3JAMS

Cryoem structure of 40s-eif1a-eif1 complex from yeast
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
145
structure length
145
Chain Sequence
SLVVQEQGSFQHILRLLNTNVDGNINVVYALTTIRGVGRRYANLVCKKADVDLHKRAGELTQEELERIVQIMQNPTHYKIPAWFLNRQKDVNDGKDYHSLANNLESKLRDDLERLKKIRSHRGIRHFWGLRVRGQHTKTTGRRRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational Differences between Open and Closed States of the Eukaryotic Translation Initiation Complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Translation
molecule keywords 18S rRNA
total genus 23
structure length 145
sequence length 145
ec nomenclature
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3jamS01
3J80S 3SAWA 2F4VM 5A2QS 2UUBM 1L1TA 3T1YM 2HHHM 1IBLM 4B3TM 1XC8A 4JI7M 4DV5M 2UU9M 1PJIA 1K3XA 2UXDM 3TWLA 5IT9S 4GKKM 4G4RA 1Q3CA 4JI8M 3VK7A 2UUCM 3TWMA 4LFCM 4DV7M 1I94M 4B3RM 4X66M 1MX0A 1XNRM 1L2BA 3GQ5A 1MU5A 1NNJA 5ITRA 2EA0A 4DR3M 5LMUM 4B3SM 4JI5M 3U6OA 2UXCM 1R2YA 3T1HM 4JI1M 4JI0M 4LF8M 3U6MA 2XZUA 3JR5A 2UXBM 4LFAM 4YY3M 4DV6M 4X64M 4JI2M 4PD2A 3A46A 3SARA 3GQ4A 3GPUA 3GQ3A 4CISA 4GKJM 2ZBKB 4K0KM 4PDGA 4DV1M 1Q39A 1N36M 4DR6M 2E5LM 4JI6M 4DR2M 4PDIA 4KHPM 4NXNM 2HKJA 2F5SA 5ITTA 1R2ZA 4NRWA 1K3WA 4DR5M 3SASA 1XNQM 3DOAA 4G4NA 3JR4A 3GPXA 1TDHA 1L1ZA 4AQYM 4LF9M 1PJJA 1KFVA 4PCZA 1TDZA 3OTOM 3GPPA 1HNWM 5BR8M 3SATA 3U6EA 4LF6M 1FJGM 4MB7A 5ITYA 4DUYM 4JI4M 5ITUA 3A45A 1Z5BA 4X65M 5IWAM 3TWKA 3GO8A 4G4QA 4X62M 5LMNM 3SAUA 1Q3BA 2ZM6M 4JI3M 1HR0M 2VQEM 1HNZM 2OPFA 1N34M 3W0FA 4LF7M 4DV2M 2Q2EB 3GPYA 4DR1M 1K82A 4B3MM 4DR4M 4JV5M 4G4OA 3SBJA 4DV3M 3JAMS 3VK8A 1N33M 3U6LA 3U6QA 2XZFA 4YHHM 1IBKM 1HNXM 1IBMM 3SAVA 1J5EM 4NXMM 5ITQA 1Z5CA 1XMOM 4DV4M 2F5OA 1Z5AA 3A42A 2F5QA 1L2DA 5ITXA 4OX9M 4DV0M 4JYAM 4LFBM 1XMQM 2OQ4A 2F5PA 5ITXE 3J81S 4DR7M 3U6CA 4LF4M 4NRVA 3U6DA 3C58A 3U6PA 3U6SA 1PM5A 5FLXS 1EE8A 3GP1A 4LF5M 2UUAM 1L2CA 2F5NA 2VQFM 1N32M 1Z59A 4ITQA 4DUZM 3J7AS
chains in the Genus database with same CATH superfamily
2KEBA 1ZQ9A 4IBIA 3GLGB 2M5ZA 1L1TA 2DZLA 2FH0A 5KQ8A 2CUZA 2R44A 3HJ8A 4B3TM 1SXJD 4DV5M 2CFOA 1PJIA 4OU7A 2KHHA 2UXDM 2XFSA 3D8BA 3TWLA 1JR3A 1ZMWA 1I4WA 1DGFA 5DYGA 3U60A 4OW0A 2MGWA 4DV7M 2A5YB 3J2PB 2C98A 4IBGA 1Z6TA 1G3IA 2DHRA 2LH0A 4WP2A 1XNRM 3E9SA 1L2BA 5FTMA 5H37D 1QYRA 2LNHC 3IG8A 1WIVA 2JP7A 2G8LA 1IY1A 5LMUM 1QAMA 2Y21A 1OTRA 1E9SA 2ZAOA 2LTUA 1ZMVA 2KXEA 4GIPA 1FNNA 3B89A 4X64M 3UMMA 4IBKA 3KS8A 1MJGM 2JNHA 1QUTA 2CE7A 3GQ4A 2L4FA 3GLFB 1IN8A 1EIJA 3BBZA 4GKJM 1NV8A 2QQ8A 3HWSA 4DV1M 3FYDA 1XHBA 1PGYA 1JR3D 1JQJC 3SYKA 3K92A 2DKLA 4R71A 4PDIA 1OIZA 1ZMUA 4OVZA 1GL6A 5JI2E 1K3WA 2HCBA 2XF3A 4IJEA 2I7PA 4RNAA 3SASA 1OFIA 3DOAA 1XWIA 3FUXA 2CWBA 2R46A 5KQDA 3GLIE 2M60A 1QDRA 3KS4A 2KRUA 4LJ6A 3C3EA 4WW0A 5C1BA 1WR1B 5EXSA 2HAKA 2QNJA 2XLJA 1S3SA 2R62A 3GPPA 2XH9A 2Z8YM 3GRYA 4GC9A 4LJAA 3LW5F 4LF6M 2DAEA 1FJGM 4MB7A 3Q8GA 2DWMA 3KSJA 4JXJA 1IN6A 1LV7A 1QAQA 1G59A 4G4QA 1XXHA 3HU1A 2K9DA 3GLHB 4M9XA 1C1KA 1QUSA 4JI3M 2FNAA 3U60B 2VIIA 3KXEC 1HNZM 2P5TA 2LVNC 4LF7M 1CUKA 1QVRA 1OAIA 2Q2EB 3ZH9B 2Z7JA 4B3MM 4JV5M 2H1RA 2C96A 3BXWA 4XBOA 2V1UA 4RF1A 3H4MA 3U61B 2MROB 2O5RA 2R0IA 3U6LA 3VK8A 2XZFA 4M0WA 5DNYA 1J5EM 4ZPXA 2EO2A 2KNVA 4NXMM 1EFUB 5ITQA 1N77A 1XMOM 1Q02A 3K8ZA 3R8FA 1IN4A 3IHPA 2R65A 1LTMA 2FOIC 4OX9M 3V76A 2FE8A 4JYAM 3AL0C 1SG9A 5ITXE 3J81S 1N78A 2C9OA 4NRVA 3DA1A 4QNRA 2XSZD 5FTJA 3GLIA 4IIWA 1G71A 4CGYB 4FWHA 2D7GA 3GRRA 3E21A 2VQFM 2ZAMA 2K6BA 1Z59A 3QAUA 3EIHA 5IZ7D 4D81A 4QOSA 2LBCA 3VKGA 1IXRC 1V33A 3FTCA 5FSWA 3SAWA 2F4VM 3CTWB 3KFUG 2D7EA 3L2AA 5A2QS 1N75A 3M0EA 4QHTA 2Y20A 4CHTB 1L8QA 3AJIB 1XC8A 2O01F 2KRKA 1J7KA 3M7GA 5KPZA 3LMMA 4G4RA 1Q3CA 3VK7A 3U61A 4FCTA 4LJ4A 4XGIA 1I94M 2NQ8C 2Y0TA 2DWZB 2DENA 2BNKA 2CEAA 4GMQA 3ZCBB 2G3QA 3FUWA 1DV0A 4B3SM 1GABA 4GHLA 2JZ0A 2G5GX 1QAOA 1HT2E 2R4EA 2VDBB 3L29A 4NOOB 2EKFA 3KP0E 4JI0M 3T38A 3JR5A 2CHVA 3U5ZA 3LQQA 5KO3A 4IBEA 4JI2M 4PD2A 1OQYA 3SARA 3K9PA 5EXXA 1ORYB 2X8AA 3GPUA 1IN5A 2R45A 2HL7A 4K0KM 4BB9A 1A5TA 3L25A 4IBDA 1N36M 2VF7A 4Z8XA 4DR6M 1NNUC 2E5LM 4FWDA 4KO8A 3QYEA 3RE8A 4JI6M 2OOAA 3KDSE 4AW4A 4F1IA 1SXJE 3DZDA 1R2ZA 1G41A 2EUCA 3QYBA 4REZA 2FS1A 1ZAEA 5GKNA 1QDTA 1AIPC 1XNQM 3GLHE 2DAGA 2KDLA 2RGOA 4A3VB 5DFLA 3T15A 2KZUA 1TR8A 2XEPA 2KW0A 3HU2A 3L27A 1IXSB 1KFVA 1VEKA 1XB2B 2CV0A 3D8LA 4I4LA 3LVWA 1G8PA 3HHZA 4R3DA 3W0LB 3SATA 2D7HA 2WZJA 1OIPA 3RGSA 1IY2A 4KLNA 4X65M 2R18A 4FW9A 3HKPA 3GRUA 4X62M 2L7HA 1X37A 1ZV1A 3M6AA 2ZM6M 3HX3A 2N35A 1GKIA 2VQEM 1SXJB 4WURA 1QQWA 1YUBA 2CP8A 4FVMA 4M0DA 3W0FA 4DV2M 1N34M 4ANRA 4GH9A 4DR1M 2RRUA 5EP2A 2BWBA 3FTEA 3FRHA 5IREB 4LGMA 2LHCA 4DV3M 3JAMS 3FTDA 1N33M 3VDUA 1XXHB 4YHHM 3GRVA 1IXSA 1HQCA 1RU3A 1T43A 2CV2A 4GHAA 1F4IA 4BBAA 1NY6A 2Z3XA 2GQFA 1OKSA 1Z5CA 3PFIA 4R7GA 5FTKA 1TTEA 4DV4M 4B08A 4B7GA 2F5OA 3A42A 3GLGE 4L15A 1NSFA 1GVNA 4MH0E 4NC6A 4G3OA 3HHXA 3W68A 2OQ4A 4DR7M 2KNZA 2EKKA 1KYIA 3HU3A 1W5SA 2WSEF 3C58A 3U6PA 1TH3A 3KW6A 5FLXS 1EE8A 4LF5M 4KT0F 4I5SA 2UUAM 3TPZA 2DAMA 2DWLA 3L28A 4QNMA 3TL4X 4IBFA 2XGNA 2L6OA 3ZQJA 4DUZM 4ITQA 3PNYA 4IBBA 2JY5A 2RKOA 2XSZA 4FWGA 4GC5A 2JY8A 5FTNA 3SMPA 5KPTA 3HY5A 3RGPA 1WGLA 2UUBM 2LXEA 2QP9X 2HHHM 2DI0A 4RKUF 2JZ1A 4JI7M 2KZSA 1JR3E 3AOGA 3HJQA 2UU9M 4AKHA 3UK6A 3ILKA 2J5YA 3UGJA 3AV0A 5IT9S 4GKKM 4AKGA 3CGWA 4S12A 4JI8M 1MN3A 3FKEA 3FUTA 2UUCM 3K1JA 3SHGB 1GLNA 4MGKE 2QZ4A 3TWMA 3LCUA 2LVQD 3TQSA 4X66M 3Q8XA 1NJFA 4LCBA 2K47A 3SHFA 3I01M 2LVOC 3GQ5A 5F3WA 4L4UA 1SXJA 4NSRA 3LCVB 5ITRA 1NNJA 1C7YA 4JI5M 4LG2A 1TGUA 4HLQA 3AOEA 3B7ZA 1VDLA 2YQZA 4GRIA 3FUVA 3U6OA 2W82A 2UXCM 1R2YA 3GLHA 3T1HM 4JI1M 4LF8M 1DGBA 2LVAA 4Y28F 1YLAA 1D2NA 1DGHB 4LZZA 4LFAM 4DV6M 2QBYA 2LWXA 2J7OA 3KP1E 3A46A 3FYCA 4II7A 3SC3A 4Z6YA 2QSFX 3UJNA 3C9PA 1QZEA 2K0BX 4AG5A 2HWJA 2VF8A 4XK8F 4DR2M 3DFZA 2HKJA 2H5XA 1P3QQ 2F5SA 3MHVC 3IECA 1QZMA 4DR5M 1NHGC 4LJ7A 2BJWA 4L16A 2X49A 4G4NA 5EQTA 2WSFF 4FCWA 1QANA 3LVVA 3UZUA 1L1ZA 2MR9A 3PXGA 3SFZA 4CJ6A 1DGHA 1PJJA 4LF9M 2DAKA 3OTOM 4B7FA 3MMPA 1TDZA 2ZTCA 3J27B 2ERCA 2QENA 2DXIA 3U6EA 5L8RF 4JI4M 4TUWA 5ITUA 3A45A 1Z5BA 1PRBA 1XXHE 3LQRA 4L6V6 2L4EA 1Y8GA 3TWKA 3KOZE 1UFZA 1TF0B 4BLCA 1VQ1A 4LGYA 5LMNM 2DWNA 1AUAA 2QCUA 4MGYE 3E46A 3FTFA 2JY7A 2YFQA 1IQPA 3MJ5A 1IN7A 4GEWA 4F2LA 3GLFA 5BPVA 4HEOA 1OFHA 1WGNA 4M9SA 3GPYA 3H4JA 4FCVA 1E32A 3K2LA 2AHMA 3THGA 1W5TA 1NY5A 4AKIA 3PNVA 1VDDA 3B74A 3I04M 7CATA 1IBKM 1HNXM 1H6UA 2QPAA 3SAVA 1IBMM 2OO9A 4LY6A 1IFYA 1IM2A 1E9RA 4W5WA 2BWEA 4IJFA 4D80A 2R6FA 4NL4H 1Z5AA 2DZOB 3L26A 2KNAA 4AI6A 3AOEC 2V6ZM 5ITXA 4P17A 4LFBM 5EP4A 2XFTA 3K9OA 2CV1A 2BJVA 3U6CA 4LF4M 5KPRA 2ZANA 3U6SA 1PM5A 4UN2B 1HT1E 3CF2A 3VLFB 3B7NA 1BVSA 2F5NA 1PJTA 1IXZA 1GJTA 4AG6A 2C9CA 1GL7A 1R4GA 4P16A 3J7AS 5E26A 4PT5A 1NO1A 3J80S 3HJSA 1HQYE 1T6OA 1NV9A 3T1YM 1IBLM 4AZFA 3FRIA 1K3XA 2L09A 5FTLA 4L8RC 3MK6A 3B7QA 3VFDA 3VDPA 3CF0A 4JN6A 3NBXX 2J7NA 2CRUA 4LZJA 4LFCM 1VEJA 3RFWA 4B3RM 1G4AE 2L7IA 2JWSA 1PJQA 1MX0A 2APLA 1HJPA 3CF6E 4M9ZA 1D0MA 3TE6A 4KODA 2JA2A 4LJ5A 1MU5A 2EA0A 4B7HA 4DR3M 4MM3B 3I4YA 2Y0QA 3EIEA 1TH2A 1WXQA 2YR0A 3FUUA 3U6MA 3A98B 2XZUA 2C99A 2LVPC 4YY3M 3GLIB 2UXBM 1T3TA 2V1CA 3HHWA 1E94E 2DNAA 3ZC7B 3I4VA 3J7BA 1SXJC 2O25A 5EJCA 8CATA 3GQ3A 2R4JA 4CISA 2ZBKB 3HZJA 1GJSA 4PDGA 1R7RA 2Z4RA 1DGGA 1Q39A 1R5LA 1R6BX 2FFJA 5C18A 3AKZA 1GO5A 3FD9A 3F92A 5E6JA 5EP3A 2Z4SA 4NXNM 4KHPM 4HL4A 4I8OA 3SYLA 1D0LA 5ITTA 1NJGA 4DBGB 4NRWA 2WSCF 4QHSA 1VEGA 2GNOA 2JXNA 5EXTA 2DVWB 4G6ZA 1V34A 3JR4A 1D0KA 3GLFE 3C3DA 3GLGA 3GPXA 2RGHA 4LJ9A 1JB0F 1TDHA 3NWLA 4LJ8A 2EJSA 1NVMA 4AQYM 3U5ZB 2CHGA 4CIZA 4PCZA 3PVSA 1HNWM 2DHYA 5BR8M 2L2DA 2I7NA 3KOYE 1OAOC 2MJ5B 3KOWE 5ITYA 4DUYM 5EP1A 5IWAM 4IBJA 2C5RA 4Q7JA 4D82A 2JY6B 3QWLA 3GO8A 3SMSA 3VKHA 4MGZE 5JI3E 3SAUA 1Q3BA 2OOBA 3WHLA 1HR0M 4LRTA 3B9PA 1VG5A 3BOSA 3HGIA 4RF0A 3AFHA 1J09A 1WHCA 2OPFA 1IY0A 2ZTDA 1KSFX 4FD2A 1TH4A 1PJSA 1K82A 4DR4M 4EIWA 2JUJA 1DO2A 2X4AA 3E4RA 4GITA 3HHYA 4G4OA 3SBJA 2YNMD 4NSOB 3U6QA 3KVWA 4IBCA 2QHOB 2KA6B 3T6PA 3KOXE 1YSYA 4QOZC 2B3TA 1V92A 2MH8A 2F5QA 3FE3A 1OJLA 3I51A 1L2DA 4DV0M 4OVZB 3NBIA 4MGIE 1DO0A 1WJ7A 4MGHA 1YE9A 3W67A 1XMQM 2F5PA 2DZNB 1UM8A 2LHGA 3U6DA 1NHWC 2DAIA 2QBYB 4L78A 5EXPA 3WHKA 3GP1A 4I81A 1L2CA 1N32M 2CHQA 3R9XB 3IG5A 5DYIA 3KSXA 4LRSA
chains in the Genus database with same CATH topology
2KEBA 1ZQ9A 4IBIA 3GLGB 2M5ZA 1L1TA 5KQ8A 2CUZA 3HJ8A 4B3TM 1SXJD 4DV5M 2CFOA 1PJIA 4OU7A 2UXDM 2XFSA 3D8BA 3TWLA 1JR3A 1I4WA 1DGFA 5DYGA 3U60A 4OW0A 4DV7M 2A5YB 3J2PB 2C98A 4IBGA 1Z6TA 1G3IA 2DHRA 2LH0A 1XNRM 3E9SA 1L2BA 5FTMA 5H37D 1QYRA 2LNHC 3IG8A 2G8LA 1IY1A 5LMUM 1QAMA 2Y21A 1E9SA 2ZAOA 2KXEA 4GIPA 1FNNA 4X64M 3UMMA 4IBKA 3KS8A 3GQ4A 3GLFB 2CE7A 1IN8A 4GKJM 3HWSA 4DV1M 3FYDA 1XHBA 1JR3D 1JQJC 3SYKA 3K92A 4PDIA 4OVZA 1GL6A 5JI2E 1K3WA 2HCBA 2XF3A 4IJEA 2I7PA 4RNAA 3SASA 1OFIA 3DOAA 1XWIA 3FUXA 2R46A 5KQDA 2M60A 3KS4A 2KRUA 4LJ6A 4WW0A 5C1BA 5EXSA 2XLJA 1S3SA 2R62A 3GPPA 2XH9A 4GC9A 3GRYA 4LJAA 4LF6M 1FJGM 4MB7A 2DWMA 3KSJA 4JXJA 1IN6A 1LV7A 1QAQA 1G59A 4G4QA 1XXHA 3HU1A 3GLHB 4M9XA 1C1KA 4JI3M 2FNAA 3U60B 3KXEC 2VIIA 1HNZM 2P5TA 4LF7M 1QVRA 2Q2EB 4B3MM 3ZH9B 2Z7JA 4JV5M 2H1RA 2C96A 4XBOA 2V1UA 4RF1A 3H4MA 3U61B 2O5RA 3VK8A 3U6LA 2XZFA 4M0WA 5DNYA 1J5EM 4ZPXA 2EO2A 4NXMM 5ITQA 1N77A 1XMOM 3K8ZA 3R8FA 1IN4A 2R65A 2FOIC 4OX9M 2FE8A 4JYAM 3AL0C 5ITXE 3J81S 1N78A 2C9OA 4NRVA 3DA1A 4QNRA 2XSZD 5FTJA 3GLIA 4IIWA 4CGYB 4FWHA 2D7GA 3GRRA 2VQFM 2ZAMA 3QAUA 1Z59A 5IZ7D 3EIHA 4D81A 4QOSA 3VKGA 1IXRC 3FTCA 5FSWA 3SAWA 2F4VM 3CTWB 3KFUG 2D7EA 3L2AA 5A2QS 1N75A 3M0EA 4QHTA 2Y20A 4CHTB 1L8QA 3AJIB 1XC8A 2KRKA 1J7KA 3M7GA 5KPZA 3LMMA 4G4RA 1Q3CA 3VK7A 3U61A 4FCTA 4LJ4A 4XGIA 1I94M 2NQ8C 2Y0TA 2DWZB 2BNKA 2CEAA 4GMQA 3ZCBB 3FUWA 4B3SM 4GHLA 2G5GX 1QAOA 1HT2E 2R4EA 4NOOB 3L29A 3KP0E 4JI0M 3T38A 3JR5A 2CHVA 3U5ZA 3LQQA 5KO3A 4IBEA 4JI2M 4PD2A 3SARA 5EXXA 1ORYB 2X8AA 3GPUA 1IN5A 2R45A 2HL7A 4K0KM 4BB9A 3L25A 4IBDA 1N36M 4Z8XA 4DR6M 1NNUC 2E5LM 4FWDA 4KO8A 3RE8A 4JI6M 3KDSE 4AW4A 1SXJE 3DZDA 1R2ZA 1G41A 2EUCA 4REZA 1ZAEA 5GKNA 1XNQM 2RGOA 4A3VB 3T15A 2KZUA 2XEPA 2KW0A 3HU2A 3L27A 1IXSB 1KFVA 2CV0A 3D8LA 4I4LA 3LVWA 1G8PA 3HHZA 4R3DA 3W0LB 3SATA 2D7HA 3RGSA 1IY2A 4KLNA 4X65M 2R18A 4FW9A 3HKPA 3GRUA 4X62M 2L7HA 1X37A 3M6AA 2ZM6M 1GKIA 2VQEM 1SXJB 4WURA 1QQWA 1YUBA 4FVMA 4M0DA 3W0FA 4DV2M 1N34M 4GH9A 4DR1M 5EP2A 3FTEA 5IREB 4LGMA 4DV3M 3JAMS 3FTDA 1N33M 3VDUA 1XXHB 4YHHM 3GRVA 1HQCA 2CV2A 4GHAA 4BBAA 1NY6A 2Z3XA 1Z5CA 3PFIA 4R7GA 5FTKA 4DV4M 4B08A 4B7GA 2F5OA 3A42A 4L15A 1NSFA 1GVNA 4MH0E 3HHXA 2OQ4A 4DR7M 1KYIA 3HU3A 1W5SA 3C58A 3U6PA 1TH3A 3KW6A 5FLXS 1EE8A 4LF5M 4I5SA 2UUAM 3TPZA 2DWLA 3L28A 4QNMA 3TL4X 4IBFA 2XGNA 2L6OA 4ITQA 4DUZM 3PNYA 4IBBA 5FTNA 2RKOA 2XSZA 4FWGA 4GC5A 3SMPA 5KPTA 3RGPA 2UUBM 2LXEA 2QP9X 2HHHM 4JI7M 2KZSA 3AOGA 3HJQA 2UU9M 4AKHA 3UK6A 3ILKA 3UGJA 3AV0A 5IT9S 4GKKM 4AKGA 4S12A 4JI8M 3FKEA 3FUTA 2UUCM 3K1JA 3SHGB 1GLNA 4MGKE 2QZ4A 3TWMA 3TQSA 4X66M 3Q8XA 1NJFA 4LCBA 2K47A 3SHFA 3GQ5A 5F3WA 4L4UA 1SXJA 4NSRA 5ITRA 1NNJA 4JI5M 4LG2A 1TGUA 4HLQA 3AOEA 4GRIA 3U6OA 2YQZA 3FUVA 2UXCM 2W82A 1R2YA 3GLHA 3T1HM 4JI1M 4LF8M 1DGBA 2QBYA 1D2NA 1DGHB 4LZZA 4LFAM 4DV6M 2LWXA 2J7OA 3KP1E 3A46A 3FYCA 4II7A 3SC3A 4Z6YA 3UJNA 4AG5A 4DR2M 3DFZA 2HKJA 2F5SA 3MHVC 4DR5M 1QZMA 1NHGC 4LJ7A 2BJWA 4L16A 2X49A 4G4NA 5EQTA 4FCWA 1QANA 3LVVA 3UZUA 1L1ZA 3PXGA 3SFZA 1DGHA 1PJJA 4LF9M 1TDZA 3OTOM 4B7FA 2DXIA 3J27B 2ERCA 2QENA 3U6EA 4JI4M 4TUWA 5ITUA 3A45A 1Z5BA 3LQRA 3TWKA 3KOZE 4BLCA 5LMNM 4LGYA 2DWNA 2QCUA 4MGYE 3FTFA 2YFQA 1IQPA 3MJ5A 1IN7A 3GLFA 5BPVA 1OFHA 4M9SA 3GPYA 4FCVA 1E32A 3K2LA 2AHMA 3THGA 1W5TA 1NY5A 4AKIA 3PNVA 1VDDA 7CATA 1IBKM 1HNXM 1H6UA 2QPAA 3SAVA 1IBMM 4LY6A 1IM2A 1E9RA 4W5WA 4IJFA 4D80A 4NL4H 1Z5AA 2DZOB 3L26A 4AI6A 3AOEC 2V6ZM 5ITXA 4LFBM 5EP4A 2XFTA 2CV1A 2BJVA 3U6CA 4LF4M 5KPRA 2ZANA 3U6SA 1PM5A 1HT1E 3CF2A 3VLFB 2F5NA 1IXZA 4AG6A 2C9CA 1GL7A 4P16A 3J7AS 5E26A 4PT5A 3J80S 3HJSA 1HQYE 3T1YM 1IBLM 4AZFA 1K3XA 2L09A 5FTLA 4L8RC 3MK6A 3VFDA 3VDPA 3CF0A 4JN6A 2J7NA 4LZJA 4LFCM 3RFWA 4B3RM 1G4AE 2L7IA 1MX0A 4M9ZA 3CF6E 3TE6A 4KODA 2JA2A 4LJ5A 1MU5A 2EA0A 4B7HA 4DR3M 4MM3B 3I4YA 2Y0QA 3EIEA 1TH2A 1WXQA 2YR0A 3FUUA 3U6MA 3A98B 2XZUA 2C99A 3GLIB 4YY3M 2UXBM 1T3TA 2V1CA 3HHWA 1E94E 3ZC7B 3I4VA 3J7BA 1SXJC 3GQ3A 5EJCA 8CATA 4CISA 2R4JA 2ZBKB 4PDGA 1R7RA 2Z4RA 1DGGA 1Q39A 1R6BX 2FFJA 5C18A 3AKZA 3FD9A 5E6JA 5EP3A 2Z4SA 4NXNM 4KHPM 4HL4A 4I8OA 3SYLA 5ITTA 1NJGA 4NRWA 4QHSA 5EXTA 2DVWB 4G6ZA 3JR4A 3GLGA 3GPXA 2RGHA 4LJ9A 1TDHA 3NWLA 4LJ8A 1NVMA 4AQYM 3U5ZB 2CHGA 4PCZA 3PVSA 1HNWM 5BR8M 2I7NA 3KOYE 3KOWE 5ITYA 4DUYM 5EP1A 5IWAM 4IBJA 2C5RA 4D82A 3GO8A 3QWLA 3VKHA 3SMSA 4MGZE 5JI3E 3SAUA 1Q3BA 3WHLA 1HR0M 4LRTA 3B9PA 3BOSA 3HGIA 4RF0A 3AFHA 1J09A 2OPFA 1IY0A 1KSFX 4FD2A 1TH4A 1K82A 4DR4M 4EIWA 2X4AA 1DO2A 3E4RA 3HHYA 4GITA 4G4OA 3SBJA 2YNMD 4NSOB 3U6QA 3KVWA 4IBCA 2KA6B 3KOXE 1YSYA 4QOZC 2F5QA 3I51A 1OJLA 1L2DA 4DV0M 4OVZB 3NBIA 4MGIE 1DO0A 4MGHA 1XMQM 1YE9A 2F5PA 2DZNB 1UM8A 3U6DA 1NHWC 2QBYB 4L78A 5EXPA 3WHKA 3GP1A 4I81A 1L2CA 1N32M 2CHQA 3R9XB 3IG5A 5DYIA 3KSXA 4LRSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J80 S;  3SAW A;  2F4V M;  5A2Q S;  2UUB M;  1L1T A;  3T1Y M;  2HHH M;  1IBL M;  4B3T M;  1XC8 A;  4JI7 M;  4DV5 M;  2UU9 M;  1PJI A;  1K3X A;  2UXD M;  3TWL A;  5IT9 S;  4GKK M;  4G4R A;  1Q3C A;  4JI8 M;  3VK7 A;  2UUC M;  3TWM A;  4LFC M;  4DV7 M;  1I94 M;  4B3R M;  4X66 M;  1MX0 A;  1XNR M;  1L2B A;  3GQ5 A;  1MU5 A;  1NNJ A;  5ITR A;  2EA0 A;  4DR3 M;  5LMU M;  4B3S M;  4JI5 M;  3U6O A;  2UXC M;  1R2Y A;  3T1H M;  4JI1 M;  4JI0 M;  4LF8 M;  3U6M A;  2XZU A;  3JR5 A;  2UXB M;  4LFA M;  4YY3 M;  4DV6 M;  4X64 M;  4JI2 M;  4PD2 A;  3A46 A;  3SAR A;  3GQ4 A;  3GPU A;  3GQ3 A;  4CIS A;  4GKJ M;  2ZBK B;  4K0K M;  4PDG A;  4DV1 M;  1Q39 A;  1N36 M;  4DR6 M;  2E5L M;  4JI6 M;  4DR2 M;  4PDI A;  4KHP M;  4NXN M;  2HKJ A;  2F5S A;  5ITT A;  1R2Z A;  4NRW A;  1K3W A;  4DR5 M;  3SAS A;  1XNQ M;  3DOA A;  4G4N A;  3JR4 A;  3GPX A;  1TDH A;  1L1Z A;  4AQY M;  4LF9 M;  1PJJ A;  1KFV A;  4PCZ A;  1TDZ A;  3OTO M;  3GPP A;  1HNW M;  5BR8 M;  3SAT A;  3U6E A;  4LF6 M;  1FJG M;  4MB7 A;  5ITY A;  4DUY M;  4JI4 M;  5ITU A;  3A45 A;  1Z5B A;  4X65 M;  5IWA M;  3TWK A;  3GO8 A;  4G4Q A;  4X62 M;  5LMN M;  3SAU A;  1Q3B A;  2ZM6 M;  4JI3 M;  1HR0 M;  2VQE M;  1HNZ M;  2OPF A;  1N34 M;  3W0F A;  4LF7 M;  4DV2 M;  2Q2E B;  3GPY A;  4DR1 M;  1K82 A;  4B3M M;  4DR4 M;  4JV5 M;  4G4O A;  3SBJ A;  4DV3 M;  3JAM S;  3VK8 A;  1N33 M;  3U6L A;  3U6Q A;  2XZF A;  4YHH M;  1IBK M;  1HNX M;  1IBM M;  3SAV A;  1J5E M;  4NXM M;  5ITQ A;  1Z5C A;  1XMO M;  4DV4 M;  2F5O A;  1Z5A A;  3A42 A;  2F5Q A;  1L2D A;  5ITX A;  4OX9 M;  4DV0 M;  4JYA M;  4LFB M;  1XMQ M;  2OQ4 A;  2F5P A;  5ITX E;  3J81 S;  4DR7 M;  3U6C A;  4LF4 M;  4NRV A;  3U6D A;  3C58 A;  3U6P A;  3U6S A;  1PM5 A;  5FLX S;  1EE8 A;  3GP1 A;  4LF5 M;  2UUA M;  1L2C A;  2F5N A;  2VQF M;  1N32 M;  1Z59 A;  4ITQ A;  4DUZ M;  3J7A S; 
#chains in the Genus database with same CATH topology
 2KEB A;  1ZQ9 A;  4IBI A;  3GLG B;  2M5Z A;  1L1T A;  2DZL A;  2FH0 A;  5KQ8 A;  2CUZ A;  2R44 A;  3HJ8 A;  4B3T M;  1SXJ D;  4DV5 M;  2CFO A;  1PJI A;  4OU7 A;  2KHH A;  2UXD M;  2XFS A;  3D8B A;  3TWL A;  1JR3 A;  1ZMW A;  1I4W A;  1DGF A;  5DYG A;  3U60 A;  4OW0 A;  2MGW A;  4DV7 M;  2A5Y B;  3J2P B;  2C98 A;  4IBG A;  1Z6T A;  1G3I A;  2DHR A;  2LH0 A;  4WP2 A;  1XNR M;  3E9S A;  1L2B A;  5FTM A;  5H37 D;  1QYR A;  2LNH C;  3IG8 A;  1WIV A;  2JP7 A;  2G8L A;  1IY1 A;  5LMU M;  1QAM A;  2Y21 A;  1OTR A;  1E9S A;  2ZAO A;  2LTU A;  1ZMV A;  2KXE A;  4GIP A;  1FNN A;  3B89 A;  4X64 M;  3UMM A;  4IBK A;  3KS8 A;  1MJG M;  2JNH A;  1QUT A;  2CE7 A;  3GQ4 A;  2L4F A;  3GLF B;  1IN8 A;  1EIJ A;  3BBZ A;  4GKJ M;  1NV8 A;  2QQ8 A;  3HWS A;  4DV1 M;  3FYD A;  1XHB A;  1PGY A;  1JR3 D;  1JQJ C;  3SYK A;  3K92 A;  2DKL A;  4R71 A;  4PDI A;  1OIZ A;  1ZMU A;  4OVZ A;  1GL6 A;  5JI2 E;  1K3W A;  2HCB A;  2XF3 A;  4IJE A;  2I7P A;  4RNA A;  3SAS A;  1OFI A;  3DOA A;  1XWI A;  3FUX A;  2CWB A;  2R46 A;  5KQD A;  3GLI E;  2M60 A;  1QDR A;  3KS4 A;  2KRU A;  4LJ6 A;  3C3E A;  4WW0 A;  5C1B A;  1WR1 B;  5EXS A;  2HAK A;  2QNJ A;  2XLJ A;  1S3S A;  2R62 A;  3GPP A;  2XH9 A;  2Z8Y M;  3GRY A;  4GC9 A;  4LJA A;  3LW5 F;  4LF6 M;  2DAE A;  1FJG M;  4MB7 A;  3Q8G A;  2DWM A;  3KSJ A;  4JXJ A;  1IN6 A;  1LV7 A;  1QAQ A;  1G59 A;  4G4Q A;  1XXH A;  3HU1 A;  2K9D A;  3GLH B;  4M9X A;  1C1K A;  1QUS A;  4JI3 M;  2FNA A;  3U60 B;  2VII A;  3KXE C;  1HNZ M;  2P5T A;  2LVN C;  4LF7 M;  1CUK A;  1QVR A;  1OAI A;  2Q2E B;  3ZH9 B;  2Z7J A;  4B3M M;  4JV5 M;  2H1R A;  2C96 A;  3BXW A;  4XBO A;  2V1U A;  4RF1 A;  3H4M A;  3U61 B;  2MRO B;  2O5R A;  2R0I A;  3U6L A;  3VK8 A;  2XZF A;  4M0W A;  5DNY A;  1J5E M;  4ZPX A;  2EO2 A;  2KNV A;  4NXM M;  1EFU B;  5ITQ A;  1N77 A;  1XMO M;  1Q02 A;  3K8Z A;  3R8F A;  1IN4 A;  3IHP A;  2R65 A;  1LTM A;  2FOI C;  4OX9 M;  3V76 A;  2FE8 A;  4JYA M;  3AL0 C;  1SG9 A;  5ITX E;  3J81 S;  1N78 A;  2C9O A;  4NRV A;  3DA1 A;  4QNR A;  2XSZ D;  5FTJ A;  3GLI A;  4IIW A;  1G71 A;  4CGY B;  4FWH A;  2D7G A;  3GRR A;  3E21 A;  2VQF M;  2ZAM A;  2K6B A;  1Z59 A;  3QAU A;  3EIH A;  5IZ7 D;  4D81 A;  4QOS A;  2LBC A;  3VKG A;  1IXR C;  1V33 A;  3FTC A;  5FSW A;  3SAW A;  2F4V M;  3CTW B;  3KFU G;  2D7E A;  3L2A A;  5A2Q S;  1N75 A;  3M0E A;  4QHT A;  2Y20 A;  4CHT B;  1L8Q A;  3AJI B;  1XC8 A;  2O01 F;  2KRK A;  1J7K A;  3M7G A;  5KPZ A;  3LMM A;  4G4R A;  1Q3C A;  3VK7 A;  3U61 A;  4FCT A;  4LJ4 A;  4XGI A;  1I94 M;  2NQ8 C;  2Y0T A;  2DWZ B;  2DEN A;  2BNK A;  2CEA A;  4GMQ A;  3ZCB B;  2G3Q A;  3FUW A;  1DV0 A;  4B3S M;  1GAB A;  4GHL A;  2JZ0 A;  2G5G X;  1QAO A;  1HT2 E;  2R4E A;  2VDB B;  3L29 A;  4NOO B;  2EKF A;  3KP0 E;  4JI0 M;  3T38 A;  3JR5 A;  2CHV A;  3U5Z A;  3LQQ A;  5KO3 A;  4IBE A;  4JI2 M;  4PD2 A;  1OQY A;  3SAR A;  3K9P A;  5EXX A;  1ORY B;  2X8A A;  3GPU A;  1IN5 A;  2R45 A;  2HL7 A;  4K0K M;  4BB9 A;  1A5T A;  3L25 A;  4IBD A;  1N36 M;  2VF7 A;  4Z8X A;  4DR6 M;  1NNU C;  2E5L M;  4FWD A;  4KO8 A;  3QYE A;  3RE8 A;  4JI6 M;  2OOA A;  3KDS E;  4AW4 A;  4F1I A;  1SXJ E;  3DZD A;  1R2Z A;  1G41 A;  2EUC A;  3QYB A;  4REZ A;  2FS1 A;  1ZAE A;  5GKN A;  1QDT A;  1AIP C;  1XNQ M;  3GLH E;  2DAG A;  2KDL A;  2RGO A;  4A3V B;  5DFL A;  3T15 A;  2KZU A;  1TR8 A;  2XEP A;  2KW0 A;  3HU2 A;  3L27 A;  1IXS B;  1KFV A;  1VEK A;  1XB2 B;  2CV0 A;  3D8L A;  4I4L A;  3LVW A;  1G8P A;  3HHZ A;  4R3D A;  3W0L B;  3SAT A;  2D7H A;  2WZJ A;  1OIP A;  3RGS A;  1IY2 A;  4KLN A;  4X65 M;  2R18 A;  4FW9 A;  3HKP A;  3GRU A;  4X62 M;  2L7H A;  1X37 A;  1ZV1 A;  3M6A A;  2ZM6 M;  3HX3 A;  2N35 A;  1GKI A;  2VQE M;  1SXJ B;  4WUR A;  1QQW A;  1YUB A;  2CP8 A;  4FVM A;  4M0D A;  3W0F A;  4DV2 M;  1N34 M;  4ANR A;  4GH9 A;  4DR1 M;  2RRU A;  5EP2 A;  2BWB A;  3FTE A;  3FRH A;  5IRE B;  4LGM A;  2LHC A;  4DV3 M;  3JAM S;  3FTD A;  1N33 M;  3VDU A;  1XXH B;  4YHH M;  3GRV A;  1IXS A;  1HQC A;  1RU3 A;  1T43 A;  2CV2 A;  4GHA A;  1F4I A;  4BBA A;  1NY6 A;  2Z3X A;  2GQF A;  1OKS A;  1Z5C A;  3PFI A;  4R7G A;  5FTK A;  1TTE A;  4DV4 M;  4B08 A;  4B7G A;  2F5O A;  3A42 A;  3GLG E;  4L15 A;  1NSF A;  1GVN A;  4MH0 E;  4NC6 A;  4G3O A;  3HHX A;  3W68 A;  2OQ4 A;  4DR7 M;  2KNZ A;  2EKK A;  1KYI A;  3HU3 A;  1W5S A;  2WSE F;  3C58 A;  3U6P A;  1TH3 A;  3KW6 A;  5FLX S;  1EE8 A;  4LF5 M;  4KT0 F;  4I5S A;  2UUA M;  3TPZ A;  2DAM A;  2DWL A;  3L28 A;  4QNM A;  3TL4 X;  4IBF A;  2XGN A;  2L6O A;  3ZQJ A;  4DUZ M;  4ITQ A;  3PNY A;  4IBB A;  2JY5 A;  2RKO A;  2XSZ A;  4FWG A;  4GC5 A;  2JY8 A;  5FTN A;  3SMP A;  5KPT A;  3HY5 A;  3RGP A;  1WGL A;  2UUB M;  2LXE A;  2QP9 X;  2HHH M;  2DI0 A;  4RKU F;  2JZ1 A;  4JI7 M;  2KZS A;  1JR3 E;  3AOG A;  3HJQ A;  2UU9 M;  4AKH A;  3UK6 A;  3ILK A;  2J5Y A;  3UGJ A;  3AV0 A;  5IT9 S;  4GKK M;  4AKG A;  3CGW A;  4S12 A;  4JI8 M;  1MN3 A;  3FKE A;  3FUT A;  2UUC M;  3K1J A;  3SHG B;  1GLN A;  4MGK E;  2QZ4 A;  3TWM A;  3LCU A;  2LVQ D;  3TQS A;  4X66 M;  3Q8X A;  1NJF A;  4LCB A;  2K47 A;  3SHF A;  3I01 M;  2LVO C;  3GQ5 A;  5F3W A;  4L4U A;  1SXJ A;  4NSR A;  3LCV B;  5ITR A;  1NNJ A;  1C7Y A;  4JI5 M;  4LG2 A;  1TGU A;  4HLQ A;  3AOE A;  3B7Z A;  1VDL A;  2YQZ A;  4GRI A;  3FUV A;  3U6O A;  2W82 A;  2UXC M;  1R2Y A;  3GLH A;  3T1H M;  4JI1 M;  4LF8 M;  1DGB A;  2LVA A;  4Y28 F;  1YLA A;  1D2N A;  1DGH B;  4LZZ A;  4LFA M;  4DV6 M;  2QBY A;  2LWX A;  2J7O A;  3KP1 E;  3A46 A;  3FYC A;  4II7 A;  3SC3 A;  4Z6Y A;  2QSF X;  3UJN A;  3C9P A;  1QZE A;  2K0B X;  4AG5 A;  2HWJ A;  2VF8 A;  4XK8 F;  4DR2 M;  3DFZ A;  2HKJ A;  2H5X A;  1P3Q Q;  2F5S A;  3MHV C;  3IEC A;  1QZM A;  4DR5 M;  1NHG C;  4LJ7 A;  2BJW A;  4L16 A;  2X49 A;  4G4N A;  5EQT A;  2WSF F;  4FCW A;  1QAN A;  3LVV A;  3UZU A;  1L1Z A;  2MR9 A;  3PXG A;  3SFZ A;  4CJ6 A;  1DGH A;  1PJJ A;  4LF9 M;  2DAK A;  3OTO M;  4B7F A;  3MMP A;  1TDZ A;  2ZTC A;  3J27 B;  2ERC A;  2QEN A;  2DXI A;  3U6E A;  5L8R F;  4JI4 M;  4TUW A;  5ITU A;  3A45 A;  1Z5B A;  1PRB A;  1XXH E;  3LQR A;  4L6V 6;  2L4E A;  1Y8G A;  3TWK A;  3KOZ E;  1UFZ A;  1TF0 B;  4BLC A;  1VQ1 A;  4LGY A;  5LMN M;  2DWN A;  1AUA A;  2QCU A;  4MGY E;  3E46 A;  3FTF A;  2JY7 A;  2YFQ A;  1IQP A;  3MJ5 A;  1IN7 A;  4GEW A;  4F2L A;  3GLF A;  5BPV A;  4HEO A;  1OFH A;  1WGN A;  4M9S A;  3GPY A;  3H4J A;  4FCV A;  1E32 A;  3K2L A;  2AHM A;  3THG A;  1W5T A;  1NY5 A;  4AKI A;  3PNV A;  1VDD A;  3B74 A;  3I04 M;  7CAT A;  1IBK M;  1HNX M;  1H6U A;  2QPA A;  3SAV A;  1IBM M;  2OO9 A;  4LY6 A;  1IFY A;  1IM2 A;  1E9R A;  4W5W A;  2BWE A;  4IJF A;  4D80 A;  2R6F A;  4NL4 H;  1Z5A A;  2DZO B;  3L26 A;  2KNA A;  4AI6 A;  3AOE C;  2V6Z M;  5ITX A;  4P17 A;  4LFB M;  5EP4 A;  2XFT A;  3K9O A;  2CV1 A;  2BJV A;  3U6C A;  4LF4 M;  5KPR A;  2ZAN A;  3U6S A;  1PM5 A;  4UN2 B;  1HT1 E;  3CF2 A;  3VLF B;  3B7N A;  1BVS A;  2F5N A;  1PJT A;  1IXZ A;  1GJT A;  4AG6 A;  2C9C A;  1GL7 A;  1R4G A;  4P16 A;  3J7A S;  5E26 A;  4PT5 A;  1NO1 A;  3J80 S;  3HJS A;  1HQY E;  1T6O A;  1NV9 A;  3T1Y M;  1IBL M;  4AZF A;  3FRI A;  1K3X A;  2L09 A;  5FTL A;  4L8R C;  3MK6 A;  3B7Q A;  3VFD A;  3VDP A;  3CF0 A;  4JN6 A;  3NBX X;  2J7N A;  2CRU A;  4LZJ A;  4LFC M;  1VEJ A;  3RFW A;  4B3R M;  1G4A E;  2L7I A;  2JWS A;  1PJQ A;  1MX0 A;  2APL A;  1HJP A;  3CF6 E;  4M9Z A;  1D0M A;  3TE6 A;  4KOD A;  2JA2 A;  4LJ5 A;  1MU5 A;  2EA0 A;  4B7H A;  4DR3 M;  4MM3 B;  3I4Y A;  2Y0Q A;  3EIE A;  1TH2 A;  1WXQ A;  2YR0 A;  3FUU A;  3U6M A;  3A98 B;  2XZU A;  2C99 A;  2LVP C;  4YY3 M;  3GLI B;  2UXB M;  1T3T A;  2V1C A;  3HHW A;  1E94 E;  2DNA A;  3ZC7 B;  3I4V A;  3J7B A;  1SXJ C;  2O25 A;  5EJC A;  8CAT A;  3GQ3 A;  2R4J A;  4CIS A;  2ZBK B;  3HZJ A;  1GJS A;  4PDG A;  1R7R A;  2Z4R A;  1DGG A;  1Q39 A;  1R5L A;  1R6B X;  2FFJ A;  5C18 A;  3AKZ A;  1GO5 A;  3FD9 A;  3F92 A;  5E6J A;  5EP3 A;  2Z4S A;  4NXN M;  4KHP M;  4HL4 A;  4I8O A;  3SYL A;  1D0L A;  5ITT A;  1NJG A;  4DBG B;  4NRW A;  2WSC F;  4QHS A;  1VEG A;  2GNO A;  2JXN A;  5EXT A;  2DVW B;  4G6Z A;  1V34 A;  3JR4 A;  1D0K A;  3GLF E;  3C3D A;  3GLG A;  3GPX A;  2RGH A;  4LJ9 A;  1JB0 F;  1TDH A;  3NWL A;  4LJ8 A;  2EJS A;  1NVM A;  4AQY M;  3U5Z B;  2CHG A;  4CIZ A;  4PCZ A;  3PVS A;  1HNW M;  2DHY A;  5BR8 M;  2L2D A;  2I7N A;  3KOY E;  1OAO C;  2MJ5 B;  3KOW E;  5ITY A;  4DUY M;  5EP1 A;  5IWA M;  4IBJ A;  2C5R A;  4Q7J A;  4D82 A;  2JY6 B;  3QWL A;  3GO8 A;  3SMS A;  3VKH A;  4MGZ E;  5JI3 E;  3SAU A;  1Q3B A;  2OOB A;  3WHL A;  1HR0 M;  4LRT A;  3B9P A;  1VG5 A;  3BOS A;  3HGI A;  4RF0 A;  3AFH A;  1J09 A;  1WHC A;  2OPF A;  1IY0 A;  2ZTD A;  1KSF X;  4FD2 A;  1TH4 A;  1PJS A;  1K82 A;  4DR4 M;  4EIW A;  2JUJ A;  1DO2 A;  2X4A A;  3E4R A;  4GIT A;  3HHY A;  4G4O A;  3SBJ A;  2YNM D;  4NSO B;  3U6Q A;  3KVW A;  4IBC A;  2QHO B;  2KA6 B;  3T6P A;  3KOX E;  1YSY A;  4QOZ C;  2B3T A;  1V92 A;  2MH8 A;  2F5Q A;  3FE3 A;  1OJL A;  3I51 A;  1L2D A;  4DV0 M;  4OVZ B;  3NBI A;  4MGI E;  1DO0 A;  1WJ7 A;  4MGH A;  1YE9 A;  3W67 A;  1XMQ M;  2F5P A;  2DZN B;  1UM8 A;  2LHG A;  3U6D A;  1NHW C;  2DAI A;  2QBY B;  4L78 A;  5EXP A;  3WHK A;  3GP1 A;  4I81 A;  1L2C A;  1N32 M;  2CHQ A;  3R9X B;  3IG5 A;  5DYI A;  3KSX A;  4LRS A; 
#chains in the Genus database with same CATH homology
 2KEB A;  1ZQ9 A;  4IBI A;  3GLG B;  2M5Z A;  1L1T A;  5KQ8 A;  2CUZ A;  3HJ8 A;  4B3T M;  1SXJ D;  4DV5 M;  2CFO A;  1PJI A;  4OU7 A;  2UXD M;  2XFS A;  3D8B A;  3TWL A;  1JR3 A;  1I4W A;  1DGF A;  5DYG A;  3U60 A;  4OW0 A;  4DV7 M;  2A5Y B;  3J2P B;  2C98 A;  4IBG A;  1Z6T A;  1G3I A;  2DHR A;  2LH0 A;  1XNR M;  3E9S A;  1L2B A;  5FTM A;  5H37 D;  1QYR A;  2LNH C;  3IG8 A;  2G8L A;  1IY1 A;  5LMU M;  1QAM A;  2Y21 A;  1E9S A;  2ZAO A;  2KXE A;  4GIP A;  1FNN A;  4X64 M;  3UMM A;  4IBK A;  3KS8 A;  3GQ4 A;  3GLF B;  2CE7 A;  1IN8 A;  4GKJ M;  3HWS A;  4DV1 M;  3FYD A;  1XHB A;  1JR3 D;  1JQJ C;  3SYK A;  3K92 A;  4PDI A;  4OVZ A;  1GL6 A;  5JI2 E;  1K3W A;  2HCB A;  2XF3 A;  4IJE A;  2I7P A;  4RNA A;  3SAS A;  1OFI A;  3DOA A;  1XWI A;  3FUX A;  2R46 A;  5KQD A;  2M60 A;  3KS4 A;  2KRU A;  4LJ6 A;  4WW0 A;  5C1B A;  5EXS A;  2XLJ A;  1S3S A;  2R62 A;  3GPP A;  2XH9 A;  4GC9 A;  3GRY A;  4LJA A;  4LF6 M;  1FJG M;  4MB7 A;  2DWM A;  3KSJ A;  4JXJ A;  1IN6 A;  1LV7 A;  1QAQ A;  1G59 A;  4G4Q A;  1XXH A;  3HU1 A;  3GLH B;  4M9X A;  1C1K A;  4JI3 M;  2FNA A;  3U60 B;  3KXE C;  2VII A;  1HNZ M;  2P5T A;  4LF7 M;  1QVR A;  2Q2E B;  4B3M M;  3ZH9 B;  2Z7J A;  4JV5 M;  2H1R A;  2C96 A;  4XBO A;  2V1U A;  4RF1 A;  3H4M A;  3U61 B;  2O5R A;  3VK8 A;  3U6L A;  2XZF A;  4M0W A;  5DNY A;  1J5E M;  4ZPX A;  2EO2 A;  4NXM M;  5ITQ A;  1N77 A;  1XMO M;  3K8Z A;  3R8F A;  1IN4 A;  2R65 A;  2FOI C;  4OX9 M;  2FE8 A;  4JYA M;  3AL0 C;  5ITX E;  3J81 S;  1N78 A;  2C9O A;  4NRV A;  3DA1 A;  4QNR A;  2XSZ D;  5FTJ A;  3GLI A;  4IIW A;  4CGY B;  4FWH A;  2D7G A;  3GRR A;  2VQF M;  2ZAM A;  3QAU A;  1Z59 A;  5IZ7 D;  3EIH A;  4D81 A;  4QOS A;  3VKG A;  1IXR C;  3FTC A;  5FSW A;  3SAW A;  2F4V M;  3CTW B;  3KFU G;  2D7E A;  3L2A A;  5A2Q S;  1N75 A;  3M0E A;  4QHT A;  2Y20 A;  4CHT B;  1L8Q A;  3AJI B;  1XC8 A;  2KRK A;  1J7K A;  3M7G A;  5KPZ A;  3LMM A;  4G4R A;  1Q3C A;  3VK7 A;  3U61 A;  4FCT A;  4LJ4 A;  4XGI A;  1I94 M;  2NQ8 C;  2Y0T A;  2DWZ B;  2BNK A;  2CEA A;  4GMQ A;  3ZCB B;  3FUW A;  4B3S M;  4GHL A;  2G5G X;  1QAO A;  1HT2 E;  2R4E A;  4NOO B;  3L29 A;  3KP0 E;  4JI0 M;  3T38 A;  3JR5 A;  2CHV A;  3U5Z A;  3LQQ A;  5KO3 A;  4IBE A;  4JI2 M;  4PD2 A;  3SAR A;  5EXX A;  1ORY B;  2X8A A;  3GPU A;  1IN5 A;  2R45 A;  2HL7 A;  4K0K M;  4BB9 A;  3L25 A;  4IBD A;  1N36 M;  4Z8X A;  4DR6 M;  1NNU C;  2E5L M;  4FWD A;  4KO8 A;  3RE8 A;  4JI6 M;  3KDS E;  4AW4 A;  1SXJ E;  3DZD A;  1R2Z A;  1G41 A;  2EUC A;  4REZ A;  1ZAE A;  5GKN A;  1XNQ M;  2RGO A;  4A3V B;  3T15 A;  2KZU A;  2XEP A;  2KW0 A;  3HU2 A;  3L27 A;  1IXS B;  1KFV A;  2CV0 A;  3D8L A;  4I4L A;  3LVW A;  1G8P A;  3HHZ A;  4R3D A;  3W0L B;  3SAT A;  2D7H A;  3RGS A;  1IY2 A;  4KLN A;  4X65 M;  2R18 A;  4FW9 A;  3HKP A;  3GRU A;  4X62 M;  2L7H A;  1X37 A;  3M6A A;  2ZM6 M;  1GKI A;  2VQE M;  1SXJ B;  4WUR A;  1QQW A;  1YUB A;  4FVM A;  4M0D A;  3W0F A;  4DV2 M;  1N34 M;  4GH9 A;  4DR1 M;  5EP2 A;  3FTE A;  5IRE B;  4LGM A;  4DV3 M;  3JAM S;  3FTD A;  1N33 M;  3VDU A;  1XXH B;  4YHH M;  3GRV A;  1HQC A;  2CV2 A;  4GHA A;  4BBA A;  1NY6 A;  2Z3X A;  1Z5C A;  3PFI A;  4R7G A;  5FTK A;  4DV4 M;  4B08 A;  4B7G A;  2F5O A;  3A42 A;  4L15 A;  1NSF A;  1GVN A;  4MH0 E;  3HHX A;  2OQ4 A;  4DR7 M;  1KYI A;  3HU3 A;  1W5S A;  3C58 A;  3U6P A;  1TH3 A;  3KW6 A;  5FLX S;  1EE8 A;  4LF5 M;  4I5S A;  2UUA M;  3TPZ A;  2DWL A;  3L28 A;  4QNM A;  3TL4 X;  4IBF A;  2XGN A;  2L6O A;  4ITQ A;  4DUZ M;  3PNY A;  4IBB A;  5FTN A;  2RKO A;  2XSZ A;  4FWG A;  4GC5 A;  3SMP A;  5KPT A;  3RGP A;  2UUB M;  2LXE A;  2QP9 X;  2HHH M;  4JI7 M;  2KZS A;  3AOG A;  3HJQ A;  2UU9 M;  4AKH A;  3UK6 A;  3ILK A;  3UGJ A;  3AV0 A;  5IT9 S;  4GKK M;  4AKG A;  4S12 A;  4JI8 M;  3FKE A;  3FUT A;  2UUC M;  3K1J A;  3SHG B;  1GLN A;  4MGK E;  2QZ4 A;  3TWM A;  3TQS A;  4X66 M;  3Q8X A;  1NJF A;  4LCB A;  2K47 A;  3SHF A;  3GQ5 A;  5F3W A;  4L4U A;  1SXJ A;  4NSR A;  5ITR A;  1NNJ A;  4JI5 M;  4LG2 A;  1TGU A;  4HLQ A;  3AOE A;  4GRI A;  3U6O A;  2YQZ A;  3FUV A;  2UXC M;  2W82 A;  1R2Y A;  3GLH A;  3T1H M;  4JI1 M;  4LF8 M;  1DGB A;  2QBY A;  1D2N A;  1DGH B;  4LZZ A;  4LFA M;  4DV6 M;  2LWX A;  2J7O A;  3KP1 E;  3A46 A;  3FYC A;  4II7 A;  3SC3 A;  4Z6Y A;  3UJN A;  4AG5 A;  4DR2 M;  3DFZ A;  2HKJ A;  2F5S A;  3MHV C;  4DR5 M;  1QZM A;  1NHG C;  4LJ7 A;  2BJW A;  4L16 A;  2X49 A;  4G4N A;  5EQT A;  4FCW A;  1QAN A;  3LVV A;  3UZU A;  1L1Z A;  3PXG A;  3SFZ A;  1DGH A;  1PJJ A;  4LF9 M;  1TDZ A;  3OTO M;  4B7F A;  2DXI A;  3J27 B;  2ERC A;  2QEN A;  3U6E A;  4JI4 M;  4TUW A;  5ITU A;  3A45 A;  1Z5B A;  3LQR A;  3TWK A;  3KOZ E;  4BLC A;  5LMN M;  4LGY A;  2DWN A;  2QCU A;  4MGY E;  3FTF A;  2YFQ A;  1IQP A;  3MJ5 A;  1IN7 A;  3GLF A;  5BPV A;  1OFH A;  4M9S A;  3GPY A;  4FCV A;  1E32 A;  3K2L A;  2AHM A;  3THG A;  1W5T A;  1NY5 A;  4AKI A;  3PNV A;  1VDD A;  7CAT A;  1IBK M;  1HNX M;  1H6U A;  2QPA A;  3SAV A;  1IBM M;  4LY6 A;  1IM2 A;  1E9R A;  4W5W A;  4IJF A;  4D80 A;  4NL4 H;  1Z5A A;  2DZO B;  3L26 A;  4AI6 A;  3AOE C;  2V6Z M;  5ITX A;  4LFB M;  5EP4 A;  2XFT A;  2CV1 A;  2BJV A;  3U6C A;  4LF4 M;  5KPR A;  2ZAN A;  3U6S A;  1PM5 A;  1HT1 E;  3CF2 A;  3VLF B;  2F5N A;  1IXZ A;  4AG6 A;  2C9C A;  1GL7 A;  4P16 A;  3J7A S;  5E26 A;  4PT5 A;  3J80 S;  3HJS A;  1HQY E;  3T1Y M;  1IBL M;  4AZF A;  1K3X A;  2L09 A;  5FTL A;  4L8R C;  3MK6 A;  3VFD A;  3VDP A;  3CF0 A;  4JN6 A;  2J7N A;  4LZJ A;  4LFC M;  3RFW A;  4B3R M;  1G4A E;  2L7I A;  1MX0 A;  4M9Z A;  3CF6 E;  3TE6 A;  4KOD A;  2JA2 A;  4LJ5 A;  1MU5 A;  2EA0 A;  4B7H A;  4DR3 M;  4MM3 B;  3I4Y A;  2Y0Q A;  3EIE A;  1TH2 A;  1WXQ A;  2YR0 A;  3FUU A;  3U6M A;  3A98 B;  2XZU A;  2C99 A;  3GLI B;  4YY3 M;  2UXB M;  1T3T A;  2V1C A;  3HHW A;  1E94 E;  3ZC7 B;  3I4V A;  3J7B A;  1SXJ C;  3GQ3 A;  5EJC A;  8CAT A;  4CIS A;  2R4J A;  2ZBK B;  4PDG A;  1R7R A;  2Z4R A;  1DGG A;  1Q39 A;  1R6B X;  2FFJ A;  5C18 A;  3AKZ A;  3FD9 A;  5E6J A;  5EP3 A;  2Z4S A;  4NXN M;  4KHP M;  4HL4 A;  4I8O A;  3SYL A;  5ITT A;  1NJG A;  4NRW A;  4QHS A;  5EXT A;  2DVW B;  4G6Z A;  3JR4 A;  3GLG A;  3GPX A;  2RGH A;  4LJ9 A;  1TDH A;  3NWL A;  4LJ8 A;  1NVM A;  4AQY M;  3U5Z B;  2CHG A;  4PCZ A;  3PVS A;  1HNW M;  5BR8 M;  2I7N A;  3KOY E;  3KOW E;  5ITY A;  4DUY M;  5EP1 A;  5IWA M;  4IBJ A;  2C5R A;  4D82 A;  3GO8 A;  3QWL A;  3VKH A;  3SMS A;  4MGZ E;  5JI3 E;  3SAU A;  1Q3B A;  3WHL A;  1HR0 M;  4LRT A;  3B9P A;  3BOS A;  3HGI A;  4RF0 A;  3AFH A;  1J09 A;  2OPF A;  1IY0 A;  1KSF X;  4FD2 A;  1TH4 A;  1K82 A;  4DR4 M;  4EIW A;  2X4A A;  1DO2 A;  3E4R A;  3HHY A;  4GIT A;  4G4O A;  3SBJ A;  2YNM D;  4NSO B;  3U6Q A;  3KVW A;  4IBC A;  2KA6 B;  3KOX E;  1YSY A;  4QOZ C;  2F5Q A;  3I51 A;  1OJL A;  1L2D A;  4DV0 M;  4OVZ B;  3NBI A;  4MGI E;  1DO0 A;  4MGH A;  1XMQ M;  1YE9 A;  2F5P A;  2DZN B;  1UM8 A;  3U6D A;  1NHW C;  2QBY B;  4L78 A;  5EXP A;  3WHK A;  3GP1 A;  4I81 A;  1L2C A;  1N32 M;  2CHQ A;  3R9X B;  3IG5 A;  5DYI A;  3KSX A;  4LRS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...