3JAML

Cryoem structure of 40s-eif1a-eif1 complex from yeast
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
155
structure length
155
Chain Sequence
STELTVQSERAFQKQPHIFTNPKAKANRKTKRWYKNVGLGFKTPKTAIEGSYIDKKCPFTGLVSIRGKILTGTVVSTRMHRTIVIRRDYLHYVPKYNRYEKRHKNVPAHVSPAFRVQVGDIVTVGQCRPISKTVRFNVLKVASATGKANKQFAKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 18S rRNA
publication title Conformational Differences between Open and Closed States of the Eukaryotic Translation Initiation Complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Translation
total genus 20
structure length 155
sequence length 155
ec nomenclature
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00366 Ribosomal_S17 Ribosomal protein S17
L PF16205 Ribosomal_S17_N Ribosomal_S17 N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.1000 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3jamL00
3JAML 5IT9L 3J81L 3J7AV 5LL6X 5FLXL 5A2QL 3J80L
chains in the Genus database with same CATH superfamily
1JWSD 4X65L 2B8FA 2JA5H 4EGVA 3J7AV 3QWNA 2JP1A 2XNAC 4GKKQ 3BS1A 4XIGS 4OELB 3C46A 3NQIA 5JEAH 1A2UA 4X6AH 1VF7A 2F0HA 1B7YB 1A3TA 1PLFA 4BBSG 3VR6A 3BU2A 3CD6A 4I65A 2A69D 4KV6A 2I5HA 2PCFB 2B2YA 3JAMc 4DUYL 4C3IG 2JJQA 2HIVA 1RL2A 4C3HH 3SK5A 4LF4Q 2Z4HA 4JI4L 2N3SA 3S2DB 2Q8TA 2ES2A 2R7ZB 1X6OA 1HUNA 1STEA 1B44D 2QDLA 4TSSA 3C2PA 2KHSA 2E5LQ 3M3YH 1VQPA 5DLQE 3GTPB 1HNWQ 2D62A 4L5TA 2KCNA 1PRTD 1VQ9A 3O13A 4B3TL 4A3LG 2R93B 2L11A 2RDGA 5M5YH 2AQ1B 1LT3D 2VY3A 3KLSX 3H09A 4UDUC 2F0JA 4RKLA 2M9VA 3M4OB 3K5OA 1STNA 1LTTD 1NBWA 2NVQB 3TP7A 4RG1A 4NB3A 1LTAD 2PQAB 4Y7NH 2I07B 1SYDA 2F0GA 3FMCA 3NENA 1EYCA 2AWOA 2QGQA 3BDCA 1STBA 3T1YQ 3HOWG 5IWAL 4NKLA 4OGQC 1LT4D 2HIXA 1WD0A 3EIVA 1YNJC 4BWGB 1J5EQ 2J0TD 1AH9A 1WTWA 4XYOA 4KKTA 4DNIA 1CSPA 5EPJA 2JA5G 3MFYA 2F3VA 1PTOD 2UU9Q 2PO4A 1D6EC 1C8CA 1XMOL 2VB2X 1JOOA 1HHVA 5JEAG 3A56A 4H44C 4PMCA 3BZCA 2HHHL 3PUYA 3RZOH 3AMUA 1ASZA 5K5PA 1CT1D 1Z7TA 2VNUD 4A3BH 2ZTCA 1JWUD 4LAAA 4B3MQ 2QILA 4CDFC 4ZKBB 4ZYSA 1D8LA 1R4QB 1SMYD 3S14B 3E9IA 3HP3A 1ZYRC 3GTOH 2NVXB 2QCPX 4DK0A 2PMZB 2F3WA 2RF4A 2A68C 2DJFC 3FKIB 3QG1A 3HZXA 4BY1B 4IPCA 3S1MB 4ZQ3A 4XDXA 3OTOQ 5EKIA 2BA1A 3VA5A 4A3EB 2MO1A 5I2XA 4X3UA 1YNNC 3GTMH 5KRUA 3T51B 2JK8A 4YWLA 5IT9c 4C56C 2B2VA 3KOJA 5KEEA 2F0OA 1GUNA 2OEOA 1STGA 1VQJA 1MBYA 2QEXA 4GOPA 2EIFA 2IX3A 1CFMA 4LF8Q 4BBSB 2Z0SA 4JI5Q 3A7LA 1NR4A 4OO1H 4WJWA 3CCVA 1DONA 1OXTA 4C3IB 1I94L 5JPNC 4YHHL 4ZK9B 1HH2P 3OHXC 3HOYB 1U9RA 2HT1A 4IFDG 1HTLD 4OX9Q 2K33A 3CC2A 5JOBA 3HKSA 3TREA 4JPBW 1IW7D 4CJ1B 2RKSA 1HJPA 1TWAH 1H9KA 4A3BG 1MJCA 1V1PA 1CKOA 2MUYA 2G9HD 1EY0A 3UE1A 3JC66 1S5CD 4DU9A 5CC4A 2F0UA 3TEHB 4LK1C 5HY6A 2UUBL 1EWIA 2VQEL 4KKSA 5I6WA 1P16A 1CI3M 1PH3A 2A8VA 1IBLQ 1PZJD 1GOZA 1I6HB 3UDIA 3GTQB 3EJIA 2FHTA 4X3KA 3CQZB 2GVAA 1NCVA 3KDFB 1D5ZC 1PMRA 2NZ1D 3GTJB 1SNOA 3HOWB 3A5ZB 4KHPQ 4AQYL 5A2QL 1V43A 2D9UA 5EBDA 2EYJA 3MC0B 4M8AA 5C44G 1R9TH 4GLVB 5FKAC 1ILPA 1XMQL 4JV5L 2E2JH 4ID6A 4KHZA 2LXJA 4JCVE 5AJ3Q 1CQVA 4LF7L 3V2TA 4LF9L 1GUSA 2IW3A 3U4VA 3PIOA 1U4MA 2KCCA 2Q8IB 4J15A 4K5VA 1OXVA 3U58A 3AYHB 4UP7A 4V190 1QB5D 1G2TA 3KUPA 3J80L 4OO1G 2WP8J 3S1RH 4RH6A 1LT5D 3GTLH 1SYCA 1B2TA 5ISRA 5KYIA 4FF2A 2JYOA 2JA8B 3TZUA 1KD1C 3S2HH 4LF4L 1B50A 2NVTB 4DV2L 5FLXL 2VZAA 4HIOA 2F0PA 5M5XB 3I7FA 1YVCA 1LTBD 4FVMA 4IPGA 2F4IA 3W2DA 3TP8A 2E5LL 2O5JC 3NWSA 4JI2Q 2AUKA 1HZCA 4WFN3 1S5DD 4C2MB 4RA8A 2MGSA 2CQOA 3MWYW 1IBMQ 5JJIA 5IY0A 1D2BA 2F0SA 4XQJA 3A7AB 1AE2A 4Y7NB 1VMPA 3IKJA 5E4WC 2NZOA 2WIIB 1VQDA 3I73A 1VQ5A 2N49A 3AFQA 2RCFA 2V4DA 5LMNQ 2YU9H 4IOAA 4O0AA 4DR2Q 3S1QB 3GV6A 3V05A 2KUMA 3DUZA 3A55A 1S5FD 1VQHA 2K01A 1PH8A 2Z1CA 3T1YL 3GTGH 1K9MC 2PYKA 2H4OA 3G4SA 4GNXB 2K5WA 2OQKA 2Q2HA 1Q8KA 3Q22A 1SXTA 3S17B 1J5EL 3FRPB 1IZ6A 3HOXG 5JVG3 2UU9L 1ZKOA 4IUPA 1KL9A 1TWHB 3RR5A 1EOVA 2UUCL 5LL6X 4CDCC 2PI2E 3D31A 4NXMQ 1D7QA 4NP5A 3FP9A 2NZHA 4ILWA 1RHPA 3KF6B 4IJHA 2K75A 3VYUA 1TWCH 1QUQB 1BVSA 2QF7A 1V8QA 2I5LX 3TP6A 1RODA 4GS3A 1SRUA 3WOEA 2DJGC 1WTOA 4APVA 3PUZA 2GA4B 1L2FA 3F2DA 3ND9A 3CC7A 4FXKC 2WAQG 2WB1E 1PFNA 5CMDA 3RNUA 4A3JB 5C44B 3CCLA 4IZ8A 1PRTB 3FEWX 1YI2A 1IYUA 1YZ6A 1JOKA 3C1FA 1WFQA 4PZ8A 1D5MC 3C1EA 1CZWA 1JJGA 2F0KA 1F2LA 3UI2A 4PZ7A 1TXYA 1EL0A 1Q3LA 2O2LD 4A75A 2YYZA 1XPRA 2NVYB 5M5WB 3J7A5 1YEZA 3BG3A 4WRDA 1AZPA 1Y8PB 3S2DH 4LF8L 2R7ZH 3AFPA 1TWFH 1IBKQ 1I4PA 5GAEC 3OW2A 2B63G 5CV9A 2VL6A 5M3MB 4O42A 4RCNA 2CW0D 5BN3A 2JQOA 2R93H 4OIKA 1KRTA 1FNUA 3ULJA 5IGDA 4QB4A 1PTOB 1S72A 1TU2B 1F77A 2DY7A 2XSCA 4OX9L 1KLGD 3M4OH 4KN7C 5LL6S 5CORA 4K2LA 3Q0AA 4P73A 5FOBB 2XWBB 2NVQH 2UUAL 2F4VQ 3PSIA 4M1UB 1MSHA 4XQQA 5KNBA 2BOSA 4JI1L 1CQFA 1HR0Q 2KBNA 1YITA 2SNSA 1O7IA 3GD7A 4DUZQ 1X32A 4DPGA 5ELFA 1H95A 5C4JB 1A62A 1CKMA 4QQBX 2PNHA 3I3CA 1U4PA 1ZEQX 1B8AA 2QDBA 4Q0FA 2E2IB 2B2UC 3GP7A 5J22A 5IYCH 1OO9B 3E9HA 4DN4M 2JA9A 4B9XA 2YV5A 3ULPA 2FXQA 2SNMA 4LW1A 4GKJL 4DGZA 2ENBA 2E2JB 5ELNA 1WTXA 4LFBQ 2I46A 1FD7D 1EYGA 3HOXB 1SN8A 3CF5A 2Z9HA 5G3LF 4HJ9A 1SEBD 3KBXA 5IT9L 3TSSA 1N34Q 1ESRA 2X69A 1I4RA 2RHSB 1X3EA 5ELEA 3I4MH 4ME3A 3S14H 2NVXH 1PH7A 4DV4L 3F8TA 3GTLB 2UXBL 4JI6Q 2R7ZG 3FKIH 2Q2UA 3S1MH 3NK9A 3KFUA 1F9SA 4A3EH 4FF3A 1LTSD 4AYBG 3S2HB 2PPBC 3H91A 1C9OA 3NWTA 1LYLA 2F03A 2R93G 1X3FA 2R6GA 2RDHA 1XNQQ 1U0LA 1L0WA 2JA7G 1DZ1A 4MHEA 2WAQB 2KQ3A 1E24A 1BXTA 1Q1BA 2PNRC 3W5OA 1SJED 5C5MA 3NTHA 1ICWA 5FO9B 1CK1A 4HMJA 1M90C 4JBKA 5LMUQ 2JSOA 4R4TA 2AQ3B 4NMZA 3E3XA 2B39A 5JEAJ 1EIGA 3LWUA 1TS2A 4OXPA 4QGUA 3QJYA 2MNAA 2K50A 1IBML 1QE6A 1WVLA 3J80i 1OXUA 1T5EA 1CA6A 4HAEA 4ZCKA 3M4YA 3HOYH 1YJNA 2Q2IA 1SYBA 4MN3A 5IYCG 4KJNA 2KECA 4JI8Q 5JPMC 2I0QA 4U673 3I4NB 4HIKA 2B63B 4A93B 1F9RA 1UEBA 2B2TC 2WKDA 2A19A 4DR2L 3T1HQ 4GNXC 2KENA 5IGCA 2DNEA 4QIWB 4PQXA 3RLFA 1E1OA 4DK3C 1A3UA 1KNEA 2F0WA 3BVGA 2BE5D 1LTLA 4JW0A 1JWMD 3CAMA 5CGKA 4XTCS 4QUFA 1IKLA 2EQSA 2UXCQ 1K83B 2P5ZX 3Q24A 2OXPA 3VR3A 2RHQB 4HCSA 1FJGQ 1X3QA 4JI0L 3I4MG 1BBWA 1EY7A 3RN2A 1Q12A 3UDGA 4DR4Q 2VS1A 1GHJA 3FKIG 3GTQH 4JYAL 1TWCB 3KLRA 2ICEC 3CQZH 4FDBA 3F2CA 1FVIA 2A69C 3J81E 1K28A 1RIPA 3MEHA 1SYEA 4LUVA 4R4QA 4RGTA 4YIJA 3KYHC 5D3DA 1X55A 1D5XC 1NAPA 2EY6A 5COYA 2B2UA 1JCKB 1HNZQ 3R3OA 2M2LA 4J8QA 4IUUA 3CMEA 4UY8C 3KDFA 4A4IA 1VQCA 1C48A 3SXHA 5GQOA 2EYLA 2JN4A 1YJWA 3NUCA 2YTYA 3G6JB 1NE3A 1PRTC 3H0GB 1QILA 4UAIA 3QB3A 1K8MA 1EFWA 3KF8B 1J9OA 3CU7A 1XPUA 1EWHA 2FMMA 2A6ED 1J8IA 4R9WA 4DV7Q 1PH6A 1J6QA 2OTLA 2AMCB 4RHSA 3MXNA 3HOYG 2JA8H 2NBFA 1TWFB 4X66Q 1EOTA 2OWOA 2NVTH 1SNCA 1N33L 1VQ8A 5M5XH 4KJOA 5EBCA 3JAMi 1IBKL 4KK7A 4DR3L 4AYBB 2QEJC 5GAHC 1BR9A 5E7NA 2E2DC 4BXXH 2A6HD 2JA7B 5EPLA 4B3RL 1PTOC 3IFTA 1EIYB 4C2MH 2K1BA 2PW7A 5C5LA 4TVAB 1FYCA 5I6YA 2LKVA 1KAAA 4JI7Q 1QOHA 1CZGA 2EY5A 5JJKA 2R7FA 1WYDA 1UE7A 3ZJYC 2F4VL 3EA6A 3ICEA 4FXGC 1HR0L 1SMYC 3HFZB 2B2WC 3LWEA 2UXDL 3S1QH 4LF6Q 1TS5A 1T5XD 4UP8A 2I5MX 3I4LA 5CYUA 4A3KG 4P2CB 1GHKA 2BCOA 2EY2A 4KHVA 4L6TB 3NHHA 4P72A 2D2CC 1PZID 5EPKA 4IFDH 2ASBA 3A8JE 1G51A 3S17H 5G3LD 2BDNA 3CW2C 3P7JA 1HPCA 4OWWB 2EXZA 2MFIA 1A6XA 1ENFA 4N8X1 1PH1A 2B2TA 4IUQA 5E1FA 1TWHH 1NR2A 1TIID 4GNXA 1YNXA 4LUZA 4QCLA 1DM0B 3NSWA 1II3A 1OTCA 2CWPA 3J81c 1PXUA 4X3TA 1JJCB 2HUGA 4DV3L 3CCMA 3CPFA 3FPPA 2F0EA 3NEMA 1SR3A 3I4MB 4GN4B 5C0XG 1P8LA 4DNRB 3RN5A 1HFNA 4DK1A 2M00A 2JA8G 3L2PA 3OSOA 1WCMG 3D4DA 4H7BA 1R4PB 2EYPA 5JAVA 4PV1C 1I4XA 3CPWA 3SVMA 1QUQA 4DR6Q 4JK1C 4A3JH 1GVPA 4BXXG 5C44H 4B3SQ 1N32L 4AH6A 3D6CA 3E5SA 3I91A 4YWKA 2KEEA 3G6EA 2EYFA 3T16A 3PIO3 4TRDA 3P20A 1BCPF 1HZBA 4BBRG 3J81j 2WKCA 1IW7C 1I50H 1DOKA 4JI3Q 1HTPA 5C4XB 1JORA 3K5NA 1QZHA 2YTXA 2NVYH 4U68A 5M5WH 1SDFA 2EJMA 2GN5A 2VQFQ 4LWCA 1ET9A 1CUKA 3FDTA 4XT3B 3A8KE 4JOIC 1MHWC 1U4RA 5M3MH 5FLMH 2RCNA 2ICIA 4NW2A 1M1KC 1Q82C 2FJ2A 1W6JA 1NSNS 2A73B 3URYA 2EDGA 1PTOH 1UE6A 1NTGA 3L9AX 5H1SE 2IHFA 1EQTA 4HCEA 5HGQA 3DWPA 3IRBA 1TT2A 4LMQD 4CKBA 3HOVG 2XWJB 2B8GA 4YCWA 3H94A 1I6VC 2CHBD 2E75C 5D14A 1UUPA 1EY5A 5E4XA 1PYSB 1VQAA 1EIHA 3K80C 2A1AA 3EN2A 4R8IA 5C4JH 2SOBA 1SE8A 1XXGA 1Q46A 4IUVA 3H6MA 5J1ZA 1DD2A 1YHQA 2E2IH 2C35B 2RSNA 4DR4L 1ESFA 1VQFA 2E2HB 1S5ED 2AQ2B 4K14A 4HSVA 4K8JA 1ENCA 2B2WA 4L8JA 4ZAIA 4A3JG 4A3KB 2ZXPA 2F0IA 3RUZA 5IODA 3HS0C 2K28A 2PZWA 2VB3X 3EQLC 5FK9C 3K5MA 3EVQA 4ZUIA 1H9MA 1Y8OB 4KKUA 2Z6KC 4RCOA 3HOXH 2HD3A 1HNZL 4DR5Q 1G2SA 2K7VA 4GKKL 3KLSA 1PHJA 3CCJA 1VQ4A 4F88A 4HEDA 2F52A 4L5QA 4IN3A 2ZJQA 4DR1Q 2WFWA 4X62Q 5M3MG 5FLMG 4FYDA 3U4ZA 1HRJA 2CVRA 2EJFC 4DV7L 3OIQA 4QL5A 4DNTB 1WCMB 2OF1A 4DR7Q 3DM1A 4XT1B 3D0FA 4LF5Q 1EY8A 1FL0A 4DAVA 1TS4A 2F0VA 3NBHB 2VXWA 4X66L 2Y0SB 5J39A 2DUDA 2OTJA 1JMCA 1SE4A 5EKLA 2DNCA 1GO3E 1HNWL 3TP5A 2X6GA 1FNVA 4DV5Q 4DV6Q 4BBRB 1UE5A 1Z9FA 4LFAQ 3NXWA 1LUZA 2F0LA 1IL2A 2R3ZA 1H9SB 1SNDA 4KI0A 1NNXA 3MFGA 1HA5A 1LM0A 4K5WA 1BUVT 4JI7L 1QG7A 4HJAA 2SEBD 5GAGC 3GTKB 1UAPA 2QA4A 1WOCA 1PDQA 3I4NH 2ZJPA 2B63H 4JOIA 1IHZA 4A93H 1HFGA 1LACA 4LF6L 3HOUB 3UDFA 3G71A 1G6ZA 4DV0Q 2PW5A 1BOSA 2WV6D 4F87A 3UDXA 4K0KQ 2N78A 1A63A 2ZTDA 3FHWA 4CGYB 2LS01 1K83H 3HOVB 3NP8A 1EQVA 2XRQD 5DNFA 3DHQA 2HCIA 1IL8A 2EJGC 2JA6B 2QKIC 3I90A 3PIPA 5DEHA 4B3ML 1CSQA 4XQNA 4IPDA 3S16B 4A3CH 1VQEA 5E3FA 2NN6H 1I4QA 2KCMA 1GUWA 2L0CA 1E3PA 3JAML 4A3GB 3QR8A 5T1IA 3SK6A 1UE1A 1BCPD 1Q90A 4GZYC 4C3JG 1SROA 2H1EA 2AUJD 2BDOA 3OTOL 4F7XA 4NXNQ 4DR6L 3BZKA 4ZUJA 2CW0C 3HEJA 1KHIA 3H0GH 3Q23A 1STAA 1VCIA 4X65Q 2KA7A 1BQQT 3E0EA 4V0BA 1I50B 2Z6KA 2IX1A 2WINB 3ND8A 3MXGA 5A2QE 1O7ZA 5LHY1 3M7NA 1SJHD 3MXPA 4DKAC 1MKHA 1NUCA 5IGEA 1EY9A 2K5QA 4QF4A 1AFPA 4IURA 4HSPA 4RHRA 2K4KA 1RTOA 5C3XA 2MJ8A 1TVXA 5ELBA 3KF8A 4P74A 4YY3Q 5KIXA 3GO5A 1F9PA 3I4NG 2XIWA 1DOMA 4G7HC 4JI5L 1Y8NB 3STBC 4ZLTF 3F2UA 4A93G 4EQOA 2VQFL 3OOCA 1GM5A 1JT8A 2Z8LA 4R4CA 2PQEA 1E2VA 1SLJA 1TWGB 3U9OA 2JA7H 4S3SA 1Z47A 3J7ZC 1VQLA 2HDMA 3GQBA 1SNMA 4B3TQ 3MTSA 1QVGA 1ONLA 5IP7G 3RMHA 2EZVA 1VMCA 3DM3A 3E0JA 5FLXE 4PG3A 4A3CG 1PV4A 1I3QH 3PF4A 3U9SA 1L1OB 5ELDA 3STBD 4HIDA 2NN6G 3CCRA 3D3RA 2N88A 4YWMA 1CM9A 3CMAA 1KQSA 1PH2A 1DJRD 1ENAA 2PQAA 1W3SA 4MTKA 2CH4A 2XGTA 4N9TA 3HOZG 1IBLL 1RTNA 1XTDA 2NWGA 1IXRA 3A8IE 1ML0D 1PH5A 4KLKA 1JR0D 1LT6D 1F2ZA 2DY8A 1JJ2A 3H3VC 5IWAQ 1V1QA 4L5SA 2F1MA 4KHPL 2PMZE 2Z6BA 3TRZA 3X3NA 3H0GG 1G8ZD 1B4OA 1STHA 2EPBA 3WWVA 1U5KA 2WACA 5FO7B 3HKZE 5AJ3L 3R2IA 2OCEA 4JC0A 2KHJA 2E76C 4PMBA 2E74C 3QIAA 2LSSA 3NE5B 3CC4A 3WOFA 4L63B 4IFDI 5C6AA 1ET6A 3HGBA 4ZKCB 5IYBH 3H15A 5C3EB 2MP1A 5DAUA 1UWVA 4GLXA 2AHOB 1E2ZA 4KD3A 1Q86C 4P71A 5D65A 2VW9A 4JG2A 1EIFA 3P1HA 2B2YC 4X62L 2WB1G 4CDDC 3I8ZA 1M8AA 2KCTA 1PFSA 4C3JB 3CCSA 3IAYA 1SNPA 2YTVA 3L0OA 1GXDC 2NTSA 3CCUA 3SR1A 1L0YB 3OWEB 5C4XH 2CQAA 2RVLA 2A74C 4BY7H 2CKZB 4J6HA 4LJZC 1G91A 4JI2L 5CBAE 2BE5C 3CP0A 3WDNA 3N6RA 1B3AA 1A8VA 1AN8A 1VQGA 3I72A 4DV5L 3A74A 4DV6L 3BVZA 3K0YA 4UHVA 3MEFA 4RMFA 4LUOA 1CKNB 3BDOA 3LGJA 2X6LA 1KABA 3GDEA 1TKWB 5M9OA 3VR5A 3VDYA 5LMNL 1XJVA 1JB3A 4A3MB 2IHEA 1NMGA 4G57A 4G7ZC 3SHLA 3I2ZA 2VUMH 1YBYA 1E7ZA 1XWEA 4OO1I 2D0PA 1XNRQ 4EQ5A 2O5IC 4NPSA 4DV0L 4B08A 4O1NA 4LFCQ 3DEOA 3TN2A 4Q5VA 1WJJA 5EQ0A 3VYSA 3K8AA 3DWAA 1PZKD 5CBEE 5IYBG 2ZXRA 4NXML 2UUBQ 3TDQA 2L5TA 1VQOA 2K14A 4A3IG 4EVOA 2A6EC 2E2HH 1RDPD 1IYVA 2N55A 1K8AC 1SE3A 3H3VH 4MTNA 3SEBA 3G7LA 1BF4A 3RZDB 3SE0A 2AWNA 1SYGA 1A15A 4A3KH 1AP0A 3HOZB 4OONA 4FP5D 3ERSX 3T53B 1VDZA 3OMGA 2K5DA 1BDOA 1PYWD 1ICFB 1E22A 3S1NH 1K73C 2LFNA 1KDCA 4DAPA 3T56B 4E6IA 2BH8A 1VQMA 4IFDJ 5C4XG 5IGGA 5EJWA 4JV5Q 4H02A 5F2DA 1W6KA 1OXXK 3PQIA 5DM73 4BY7G 2LMCB 2A6HC 3BJUA 4LF7Q 3OW7A 4LF9Q 1G6PA 2B2VC 4QUCA 1X3PA 1EEFD 3V96A 1YHAA 2F3IA 3PO3H 3Q6SA 5C0XH 3M4QA 4GOPC 1FGBD 4DAYB 1QJOA 1WCMH 1AEXA 1JICA 5IGFA 4X64Q 1A2TA 4CDEC 2J7ZA 4YY3L 5IT9E 4FF4A 3DWQA 2RDFA 4A3FG 1PA6A 3PO2G 2VUMG 2J4XA 4A3DB 3OPOA 4IOCA 1D1KA 2WB1B 2XVSA 2K04A 5K36H 5IIFA 4ALPA 4R1JA 4DV2Q 1B9NA 1C0AA 3NBHA 3N52A 1DOLA 4BBRH 4DV1Q 2L4NA 1X9NA 1RD9D 3A54A 5BR8Q 3K7AB 5EAYA 5I4DA 4NDXA 1EZ8A 1I3QB 4GN5A 2ZXOA 2D0OA 4K8IA 2KJXA 1F2YA 1KNAA 1L1OC 4GLAC 4N9PA 1BKBA 4H0LC 3GTKH 4FF1A 1VQNA 5I9OA 2JE6I 4OWTB 4DUZL 3LNNA 1H9SA 3RLNA 1H9JA 5C3WA 5GADC 5IGBA 3SK8A 2IPKD 3I55A 3HOUH 1Y1VB 1GUTA 3KBGA 4A76A 4HTHA 2ATWA 1BCPB 1KIXA 2LXKA 4HJ8A 1MIUA 1RCVD 2C9OA 2MHVA 4HJ7A 4YCUA 2CH4W 1Y69U 1QNUA 2KOLA 4BS9A 1QVCA 2EYOA 3HOVH 4K6DA 1F2MA 2IWHA 2CCZA 1HQMC 3MHBA 4LFBL 1GD7A 1K8GA 5CV7A 2O4XA 2HQEA 2R7DA 2JA6H 3PV0A 4PMWA 1JE5A 1A0IA 3NQTA 4TKOB 2UUCQ 3CCQA 3S16H 3K81C 2XRSD 3PO3G 1DCZA 4FNFA 3J7YW 1N34L 2MO0A 3J7AF 4DAMA 3TZDA 4EQNA 2RA4A 3DLLA 4A3GH 3UE0A 3KF6A 4F8MA 4XXEA 4A3IB 3J81i 4JI6L 4KY5A 2C5CA 2Y0SG 2F0TA 2FMCA 1NMFA 1PFBA 4O2DA 4C3HG 5CV6A 5K36G 1YNJD 3M4PA 5ELCA 3PCOB 1ILQA 1LV9A 1BNZA 1XNQL 3TS2A 3NTIA 3D4RA 1X65A 1SFOB 1JQYD 2NN6I 1Q7YC 5BN5A 4JBJA 4R4IA 1PH9A 2HDLA 3HKZB 3OYYA 4BY7B 5LMUL 1SSOA 2OQ0A 3M7GA 1S3OA 2KHIA 4FO2A 1JC7A 2G5DA 1W2BA 4IPHA 1UEAB 1Q81C 4HIMA 4CKEA 4WORA 1XYIA 5JJZA 3R8BA 3HOUG 1EYDA 1ZYRD 2GVBA 1EZ6A 1RKNA 2DN8A 3KK7A 3K59A 2A68D 3LX0A 2R92H 1TWGH 3KLWA 3CKIB 2ID0A 4JI8L 3EFXD 3W1BA 3Q8DA 1I4HA 4A3FB 4TQUS 3PO2B 2VUMB 4IJLA 5T1GA 1NJIC 1O80A 4JBWA 3T1HL 1UNSA 3W1GA 4ME5A 1YNND 2V1CC 4PNYA 1BO0A 1HZAA 2K03A 1Y1WH 2JA6G 2XTIA 1DGSA 4IUTA 1LTID 1KLUD 1XNRL 2UXCL 2PZUA 2UUAQ 3VR4A 3BZDB 3K6OA 1FJGL 2K52A 4LFCL 4G7OC 4JI1Q 4A3GG 3DMUA 1KRSA 1MI2A 4XYQA 1U4LA 4QY7A 2JEBI 4JBMA 1L1OA 1LTRD 2RSOA 1SAPA 5IE8A 2F0QA 2FFKB 5A35A 1EUJA 1YJ9A 3S1NB 2HQLA 1HZ9A 3L3OC 4DFAA 4WJ3M 4UP9A 3K57A 4HN7A 1N8RC 4GKJQ 2EXDA 5FJ8H 4DXGA 3PIP3 4CKCA 4H13C 3W3AA 2ZTEA 2WAQE 1E1TA 1TQOA 4B9WA 4RKBA 2JA5B 1E0BA 2EYMA 1CHQD 4YCVA 5C3EH 5ELOA 2JEAI 2EY1A 3PO3B 4P75A 3SK4A 2BH2A 3I70A 1LABA 3MXNB 4BA1I 4DV4Q 3S15H 2UXBQ 5FO8B 1GUGA 2R92G 2IY5B 1C4QA 5IOCA 2Z4IA 4C3JH 3SGIA 3ONAB 3MXUA 3L7ZC 4X64L 1S40A 3QOJA 3OMCA 4C3HB 4R4OA 2K5HA 3VR2A 5KNCA 1EQRA 1HNXQ 1EFID 1Y1WG 2D5DA 2ZM6Q 1JE4A 1N36Q 1ASYA 1G291 4QJFA 1HA6A 1QWYA 2IJ0A 1OXSC 1Y14B 5EGTA 3M3YB 4QIWE 1AE3A 4C1NK 1O7YA 1I4GA 1WTHA 4DV1L 1O78A 3M9BA 3NELA 5BR8L 2NB0A 5M5YB 3R2TA 5HGTA 1AW7A 1KC8C 5C4HA 4OIJA 5I2YA 1EY4A 1LO5D 1V1OA 3OIPA 5AFWA 1S5BD 4MIUA 4A3MH 1CKNA 4C1NI 3D8GA 1M4VA 2LY7A 4POFA 1K3RA 4X3SA 1BCPC 1DYQA 1LTGD 1KAWA 5FJ8G 3F1ZA 4IUNA 1BBUA 3T13A 2F0FA 5IP7H 1AZQA 3MA2B 1X3GA 3DXJC 3I4OA 1IYJB 2L12A 5C3EG 1A3VA 1FNWA 1GUOA 1VQ7A 1KXLA 4OL7A 4KMUC 2B3GA 2Q8RE 4JI0Q 2Q2TA 1VQ6A 3RZOB 1SE2A 4POGA 3ERQA 3CXCA 3RZDH 1X54A 3C3LA 4A3BB 4OEMB 4RFBA 3RD4A 3HOZH 1EU3A 1SBBB 5CV8A 1LLRD 4EX5A 4JYAQ 4R8NA 5D3IB 1QVFA 5JJLA 4Z9CB 2F0NA 1K3BC 3S9WA 4IO9A 1V9PA 2NYZD 3ER0A 4RAUC 1VQBA 3NTKA 3GTOB 5M3FH 4KTAA 1PFMA 2ZT9C 4K5XA 1N9WA 4HR7B 4B3SL 4PZ6A 2G9DA 2N8NA 4ZRZA 3VYTA 3H3VI 2L15A 4KY7A 1STYA 4AYBE 1BBXC 2IT1A 3PF5A 1ZXTA 3CRLC 2XN9C 4LNQA 1MD2D 4JI3L 3GTMB 1SMXA 1B53A 4GOPB 3ITPA 1TR5A 3AU7A 2BA0A 4OWXB 2EE1A 1Q1EA 2ALYB 3BDLA 1NY4A 2PI2A 4GN3B 3R93A 4IQZA 1WI5A 5LMNW 3A5UA 4DUYQ 3NBIA 2SDFA 2K6AA 5J3BA 4A3MG 4K6LA 3QO2A 1I5FA 3PUWA 1JOQA 4JI4Q 3EBEA 4A3DH 3G48A 4AIMA 2R92B 1KDAA 4DAYA 3J80E 3U50C 4CJ2C 1XTCD 2KEDA 1N33Q 4MZ9A 3I56A 1HXYD 5KYLA 3EROA 4DR3Q 5KNDA 5C0XI 5IYDH 1HQRD 3MAQA 5JVH3 1XPOA 3K7AH 1V1PB 1Y1WB 3GTPH 3K7UC 2EVBA 1Z6HA 4B3RQ 1GKHA 1K8OA 5CV4A 1WD1A 4DK6C 3E6ZX 3B6YA 3MVVA 3TBIB 1B3QA 1EYAA 1XX8A 3J81L 3F2BA 1TWAB 1VS0A 2NUCA 2OT2A 4RWSC 2ZJRA 1PRTF 3IFDA 1HUMA 4DF7A 1QCBD 1Y1VH 2K5NA 1C7YA 2JXMB 3OWFA 1MSGA 1T9HA 2EOTA 2UXDQ 3NPPA 4I7ZC 2MPMA 2TMPA 3VYRA 1PH4A 5M3FG 2FINB 2HCCA 1YIJA 4DA2A 1SYFA 2L9HA 1EU4A 3M85A 1KTKA 5GROA 5C4ZA 1XMOQ 4G4KA 4K2KA 2HHHQ 4FXDA 4DXFA 4DR5L 3FPUB 1R9TB 1RF2D 3T4AC 1EWCA 3PGZA 2TSSA 2A5HA 3CCEA 2AKWB 2K32A 3RLOA 4RGOS 1PTOF 4DV3Q 1PYBA 3HG9A 4A3IH 5EKKA 2CFMA 1TY2A 5NUCA 4DR1L 3AEVA 4J1MA 1FGUA 2L55A 3AB9A 3K0XA 4A3DG 1TS3A 3S15B 1TY0A 1VQIA 4WJ4A 4RGMA 3ZYYX 5TSSA 4KN4C 4MNOA 4ODGA 3S24A 1PVOA 3BVMA 4DR7L 3S1RB 1EEID 4LF5L 1Q8IA 5IYDG 2IL8A 1H9RA 4N8FA 4BY1H 1SFOH 3QOLA 1VF5C 1N32Q 2E8GA 3HRZC 4IALA 1WTQA 1VQKA 1K0SA 1B70B 2DGYA 3JAME 4Y52H 1MJEA 5IP9H 3K5LA 2F0MA 3TQYA 1O7LA 1HNXL 1HR0W 3IL8A 4ULLA 2ZM6L 3MZ5A 1KDBA 4LFAL 3BYYB 1L0XB 1N36L 2R61A 2RBMA 1YHBA 3VA7A 3A0JA 4QMGA 1EQQA 2F0DA 3J80c 3BYTB 1CTMA 5CR3A 3PMFA 1B1ZA 3X3MA 1Y1VG 4UPAA 1MGSA 1QZGA 1S4ZA 2RQXA 4KY6A 1QNKA 1IKMA 2B29A 4BBSH 4ABNA 5BN4A 1HCZA 1I94Q 5C0XJ 4YHHQ 4CJ0B 4A3FH 1B9MA 4HMIA 3PO2H 1CA5A 3CHBD 5FLXc 5HURA 1DXMA 4C3IH 3PUXA 3AQQA 5DM63 1CHPD 4L5RC 2YU9B 3ULLA 3FVQA 1WTRA 2KVMA 2H5XA 3SDZA 5CV5A 1SNQA 3GTGB 4K0KL 4CBVA 4JVZA 2PZTA 2CWAA 4OHJA 3K58A 2QW7A 3CRKC 3KJPA 4KD4A 3TS0A 4A3LH 4HJ5A 1WTPA 2VQEQ 5I9PA 3KJOA 1GJXA 4BA2I 1D1IA 3GV3A 2MQHA 1JB7A 1RJTA 2K5VA 2EYHA 1E2WA 2L1BA 4RGNA 1F9QA 5KGUA 3PUVA 1I6HH 4AQYQ 3DEPA 1K0RA 4EQPA 2NTTA 2IX0A 4BY1G 1X56A 4CHTB 2K05A 1FR3A 3GTJH 5M3FB 5L37A 3TMEA 1XMQQ 4A3EG 3HOWH 3HKZG 5IP9G 1EY6A 4NXNL 3D4WA 3D6WA 1WTVA 2Y0SE 4I7AA 3P75A
chains in the Genus database with same CATH topology
1JWSD 2B8FA 3J7AV 4EGVA 3QWNA 2JP1A 2XNAC 3BS1A 4XIGS 3C46A 3NQIA 5JEAH 1A2UA 1VF7A 2F0HA 1A3TA 1PLFA 3VR6A 4I65A 2A69D 4KV6A 2PCFB 2B2YA 4C3IG 3SK5A 2Z4HA 3S2DB 2Q8TA 2R7ZB 1HUNA 1STEA 1B44D 4TSSA 3C2PA 2KHSA 3GTPB 2D62A 2KCNA 1PRTD 3O13A 2R93B 2L11A 2RDGA 2AQ1B 1LT3D 3KLSX 3H09A 4UDUC 2F0JA 4RKLA 2M9VA 3M4OB 3K5OA 1STNA 1LTTD 2NVQB 3TP7A 1LTAD 2I07B 1SYDA 2F0GA 3FMCA 1EYCA 2AWOA 3BDCA 1STBA 4NKLA 4OGQC 1LT4D 1WD0A 1YNJC 4BWGB 2J0TD 1WTWA 4XYOA 4KKTA 5EPJA 3MFYA 2F3VA 1PTOD 2PO4A 1D6EC 1C8CA 2VB2X 1JOOA 1HHVA 5JEAG 3A56A 4H44C 4PMCA 3PUYA 3AMUA 5K5PA 1CT1D 1Z7TA 2VNUD 4LAAA 1JWUD 2QILA 4ZKBB 4ZYSA 1SMYD 1R4QB 3S14B 3HP3A 1ZYRC 2NVXB 2QCPX 4DK0A 2PMZB 2F3WA 2A68C 3FKIB 3QG1A 3HZXA 4BY1B 3S1MB 4ZQ3A 4XDXA 5EKIA 2BA1A 3VA5A 4A3EB 5I2XA 4X3UA 1YNNC 5KRUA 3T51B 4C56C 2B2VA 5KEEA 2F0OA 1GUNA 2OEOA 1STGA 1MBYA 2IX3A 1CFMA 4BBSB 3A7LA 1NR4A 4OO1H 4WJWA 1DONA 1OXTA 4C3IB 5JPNC 4ZK9B 3OHXC 3HOYB 1U9RA 4IFDG 1HTLD 2K33A 5JOBA 1IW7D 4CJ1B 2RKSA 1H9KA 1V1PA 2MUYA 2G9HD 1EY0A 4DU9A 1S5CD 5CC4A 2F0UA 4LK1C 4KKSA 5I6WA 1CI3M 1PZJD 1GOZA 1I6HB 3GTQB 3EJIA 2FHTA 4X3KA 3CQZB 1NCVA 1D5ZC 1PMRA 2NZ1D 3GTJB 1SNOA 3HOWB 5A2QL 1V43A 2D9UA 5EBDA 2EYJA 3MC0B 4M8AA 5FKAC 1ILPA 4ID6A 4KHZA 1CQVA 3V2TA 1GUSA 2IW3A 1U4MA 2KCCA 2Q8IB 4K5VA 1OXVA 4V190 1QB5D 1G2TA 3KUPA 3J80L 4OO1G 2WP8J 4RH6A 1LT5D 1SYCA 1B2TA 5ISRA 5KYIA 4FF2A 2JYOA 2JA8B 3TZUA 1B50A 2NVTB 5FLXL 2F0PA 5M5XB 1LTBD 4FVMA 2F4IA 3W2DA 3TP8A 2O5JC 3NWSA 2AUKA 4WFN3 1S5DD 4C2MB 4RA8A 2MGSA 3MWYW 1D2BA 2F0SA 4XQJA 3A7AB 4Y7NB 1VMPA 3IKJA 5E4WC 2WIIB 3I73A 2V4DA 3S1QB 3GV6A 3V05A 2KUMA 3DUZA 3A55A 1S5FD 2K01A 2Z1CA 2PYKA 2H4OA 2K5WA 3Q22A 1SXTA 3S17B 3FRPB 5JVG3 1ZKOA 4IUPA 1TWHB 5LL6X 3D31A 4NP5A 4ILWA 1RHPA 3VYUA 2QF7A 1V8QA 3TP6A 1RODA 3WOEA 1WTOA 3PUZA 2GA4B 3ND9A 4FXKC 1PFNA 5CMDA 4A3JB 5C44B 4IZ8A 1PRTB 3FEWX 1IYUA 3C1FA 1JOKA 1D5MC 3C1EA 1CZWA 2F0KA 1F2LA 3UI2A 1EL0A 1Q3LA 2O2LD 2YYZA 2NVYB 5M5WB 3BG3A 4WRDA 1AZPA 1Y8PB 1I4PA 5CV9A 5M3MB 4O42A 4RCNA 2CW0D 5BN3A 4OIKA 1FNUA 5IGDA 4QB4A 1PTOB 1TU2B 1F77A 2DY7A 2XSCA 1KLGD 4KN7C 5LL6S 5CORA 4K2LA 3Q0AA 5FOBB 2XWBB 4M1UB 5KNBA 1MSHA 4XQQA 2BOSA 1CQFA 2SNSA 3GD7A 1X32A 5ELFA 5C4JB 3I3CA 1U4PA 1ZEQX 2QDBA 4Q0FA 2E2IB 2B2UC 3GP7A 5J22A 1OO9B 4DN4M 4B9XA 2SNMA 4DGZA 2ENBA 2E2JB 1WTXA 2I46A 1FD7D 3HOXB 5G3LF 1SEBD 3KBXA 5IT9L 3TSSA 1ESRA 2X69A 1I4RA 5ELEA 3GTLB 3NK9A 1F9SA 4FF3A 1LTSD 3S2HB 2PPBC 3H91A 3NWTA 2F03A 2R6GA 2RDHA 1DZ1A 4MHEA 2WAQB 2KQ3A 1BXTA 1Q1BA 2PNRC 1SJED 5C5MA 3NTHA 1ICWA 5FO9B 1CK1A 4HMJA 2JSOA 2AQ3B 4NMZA 2B39A 5JEAJ 1EIGA 3LWUA 1TS2A 3QJYA 1QE6A 1WVLA 1OXUA 1T5EA 1CA6A 4HAEA 3M4YA 1SYBA 4MN3A 4KJNA 2KECA 5JPMC 4U673 3I4NB 2B63B 4A93B 1F9RA 2WKDA 2B2TC 5IGCA 2DNEA 4QIWB 4PQXA 3RLFA 1A3UA 1KNEA 2F0WA 3BVGA 2BE5D 1JWMD 5CGKA 4XTCS 4QUFA 1IKLA 1K83B 3Q24A 2OXPA 3VR3A 4HCSA 1X3QA 1EY7A 1Q12A 1GHJA 1TWCB 3KLRA 2ICEC 2A69C 3J81E 3MEHA 1SYEA 4RGTA 4YIJA 5D3DA 1D5XC 1NAPA 2EY6A 5COYA 2B2UA 1JCKB 3R3OA 2M2LA 4J8QA 4IUUA 1C48A 3SXHA 2EYLA 3NUCA 3G6JB 1PRTC 3H0GB 1QILA 4UAIA 3QB3A 1K8MA 1J9OA 3CU7A 1EWHA 2FMMA 2A6ED 1J8IA 4R9WA 4RHSA 3MXNA 2NBFA 1TWFB 1EOTA 1SNCA 4KJOA 5EBCA 4KK7A 4AYBB 2QEJC 1BR9A 2E2DC 2A6HD 2JA7B 5EPLA 1PTOC 3IFTA 2K1BA 2PW7A 5C5LA 1FYCA 5I6YA 2LKVA 1KAAA 1QOHA 1CZGA 2EY5A 3EA6A 4FXGC 1SMYC 2B2WC 3LWEA 1TS5A 1T5XD 5CYUA 3I4LA 4P2CB 1GHKA 2BCOA 2EY2A 4KHVA 4L6TB 3NHHA 5EPKA 2D2CC 1PZID 4IFDH 3A8JE 5G3LD 2BDNA 3P7JA 1HPCA 2EXZA 1A6XA 1ENFA 2B2TA 4IUQA 5E1FA 1NR2A 1TIID 4QCLA 1DM0B 3NSWA 1II3A 1PXUA 4X3TA 2HUGA 3FPPA 2F0EA 3I4MB 5C0XG 4DNRB 1HFNA 4DK1A 2M00A 3OSOA 4H7BA 3D4DA 1R4PB 2EYPA 5JAVA 4PV1C 1I4XA 3SVMA 4JK1C 3D6CA 3E5SA 3I91A 2KEEA 2EYFA 3T16A 3PIO3 4TRDA 3P20A 1BCPF 2WKCA 1IW7C 1DOKA 1HTPA 5C4XB 1JORA 3K5NA 4U68A 1SDFA 2EJMA 1ET9A 3FDTA 4XT3B 3A8KE 1U4RA 4NW2A 2ICIA 2FJ2A 1W6JA 1NSNS 2A73B 3URYA 2EDGA 1PTOH 3L9AX 1EQTA 4HCEA 3DWPA 1TT2A 4LMQD 4CKBA 2XWJB 2B8GA 3H94A 1I6VC 2CHBD 2E75C 5D14A 1UUPA 1EY5A 5E4XA 1EIHA 4R8IA 2SOBA 1XXGA 4IUVA 3H6MA 5J1ZA 1DD2A 2RSNA 1ESFA 2E2HB 1S5ED 2AQ2B 4K14A 4HSVA 4K8JA 1ENCA 2B2WA 4L8JA 4ZAIA 4A3KB 2ZXPA 2F0IA 3RUZA 5IODA 3HS0C 2K28A 2PZWA 2VB3X 3EQLC 5FK9C 3K5MA 3EVQA 4ZUIA 1H9MA 1Y8OB 4KKUA 4RCOA 1G2SA 2K7VA 3KLSA 4F88A 4HEDA 4IN3A 4FYDA 1HRJA 2CVRA 2EJFC 3OIQA 4DNTB 1WCMB 2OF1A 3DM1A 4XT1B 1EY8A 4DAVA 1TS4A 2F0VA 2VXWA 2Y0SB 5J39A 1SE4A 5EKLA 2DNCA 3TP5A 2X6GA 1FNVA 4BBRB 3NXWA 2F0LA 2R3ZA 1H9SB 1SNDA 4KI0A 3MFGA 1HA5A 4K5WA 1BUVT 1QG7A 2SEBD 3GTKB 1UAPA 1PDQA 1IHZA 1HFGA 1LACA 3HOUB 1G6ZA 2PW5A 1BOSA 2WV6D 4F87A 4CGYB 2LS01 3HOVB 3NP8A 1EQVA 2XRQD 5DNFA 3DHQA 2HCIA 1IL8A 2EJGC 2JA6B 2QKIC 3I90A 5DEHA 4XQNA 3S16B 5E3FA 2NN6H 1I4QA 1GUWA 2L0CA 3JAML 4A3GB 3SK6A 1BCPD 1Q90A 4GZYC 4C3JG 2H1EA 2AUJD 2BDOA 4F7XA 4ZUJA 2CW0C 3HEJA 3Q23A 1STAA 1VCIA 2KA7A 1BQQT 4V0BA 1I50B 2IX1A 2WINB 3ND8A 3MXGA 5A2QE 1O7ZA 5LHY1 3M7NA 1SJHD 3MXPA 1NUCA 5IGEA 1EY9A 2K5QA 4QF4A 1AFPA 4IURA 4HSPA 4RHRA 1RTOA 5C3XA 2MJ8A 1TVXA 5ELBA 3KF8A 5KIXA 3GO5A 1F9PA 2XIWA 1DOMA 4G7HC 1Y8NB 4ZLTF 3F2UA 4EQOA 3OOCA 2Z8LA 2PQEA 1E2VA 1TWGB 3U9OA 4S3SA 1Z47A 2HDMA 3GQBA 1SNMA 3MTSA 1ONLA 3RMHA 2EZVA 1VMCA 3E0JA 5FLXE 3U9SA 5ELDA 2NN6G 3D3RA 2N88A 1CM9A 1DJRD 1ENAA 4N9TA 1RTNA 2NWGA 3A8IE 1ML0D 1JR0D 1LT6D 1F2ZA 2DY8A 3H3VC 2F1MA 3X3NA 1G8ZD 1B4OA 1STHA 2EPBA 2WACA 5FO7B 3R2IA 2E76C 4PMBA 2E74C 3QIAA 3NE5B 3WOFA 4L63B 4IFDI 5C6AA 1ET6A 3HGBA 4ZKCB 5C3EB 2MP1A 5DAUA 1E2ZA 4KD3A 5D65A 3P1HA 2B2YC 3I8ZA 1M8AA 4C3JB 3IAYA 1SNPA 1GXDC 2NTSA 3SR1A 1L0YB 3OWEB 2CQAA 2RVLA 2A74C 4J6HA 4LJZC 1G91A 5CBAE 2BE5C 3WDNA 3N6RA 1B3AA 1AN8A 3I72A 3BVZA 3K0YA 3BDOA 2X6LA 1KABA 1TKWB 5M9OA 3VR5A 1JB3A 4A3MB 4G57A 4G7ZC 3SHLA 1XWEA 4OO1I 2O5IC 4B08A 4O1NA 3DEOA 3TN2A 4Q5VA 5EQ0A 3VYSA 3DWAA 1PZKD 5CBEE 2ZXRA 3TDQA 2L5TA 4EVOA 2A6EC 1RDPD 1IYVA 2N55A 1SE3A 3SEBA 1BF4A 3G7LA 3RZDB 3SE0A 2AWNA 1SYGA 1A15A 1AP0A 3HOZB 4FP5D 3T53B 1VDZA 3OMGA 1BDOA 2K5DA 1PYWD 2LFNA 1KDCA 4DAPA 3T56B 4E6IA 4IFDJ 5IGGA 5EJWA 5F2DA 1W6KA 1OXXK 5DM73 2LMCB 2A6HC 3OW7A 2B2VC 4QUCA 1X3PA 1EEFD 3V96A 3Q6SA 5C0XH 1FGBD 1QJOA 1AEXA 1JICA 5IGFA 1A2TA 2J7ZA 5IT9E 4FF4A 3DWQA 2RDFA 2J4XA 4A3DB 3OPOA 1D1KA 2WB1B 2XVSA 2K04A 5K36H 5IIFA 1B9NA 3NBHA 3N52A 1DOLA 2L4NA 1RD9D 3A54A 3K7AB 5I4DA 4NDXA 1EZ8A 1I3QB 2ZXOA 4K8IA 2KJXA 1F2YA 1KNAA 4N9PA 4H0LC 4FF1A 5I9OA 2JE6I 3LNNA 1H9SA 5C3WA 1H9JA 5IGBA 3SK8A 2IPKD 1Y1VB 1GUTA 3KBGA 4HTHA 1BCPB 1RCVD 2C9OA 2MHVA 1Y69U 1QNUA 2KOLA 4BS9A 2EYOA 4K6DA 1F2MA 2IWHA 1HQMC 3MHBA 5CV7A 2O4XA 2HQEA 3PV0A 4PMWA 3NQTA 4TKOB 2XRSD 1DCZA 4FNFA 3J7YW 3J7AF 3TZDA 4EQNA 2RA4A 4F8MA 4XXEA 4A3IB 4KY5A 2C5CA 2F0TA 2FMCA 1PFBA 4C3HG 5CV6A 5K36G 1YNJD 5ELCA 1ILQA 1LV9A 1BNZA 3NTIA 3D4RA 1SFOB 1JQYD 2NN6I 5BN5A 2HDLA 3HKZB 4BY7B 1SSOA 3M7GA 4FO2A 1JC7A 1UEAB 4CKEA 4WORA 1XYIA 5JJZA 3R8BA 1EYDA 1ZYRD 1EZ6A 1RKNA 2DN8A 3KK7A 3K59A 2A68D 3LX0A 3CKIB 2ID0A 3EFXD 1I4HA 4A3FB 4TQUS 3PO2B 2VUMB 5T1GA 1O80A 4JBWA 1UNSA 4ME5A 1YNND 4PNYA 1BO0A 2K03A 4IUTA 1LTID 1KLUD 2PZUA 3VR4A 3BZDB 3K6OA 4G7OC 3DMUA 1MI2A 4XYQA 1U4LA 2JEBI 1LTRD 2RSOA 1SAPA 2F0QA 2FFKB 5A35A 3S1NB 3L3OC 4DFAA 3K57A 4HN7A 4DXGA 3PIP3 4CKCA 4H13C 3W3AA 1TQOA 4B9WA 4RKBA 2JA5B 1E0BA 2EYMA 1CHQD 2JEAI 2EY1A 3PO3B 3SK4A 3I70A 1LABA 4BA1I 5FO8B 1GUGA 1C4QA 5IOCA 2Z4IA 3ONAB 3MXUA 3L7ZC 3QOJA 3OMCA 4C3HB 3VR2A 5KNCA 1EFID 2D5DA 1JE4A 1G291 1HA6A 1QWYA 2IJ0A 1OXSC 5EGTA 3M3YB 4C1NK 1O7YA 1I4GA 1O78A 2NB0A 5M5YB 3R2TA 5HGTA 1AW7A 5C4HA 4OIJA 5I2YA 1EY4A 1LO5D 1V1OA 3OIPA 5AFWA 1S5BD 4MIUA 4C1NI 3D8GA 1M4VA 2LY7A 4X3SA 1BCPC 1DYQA 1LTGD 4IUNA 3T13A 2F0FA 1AZQA 3MA2B 3DXJC 2L12A 1A3VA 1FNWA 1GUOA 4OL7A 4KMUC 2Q8RE 3RZOB 1SE2A 3ERQA 3C3LA 4A3BB 4RFBA 3RD4A 1EU3A 1SBBB 5CV8A 1LLRD 4R8NA 5D3IB 4Z9CB 2F0NA 3S9WA 2NYZD 4RAUC 3NTKA 3GTOB 4KTAA 1PFMA 2ZT9C 4K5XA 4HR7B 2G9DA 4ZRZA 3VYTA 4KY7A 1STYA 1BBXC 2IT1A 1ZXTA 3CRLC 2XN9C 1MD2D 3GTMB 1B53A 3ITPA 1TR5A 3AU7A 2BA0A 2EE1A 1Q1EA 3BDLA 3R93A 4IQZA 3NBIA 2SDFA 2K6AA 4K6LA 3QO2A 3PUWA 1JOQA 2R92B 1KDAA 4DAYA 3J80E 4CJ2C 1XTCD 2KEDA 1HXYD 5KYLA 3EROA 5KNDA 5C0XI 1HQRD 3MAQA 5JVH3 1V1PB 1Y1WB 2EVBA 1Z6HA 1K8OA 5CV4A 1WD1A 3E6ZX 3TBIB 3MVVA 1EYAA 1XX8A 3J81L 1TWAB 2NUCA 2OT2A 4RWSC 1PRTF 3IFDA 1HUMA 4DF7A 1QCBD 2JXMB 3OWFA 1MSGA 2EOTA 3NPPA 4I7ZC 2MPMA 2TMPA 3VYRA 2FINB 2HCCA 4DA2A 1SYFA 2L9HA 1EU4A 3M85A 1KTKA 5C4ZA 4G4KA 4K2KA 4FXDA 4DXFA 3FPUB 1R9TB 1RF2D 3T4AC 1EWCA 2TSSA 2A5HA 2K32A 4RGOS 1PTOF 3HG9A 5EKKA 1TY2A 5NUCA 4J1MA 2L55A 3AB9A 1TS3A 3S15B 1TY0A 4RGMA 3ZYYX 5TSSA 4KN4C 4ODGA 3BVMA 3S1RB 1EEID 1Q8IA 2IL8A 1H9RA 3QOLA 1VF5C 4IALA 3HRZC 1WTQA 3JAME 3K5LA 2F0MA 1O7LA 3IL8A 4ULLA 3MZ5A 1KDBA 3BYYB 1L0XB 2R61A 2RBMA 3VA7A 4QMGA 2F0DA 3BYTB 1CTMA 5CR3A 3PMFA 1B1ZA 3X3MA 1MGSA 4KY6A 1S4ZA 2RQXA 1QNKA 1IKMA 4ABNA 5BN4A 1HCZA 5C0XJ 4CJ0B 1B9MA 4HMIA 1CA5A 3CHBD 5HURA 1DXMA 3PUXA 5DM63 1CHPD 2YU9B 3FVQA 1WTRA 2KVMA 3SDZA 5CV5A 1SNQA 3GTGB 4CBVA 2PZTA 4OHJA 3K58A 3CRKC 4KD4A 1WTPA 5I9PA 1GJXA 4BA2I 1D1IA 3GV3A 1RJTA 2EYHA 1E2WA 2L1BA 4RGNA 1F9QA 5KGUA 3PUVA 3DEPA 4EQPA 2NTTA 2IX0A 4CHTB 2K05A 1FR3A 5M3FB 3TMEA 1EY6A 3D4WA 3D6WA 1WTVA 5T1IA 3P75A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JAM L;  5IT9 L;  3J81 L;  3J7A V;  5LL6 X;  5FLX L;  5A2Q L;  3J80 L; 
#chains in the Genus database with same CATH topology
 1JWS D;  4X65 L;  2B8F A;  2JA5 H;  4EGV A;  3J7A V;  3QWN A;  2JP1 A;  2XNA C;  4GKK Q;  3BS1 A;  4XIG S;  4OEL B;  3C46 A;  3NQI A;  5JEA H;  1A2U A;  4X6A H;  1VF7 A;  2F0H A;  1B7Y B;  1A3T A;  1PLF A;  4BBS G;  3VR6 A;  3BU2 A;  3CD6 A;  4I65 A;  2A69 D;  4KV6 A;  2I5H A;  2PCF B;  2B2Y A;  3JAM c;  4DUY L;  4C3I G;  2JJQ A;  2HIV A;  1RL2 A;  4C3H H;  3SK5 A;  4LF4 Q;  2Z4H A;  4JI4 L;  2N3S A;  3S2D B;  2Q8T A;  2ES2 A;  2R7Z B;  1X6O A;  1HUN A;  1STE A;  1B44 D;  2QDL A;  4TSS A;  3C2P A;  2KHS A;  2E5L Q;  3M3Y H;  1VQP A;  5DLQ E;  3GTP B;  1HNW Q;  2D62 A;  4L5T A;  2KCN A;  1PRT D;  1VQ9 A;  3O13 A;  4B3T L;  4A3L G;  2R93 B;  2L11 A;  2RDG A;  5M5Y H;  2AQ1 B;  1LT3 D;  2VY3 A;  3KLS X;  3H09 A;  4UDU C;  2F0J A;  4RKL A;  2M9V A;  3M4O B;  3K5O A;  1STN A;  1LTT D;  1NBW A;  2NVQ B;  3TP7 A;  4RG1 A;  4NB3 A;  1LTA D;  2PQA B;  4Y7N H;  2I07 B;  1SYD A;  2F0G A;  3FMC A;  3NEN A;  1EYC A;  2AWO A;  2QGQ A;  3BDC A;  1STB A;  3T1Y Q;  3HOW G;  5IWA L;  4NKL A;  4OGQ C;  1LT4 D;  2HIX A;  1WD0 A;  3EIV A;  1YNJ C;  4BWG B;  1J5E Q;  2J0T D;  1AH9 A;  1WTW A;  4XYO A;  4KKT A;  4DNI A;  1CSP A;  5EPJ A;  2JA5 G;  3MFY A;  2F3V A;  1PTO D;  2UU9 Q;  2PO4 A;  1D6E C;  1C8C A;  1XMO L;  2VB2 X;  1JOO A;  1HHV A;  5JEA G;  3A56 A;  4H44 C;  4PMC A;  3BZC A;  2HHH L;  3PUY A;  3RZO H;  3AMU A;  1ASZ A;  5K5P A;  1CT1 D;  1Z7T A;  2VNU D;  4A3B H;  2ZTC A;  1JWU D;  4LAA A;  4B3M Q;  2QIL A;  4CDF C;  4ZKB B;  4ZYS A;  1D8L A;  1R4Q B;  1SMY D;  3S14 B;  3E9I A;  3HP3 A;  1ZYR C;  3GTO H;  2NVX B;  2QCP X;  4DK0 A;  2PMZ B;  2F3W A;  2RF4 A;  2A68 C;  2DJF C;  3FKI B;  3QG1 A;  3HZX A;  4BY1 B;  4IPC A;  3S1M B;  4ZQ3 A;  4XDX A;  3OTO Q;  5EKI A;  2BA1 A;  3VA5 A;  4A3E B;  2MO1 A;  5I2X A;  4X3U A;  1YNN C;  3GTM H;  5KRU A;  3T51 B;  2JK8 A;  4YWL A;  5IT9 c;  4C56 C;  2B2V A;  3KOJ A;  5KEE A;  2F0O A;  1GUN A;  2OEO A;  1STG A;  1VQJ A;  1MBY A;  2QEX A;  4GOP A;  2EIF A;  2IX3 A;  1CFM A;  4LF8 Q;  4BBS B;  2Z0S A;  4JI5 Q;  3A7L A;  1NR4 A;  4OO1 H;  4WJW A;  3CCV A;  1DON A;  1OXT A;  4C3I B;  1I94 L;  5JPN C;  4YHH L;  4ZK9 B;  1HH2 P;  3OHX C;  3HOY B;  1U9R A;  2HT1 A;  4IFD G;  1HTL D;  4OX9 Q;  2K33 A;  3CC2 A;  5JOB A;  3HKS A;  3TRE A;  4JPB W;  1IW7 D;  4CJ1 B;  2RKS A;  1HJP A;  1TWA H;  1H9K A;  4A3B G;  1MJC A;  1V1P A;  1CKO A;  2MUY A;  2G9H D;  1EY0 A;  3UE1 A;  3JC6 6;  1S5C D;  4DU9 A;  5CC4 A;  2F0U A;  3TEH B;  4LK1 C;  5HY6 A;  2UUB L;  1EWI A;  2VQE L;  4KKS A;  5I6W A;  1P16 A;  1CI3 M;  1PH3 A;  2A8V A;  1IBL Q;  1PZJ D;  1GOZ A;  1I6H B;  3UDI A;  3GTQ B;  3EJI A;  2FHT A;  4X3K A;  3CQZ B;  2GVA A;  1NCV A;  3KDF B;  1D5Z C;  1PMR A;  2NZ1 D;  3GTJ B;  1SNO A;  3HOW B;  3A5Z B;  4KHP Q;  4AQY L;  5A2Q L;  1V43 A;  2D9U A;  5EBD A;  2EYJ A;  3MC0 B;  4M8A A;  5C44 G;  1R9T H;  4GLV B;  5FKA C;  1ILP A;  1XMQ L;  4JV5 L;  2E2J H;  4ID6 A;  4KHZ A;  2LXJ A;  4JCV E;  5AJ3 Q;  1CQV A;  4LF7 L;  3V2T A;  4LF9 L;  1GUS A;  2IW3 A;  3U4V A;  3PIO A;  1U4M A;  2KCC A;  2Q8I B;  4J15 A;  4K5V A;  1OXV A;  3U58 A;  3AYH B;  4UP7 A;  4V19 0;  1QB5 D;  1G2T A;  3KUP A;  3J80 L;  4OO1 G;  2WP8 J;  3S1R H;  4RH6 A;  1LT5 D;  3GTL H;  1SYC A;  1B2T A;  5ISR A;  5KYI A;  4FF2 A;  2JYO A;  2JA8 B;  3TZU A;  1KD1 C;  3S2H H;  4LF4 L;  1B50 A;  2NVT B;  4DV2 L;  5FLX L;  2VZA A;  4HIO A;  2F0P A;  5M5X B;  3I7F A;  1YVC A;  1LTB D;  4FVM A;  4IPG A;  2F4I A;  3W2D A;  3TP8 A;  2E5L L;  2O5J C;  3NWS A;  4JI2 Q;  2AUK A;  1HZC A;  4WFN 3;  1S5D D;  4C2M B;  4RA8 A;  2MGS A;  2CQO A;  3MWY W;  1IBM Q;  5JJI A;  5IY0 A;  1D2B A;  2F0S A;  4XQJ A;  3A7A B;  1AE2 A;  4Y7N B;  1VMP A;  3IKJ A;  5E4W C;  2NZO A;  2WII B;  1VQD A;  3I73 A;  1VQ5 A;  2N49 A;  3AFQ A;  2RCF A;  2V4D A;  5LMN Q;  2YU9 H;  4IOA A;  4O0A A;  4DR2 Q;  3S1Q B;  3GV6 A;  3V05 A;  2KUM A;  3DUZ A;  3A55 A;  1S5F D;  1VQH A;  2K01 A;  1PH8 A;  2Z1C A;  3T1Y L;  3GTG H;  1K9M C;  2PYK A;  2H4O A;  3G4S A;  4GNX B;  2K5W A;  2OQK A;  2Q2H A;  1Q8K A;  3Q22 A;  1SXT A;  3S17 B;  1J5E L;  3FRP B;  1IZ6 A;  3HOX G;  5JVG 3;  2UU9 L;  1ZKO A;  4IUP A;  1KL9 A;  1TWH B;  3RR5 A;  1EOV A;  2UUC L;  5LL6 X;  4CDC C;  2PI2 E;  3D31 A;  4NXM Q;  1D7Q A;  4NP5 A;  3FP9 A;  2NZH A;  4ILW A;  1RHP A;  3KF6 B;  4IJH A;  2K75 A;  3VYU A;  1TWC H;  1QUQ B;  1BVS A;  2QF7 A;  1V8Q A;  2I5L X;  3TP6 A;  1ROD A;  4GS3 A;  1SRU A;  3WOE A;  2DJG C;  1WTO A;  4APV A;  3PUZ A;  2GA4 B;  1L2F A;  3F2D A;  3ND9 A;  3CC7 A;  4FXK C;  2WAQ G;  2WB1 E;  1PFN A;  5CMD A;  3RNU A;  4A3J B;  5C44 B;  3CCL A;  4IZ8 A;  1PRT B;  3FEW X;  1YI2 A;  1IYU A;  1YZ6 A;  1JOK A;  3C1F A;  1WFQ A;  4PZ8 A;  1D5M C;  3C1E A;  1CZW A;  1JJG A;  2F0K A;  1F2L A;  3UI2 A;  4PZ7 A;  1TXY A;  1EL0 A;  1Q3L A;  2O2L D;  4A75 A;  2YYZ A;  1XPR A;  2NVY B;  5M5W B;  3J7A 5;  1YEZ A;  3BG3 A;  4WRD A;  1AZP A;  1Y8P B;  3S2D H;  4LF8 L;  2R7Z H;  3AFP A;  1TWF H;  1IBK Q;  1I4P A;  5GAE C;  3OW2 A;  2B63 G;  5CV9 A;  2VL6 A;  5M3M B;  4O42 A;  4RCN A;  2CW0 D;  5BN3 A;  2JQO A;  2R93 H;  4OIK A;  1KRT A;  1FNU A;  3ULJ A;  5IGD A;  4QB4 A;  1PTO B;  1S72 A;  1TU2 B;  1F77 A;  2DY7 A;  2XSC A;  4OX9 L;  1KLG D;  3M4O H;  4KN7 C;  5LL6 S;  5COR A;  4K2L A;  3Q0A A;  4P73 A;  5FOB B;  2XWB B;  2NVQ H;  2UUA L;  2F4V Q;  3PSI A;  4M1U B;  1MSH A;  4XQQ A;  5KNB A;  2BOS A;  4JI1 L;  1CQF A;  1HR0 Q;  2KBN A;  1YIT A;  2SNS A;  1O7I A;  3GD7 A;  4DUZ Q;  1X32 A;  4DPG A;  5ELF A;  1H95 A;  5C4J B;  1A62 A;  1CKM A;  4QQB X;  2PNH A;  3I3C A;  1U4P A;  1ZEQ X;  1B8A A;  2QDB A;  4Q0F A;  2E2I B;  2B2U C;  3GP7 A;  5J22 A;  5IYC H;  1OO9 B;  3E9H A;  4DN4 M;  2JA9 A;  4B9X A;  2YV5 A;  3ULP A;  2FXQ A;  2SNM A;  4LW1 A;  4GKJ L;  4DGZ A;  2ENB A;  2E2J B;  5ELN A;  1WTX A;  4LFB Q;  2I46 A;  1FD7 D;  1EYG A;  3HOX B;  1SN8 A;  3CF5 A;  2Z9H A;  5G3L F;  4HJ9 A;  1SEB D;  3KBX A;  5IT9 L;  3TSS A;  1N34 Q;  1ESR A;  2X69 A;  1I4R A;  2RHS B;  1X3E A;  5ELE A;  3I4M H;  4ME3 A;  3S14 H;  2NVX H;  1PH7 A;  4DV4 L;  3F8T A;  3GTL B;  2UXB L;  4JI6 Q;  2R7Z G;  3FKI H;  2Q2U A;  3S1M H;  3NK9 A;  3KFU A;  1F9S A;  4A3E H;  4FF3 A;  1LTS D;  4AYB G;  3S2H B;  2PPB C;  3H91 A;  1C9O A;  3NWT A;  1LYL A;  2F03 A;  2R93 G;  1X3F A;  2R6G A;  2RDH A;  1XNQ Q;  1U0L A;  1L0W A;  2JA7 G;  1DZ1 A;  4MHE A;  2WAQ B;  2KQ3 A;  1E24 A;  1BXT A;  1Q1B A;  2PNR C;  3W5O A;  1SJE D;  5C5M A;  3NTH A;  1ICW A;  5FO9 B;  1CK1 A;  4HMJ A;  1M90 C;  4JBK A;  5LMU Q;  2JSO A;  4R4T A;  2AQ3 B;  4NMZ A;  3E3X A;  2B39 A;  5JEA J;  1EIG A;  3LWU A;  1TS2 A;  4OXP A;  4QGU A;  3QJY A;  2MNA A;  2K50 A;  1IBM L;  1QE6 A;  1WVL A;  3J80 i;  1OXU A;  1T5E A;  1CA6 A;  4HAE A;  4ZCK A;  3M4Y A;  3HOY H;  1YJN A;  2Q2I A;  1SYB A;  4MN3 A;  5IYC G;  4KJN A;  2KEC A;  4JI8 Q;  5JPM C;  2I0Q A;  4U67 3;  3I4N B;  4HIK A;  2B63 B;  4A93 B;  1F9R A;  1UEB A;  2B2T C;  2WKD A;  2A19 A;  4DR2 L;  3T1H Q;  4GNX C;  2KEN A;  5IGC A;  2DNE A;  4QIW B;  4PQX A;  3RLF A;  1E1O A;  4DK3 C;  1A3U A;  1KNE A;  2F0W A;  3BVG A;  2BE5 D;  1LTL A;  4JW0 A;  1JWM D;  3CAM A;  5CGK A;  4XTC S;  4QUF A;  1IKL A;  2EQS A;  2UXC Q;  1K83 B;  2P5Z X;  3Q24 A;  2OXP A;  3VR3 A;  2RHQ B;  4HCS A;  1FJG Q;  1X3Q A;  4JI0 L;  3I4M G;  1BBW A;  1EY7 A;  3RN2 A;  1Q12 A;  3UDG A;  4DR4 Q;  2VS1 A;  1GHJ A;  3FKI G;  3GTQ H;  4JYA L;  1TWC B;  3KLR A;  2ICE C;  3CQZ H;  4FDB A;  3F2C A;  1FVI A;  2A69 C;  3J81 E;  1K28 A;  1RIP A;  3MEH A;  1SYE A;  4LUV A;  4R4Q A;  4RGT A;  4YIJ A;  3KYH C;  5D3D A;  1X55 A;  1D5X C;  1NAP A;  2EY6 A;  5COY A;  2B2U A;  1JCK B;  1HNZ Q;  3R3O A;  2M2L A;  4J8Q A;  4IUU A;  3CME A;  4UY8 C;  3KDF A;  4A4I A;  1VQC A;  1C48 A;  3SXH A;  5GQO A;  2EYL A;  2JN4 A;  1YJW A;  3NUC A;  2YTY A;  3G6J B;  1NE3 A;  1PRT C;  3H0G B;  1QIL A;  4UAI A;  3QB3 A;  1K8M A;  1EFW A;  3KF8 B;  1J9O A;  3CU7 A;  1XPU A;  1EWH A;  2FMM A;  2A6E D;  1J8I A;  4R9W A;  4DV7 Q;  1PH6 A;  1J6Q A;  2OTL A;  2AMC B;  4RHS A;  3MXN A;  3HOY G;  2JA8 H;  2NBF A;  1TWF B;  4X66 Q;  1EOT A;  2OWO A;  2NVT H;  1SNC A;  1N33 L;  1VQ8 A;  5M5X H;  4KJO A;  5EBC A;  3JAM i;  1IBK L;  4KK7 A;  4DR3 L;  4AYB B;  2QEJ C;  5GAH C;  1BR9 A;  5E7N A;  2E2D C;  4BXX H;  2A6H D;  2JA7 B;  5EPL A;  4B3R L;  1PTO C;  3IFT A;  1EIY B;  4C2M H;  2K1B A;  2PW7 A;  5C5L A;  4TVA B;  1FYC A;  5I6Y A;  2LKV A;  1KAA A;  4JI7 Q;  1QOH A;  1CZG A;  2EY5 A;  5JJK A;  2R7F A;  1WYD A;  1UE7 A;  3ZJY C;  2F4V L;  3EA6 A;  3ICE A;  4FXG C;  1HR0 L;  1SMY C;  3HFZ B;  2B2W C;  3LWE A;  2UXD L;  3S1Q H;  4LF6 Q;  1TS5 A;  1T5X D;  4UP8 A;  2I5M X;  3I4L A;  5CYU A;  4A3K G;  4P2C B;  1GHK A;  2BCO A;  2EY2 A;  4KHV A;  4L6T B;  3NHH A;  4P72 A;  2D2C C;  1PZI D;  5EPK A;  4IFD H;  2ASB A;  3A8J E;  1G51 A;  3S17 H;  5G3L D;  2BDN A;  3CW2 C;  3P7J A;  1HPC A;  4OWW B;  2EXZ A;  2MFI A;  1A6X A;  1ENF A;  4N8X 1;  1PH1 A;  2B2T A;  4IUQ A;  5E1F A;  1TWH H;  1NR2 A;  1TII D;  4GNX A;  1YNX A;  4LUZ A;  4QCL A;  1DM0 B;  3NSW A;  1II3 A;  1OTC A;  2CWP A;  3J81 c;  1PXU A;  4X3T A;  1JJC B;  2HUG A;  4DV3 L;  3CCM A;  3CPF A;  3FPP A;  2F0E A;  3NEM A;  1SR3 A;  3I4M B;  4GN4 B;  5C0X G;  1P8L A;  4DNR B;  3RN5 A;  1HFN A;  4DK1 A;  2M00 A;  2JA8 G;  3L2P A;  3OSO A;  1WCM G;  3D4D A;  4H7B A;  1R4P B;  2EYP A;  5JAV A;  4PV1 C;  1I4X A;  3CPW A;  3SVM A;  1QUQ A;  4DR6 Q;  4JK1 C;  4A3J H;  1GVP A;  4BXX G;  5C44 H;  4B3S Q;  1N32 L;  4AH6 A;  3D6C A;  3E5S A;  3I91 A;  4YWK A;  2KEE A;  3G6E A;  2EYF A;  3T16 A;  3PIO 3;  4TRD A;  3P20 A;  1BCP F;  1HZB A;  4BBR G;  3J81 j;  2WKC A;  1IW7 C;  1I50 H;  1DOK A;  4JI3 Q;  1HTP A;  5C4X B;  1JOR A;  3K5N A;  1QZH A;  2YTX A;  2NVY H;  4U68 A;  5M5W H;  1SDF A;  2EJM A;  2GN5 A;  2VQF Q;  4LWC A;  1ET9 A;  1CUK A;  3FDT A;  4XT3 B;  3A8K E;  4JOI C;  1MHW C;  1U4R A;  5M3M H;  5FLM H;  2RCN A;  2ICI A;  4NW2 A;  1M1K C;  1Q82 C;  2FJ2 A;  1W6J A;  1NSN S;  2A73 B;  3URY A;  2EDG A;  1PTO H;  1UE6 A;  1NTG A;  3L9A X;  5H1S E;  2IHF A;  1EQT A;  4HCE A;  5HGQ A;  3DWP A;  3IRB A;  1TT2 A;  4LMQ D;  4CKB A;  3HOV G;  2XWJ B;  2B8G A;  4YCW A;  3H94 A;  1I6V C;  2CHB D;  2E75 C;  5D14 A;  1UUP A;  1EY5 A;  5E4X A;  1PYS B;  1VQA A;  1EIH A;  3K80 C;  2A1A A;  3EN2 A;  4R8I A;  5C4J H;  2SOB A;  1SE8 A;  1XXG A;  1Q46 A;  4IUV A;  3H6M A;  5J1Z A;  1DD2 A;  1YHQ A;  2E2I H;  2C35 B;  2RSN A;  4DR4 L;  1ESF A;  1VQF A;  2E2H B;  1S5E D;  2AQ2 B;  4K14 A;  4HSV A;  4K8J A;  1ENC A;  2B2W A;  4L8J A;  4ZAI A;  4A3J G;  4A3K B;  2ZXP A;  2F0I A;  3RUZ A;  5IOD A;  3HS0 C;  2K28 A;  2PZW A;  2VB3 X;  3EQL C;  5FK9 C;  3K5M A;  3EVQ A;  4ZUI A;  1H9M A;  1Y8O B;  4KKU A;  2Z6K C;  4RCO A;  3HOX H;  2HD3 A;  1HNZ L;  4DR5 Q;  1G2S A;  2K7V A;  4GKK L;  3KLS A;  1PHJ A;  3CCJ A;  1VQ4 A;  4F88 A;  4HED A;  2F52 A;  4L5Q A;  4IN3 A;  2ZJQ A;  4DR1 Q;  2WFW A;  4X62 Q;  5M3M G;  5FLM G;  4FYD A;  3U4Z A;  1HRJ A;  2CVR A;  2EJF C;  4DV7 L;  3OIQ A;  4QL5 A;  4DNT B;  1WCM B;  2OF1 A;  4DR7 Q;  3DM1 A;  4XT1 B;  3D0F A;  4LF5 Q;  1EY8 A;  1FL0 A;  4DAV A;  1TS4 A;  2F0V A;  3NBH B;  2VXW A;  4X66 L;  2Y0S B;  5J39 A;  2DUD A;  2OTJ A;  1JMC A;  1SE4 A;  5EKL A;  2DNC A;  1GO3 E;  1HNW L;  3TP5 A;  2X6G A;  1FNV A;  4DV5 Q;  4DV6 Q;  4BBR B;  1UE5 A;  1Z9F A;  4LFA Q;  3NXW A;  1LUZ A;  2F0L A;  1IL2 A;  2R3Z A;  1H9S B;  1SND A;  4KI0 A;  1NNX A;  3MFG A;  1HA5 A;  1LM0 A;  4K5W A;  1BUV T;  4JI7 L;  1QG7 A;  4HJA A;  2SEB D;  5GAG C;  3GTK B;  1UAP A;  2QA4 A;  1WOC A;  1PDQ A;  3I4N H;  2ZJP A;  2B63 H;  4JOI A;  1IHZ A;  4A93 H;  1HFG A;  1LAC A;  4LF6 L;  3HOU B;  3UDF A;  3G71 A;  1G6Z A;  4DV0 Q;  2PW5 A;  1BOS A;  2WV6 D;  4F87 A;  3UDX A;  4K0K Q;  2N78 A;  1A63 A;  2ZTD A;  3FHW A;  4CGY B;  2LS0 1;  1K83 H;  3HOV B;  3NP8 A;  1EQV A;  2XRQ D;  5DNF A;  3DHQ A;  2HCI A;  1IL8 A;  2EJG C;  2JA6 B;  2QKI C;  3I90 A;  3PIP A;  5DEH A;  4B3M L;  1CSQ A;  4XQN A;  4IPD A;  3S16 B;  4A3C H;  1VQE A;  5E3F A;  2NN6 H;  1I4Q A;  2KCM A;  1GUW A;  2L0C A;  1E3P A;  3JAM L;  4A3G B;  3QR8 A;  5T1I A;  3SK6 A;  1UE1 A;  1BCP D;  1Q90 A;  4GZY C;  4C3J G;  1SRO A;  2H1E A;  2AUJ D;  2BDO A;  3OTO L;  4F7X A;  4NXN Q;  4DR6 L;  3BZK A;  4ZUJ A;  2CW0 C;  3HEJ A;  1KHI A;  3H0G H;  3Q23 A;  1STA A;  1VCI A;  4X65 Q;  2KA7 A;  1BQQ T;  3E0E A;  4V0B A;  1I50 B;  2Z6K A;  2IX1 A;  2WIN B;  3ND8 A;  3MXG A;  5A2Q E;  1O7Z A;  5LHY 1;  3M7N A;  1SJH D;  3MXP A;  4DKA C;  1MKH A;  1NUC A;  5IGE A;  1EY9 A;  2K5Q A;  4QF4 A;  1AFP A;  4IUR A;  4HSP A;  4RHR A;  2K4K A;  1RTO A;  5C3X A;  2MJ8 A;  1TVX A;  5ELB A;  3KF8 A;  4P74 A;  4YY3 Q;  5KIX A;  3GO5 A;  1F9P A;  3I4N G;  2XIW A;  1DOM A;  4G7H C;  4JI5 L;  1Y8N B;  3STB C;  4ZLT F;  3F2U A;  4A93 G;  4EQO A;  2VQF L;  3OOC A;  1GM5 A;  1JT8 A;  2Z8L A;  4R4C A;  2PQE A;  1E2V A;  1SLJ A;  1TWG B;  3U9O A;  2JA7 H;  4S3S A;  1Z47 A;  3J7Z C;  1VQL A;  2HDM A;  3GQB A;  1SNM A;  4B3T Q;  3MTS A;  1QVG A;  1ONL A;  5IP7 G;  3RMH A;  2EZV A;  1VMC A;  3DM3 A;  3E0J A;  5FLX E;  4PG3 A;  4A3C G;  1PV4 A;  1I3Q H;  3PF4 A;  3U9S A;  1L1O B;  5ELD A;  3STB D;  4HID A;  2NN6 G;  3CCR A;  3D3R A;  2N88 A;  4YWM A;  1CM9 A;  3CMA A;  1KQS A;  1PH2 A;  1DJR D;  1ENA A;  2PQA A;  1W3S A;  4MTK A;  2CH4 A;  2XGT A;  4N9T A;  3HOZ G;  1IBL L;  1RTN A;  1XTD A;  2NWG A;  1IXR A;  3A8I E;  1ML0 D;  1PH5 A;  4KLK A;  1JR0 D;  1LT6 D;  1F2Z A;  2DY8 A;  1JJ2 A;  3H3V C;  5IWA Q;  1V1Q A;  4L5S A;  2F1M A;  4KHP L;  2PMZ E;  2Z6B A;  3TRZ A;  3X3N A;  3H0G G;  1G8Z D;  1B4O A;  1STH A;  2EPB A;  3WWV A;  1U5K A;  2WAC A;  5FO7 B;  3HKZ E;  5AJ3 L;  3R2I A;  2OCE A;  4JC0 A;  2KHJ A;  2E76 C;  4PMB A;  2E74 C;  3QIA A;  2LSS A;  3NE5 B;  3CC4 A;  3WOF A;  4L63 B;  4IFD I;  5C6A A;  1ET6 A;  3HGB A;  4ZKC B;  5IYB H;  3H15 A;  5C3E B;  2MP1 A;  5DAU A;  1UWV A;  4GLX A;  2AHO B;  1E2Z A;  4KD3 A;  1Q86 C;  4P71 A;  5D65 A;  2VW9 A;  4JG2 A;  1EIF A;  3P1H A;  2B2Y C;  4X62 L;  2WB1 G;  4CDD C;  3I8Z A;  1M8A A;  2KCT A;  1PFS A;  4C3J B;  3CCS A;  3IAY A;  1SNP A;  2YTV A;  3L0O A;  1GXD C;  2NTS A;  3CCU A;  3SR1 A;  1L0Y B;  3OWE B;  5C4X H;  2CQA A;  2RVL A;  2A74 C;  4BY7 H;  2CKZ B;  4J6H A;  4LJZ C;  1G91 A;  4JI2 L;  5CBA E;  2BE5 C;  3CP0 A;  3WDN A;  3N6R A;  1B3A A;  1A8V A;  1AN8 A;  1VQG A;  3I72 A;  4DV5 L;  3A74 A;  4DV6 L;  3BVZ A;  3K0Y A;  4UHV A;  3MEF A;  4RMF A;  4LUO A;  1CKN B;  3BDO A;  3LGJ A;  2X6L A;  1KAB A;  3GDE A;  1TKW B;  5M9O A;  3VR5 A;  3VDY A;  5LMN L;  1XJV A;  1JB3 A;  4A3M B;  2IHE A;  1NMG A;  4G57 A;  4G7Z C;  3SHL A;  3I2Z A;  2VUM H;  1YBY A;  1E7Z A;  1XWE A;  4OO1 I;  2D0P A;  1XNR Q;  4EQ5 A;  2O5I C;  4NPS A;  4DV0 L;  4B08 A;  4O1N A;  4LFC Q;  3DEO A;  3TN2 A;  4Q5V A;  1WJJ A;  5EQ0 A;  3VYS A;  3K8A A;  3DWA A;  1PZK D;  5CBE E;  5IYB G;  2ZXR A;  4NXM L;  2UUB Q;  3TDQ A;  2L5T A;  1VQO A;  2K14 A;  4A3I G;  4EVO A;  2A6E C;  2E2H H;  1RDP D;  1IYV A;  2N55 A;  1K8A C;  1SE3 A;  3H3V H;  4MTN A;  3SEB A;  3G7L A;  1BF4 A;  3RZD B;  3SE0 A;  2AWN A;  1SYG A;  1A15 A;  4A3K H;  1AP0 A;  3HOZ B;  4OON A;  4FP5 D;  3ERS X;  3T53 B;  1VDZ A;  3OMG A;  2K5D A;  1BDO A;  1PYW D;  1ICF B;  1E22 A;  3S1N H;  1K73 C;  2LFN A;  1KDC A;  4DAP A;  3T56 B;  4E6I A;  2BH8 A;  1VQM A;  4IFD J;  5C4X G;  5IGG A;  5EJW A;  4JV5 Q;  4H02 A;  5F2D A;  1W6K A;  1OXX K;  3PQI A;  5DM7 3;  4BY7 G;  2LMC B;  2A6H C;  3BJU A;  4LF7 Q;  3OW7 A;  4LF9 Q;  1G6P A;  2B2V C;  4QUC A;  1X3P A;  1EEF D;  3V96 A;  1YHA A;  2F3I A;  3PO3 H;  3Q6S A;  5C0X H;  3M4Q A;  4GOP C;  1FGB D;  4DAY B;  1QJO A;  1WCM H;  1AEX A;  1JIC A;  5IGF A;  4X64 Q;  1A2T A;  4CDE C;  2J7Z A;  4YY3 L;  5IT9 E;  4FF4 A;  3DWQ A;  2RDF A;  4A3F G;  1PA6 A;  3PO2 G;  2VUM G;  2J4X A;  4A3D B;  3OPO A;  4IOC A;  1D1K A;  2WB1 B;  2XVS A;  2K04 A;  5K36 H;  5IIF A;  4ALP A;  4R1J A;  4DV2 Q;  1B9N A;  1C0A A;  3NBH A;  3N52 A;  1DOL A;  4BBR H;  4DV1 Q;  2L4N A;  1X9N A;  1RD9 D;  3A54 A;  5BR8 Q;  3K7A B;  5EAY A;  5I4D A;  4NDX A;  1EZ8 A;  1I3Q B;  4GN5 A;  2ZXO A;  2D0O A;  4K8I A;  2KJX A;  1F2Y A;  1KNA A;  1L1O C;  4GLA C;  4N9P A;  1BKB A;  4H0L C;  3GTK H;  4FF1 A;  1VQN A;  5I9O A;  2JE6 I;  4OWT B;  4DUZ L;  3LNN A;  1H9S A;  3RLN A;  1H9J A;  5C3W A;  5GAD C;  5IGB A;  3SK8 A;  2IPK D;  3I55 A;  3HOU H;  1Y1V B;  1GUT A;  3KBG A;  4A76 A;  4HTH A;  2ATW A;  1BCP B;  1KIX A;  2LXK A;  4HJ8 A;  1MIU A;  1RCV D;  2C9O A;  2MHV A;  4HJ7 A;  4YCU A;  2CH4 W;  1Y69 U;  1QNU A;  2KOL A;  4BS9 A;  1QVC A;  2EYO A;  3HOV H;  4K6D A;  1F2M A;  2IWH A;  2CCZ A;  1HQM C;  3MHB A;  4LFB L;  1GD7 A;  1K8G A;  5CV7 A;  2O4X A;  2HQE A;  2R7D A;  2JA6 H;  3PV0 A;  4PMW A;  1JE5 A;  1A0I A;  3NQT A;  4TKO B;  2UUC Q;  3CCQ A;  3S16 H;  3K81 C;  2XRS D;  3PO3 G;  1DCZ A;  4FNF A;  3J7Y W;  1N34 L;  2MO0 A;  3J7A F;  4DAM A;  3TZD A;  4EQN A;  2RA4 A;  3DLL A;  4A3G H;  3UE0 A;  3KF6 A;  4F8M A;  4XXE A;  4A3I B;  3J81 i;  4JI6 L;  4KY5 A;  2C5C A;  2Y0S G;  2F0T A;  2FMC A;  1NMF A;  1PFB A;  4O2D A;  4C3H G;  5CV6 A;  5K36 G;  1YNJ D;  3M4P A;  5ELC A;  3PCO B;  1ILQ A;  1LV9 A;  1BNZ A;  1XNQ L;  3TS2 A;  3NTI A;  3D4R A;  1X65 A;  1SFO B;  1JQY D;  2NN6 I;  1Q7Y C;  5BN5 A;  4JBJ A;  4R4I A;  1PH9 A;  2HDL A;  3HKZ B;  3OYY A;  4BY7 B;  5LMU L;  1SSO A;  2OQ0 A;  3M7G A;  1S3O A;  2KHI A;  4FO2 A;  1JC7 A;  2G5D A;  1W2B A;  4IPH A;  1UEA B;  1Q81 C;  4HIM A;  4CKE A;  4WOR A;  1XYI A;  5JJZ A;  3R8B A;  3HOU G;  1EYD A;  1ZYR D;  2GVB A;  1EZ6 A;  1RKN A;  2DN8 A;  3KK7 A;  3K59 A;  2A68 D;  3LX0 A;  2R92 H;  1TWG H;  3KLW A;  3CKI B;  2ID0 A;  4JI8 L;  3EFX D;  3W1B A;  3Q8D A;  1I4H A;  4A3F B;  4TQU S;  3PO2 B;  2VUM B;  4IJL A;  5T1G A;  1NJI C;  1O80 A;  4JBW A;  3T1H L;  1UNS A;  3W1G A;  4ME5 A;  1YNN D;  2V1C C;  4PNY A;  1BO0 A;  1HZA A;  2K03 A;  1Y1W H;  2JA6 G;  2XTI A;  1DGS A;  4IUT A;  1LTI D;  1KLU D;  1XNR L;  2UXC L;  2PZU A;  2UUA Q;  3VR4 A;  3BZD B;  3K6O A;  1FJG L;  2K52 A;  4LFC L;  4G7O C;  4JI1 Q;  4A3G G;  3DMU A;  1KRS A;  1MI2 A;  4XYQ A;  1U4L A;  4QY7 A;  2JEB I;  4JBM A;  1L1O A;  1LTR D;  2RSO A;  1SAP A;  5IE8 A;  2F0Q A;  2FFK B;  5A35 A;  1EUJ A;  1YJ9 A;  3S1N B;  2HQL A;  1HZ9 A;  3L3O C;  4DFA A;  4WJ3 M;  4UP9 A;  3K57 A;  4HN7 A;  1N8R C;  4GKJ Q;  2EXD A;  5FJ8 H;  4DXG A;  3PIP 3;  4CKC A;  4H13 C;  3W3A A;  2ZTE A;  2WAQ E;  1E1T A;  1TQO A;  4B9W A;  4RKB A;  2JA5 B;  1E0B A;  2EYM A;  1CHQ D;  4YCV A;  5C3E H;  5ELO A;  2JEA I;  2EY1 A;  3PO3 B;  4P75 A;  3SK4 A;  2BH2 A;  3I70 A;  1LAB A;  3MXN B;  4BA1 I;  4DV4 Q;  3S15 H;  2UXB Q;  5FO8 B;  1GUG A;  2R92 G;  2IY5 B;  1C4Q A;  5IOC A;  2Z4I A;  4C3J H;  3SGI A;  3ONA B;  3MXU A;  3L7Z C;  4X64 L;  1S40 A;  3QOJ A;  3OMC A;  4C3H B;  4R4O A;  2K5H A;  3VR2 A;  5KNC A;  1EQR A;  1HNX Q;  1EFI D;  1Y1W G;  2D5D A;  2ZM6 Q;  1JE4 A;  1N36 Q;  1ASY A;  1G29 1;  4QJF A;  1HA6 A;  1QWY A;  2IJ0 A;  1OXS C;  1Y14 B;  5EGT A;  3M3Y B;  4QIW E;  1AE3 A;  4C1N K;  1O7Y A;  1I4G A;  1WTH A;  4DV1 L;  1O78 A;  3M9B A;  3NEL A;  5BR8 L;  2NB0 A;  5M5Y B;  3R2T A;  5HGT A;  1AW7 A;  1KC8 C;  5C4H A;  4OIJ A;  5I2Y A;  1EY4 A;  1LO5 D;  1V1O A;  3OIP A;  5AFW A;  1S5B D;  4MIU A;  4A3M H;  1CKN A;  4C1N I;  3D8G A;  1M4V A;  2LY7 A;  4POF A;  1K3R A;  4X3S A;  1BCP C;  1DYQ A;  1LTG D;  1KAW A;  5FJ8 G;  3F1Z A;  4IUN A;  1BBU A;  3T13 A;  2F0F A;  5IP7 H;  1AZQ A;  3MA2 B;  1X3G A;  3DXJ C;  3I4O A;  1IYJ B;  2L12 A;  5C3E G;  1A3V A;  1FNW A;  1GUO A;  1VQ7 A;  1KXL A;  4OL7 A;  4KMU C;  2B3G A;  2Q8R E;  4JI0 Q;  2Q2T A;  1VQ6 A;  3RZO B;  1SE2 A;  4POG A;  3ERQ A;  3CXC A;  3RZD H;  1X54 A;  3C3L A;  4A3B B;  4OEM B;  4RFB A;  3RD4 A;  3HOZ H;  1EU3 A;  1SBB B;  5CV8 A;  1LLR D;  4EX5 A;  4JYA Q;  4R8N A;  5D3I B;  1QVF A;  5JJL A;  4Z9C B;  2F0N A;  1K3B C;  3S9W A;  4IO9 A;  1V9P A;  2NYZ D;  3ER0 A;  4RAU C;  1VQB A;  3NTK A;  3GTO B;  5M3F H;  4KTA A;  1PFM A;  2ZT9 C;  4K5X A;  1N9W A;  4HR7 B;  4B3S L;  4PZ6 A;  2G9D A;  2N8N A;  4ZRZ A;  3VYT A;  3H3V I;  2L15 A;  4KY7 A;  1STY A;  4AYB E;  1BBX C;  2IT1 A;  3PF5 A;  1ZXT A;  3CRL C;  2XN9 C;  4LNQ A;  1MD2 D;  4JI3 L;  3GTM B;  1SMX A;  1B53 A;  4GOP B;  3ITP A;  1TR5 A;  3AU7 A;  2BA0 A;  4OWX B;  2EE1 A;  1Q1E A;  2ALY B;  3BDL A;  1NY4 A;  2PI2 A;  4GN3 B;  3R93 A;  4IQZ A;  1WI5 A;  5LMN W;  3A5U A;  4DUY Q;  3NBI A;  2SDF A;  2K6A A;  5J3B A;  4A3M G;  4K6L A;  3QO2 A;  1I5F A;  3PUW A;  1JOQ A;  4JI4 Q;  3EBE A;  4A3D H;  3G48 A;  4AIM A;  2R92 B;  1KDA A;  4DAY A;  3J80 E;  3U50 C;  4CJ2 C;  1XTC D;  2KED A;  1N33 Q;  4MZ9 A;  3I56 A;  1HXY D;  5KYL A;  3ERO A;  4DR3 Q;  5KND A;  5C0X I;  5IYD H;  1HQR D;  3MAQ A;  5JVH 3;  1XPO A;  3K7A H;  1V1P B;  1Y1W B;  3GTP H;  3K7U C;  2EVB A;  1Z6H A;  4B3R Q;  1GKH A;  1K8O A;  5CV4 A;  1WD1 A;  4DK6 C;  3E6Z X;  3B6Y A;  3MVV A;  3TBI B;  1B3Q A;  1EYA A;  1XX8 A;  3J81 L;  3F2B A;  1TWA B;  1VS0 A;  2NUC A;  2OT2 A;  4RWS C;  2ZJR A;  1PRT F;  3IFD A;  1HUM A;  4DF7 A;  1QCB D;  1Y1V H;  2K5N A;  1C7Y A;  2JXM B;  3OWF A;  1MSG A;  1T9H A;  2EOT A;  2UXD Q;  3NPP A;  4I7Z C;  2MPM A;  2TMP A;  3VYR A;  1PH4 A;  5M3F G;  2FIN B;  2HCC A;  1YIJ A;  4DA2 A;  1SYF A;  2L9H A;  1EU4 A;  3M85 A;  1KTK A;  5GRO A;  5C4Z A;  1XMO Q;  4G4K A;  4K2K A;  2HHH Q;  4FXD A;  4DXF A;  4DR5 L;  3FPU B;  1R9T B;  1RF2 D;  3T4A C;  1EWC A;  3PGZ A;  2TSS A;  2A5H A;  3CCE A;  2AKW B;  2K32 A;  3RLO A;  4RGO S;  1PTO F;  4DV3 Q;  1PYB A;  3HG9 A;  4A3I H;  5EKK A;  2CFM A;  1TY2 A;  5NUC A;  4DR1 L;  3AEV A;  4J1M A;  1FGU A;  2L55 A;  3AB9 A;  3K0X A;  4A3D G;  1TS3 A;  3S15 B;  1TY0 A;  1VQI A;  4WJ4 A;  4RGM A;  3ZYY X;  5TSS A;  4KN4 C;  4MNO A;  4ODG A;  3S24 A;  1PVO A;  3BVM A;  4DR7 L;  3S1R B;  1EEI D;  4LF5 L;  1Q8I A;  5IYD G;  2IL8 A;  1H9R A;  4N8F A;  4BY1 H;  1SFO H;  3QOL A;  1VF5 C;  1N32 Q;  2E8G A;  3HRZ C;  4IAL A;  1WTQ A;  1VQK A;  1K0S A;  1B70 B;  2DGY A;  3JAM E;  4Y52 H;  1MJE A;  5IP9 H;  3K5L A;  2F0M A;  3TQY A;  1O7L A;  1HNX L;  1HR0 W;  3IL8 A;  4ULL A;  2ZM6 L;  3MZ5 A;  1KDB A;  4LFA L;  3BYY B;  1L0X B;  1N36 L;  2R61 A;  2RBM A;  1YHB A;  3VA7 A;  3A0J A;  4QMG A;  1EQQ A;  2F0D A;  3J80 c;  3BYT B;  1CTM A;  5CR3 A;  3PMF A;  1B1Z A;  3X3M A;  1Y1V G;  4UPA A;  1MGS A;  1QZG A;  1S4Z A;  2RQX A;  4KY6 A;  1QNK A;  1IKM A;  2B29 A;  4BBS H;  4ABN A;  5BN4 A;  1HCZ A;  1I94 Q;  5C0X J;  4YHH Q;  4CJ0 B;  4A3F H;  1B9M A;  4HMI A;  3PO2 H;  1CA5 A;  3CHB D;  5FLX c;  5HUR A;  1DXM A;  4C3I H;  3PUX A;  3AQQ A;  5DM6 3;  1CHP D;  4L5R C;  2YU9 B;  3ULL A;  3FVQ A;  1WTR A;  2KVM A;  2H5X A;  3SDZ A;  5CV5 A;  1SNQ A;  3GTG B;  4K0K L;  4CBV A;  4JVZ A;  2PZT A;  2CWA A;  4OHJ A;  3K58 A;  2QW7 A;  3CRK C;  3KJP A;  4KD4 A;  3TS0 A;  4A3L H;  4HJ5 A;  1WTP A;  2VQE Q;  5I9P A;  3KJO A;  1GJX A;  4BA2 I;  1D1I A;  3GV3 A;  2MQH A;  1JB7 A;  1RJT A;  2K5V A;  2EYH A;  1E2W A;  2L1B A;  4RGN A;  1F9Q A;  5KGU A;  3PUV A;  1I6H H;  4AQY Q;  3DEP A;  1K0R A;  4EQP A;  2NTT A;  2IX0 A;  4BY1 G;  1X56 A;  4CHT B;  2K05 A;  1FR3 A;  3GTJ H;  5M3F B;  5L37 A;  3TME A;  1XMQ Q;  4A3E G;  3HOW H;  3HKZ G;  5IP9 G;  1EY6 A;  4NXN L;  3D4W A;  3D6W A;  1WTV A;  2Y0S E;  4I7A A;  3P75 A; 
#chains in the Genus database with same CATH homology
 1JWS D;  2B8F A;  3J7A V;  4EGV A;  3QWN A;  2JP1 A;  2XNA C;  3BS1 A;  4XIG S;  3C46 A;  3NQI A;  5JEA H;  1A2U A;  1VF7 A;  2F0H A;  1A3T A;  1PLF A;  3VR6 A;  4I65 A;  2A69 D;  4KV6 A;  2PCF B;  2B2Y A;  4C3I G;  3SK5 A;  2Z4H A;  3S2D B;  2Q8T A;  2R7Z B;  1HUN A;  1STE A;  1B44 D;  4TSS A;  3C2P A;  2KHS A;  3GTP B;  2D62 A;  2KCN A;  1PRT D;  3O13 A;  2R93 B;  2L11 A;  2RDG A;  2AQ1 B;  1LT3 D;  3KLS X;  3H09 A;  4UDU C;  2F0J A;  4RKL A;  2M9V A;  3M4O B;  3K5O A;  1STN A;  1LTT D;  2NVQ B;  3TP7 A;  1LTA D;  2I07 B;  1SYD A;  2F0G A;  3FMC A;  1EYC A;  2AWO A;  3BDC A;  1STB A;  4NKL A;  4OGQ C;  1LT4 D;  1WD0 A;  1YNJ C;  4BWG B;  2J0T D;  1WTW A;  4XYO A;  4KKT A;  5EPJ A;  3MFY A;  2F3V A;  1PTO D;  2PO4 A;  1D6E C;  1C8C A;  2VB2 X;  1JOO A;  1HHV A;  5JEA G;  3A56 A;  4H44 C;  4PMC A;  3PUY A;  3AMU A;  5K5P A;  1CT1 D;  1Z7T A;  2VNU D;  4LAA A;  1JWU D;  2QIL A;  4ZKB B;  4ZYS A;  1SMY D;  1R4Q B;  3S14 B;  3HP3 A;  1ZYR C;  2NVX B;  2QCP X;  4DK0 A;  2PMZ B;  2F3W A;  2A68 C;  3FKI B;  3QG1 A;  3HZX A;  4BY1 B;  3S1M B;  4ZQ3 A;  4XDX A;  5EKI A;  2BA1 A;  3VA5 A;  4A3E B;  5I2X A;  4X3U A;  1YNN C;  5KRU A;  3T51 B;  4C56 C;  2B2V A;  5KEE A;  2F0O A;  1GUN A;  2OEO A;  1STG A;  1MBY A;  2IX3 A;  1CFM A;  4BBS B;  3A7L A;  1NR4 A;  4OO1 H;  4WJW A;  1DON A;  1OXT A;  4C3I B;  5JPN C;  4ZK9 B;  3OHX C;  3HOY B;  1U9R A;  4IFD G;  1HTL D;  2K33 A;  5JOB A;  1IW7 D;  4CJ1 B;  2RKS A;  1H9K A;  1V1P A;  2MUY A;  2G9H D;  1EY0 A;  4DU9 A;  1S5C D;  5CC4 A;  2F0U A;  4LK1 C;  4KKS A;  5I6W A;  1CI3 M;  1PZJ D;  1GOZ A;  1I6H B;  3GTQ B;  3EJI A;  2FHT A;  4X3K A;  3CQZ B;  1NCV A;  1D5Z C;  1PMR A;  2NZ1 D;  3GTJ B;  1SNO A;  3HOW B;  5A2Q L;  1V43 A;  2D9U A;  5EBD A;  2EYJ A;  3MC0 B;  4M8A A;  5FKA C;  1ILP A;  4ID6 A;  4KHZ A;  1CQV A;  3V2T A;  1GUS A;  2IW3 A;  1U4M A;  2KCC A;  2Q8I B;  4K5V A;  1OXV A;  4V19 0;  1QB5 D;  1G2T A;  3KUP A;  3J80 L;  4OO1 G;  2WP8 J;  4RH6 A;  1LT5 D;  1SYC A;  1B2T A;  5ISR A;  5KYI A;  4FF2 A;  2JYO A;  2JA8 B;  3TZU A;  1B50 A;  2NVT B;  5FLX L;  2F0P A;  5M5X B;  1LTB D;  4FVM A;  2F4I A;  3W2D A;  3TP8 A;  2O5J C;  3NWS A;  2AUK A;  4WFN 3;  1S5D D;  4C2M B;  4RA8 A;  2MGS A;  3MWY W;  1D2B A;  2F0S A;  4XQJ A;  3A7A B;  4Y7N B;  1VMP A;  3IKJ A;  5E4W C;  2WII B;  3I73 A;  2V4D A;  3S1Q B;  3GV6 A;  3V05 A;  2KUM A;  3DUZ A;  3A55 A;  1S5F D;  2K01 A;  2Z1C A;  2PYK A;  2H4O A;  2K5W A;  3Q22 A;  1SXT A;  3S17 B;  3FRP B;  5JVG 3;  1ZKO A;  4IUP A;  1TWH B;  5LL6 X;  3D31 A;  4NP5 A;  4ILW A;  1RHP A;  3VYU A;  2QF7 A;  1V8Q A;  3TP6 A;  1ROD A;  3WOE A;  1WTO A;  3PUZ A;  2GA4 B;  3ND9 A;  4FXK C;  1PFN A;  5CMD A;  4A3J B;  5C44 B;  4IZ8 A;  1PRT B;  3FEW X;  1IYU A;  3C1F A;  1JOK A;  1D5M C;  3C1E A;  1CZW A;  2F0K A;  1F2L A;  3UI2 A;  1EL0 A;  1Q3L A;  2O2L D;  2YYZ A;  2NVY B;  5M5W B;  3BG3 A;  4WRD A;  1AZP A;  1Y8P B;  1I4P A;  5CV9 A;  5M3M B;  4O42 A;  4RCN A;  2CW0 D;  5BN3 A;  4OIK A;  1FNU A;  5IGD A;  4QB4 A;  1PTO B;  1TU2 B;  1F77 A;  2DY7 A;  2XSC A;  1KLG D;  4KN7 C;  5LL6 S;  5COR A;  4K2L A;  3Q0A A;  5FOB B;  2XWB B;  4M1U B;  5KNB A;  1MSH A;  4XQQ A;  2BOS A;  1CQF A;  2SNS A;  3GD7 A;  1X32 A;  5ELF A;  5C4J B;  3I3C A;  1U4P A;  1ZEQ X;  2QDB A;  4Q0F A;  2E2I B;  2B2U C;  3GP7 A;  5J22 A;  1OO9 B;  4DN4 M;  4B9X A;  2SNM A;  4DGZ A;  2ENB A;  2E2J B;  1WTX A;  2I46 A;  1FD7 D;  3HOX B;  5G3L F;  1SEB D;  3KBX A;  5IT9 L;  3TSS A;  1ESR A;  2X69 A;  1I4R A;  5ELE A;  3GTL B;  3NK9 A;  1F9S A;  4FF3 A;  1LTS D;  3S2H B;  2PPB C;  3H91 A;  3NWT A;  2F03 A;  2R6G A;  2RDH A;  1DZ1 A;  4MHE A;  2WAQ B;  2KQ3 A;  1BXT A;  1Q1B A;  2PNR C;  1SJE D;  5C5M A;  3NTH A;  1ICW A;  5FO9 B;  1CK1 A;  4HMJ A;  2JSO A;  2AQ3 B;  4NMZ A;  2B39 A;  5JEA J;  1EIG A;  3LWU A;  1TS2 A;  3QJY A;  1QE6 A;  1WVL A;  1OXU A;  1T5E A;  1CA6 A;  4HAE A;  3M4Y A;  1SYB A;  4MN3 A;  4KJN A;  2KEC A;  5JPM C;  4U67 3;  3I4N B;  2B63 B;  4A93 B;  1F9R A;  2WKD A;  2B2T C;  5IGC A;  2DNE A;  4QIW B;  4PQX A;  3RLF A;  1A3U A;  1KNE A;  2F0W A;  3BVG A;  2BE5 D;  1JWM D;  5CGK A;  4XTC S;  4QUF A;  1IKL A;  1K83 B;  3Q24 A;  2OXP A;  3VR3 A;  4HCS A;  1X3Q A;  1EY7 A;  1Q12 A;  1GHJ A;  1TWC B;  3KLR A;  2ICE C;  2A69 C;  3J81 E;  3MEH A;  1SYE A;  4RGT A;  4YIJ A;  5D3D A;  1D5X C;  1NAP A;  2EY6 A;  5COY A;  2B2U A;  1JCK B;  3R3O A;  2M2L A;  4J8Q A;  4IUU A;  1C48 A;  3SXH A;  2EYL A;  3NUC A;  3G6J B;  1PRT C;  3H0G B;  1QIL A;  4UAI A;  3QB3 A;  1K8M A;  1J9O A;  3CU7 A;  1EWH A;  2FMM A;  2A6E D;  1J8I A;  4R9W A;  4RHS A;  3MXN A;  2NBF A;  1TWF B;  1EOT A;  1SNC A;  4KJO A;  5EBC A;  4KK7 A;  4AYB B;  2QEJ C;  1BR9 A;  2E2D C;  2A6H D;  2JA7 B;  5EPL A;  1PTO C;  3IFT A;  2K1B A;  2PW7 A;  5C5L A;  1FYC A;  5I6Y A;  2LKV A;  1KAA A;  1QOH A;  1CZG A;  2EY5 A;  3EA6 A;  4FXG C;  1SMY C;  2B2W C;  3LWE A;  1TS5 A;  1T5X D;  5CYU A;  3I4L A;  4P2C B;  1GHK A;  2BCO A;  2EY2 A;  4KHV A;  4L6T B;  3NHH A;  5EPK A;  2D2C C;  1PZI D;  4IFD H;  3A8J E;  5G3L D;  2BDN A;  3P7J A;  1HPC A;  2EXZ A;  1A6X A;  1ENF A;  2B2T A;  4IUQ A;  5E1F A;  1NR2 A;  1TII D;  4QCL A;  1DM0 B;  3NSW A;  1II3 A;  1PXU A;  4X3T A;  2HUG A;  3FPP A;  2F0E A;  3I4M B;  5C0X G;  4DNR B;  1HFN A;  4DK1 A;  2M00 A;  3OSO A;  4H7B A;  3D4D A;  1R4P B;  2EYP A;  5JAV A;  4PV1 C;  1I4X A;  3SVM A;  4JK1 C;  3D6C A;  3E5S A;  3I91 A;  2KEE A;  2EYF A;  3T16 A;  3PIO 3;  4TRD A;  3P20 A;  1BCP F;  2WKC A;  1IW7 C;  1DOK A;  1HTP A;  5C4X B;  1JOR A;  3K5N A;  4U68 A;  1SDF A;  2EJM A;  1ET9 A;  3FDT A;  4XT3 B;  3A8K E;  1U4R A;  4NW2 A;  2ICI A;  2FJ2 A;  1W6J A;  1NSN S;  2A73 B;  3URY A;  2EDG A;  1PTO H;  3L9A X;  1EQT A;  4HCE A;  3DWP A;  1TT2 A;  4LMQ D;  4CKB A;  2XWJ B;  2B8G A;  3H94 A;  1I6V C;  2CHB D;  2E75 C;  5D14 A;  1UUP A;  1EY5 A;  5E4X A;  1EIH A;  4R8I A;  2SOB A;  1XXG A;  4IUV A;  3H6M A;  5J1Z A;  1DD2 A;  2RSN A;  1ESF A;  2E2H B;  1S5E D;  2AQ2 B;  4K14 A;  4HSV A;  4K8J A;  1ENC A;  2B2W A;  4L8J A;  4ZAI A;  4A3K B;  2ZXP A;  2F0I A;  3RUZ A;  5IOD A;  3HS0 C;  2K28 A;  2PZW A;  2VB3 X;  3EQL C;  5FK9 C;  3K5M A;  3EVQ A;  4ZUI A;  1H9M A;  1Y8O B;  4KKU A;  4RCO A;  1G2S A;  2K7V A;  3KLS A;  4F88 A;  4HED A;  4IN3 A;  4FYD A;  1HRJ A;  2CVR A;  2EJF C;  3OIQ A;  4DNT B;  1WCM B;  2OF1 A;  3DM1 A;  4XT1 B;  1EY8 A;  4DAV A;  1TS4 A;  2F0V A;  2VXW A;  2Y0S B;  5J39 A;  1SE4 A;  5EKL A;  2DNC A;  3TP5 A;  2X6G A;  1FNV A;  4BBR B;  3NXW A;  2F0L A;  2R3Z A;  1H9S B;  1SND A;  4KI0 A;  3MFG A;  1HA5 A;  4K5W A;  1BUV T;  1QG7 A;  2SEB D;  3GTK B;  1UAP A;  1PDQ A;  1IHZ A;  1HFG A;  1LAC A;  3HOU B;  1G6Z A;  2PW5 A;  1BOS A;  2WV6 D;  4F87 A;  4CGY B;  2LS0 1;  3HOV B;  3NP8 A;  1EQV A;  2XRQ D;  5DNF A;  3DHQ A;  2HCI A;  1IL8 A;  2EJG C;  2JA6 B;  2QKI C;  3I90 A;  5DEH A;  4XQN A;  3S16 B;  5E3F A;  2NN6 H;  1I4Q A;  1GUW A;  2L0C A;  3JAM L;  4A3G B;  3SK6 A;  1BCP D;  1Q90 A;  4GZY C;  4C3J G;  2H1E A;  2AUJ D;  2BDO A;  4F7X A;  4ZUJ A;  2CW0 C;  3HEJ A;  3Q23 A;  1STA A;  1VCI A;  2KA7 A;  1BQQ T;  4V0B A;  1I50 B;  2IX1 A;  2WIN B;  3ND8 A;  3MXG A;  5A2Q E;  1O7Z A;  5LHY 1;  3M7N A;  1SJH D;  3MXP A;  1NUC A;  5IGE A;  1EY9 A;  2K5Q A;  4QF4 A;  1AFP A;  4IUR A;  4HSP A;  4RHR A;  1RTO A;  5C3X A;  2MJ8 A;  1TVX A;  5ELB A;  3KF8 A;  5KIX A;  3GO5 A;  1F9P A;  2XIW A;  1DOM A;  4G7H C;  1Y8N B;  4ZLT F;  3F2U A;  4EQO A;  3OOC A;  2Z8L A;  2PQE A;  1E2V A;  1TWG B;  3U9O A;  4S3S A;  1Z47 A;  2HDM A;  3GQB A;  1SNM A;  3MTS A;  1ONL A;  3RMH A;  2EZV A;  1VMC A;  3E0J A;  5FLX E;  3U9S A;  5ELD A;  2NN6 G;  3D3R A;  2N88 A;  1CM9 A;  1DJR D;  1ENA A;  4N9T A;  1RTN A;  2NWG A;  3A8I E;  1ML0 D;  1JR0 D;  1LT6 D;  1F2Z A;  2DY8 A;  3H3V C;  2F1M A;  3X3N A;  1G8Z D;  1B4O A;  1STH A;  2EPB A;  2WAC A;  5FO7 B;  3R2I A;  2E76 C;  4PMB A;  2E74 C;  3QIA A;  3NE5 B;  3WOF A;  4L63 B;  4IFD I;  5C6A A;  1ET6 A;  3HGB A;  4ZKC B;  5C3E B;  2MP1 A;  5DAU A;  1E2Z A;  4KD3 A;  5D65 A;  3P1H A;  2B2Y C;  3I8Z A;  1M8A A;  4C3J B;  3IAY A;  1SNP A;  1GXD C;  2NTS A;  3SR1 A;  1L0Y B;  3OWE B;  2CQA A;  2RVL A;  2A74 C;  4J6H A;  4LJZ C;  1G91 A;  5CBA E;  2BE5 C;  3WDN A;  3N6R A;  1B3A A;  1AN8 A;  3I72 A;  3BVZ A;  3K0Y A;  3BDO A;  2X6L A;  1KAB A;  1TKW B;  5M9O A;  3VR5 A;  1JB3 A;  4A3M B;  4G57 A;  4G7Z C;  3SHL A;  1XWE A;  4OO1 I;  2O5I C;  4B08 A;  4O1N A;  3DEO A;  3TN2 A;  4Q5V A;  5EQ0 A;  3VYS A;  3DWA A;  1PZK D;  5CBE E;  2ZXR A;  3TDQ A;  2L5T A;  4EVO A;  2A6E C;  1RDP D;  1IYV A;  2N55 A;  1SE3 A;  3SEB A;  1BF4 A;  3G7L A;  3RZD B;  3SE0 A;  2AWN A;  1SYG A;  1A15 A;  1AP0 A;  3HOZ B;  4FP5 D;  3T53 B;  1VDZ A;  3OMG A;  1BDO A;  2K5D A;  1PYW D;  2LFN A;  1KDC A;  4DAP A;  3T56 B;  4E6I A;  4IFD J;  5IGG A;  5EJW A;  5F2D A;  1W6K A;  1OXX K;  5DM7 3;  2LMC B;  2A6H C;  3OW7 A;  2B2V C;  4QUC A;  1X3P A;  1EEF D;  3V96 A;  3Q6S A;  5C0X H;  1FGB D;  1QJO A;  1AEX A;  1JIC A;  5IGF A;  1A2T A;  2J7Z A;  5IT9 E;  4FF4 A;  3DWQ A;  2RDF A;  2J4X A;  4A3D B;  3OPO A;  1D1K A;  2WB1 B;  2XVS A;  2K04 A;  5K36 H;  5IIF A;  1B9N A;  3NBH A;  3N52 A;  1DOL A;  2L4N A;  1RD9 D;  3A54 A;  3K7A B;  5I4D A;  4NDX A;  1EZ8 A;  1I3Q B;  2ZXO A;  4K8I A;  2KJX A;  1F2Y A;  1KNA A;  4N9P A;  4H0L C;  4FF1 A;  5I9O A;  2JE6 I;  3LNN A;  1H9S A;  5C3W A;  1H9J A;  5IGB A;  3SK8 A;  2IPK D;  1Y1V B;  1GUT A;  3KBG A;  4HTH A;  1BCP B;  1RCV D;  2C9O A;  2MHV A;  1Y69 U;  1QNU A;  2KOL A;  4BS9 A;  2EYO A;  4K6D A;  1F2M A;  2IWH A;  1HQM C;  3MHB A;  5CV7 A;  2O4X A;  2HQE A;  3PV0 A;  4PMW A;  3NQT A;  4TKO B;  2XRS D;  1DCZ A;  4FNF A;  3J7Y W;  3J7A F;  3TZD A;  4EQN A;  2RA4 A;  4F8M A;  4XXE A;  4A3I B;  4KY5 A;  2C5C A;  2F0T A;  2FMC A;  1PFB A;  4C3H G;  5CV6 A;  5K36 G;  1YNJ D;  5ELC A;  1ILQ A;  1LV9 A;  1BNZ A;  3NTI A;  3D4R A;  1SFO B;  1JQY D;  2NN6 I;  5BN5 A;  2HDL A;  3HKZ B;  4BY7 B;  1SSO A;  3M7G A;  4FO2 A;  1JC7 A;  1UEA B;  4CKE A;  4WOR A;  1XYI A;  5JJZ A;  3R8B A;  1EYD A;  1ZYR D;  1EZ6 A;  1RKN A;  2DN8 A;  3KK7 A;  3K59 A;  2A68 D;  3LX0 A;  3CKI B;  2ID0 A;  3EFX D;  1I4H A;  4A3F B;  4TQU S;  3PO2 B;  2VUM B;  5T1G A;  1O80 A;  4JBW A;  1UNS A;  4ME5 A;  1YNN D;  4PNY A;  1BO0 A;  2K03 A;  4IUT A;  1LTI D;  1KLU D;  2PZU A;  3VR4 A;  3BZD B;  3K6O A;  4G7O C;  3DMU A;  1MI2 A;  4XYQ A;  1U4L A;  2JEB I;  1LTR D;  2RSO A;  1SAP A;  2F0Q A;  2FFK B;  5A35 A;  3S1N B;  3L3O C;  4DFA A;  3K57 A;  4HN7 A;  4DXG A;  3PIP 3;  4CKC A;  4H13 C;  3W3A A;  1TQO A;  4B9W A;  4RKB A;  2JA5 B;  1E0B A;  2EYM A;  1CHQ D;  2JEA I;  2EY1 A;  3PO3 B;  3SK4 A;  3I70 A;  1LAB A;  4BA1 I;  5FO8 B;  1GUG A;  1C4Q A;  5IOC A;  2Z4I A;  3ONA B;  3MXU A;  3L7Z C;  3QOJ A;  3OMC A;  4C3H B;  3VR2 A;  5KNC A;  1EFI D;  2D5D A;  1JE4 A;  1G29 1;  1HA6 A;  1QWY A;  2IJ0 A;  1OXS C;  5EGT A;  3M3Y B;  4C1N K;  1O7Y A;  1I4G A;  1O78 A;  2NB0 A;  5M5Y B;  3R2T A;  5HGT A;  1AW7 A;  5C4H A;  4OIJ A;  5I2Y A;  1EY4 A;  1LO5 D;  1V1O A;  3OIP A;  5AFW A;  1S5B D;  4MIU A;  4C1N I;  3D8G A;  1M4V A;  2LY7 A;  4X3S A;  1BCP C;  1DYQ A;  1LTG D;  4IUN A;  3T13 A;  2F0F A;  1AZQ A;  3MA2 B;  3DXJ C;  2L12 A;  1A3V A;  1FNW A;  1GUO A;  4OL7 A;  4KMU C;  2Q8R E;  3RZO B;  1SE2 A;  3ERQ A;  3C3L A;  4A3B B;  4RFB A;  3RD4 A;  1EU3 A;  1SBB B;  5CV8 A;  1LLR D;  4R8N A;  5D3I B;  4Z9C B;  2F0N A;  3S9W A;  2NYZ D;  4RAU C;  3NTK A;  3GTO B;  4KTA A;  1PFM A;  2ZT9 C;  4K5X A;  4HR7 B;  2G9D A;  4ZRZ A;  3VYT A;  4KY7 A;  1STY A;  1BBX C;  2IT1 A;  1ZXT A;  3CRL C;  2XN9 C;  1MD2 D;  3GTM B;  1B53 A;  3ITP A;  1TR5 A;  3AU7 A;  2BA0 A;  2EE1 A;  1Q1E A;  3BDL A;  3R93 A;  4IQZ A;  3NBI A;  2SDF A;  2K6A A;  4K6L A;  3QO2 A;  3PUW A;  1JOQ A;  2R92 B;  1KDA A;  4DAY A;  3J80 E;  4CJ2 C;  1XTC D;  2KED A;  1HXY D;  5KYL A;  3ERO A;  5KND A;  5C0X I;  1HQR D;  3MAQ A;  5JVH 3;  1V1P B;  1Y1W B;  2EVB A;  1Z6H A;  1K8O A;  5CV4 A;  1WD1 A;  3E6Z X;  3TBI B;  3MVV A;  1EYA A;  1XX8 A;  3J81 L;  1TWA B;  2NUC A;  2OT2 A;  4RWS C;  1PRT F;  3IFD A;  1HUM A;  4DF7 A;  1QCB D;  2JXM B;  3OWF A;  1MSG A;  2EOT A;  3NPP A;  4I7Z C;  2MPM A;  2TMP A;  3VYR A;  2FIN B;  2HCC A;  4DA2 A;  1SYF A;  2L9H A;  1EU4 A;  3M85 A;  1KTK A;  5C4Z A;  4G4K A;  4K2K A;  4FXD A;  4DXF A;  3FPU B;  1R9T B;  1RF2 D;  3T4A C;  1EWC A;  2TSS A;  2A5H A;  2K32 A;  4RGO S;  1PTO F;  3HG9 A;  5EKK A;  1TY2 A;  5NUC A;  4J1M A;  2L55 A;  3AB9 A;  1TS3 A;  3S15 B;  1TY0 A;  4RGM A;  3ZYY X;  5TSS A;  4KN4 C;  4ODG A;  3BVM A;  3S1R B;  1EEI D;  1Q8I A;  2IL8 A;  1H9R A;  3QOL A;  1VF5 C;  4IAL A;  3HRZ C;  1WTQ A;  3JAM E;  3K5L A;  2F0M A;  1O7L A;  3IL8 A;  4ULL A;  3MZ5 A;  1KDB A;  3BYY B;  1L0X B;  2R61 A;  2RBM A;  3VA7 A;  4QMG A;  2F0D A;  3BYT B;  1CTM A;  5CR3 A;  3PMF A;  1B1Z A;  3X3M A;  1MGS A;  4KY6 A;  1S4Z A;  2RQX A;  1QNK A;  1IKM A;  4ABN A;  5BN4 A;  1HCZ A;  5C0X J;  4CJ0 B;  1B9M A;  4HMI A;  1CA5 A;  3CHB D;  5HUR A;  1DXM A;  3PUX A;  5DM6 3;  1CHP D;  2YU9 B;  3FVQ A;  1WTR A;  2KVM A;  3SDZ A;  5CV5 A;  1SNQ A;  3GTG B;  4CBV A;  2PZT A;  4OHJ A;  3K58 A;  3CRK C;  4KD4 A;  1WTP A;  5I9P A;  1GJX A;  4BA2 I;  1D1I A;  3GV3 A;  1RJT A;  2EYH A;  1E2W A;  2L1B A;  4RGN A;  1F9Q A;  5KGU A;  3PUV A;  3DEP A;  4EQP A;  2NTT A;  2IX0 A;  4CHT B;  2K05 A;  1FR3 A;  5M3F B;  3TME A;  1EY6 A;  3D4W A;  3D6W A;  1WTV A;  5T1I A;  3P75 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...