNJ A;  1WQ2 A;  1SFU A;  2GIV A;  2IPQ X;  2LNB A;  2NS0 A;  4KUM A;  4ZYD A;  1LDD A;  2IW5 A;  3I0T A;  3VOD A;  2ZJ2 A;  4EJV A;  3FMS A;  2XV4 S;  4A5N A;  3KP3 A;  5ICE A;  4L5I A;  3ABU A;  3HIF A;  4I2O A;  1K78 B;  5HLI A;  4RGU A;  2XRN A;  2A61 A;  3L2C A;  5BOX A;  3K1P A;  1G6N A;  3SZT A;  2GAU A;  1Z9C A;  4KFC A;  3R4K A;  5CVJ A;  3J80 Z;  1G3Y A;  5DCM B;  3LST A;  4Q5S F;  2J5O A;  2V9V A;  3HOT A;  4Q4Z F;  1KYZ A;  3FZV A;  2ESN A;  2JT1 A;  4I0B A;  3RJP A;  2FML A;  2A68 F;  1XGS A;  4U7D A;  2ELH A;  1WWX A;  4EGY A;  5H6R A;  1ZRD A;  5L3E A;  1S3J A;  3CDH A;  5KK1 A;  3EUH A;  5K1Y A;  1K79 A;  5A2Q K;  1XN7 A;  5D8K B;  5L3D A;  1J9I A;  5ICF A;  4OOI A;  4UHT A;  3R6S A;  3FMR A;  4EVI A;  3ZPL A;  3E6M A;  2QBY B;  2BGC A;  2HKO A;  2MLG A;  4EJW A;  4A0X A;  2QM3 A;  1J0R A;  1XMA A;  3E5Q A;  4WWC A;  4GXO A;  2ZNY A;  4LGW A;  4LLN A;  1ZAO A;  1BC8 C;  2HOE A;  1TNT A;  2OQG A;  1XMK A;  2V79 A;  2WWY A;  1E17 A;  3IL2 A;  2RVC A;  4G8X A;  1J5Y A;  2X4H A;  2CQK A;  4DQ2 A;  1T98 A;  3HRT A;  2VBY A;  1MDM A;  5IT9 K;  5CVV A;  2B0L A;  1XCB A;  3R0J A;  4XSZ F;  3SQN A;  1IXC A;  3QP6 A;  5H20 A;  2VC1 A;  3R60 A;  2PEX A;  3MCZ A;  2H6B A;  1DPU A;  3EQL F;  3DEU A;  3SZP A;  3I5U A;  4BHB A;  1P6R A;  3M8E A;  1KYW A;  2YX4 A;  2XAS A;  5L3G A;  2ADU A;  5DD8 A;  2HS5 A;  1XSV A;  4M6X A;  4UV8 A;  2EJR A;  3FM5 A;  1U8R A;  1LEB A;  3HSE A;  3WTX C;  3W6J B;  5HLH A;  4RB1 A;  4RB2 C;  3RDI A;  2CSO A;  1TQM A;  1LVA A;  2DPU A;  4RB3 C;  3KP6 A;  4MTE A;  4ENK A;  2L54 A;  1D5V A;  3F8N A;  4Q47 A;  1BIA A;  1K6O A;  1IXR C;  4I09 A;  5E1X A;  1ZG3 A;  4JQF A;  4L18 B;  1IN4 A;  4L9N A;  2H27 A;  2JZY A;  3GEZ A;  1TBX A;  1F5T A;  3ZMV A;  1EH6 A;  2COM A;  1IXS B;  1HXD A;  5TJJ A;  2M45 A;  4UNO A;  5DYM A;  2XAQ A;  5JI6 A;  3MEX A;  1L3L A;  3TDZ C;  1KU7 A;  2EFQ A;  4LLG F;  1FOK A;  4TV7 A;  5FD5 A;  5LGU A;  3NQO A;  1H9T A;  3SFZ A;  1O7L A;  2MH9 A;  2HZT A;  3HRU A;  3V8L A;  4UVB A;  3I59 A;  2RV8 A;  3IRQ A;  2VOO A;  3W6K B;  4IVN A;  3KP5 A;  2TDX A;  4KN7 X;  4IXA A;  5ILU A;  1UCR A;  1F9N A;  3M7G A;  1BJA A;  3WTZ A;  1FP2 A;  2L3D A;  3GZ5 A;  5IT9 Z;  3EYI A;  1B1B A;  3LA7 A;  3LFK A;  1SAX A;  1U78 A;  4R79 A;  3F8F A;  2NNN A;  2CO5 A;  2FXA A;  2VOP A;  2EK5 A;  4M9S A;  4RS8 A;  1FT9 A;  1KQ9 A;  3KE2 A;  5AIP A;  4ZYG A;  1BM9 A;  3FXU A;  1IN8 A;  2ETH A;  1RUN A;  4L9T A;  3WTV C;  3GUD A;  4R8H A;  1R5H A;  2IT0 A;  1PP8 F;  2G9W A;  3T0Y A;  5FB2 A;  1S8N A;  2MBF A;  3HSR A;  2V1X A;  1GXQ A;  2PBI A;  1LB2 A;  2C6Y A;  3MWM A;  3M9A A;  2ZKZ A;  4YFX F;  3RPU A;  3ZN0 A;  2LF7 A;  3AAF A;  1HKT A;  5CJ9 A;  5F64 A;  3I59 B;  1DDN A;  4CDG A;  4GO1 A;  3JAM K;  5L3B A;  2H94 A;  1O3S A;  2ZBK A;  1GVJ A;  2ISZ A;  2LF8 A;  2NAZ A;  1U2W A;  1HW1 A;  2OBP A;  2P5L C;  2HFH A;  1QZY A;  1R22 A;  4KIF A;  4UV9 A;  1YFH A;  1LNW A;  4O3M A;  4P55 A;  4LB6 B;  4LK1 F;  4XRF A;  1OPC A;  2YU3 A;  2XKP A;  5DEQ A;  1S29 A;  3FWE A;  3K2Z A;  1DUX C;  3FHZ A;  3ZQ7 A;  1ZRF A;  2MH2 A;  2BBY A;  1Z7U A;  2XAG A;  4EM0 B;  4I02 A;  4BQA A;  2IA0 A;  3WTT C;  3GYH X;  1AOY A;  2E1C A;  2F5F A;  2HYF A;  3V7R A;  5DD4 A;  1Z6R A;  1ON2 A;  1QPM A;  3JTH A;  1TQP A;  4KN4 X;  1XGM A;  5LLQ A;  3FMQ A;  2XVC A;  4P9U A;  4ESJ A;  4QLC U;  3ELK A;  4IRG A;  3QU3 A;  2P6S A;  5AON A;  1ZRC A;  3ECH A;  2DI3 A;  2QVO A;  4BNC A;  2XAH A;  5DDG A;  1SMY F;  2ZFW A;  2Z5U A;  2H6C A;  3MZH A;  2EFP A;  2L02 A;  3F21 A;  2XIG A;  5E8G A;  4A12 A;  5LGN A;  1XSD A;  2XUB A;  4Y13 A;  1JXS A;  1ZLK A;  4DNC A;  3M8F A;  3DPT A;  5LEJ A;  3IWF A;  5H6Q A;  4M72 A;  1MGT A;  1GHC A;  3GFM A;  2HYG D;  2BEO A;  3RI4 A;  3E6B A;  3VEP A;  3LQR A;  3WTW C;  1IF1 A;  3HHH A;  4KYW A;  1FYK A;  2A69 F;  3F8C A;  2PLY A;  1BIB A;  2QLZ A;  5HDK A;  3P7N A;  2CWE A;  3Q9V A;  1FSH A;  2VBX A;  2M8E A;  5HLG A;  2HEO A;  4ZYE A;  4HBL A;  4L5J A;  2DQL A;  2STW A;  2R7D A;  4M73 A;  4G9Y A;  3WGG A;  1J75 A;  3HHG A;  2HDC A;  2YSR A;  4BYY A;  5ERI A;  2V1D A;  3GFL A;  1UFM A;  1ZG5 A;  2KIF A;  4PGH A;  4EV0 A;  1G3W A;  3KZY A;  4GGG A;  5IT3 A;  1B6A A;  3RKY A;  3BJO A;  3K0L A;  5D5X B;  1OYI A;  2LKP A;  2QQ9 A;  3NRV A;  5E1W A;  1OKR A;  1ODD A;  2CFX A;  3SXY A;  3V4G A;  4ON0 A;  2HQR A;  3L7W A;  4RAZ A;  5FD6 A;  4HDV A;  2DBB A;  3KEQ A;  3IWZ A;  3HUG A;  5DUI A;  2Y48 A;  2A6H F;  4HZF A;  2QWW A;  3GXO A;  5BPD A;  2D1H A;  2QYO A;  1S7O A;  1JHH A;  3QP5 A;  4ZYH A;  5D6E A;  1O7F A;  1YTY A;  4MGR A;  1FP1 D;  3IKV A;  3I71 A;  3F22 A;  1WKM A;  3E5X A;  4G6D A;  3L00 A;  3J7A O;  1IAW A;  3RYR A;  2L4A A;  1HKS A;  3ZMD A;  1MZB A;  1FYM A;  2RN7 A;  2E7X A;  2STT A;  5BMZ A;  3I4P A;  3DPL C;  3DFG A;  1TW3 A;  2M87 A;  2VBW A;  2Y0M A;  1YYV A;  3B73 A;  3BPX A;  2O6G E;  2P7C B;  2PFB A;  3MQ0 A;  5F1R A;  4CO8 A;  2PMH A;  3V8J A;  3C18 A;  2VT2 A;  3BP8 A;  3IKT A;  3WGI A;  4RB0 A;  2W25 A;  1TW2 A;  2V1U A;  3QU6 A;  3DXJ F;  2CGP A;  2FMY A;  3JSO A;  3TKY A;  1RUO A;  2JPB A;  3I54 A;  1WRJ A;  1JHF A;  2O3F A;  4Y17 A;  3CUQ B;  2VON A;  2VBZ A;  2A07 F;  3EDP A;  2X0L A;  3LA3 A;  4L0Y B;  4IPA A;  3I53 A;  3KEO A;  1TLH B;  2F5D A;  2DW4 A;  3KP7 A;  1R7J A;  5K5O A;  1HW2 A;  1EV7 A;  4OIN F;  1UHM A;  1YS6 A;  4NB5 A;  4HX4 A;  1ZGJ A;  2O0Y A;  4OMY A;  3E6C C;  1O3Q A;  5CLS A;  2VXZ A;  4I7H A;  1WSU A;  4KA4 A;  2G7H A;  4ENM A;  4AVP A;  3F8B A;  3M1E A;  2NNY A;  1SFE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...