3JAMR

Cryoem structure of 40s-eif1a-eif1 complex from yeast
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
125
structure length
125
Chain Sequence
GRVRTKTVKRASKALIEKYYPKLTMDFQTNKRLCDEIATIQSKRLRNKIAGYTTHLMKRIQKGPVRGISFKLQEEERERKDQYVPDVSALDLSHSNDVLNVDTQTAELVNSLGLKLPLSVSSVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 18S rRNA
publication title Conformational Differences between Open and Closed States of the Eukaryotic Translation Initiation Complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Translation
total genus 27
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
R PF00833 Ribosomal_S17e Ribosomal S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.60.20 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Ribosomal protein S17e-like 3jamR01
5FLXR 3J80R 3JAMR 5A2QR 5IT9R 3J81R 1RQ6A 3J7AW
chains in the Genus database with same CATH superfamily
3GLXA 5FLXR 1BI3A 1BI1A 3R61A 4O5VA 3JAMR 1G3SA 1BI2A 2EV0A 1FX7A 1XCVA 3J81R 3A52A 4HV6A 2F5CA 2QQAA 2ISZA 1C0WA 1G3WA 2F5FA 4HX8A 2F5EA 1BI0A 1U8RA 2QQBA 2TDXA 2QQ9A 4HX7A 1RQ6A 4HV5A 1F5TA 1DPRA 5IT9R 1ON1A 2EV6A 3J80R 2F5DA 2MVTA 1G3YA 1P92A 2M35A 2P0TA 2X98A 1G3TA 2DTRA 2H09A 1FWZA 3R60A 4O6JA 3J7AW 1ON2A 5A2QR 1B1BA 2HYFA 2MUNA 2HYGD 4HX4A 1DDNA 2MZ4A 2EV5A
chains in the Genus database with same CATH topology
5FLXR 3J80R 3JAMR 5A2QR 5IT9R 3J81R 1RQ6A 3J7AW
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FLX R;  3J80 R;  3JAM R;  5A2Q R;  5IT9 R;  3J81 R;  1RQ6 A;  3J7A W; 
#chains in the Genus database with same CATH topology
 3GLX A;  5FLX R;  1BI3 A;  1BI1 A;  3R61 A;  4O5V A;  3JAM R;  1G3S A;  1BI2 A;  2EV0 A;  1FX7 A;  1XCV A;  3J81 R;  3A52 A;  4HV6 A;  2F5C A;  2QQA A;  2ISZ A;  1C0W A;  1G3W A;  2F5F A;  4HX8 A;  2F5E A;  1BI0 A;  1U8R A;  2QQB A;  2TDX A;  2QQ9 A;  4HX7 A;  1RQ6 A;  4HV5 A;  1F5T A;  1DPR A;  5IT9 R;  1ON1 A;  2EV6 A;  3J80 R;  2F5D A;  2MVT A;  1G3Y A;  1P92 A;  2M35 A;  2P0T A;  2X98 A;  1G3T A;  2DTR A;  2H09 A;  1FWZ A;  3R60 A;  4O6J A;  3J7A W;  1ON2 A;  5A2Q R;  1B1B A;  2HYF A;  2MUN A;  2HYG D;  4HX4 A;  1DDN A;  2MZ4 A;  2EV5 A; 
#chains in the Genus database with same CATH homology
 5FLX R;  3J80 R;  3JAM R;  5A2Q R;  5IT9 R;  3J81 R;  1RQ6 A;  3J7A W; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...