3JAMS

Cryoem structure of 40s-eif1a-eif1 complex from yeast
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
145
structure length
145
Chain Sequence
SLVVQEQGSFQHILRLLNTNVDGNINVVYALTTIRGVGRRYANLVCKKADVDLHKRAGELTQEELERIVQIMQNPTHYKIPAWFLNRQKDVNDGKDYHSLANNLESKLRDDLERLKKIRSHRGIRHFWGLRVRGQHTKTTGRRRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 18S rRNA
publication title Conformational Differences between Open and Closed States of the Eukaryotic Translation Initiation Complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Translation
total genus 23
structure length 145
sequence length 145
ec nomenclature
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3jamS01
1XC8A 1IBLM 4LF6M 1Z59A 5ITRA 3A42A 4LFAM 1K3WA 3SAUA 2F5PA 4DV7M 4B3TM 1TDHA 1R2ZA 1HNZM 3GQ4A 4DR5M 4YY3M 2XZUA 4DV0M 2ZM6M 3GP1A 3GPXA 3U6LA 4DV6M 4DR7M 1Z5CA 4KHPM 5ITXA 1FJGM 5ITXE 3C58A 2F5QA 4X65M 2OQ4A 4G4OA 4LFCM 4DR4M 2E5LM 3T1HM 3SAVA 4CISA 4YHHM 3A46A 5LMNM 2UUBM 4DV2M 5LMUM 4JI1M 4DV4M 4AQYM 3A45A 4GKKM 1Z5BA 3GO8A 4B3MM 1L1ZA 3U6DA 4X64M 3U6PA 4G4QA 3SBJA 4B3RM 1J5EM 2Q2EB 3U6MA 2UXCM 1Q3BA 2VQEM 4JI4M 1I94M 1XMQM 4JI3M 4JI8M 2EA0A 2F4VM 4DUYM 3TWMA 1HNWM 4ITQA 3J81S 4K0KM 1TDZA 4MB7A 4DR1M 4X62M 4DV5M 4JI6M 4JI7M 3GPPA 3U6EA 3T1YM 4G4RA 3W0FA 1N32M 1IBKM 1HNXM 3JR4A 2UXDM 3U6SA 3VK7A 1XNRM 4DV3M 1L2BA 1HR0M 3OTOM 4NRVA 4PDGA 1N34M 4JI5M 4JI0M 2UUAM 2F5SA 2UUCM 1NNJA 1R2YA 1K3XA 3JR5A 1Q3CA 3DOAA 5ITTA 3GPUA 3U6QA 4LFBM 5IT9S 1L1TA 2F5NA 1N36M 2HKJA 3SARA 1MU5A 4PDIA 3GQ5A 4DV1M 1L2CA 3U6CA 2UU9M 2UXBM 1PJIA 5ITUA 3SAWA 2OPFA 4DUZM 4JI2M 4GKJM 3JAMS 4DR3M 4DR6M 4JV5M 1MX0A 1XMOM 4LF9M 4LF8M 3TWLA 1PJJA 3TWKA 3VK8A 4LF5M 4JYAM 1L2DA 1Z5AA 2VQFM 2XZFA 1PM5A 2F5OA 2ZBKB 1Q39A 3SASA 4NXMM 1XNQM 5A2QS 4LF4M 4X66M 1EE8A 4LF7M 3J7AS 4B3SM 4PCZA 4OX9M 4NXNM 4NRWA 3SATA 4G4NA 3GPYA 3U6OA 4PD2A 1K82A 5ITYA 5BR8M 1IBMM 5FLXS 1KFVA 1N33M 5IWAM 4DR2M 2HHHM 3J80S 5ITQA 3GQ3A
chains in the Genus database with same CATH superfamily
2WSCF 3HHWA 3FYCA 5BPVA 2QBYB 4MGHA 1QUSA 4LFAM 3RFWA 2EKFA 4LJ9A 2CE7A 5C1BA 2B3TA 4B3TM 1WR1B 3LMMA 4LJ4A 4GHAA 4KT0F 1QDTA 3QWLA 2I7PA 1VDDA 3UGJA 3GQ4A 4DR5M 2XZUA 3GPXA 2FS1A 3TQSA 2L4FA 2Z4SA 4DV6M 3U60B 2K9DA 1QZMA 2LHGA 4S12A 2XFTA 5ITXA 3GLHA 3IG8A 1ZMWA 2F5QA 4G4OA 1D0KA 1PRBA 1VEGA 3L2AA 4MGZE 2J5YA 3T1HM 2DNAA 3VFDA 5FTJA 3CGWA 2CEAA 5LMUM 3DA1A 5KQDA 4GEWA 2HWJA 3A45A 4LCBA 1OFHA 4Z8XA 1ZQ9A 1OJLA 1Y8GA 3Q8GA 3GRRA 2VDBB 4M9XA 4IBGA 5DFLA 3LVWA 3U6PA 4LJAA 2D7EA 3LQQA 2DAEA 4QHSA 3UJNA 1TGUA 2X4AA 2XH9A 4D82A 1QAOA 2RGHA 2CHGA 1OIPA 1SXJB 2DVWB 3E4RA 2UXCM 1Q3BA 2Y0TA 4JI4M 3GLIB 1PJTA 2ZANA 1HNWM 4ITQA 1FNNA 4LGYA 4LJ8A 2EKKA 2BWBA 2H5XA 4IBFA 4MB7A 2R4JA 3W0FA 2JZ0A 3VLFB 3JR4A 1GJSA 2W82A 4KO8A 2KNAA 1L2BA 1XXHA 5JI2E 1PJQA 2O5RA 5EQTA 4PDGA 2O01F 3IG5A 2EO2A 3ZQJA 2F5SA 3J27B 4HL4A 2UUAM 4GHLA 3U5ZA 1JB0F 4RF1A 3L27A 1GVNA 1QAQA 3B74A 1S3SA 4L16A 4XK8F 1VEKA 3GPUA 4LFBM 3UZUA 3NBIA 3HHZA 5IT9S 2EUCA 2HKJA 1E9SA 1OAOC 4IBBA 3J2PB 3GLIE 1N36M 2OO9A 2UU9M 1N75A 1H6UA 5KQ8A 1IN6A 2UXBM 3HJSA 2I7NA 3SAWA 1JR3A 2OPFA 2O25A 1WGLA 2C5RA 1VQ1A 3W0LB 1IXZA 2KNZA 3JAMS 4DR6M 2QSFX 4LF8M 2GNOA 1PJJA 3TWKA 2R44A 3VDPA 4CGYB 1F4IA 3GLFA 1R7RA 1Z5AA 3KOYE 2C9OA 2XZFA 1G4AE 1Q39A 3WHLA 1AUAA 2V1CA 4HEOA 4NL4H 4OW0A 2Y21A 1CUKA 3AOEA 4PCZA 1GL7A 1WIVA 3FRIA 5IZ7D 4G4NA 3FD9A 1G3IA 2JA2A 2X8AA 1AIPC 5IWAM 4D81A 2M5ZA 3SHGB 4LRTA 3B9PA 2JUJA 1XC8A 3IECA 1IBLM 1V33A 4LF6M 4KODA 2JXNA 5FTMA 2JZ1A 3J7BA 4GMQA 2WSFF 1TDHA 3HHYA 1HNZM 2DAMA 1WJ7A 4YY3M 4G3OA 2OOAA 5KPZA 3UMMA 2CV2A 5EJCA 3U6LA 4W5WA 3E21A 5EXPA 1T3TA 3PVSA 5KO3A 4L78A 2CV1A 4KHPM 3GQ3A 3C58A 4DBGB 5FTKA 2L2DA 3L26A 1WXQA 1W5TA 3L29A 4CHTB 2Z7JA 4LFCM 2Y20A 2VF7A 4IJFA 4XBOA 3M0EA 2APLA 5FTLA 4CISA 3A46A 5LMNM 2UUBM 4DV2M 4B7HA 3KS8A 4JI1M 1QZEA 1N77A 1Z5BA 3GO8A 3HU2A 2QQ8A 1ZMUA 1PGYA 1GABA 8CATA 3KSJA 4NOOB 2QBYA 2DZLA 3PNVA 4IJEA 4QOSA 3SBJA 4NSOB 4ANRA 3BXWA 3AV0A 1HJPA 1ZAEA 5EP2A 2KZUA 3VKHA 2KDLA 3U60A 2XGNA 4Y28F 2V6ZM 2D7GA 3LW5F 2LVAA 2K0BX 2DHYA 1P3QQ 2MH8A 1NJGA 2P5TA 2F4VM 5EP1A 3CF0A 3TWMA 3FE3A 1XHBA 1TDZA 5C18A 4JI6M 3U6EA 2DZNB 4IIWA 3EIEA 2YR0A 1HNXM 1IN4A 2LTUA 4FWGA 4WW0A 2G5GX 3VK7A 3FUXA 4MGYE 3I4VA 4GIPA 2G3QA 1VG5A 3OTOM 2LXEA 4NRVA 4JI5M 4JI0M 1ZMVA 3B7ZA 1SXJA 2LVOC 1IM2A 3CF2A 4P17A 2BJWA 2DENA 4AW4A 3GLIA 1L1TA 2F5NA 3RGPA 2VF8A 1EIJA 1SXJC 1MU5A 1NJFA 2XFSA 3FUUA 2CWBA 2LVQD 3MJ5A 5DYGA 4PDIA 1D2NA 2KRKA 4DV1M 3HU1A 1PJIA 2CHQA 2R4EA 3KVWA 4M0WA 1SXJD 1IN7A 2MJ5B 4ZPXA 2BJVA 4AKHA 2L09A 2DXIA 3K8ZA 2DWLA 3I01M 4GKJM 4DR3M 3C3DA 1MX0A 1XMOM 3TPZA 2R45A 4QNRA 3K9PA 2XF3A 2YQZA 2R65A 4L6V6 4MH0E 4LF5M 2JY8A 3RE8A 3HX3A 4B08A 4NC6A 4FWHA 2F5OA 2ZBKB 3PXGA 4A3VB 2DAGA 5A2QS 3HHXA 2DHRA 2LH0A 2YNMD 4JXJA 4FWDA 4AKIA 1V34A 2JP7A 5DYIA 1HT1E 1J7KA 2XSZA 3U6OA 4LG2A 3W67A 3QAUA 4OVZB 1NO1A 2FH0A 3KOWE 4Q7JA 5ITYA 5FLXS 1XWIA 5EXXA 1KFVA 1TH2A 1N33M 3D8BA 1MJGM 1OQYA 4R3DA 5ITQA 1GJTA 1YUBA 4FCVA 1RU3A 3T15A 2N35A 3C9PA 2K47A 2WSEF 1LV7A 3FUWA 4LY6A 3A98B 1KSFX 2YFQA 3K92A 4IBDA 2LVNC 2XSZD 3B7QA 1A5TA 3W68A 2ZTDA 3L25A 3GP1A 4FCWA 1N78A 1E32A 1GKIA 4TUWA 1ZV1A 3FKEA 1LTMA 3IHPA 1JR3D 3M6AA 3FUVA 2QNJA 3VDUA 4X65M 3HZJA 2OQ4A 4OU7A 1VEJA 2Y0QA 2E5LM 4DR4M 4JN6A 2JY7A 4GH9A 2DZOB 4YHHM 1G41A 3KP1E 1OIZA 4M9ZA 3E9SA 4I81A 4DV4M 4GKKM 2KA6B 4IBJA 3AOEC 2C98A 1UFZA 2R18A 4IBEA 1IY1A 2C99A 2MGWA 3U6DA 1XXHE 5F3WA 2ERCA 4II7A 3RGSA 4I8OA 3HGIA 1UM8A 1I4WA 2K6BA 2L7IA 2QENA 2QHOB 2KZSA 2R62A 3K2LA 1HT2E 2Q2EB 4IBIA 3U6MA 3ZH9B 4LGMA 5E26A 1IXRC 3D8LA 2XLJA 2VQEM 1T6OA 2AHMA 1I94M 1NY5A 4LJ6A 2EA0A 2DAIA 3KOZE 4LJ5A 4L4UA 1IN5A 3KW6A 1Q02A 1Z6TA 3AL0C 4X62M 4DV5M 2BNKA 1NSFA 2QP9X 3GPPA 2NQ8C 3K9OA 4G4RA 3VKGA 1N32M 2BWEA 2CP8A 3L28A 3GRUA 4IBCA 4BB9A 2UXDM 4NSRA 1R5LA 1C7YA 3GRVA 1C1KA 1HR0M 4L15A 1DGHA 2XEPA 3GLGB 1N34M 3FTDA 2V1UA 1DGHB 3KFUG 2UUCM 1OFIA 1DGGA 1R2YA 3QYEA 3JR5A 3DOAA 2R0IA 5ITTA 2ZAMA 4KLNA 5EXSA 3AKZA 1YE9A 2KW0A 1HQCA 1QYRA 2Z3XA 2DWZB 4P16A 3PFIA 3THGA 2MR9A 1QVRA 5GKNA 3T6PA 5DNYA 3GQ5A 2DI0A 3KDSE 3U6CA 1L2CA 1NHGC 3C3EA 1NNUC 2KHHA 1QAMA 4GC9A 4LZZA 4R7GA 2CHVA 2R6FA 5KPTA 2Z4RA 1IXSB 5ITUA 4AKGA 1IY2A 3I51A 4FVMA 3CTWB 1J09A 2A5YB 4GC5A 3FTFA 4JI2M 4PT5A 3MMPA 4IBKA 3SMPA 3SHFA 2HCBA 4BLCA 3TWLA 1DV0A 1T43A 1BVSA 3GLGE 2JY6B 1GLNA 2QPAA 3E46A 1G59A 4F2LA 4RNAA 2VQFM 4JYAM 1PM5A 2HAKA 1NY6A 1D0MA 1PJSA 4AZFA 1XNQM 3SASA 3LVVA 1EFUB 3GLHB 4WP2A 3HJQA 4LF7M 3J7AS 4AI6A 1DO2A 1NV9A 2ZAOA 3KSXA 3SATA 4L8RC 2L4EA 3SC3A 1X37A 3QYBA 4PD2A 1IBMM 2Z8YM 3MK6A 3CF6E 3KP0E 5H37D 2HHHM 2EJSA 3J80S 5IREB 2M60A 3Q8XA 4EIWA 2JWSA 1G8PA 1E9RA 1DGFA 1Z59A 2OOBA 3A42A 4QHTA 5ITRA 3SAUA 1K3WA 3HKPA 2CV0A 4DV7M 2F5PA 5JI3E 1R2ZA 1DGBA 4DV0M 2ZM6M 4R71A 4B7FA 1TR8A 2FE8A 4FW9A 4GITA 5E6JA 1YLAA 3WHKA 4DR7M 1Z5CA 1FJGM 5EP3A 5ITXE 3NWLA 2KXEA 2VIIA 2ZTCA 3GLHE 2LBCA 1GO5A 2FNAA 3FUTA 4MGIE 3PNYA 1JQJC 3GRYA 4CIZA 3SAVA 2J7OA 4LRSA 4OVZA 1WHCA 4AQYM 2DKLA 1GL6A 5FSWA 3TE6A 4B3MM 3HU3A 3KXEC 1L1ZA 1QQWA 3KOXE 3AOGA 4BBAA 2CFOA 4X64M 4FCTA 1XXHB 3DFZA 3ILKA 3V76A 2CRUA 1TF0B 1TH3A 3EIHA 4G4QA 3KS4A 2R46A 4HLQA 4B3RM 1J5EM 4B7GA 2HL7A 2L6OA 3R8FA 1SXJE 5KPRA 3U5ZB 2LNHC 3UK6A 3HY5A 3H4JA 1XMQM 1OAIA 3FRHA 4JI3M 4Z6YA 4JI8M 2CUZA 4DUYM 1VDLA 2MROB 1NV8A 3J81S 2D7HA 3LCVB 4K0KM 4MGKE 3R9XB 4DR1M 1TTEA 3SYLA 4JI7M 3LCUA 1NVMA 2X49A 3T1YM 2LVPC 2WZJA 2G8LA 4REZA 1IBKM 3HJ8A 5EXTA 4AG5A 1L8QA 3U6SA 1XNRM 4D80A 4DV3M 1V92A 2RGOA 2FOIC 1R4GA 4QNMA 3T38A 5FTNA 4MM3B 4QOZC 3FYDA 1OTRA 2JY5A 4XGIA 2J7NA 3GLFB 1NNJA 3MHVC 1K3XA 1Q3CA 1R6BX 2C96A 3F92A 1TH4A 4LZJA 4M9SA 1YSYA 3FTEA 2DWNA 2C9CA 2DAKA 1NHWC 3U6QA 2KNVA 1OKSA 1HQYE 4CJ6A 4GRIA 3SMSA 3SARA 2DWMA 4F1IA 1QDRA 2KRUA 3SYKA 3B89A 3LQRA 4I5SA 3SFZA 4I4LA 1JR3E 3M7GA 1SG9A 1WGNA 3ZC7B 4LJ7A 4DUZM 1W5SA 2KEBA 1G71A 1QUTA 3FTCA 3K1JA 4RKUF 2QCUA 4M0DA 5L8RF 3AFHA 1KYIA 2QZ4A 4JV5M 4LF9M 1IY0A 3GLGA 1IN8A 3VK8A 3AJIB 1D0LA 3BOSA 3I4YA 1L2DA 3ZCBB 3GLFE 1IQPA 3TL4X 3I04M 7CATA 2FFJA 1DO0A 2GQFA 2RKOA 3H4MA 4NXMM 1MN3A 5EP4A 2LHCA 3NBXX 1E94E 3U61A 4LF4M 4X66M 1EE8A 3B7NA 2JNHA 4RF0A 3U61B 4B3SM 4OX9M 1XB2B 4UN2B 4NXNM 2LWXA 4NRWA 3GPYA 4AG6A 1K82A 3DZDA 5BR8M 4FD2A 4G6ZA 2H1RA 4WURA 2L7HA 2RRUA 1IXSA 3HWSA 4DR2M 1IFYA 1QANA 3BBZA 1ORYB
chains in the Genus database with same CATH topology
3HHWA 3FYCA 5BPVA 2QBYB 4MGHA 3RFWA 4LFAM 4LJ9A 2CE7A 5C1BA 4B3TM 3LMMA 4LJ4A 4GHAA 3QWLA 2I7PA 1VDDA 3UGJA 3GQ4A 4DR5M 2XZUA 3GPXA 3TQSA 2Z4SA 4DV6M 3U60B 1QZMA 4S12A 2XFTA 5ITXA 3GLHA 3IG8A 2F5QA 4G4OA 3L2AA 4MGZE 3T1HM 3VFDA 5FTJA 2CEAA 5LMUM 3DA1A 5KQDA 3A45A 4LCBA 1OFHA 4Z8XA 1ZQ9A 1OJLA 3GRRA 4M9XA 4IBGA 3LVWA 3U6PA 4LJAA 2D7EA 3LQQA 4QHSA 3UJNA 1TGUA 2X4AA 2XH9A 4D82A 1QAOA 2RGHA 2CHGA 1SXJB 2DVWB 3E4RA 2UXCM 1Q3BA 2Y0TA 4JI4M 3GLIB 2ZANA 1HNWM 4ITQA 1FNNA 4LGYA 4LJ8A 4IBFA 4MB7A 2R4JA 3W0FA 3VLFB 3JR4A 2W82A 4KO8A 1L2BA 1XXHA 5JI2E 2O5RA 5EQTA 4PDGA 3IG5A 2EO2A 2F5SA 2UUAM 3J27B 4HL4A 4GHLA 3U5ZA 4RF1A 3L27A 1GVNA 1QAQA 4L16A 1S3SA 3GPUA 4LFBM 3UZUA 3NBIA 3HHZA 5IT9S 2EUCA 2HKJA 1E9SA 4IBBA 1N36M 3J2PB 2UU9M 1N75A 1H6UA 5KQ8A 1IN6A 2UXBM 3HJSA 2I7NA 3SAWA 1JR3A 2OPFA 2C5RA 3W0LB 1IXZA 3JAMS 4DR6M 4LF8M 1PJJA 3TWKA 3VDPA 4CGYB 3GLFA 1R7RA 1Z5AA 3KOYE 2C9OA 2XZFA 1G4AE 1Q39A 3WHLA 2V1CA 4NL4H 4OW0A 2Y21A 3AOEA 4PCZA 1GL7A 5IZ7D 4G4NA 3FD9A 1G3IA 2JA2A 2X8AA 5IWAM 4D81A 2M5ZA 3SHGB 4LRTA 3B9PA 1XC8A 1IBLM 4LF6M 4KODA 5FTMA 3J7BA 4GMQA 1TDHA 3HHYA 1HNZM 4YY3M 5KPZA 3UMMA 2CV2A 5EJCA 3U6LA 4W5WA 5EXPA 5KO3A 1T3TA 3PVSA 4L78A 2CV1A 4KHPM 3GQ3A 3C58A 5FTKA 3L26A 1WXQA 1W5TA 3L29A 4CHTB 2Z7JA 4LFCM 2Y20A 4IJFA 4XBOA 3M0EA 5FTLA 4CISA 3A46A 5LMNM 2UUBM 4DV2M 4B7HA 3KS8A 4JI1M 1N77A 1Z5BA 3GO8A 3HU2A 8CATA 3KSJA 4NOOB 2QBYA 3PNVA 4IJEA 4QOSA 3SBJA 4NSOB 3AV0A 1ZAEA 5EP2A 2KZUA 3VKHA 3U60A 2XGNA 2V6ZM 2D7GA 1NJGA 2P5TA 2F4VM 5EP1A 3CF0A 3TWMA 1XHBA 1TDZA 5C18A 4JI6M 3U6EA 2DZNB 4IIWA 3EIEA 2YR0A 1HNXM 1IN4A 4FWGA 4WW0A 2G5GX 3VK7A 3FUXA 4MGYE 3I4VA 4GIPA 3OTOM 2LXEA 4NRVA 4JI5M 4JI0M 1SXJA 1IM2A 3CF2A 2BJWA 4AW4A 3GLIA 1L1TA 2F5NA 3RGPA 1SXJC 1MU5A 1NJFA 2XFSA 3FUUA 3MJ5A 5DYGA 4PDIA 4DV1M 1D2NA 2KRKA 3HU1A 1PJIA 2CHQA 2R4EA 3KVWA 4M0WA 1SXJD 1IN7A 4ZPXA 2BJVA 4AKHA 2L09A 2DXIA 3K8ZA 2DWLA 4GKJM 4DR3M 1MX0A 1XMOM 3TPZA 2R45A 4QNRA 2XF3A 2YQZA 2R65A 4MH0E 4LF5M 3RE8A 4B08A 2F5OA 4FWHA 2ZBKB 3PXGA 4A3VB 5A2QS 3HHXA 2DHRA 2LH0A 2YNMD 4JXJA 4FWDA 4AKIA 5DYIA 1HT1E 1J7KA 2XSZA 3U6OA 4LG2A 3QAUA 4OVZB 5ITYA 3KOWE 5FLXS 1XWIA 5EXXA 1KFVA 1TH2A 1N33M 3D8BA 4R3DA 5ITQA 1YUBA 4FCVA 3T15A 2K47A 3FUWA 1LV7A 4LY6A 3A98B 1KSFX 2YFQA 3K92A 4IBDA 2XSZD 3L25A 3GP1A 4FCWA 1N78A 1E32A 1GKIA 4TUWA 3FKEA 1JR3D 3M6AA 3FUVA 3VDUA 4X65M 2OQ4A 4DR4M 4OU7A 2Y0QA 2E5LM 4JN6A 4GH9A 2DZOB 4YHHM 1G41A 3KP1E 4M9ZA 3E9SA 4I81A 4DV4M 4GKKM 2KA6B 4IBJA 3AOEC 2C98A 2R18A 4IBEA 1IY1A 2C99A 3U6DA 5F3WA 2ERCA 4II7A 3RGSA 4I8OA 3HGIA 1UM8A 1I4WA 2L7IA 2QENA 2KZSA 2R62A 3K2LA 1HT2E 2Q2EB 4IBIA 3U6MA 3ZH9B 4LGMA 5E26A 1IXRC 3D8LA 2XLJA 2VQEM 2AHMA 1I94M 1NY5A 4LJ6A 2EA0A 3KOZE 4LJ5A 4L4UA 1IN5A 3KW6A 1Z6TA 3AL0C 4X62M 4DV5M 2BNKA 1NSFA 2QP9X 3GPPA 2NQ8C 4G4RA 3VKGA 1N32M 3L28A 3GRUA 4IBCA 4BB9A 2UXDM 4NSRA 3GRVA 1C1KA 1HR0M 4L15A 1DGHA 2XEPA 3GLGB 1N34M 3FTDA 2V1UA 1DGHB 3KFUG 2UUCM 1OFIA 1DGGA 1R2YA 3JR5A 3DOAA 5ITTA 2ZAMA 4KLNA 5EXSA 3AKZA 1YE9A 2KW0A 1HQCA 1QYRA 2Z3XA 2DWZB 4P16A 3PFIA 3THGA 1QVRA 5GKNA 5DNYA 3GQ5A 1L2CA 3U6CA 3KDSE 1NHGC 1NNUC 1QAMA 4GC9A 4LZZA 4R7GA 2CHVA 5KPTA 5ITUA 2Z4RA 1IXSB 4AKGA 1IY2A 3I51A 4FVMA 3CTWB 1J09A 2A5YB 4GC5A 3FTFA 4JI2M 4PT5A 4IBKA 3SMPA 3SHFA 2HCBA 4BLCA 3TWLA 1GLNA 2QPAA 1G59A 4JYAM 4RNAA 2VQFM 1PM5A 1NY6A 4AZFA 1XNQM 3SASA 3LVVA 3GLHB 3HJQA 4LF7M 3J7AS 4AI6A 1DO2A 2ZAOA 3KSXA 3SATA 4L8RC 3SC3A 1X37A 4PD2A 1IBMM 3MK6A 3CF6E 3KP0E 5H37D 2HHHM 3J80S 5IREB 2M60A 3Q8XA 4EIWA 1G8PA 1E9RA 1DGFA 1Z59A 4QHTA 3A42A 5ITRA 1K3WA 3SAUA 2CV0A 3HKPA 2F5PA 4DV7M 5JI3E 1R2ZA 1DGBA 4DV0M 2ZM6M 4B7FA 2FE8A 4FW9A 4GITA 5E6JA 3WHKA 4DR7M 1Z5CA 1FJGM 5EP3A 5ITXE 3NWLA 2KXEA 2VIIA 2FNAA 3FUTA 4MGIE 3PNYA 1JQJC 3GRYA 3SAVA 2J7OA 4LRSA 4OVZA 4AQYM 1GL6A 5FSWA 3TE6A 4B3MM 3HU3A 3KXEC 1L1ZA 1QQWA 3KOXE 3AOGA 4BBAA 2CFOA 4X64M 4FCTA 1XXHB 3DFZA 3ILKA 4G4QA 1TH3A 3EIHA 3KS4A 2R46A 4HLQA 4B3RM 1J5EM 4B7GA 2HL7A 2L6OA 3R8FA 1SXJE 5KPRA 3U5ZB 2LNHC 3UK6A 1XMQM 4JI3M 4Z6YA 4JI8M 2CUZA 4DUYM 3J81S 2D7HA 4K0KM 4MGKE 3R9XB 4DR1M 4JI7M 3SYLA 1NVMA 2X49A 3T1YM 2G8LA 4REZA 1IBKM 3HJ8A 5EXTA 4AG5A 1L8QA 3U6SA 1XNRM 4D80A 4DV3M 2RGOA 2FOIC 4QNMA 3T38A 5FTNA 4MM3B 4QOZC 3FYDA 4XGIA 2J7NA 3GLFB 1NNJA 3MHVC 1K3XA 1Q3CA 1R6BX 2C96A 4LZJA 1TH4A 4M9SA 1YSYA 3FTEA 2DWNA 2C9CA 1NHWC 3U6QA 1HQYE 4GRIA 3SMSA 3SARA 2DWMA 2KRUA 3SYKA 3LQRA 4I5SA 3SFZA 4I4LA 3M7GA 3ZC7B 4DUZM 4LJ7A 1W5SA 2KEBA 3FTCA 3K1JA 2QCUA 4M0DA 3AFHA 1KYIA 2QZ4A 4JV5M 4LF9M 1IY0A 3GLGA 1IN8A 3VK8A 3AJIB 3BOSA 3I4YA 1L2DA 3ZCBB 1IQPA 3TL4X 7CATA 2FFJA 1DO0A 2RKOA 3H4MA 4NXMM 5EP4A 1E94E 3U61A 4LF4M 4X66M 1EE8A 3U61B 4RF0A 4B3SM 4OX9M 4NXNM 2LWXA 4NRWA 3GPYA 4AG6A 1K82A 3DZDA 5BR8M 4FD2A 4G6ZA 2H1RA 4WURA 2L7HA 3HWSA 4DR2M 1QANA 1ORYB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XC8 A;  1IBL M;  4LF6 M;  1Z59 A;  5ITR A;  3A42 A;  4LFA M;  1K3W A;  3SAU A;  2F5P A;  4DV7 M;  4B3T M;  1TDH A;  1R2Z A;  1HNZ M;  3GQ4 A;  4DR5 M;  4YY3 M;  2XZU A;  4DV0 M;  2ZM6 M;  3GP1 A;  3GPX A;  3U6L A;  4DV6 M;  4DR7 M;  1Z5C A;  4KHP M;  5ITX A;  1FJG M;  5ITX E;  3C58 A;  2F5Q A;  4X65 M;  2OQ4 A;  4G4O A;  4LFC M;  4DR4 M;  2E5L M;  3T1H M;  3SAV A;  4CIS A;  4YHH M;  3A46 A;  5LMN M;  2UUB M;  4DV2 M;  5LMU M;  4JI1 M;  4DV4 M;  4AQY M;  3A45 A;  4GKK M;  1Z5B A;  3GO8 A;  4B3M M;  1L1Z A;  3U6D A;  4X64 M;  3U6P A;  4G4Q A;  3SBJ A;  4B3R M;  1J5E M;  2Q2E B;  3U6M A;  2UXC M;  1Q3B A;  2VQE M;  4JI4 M;  1I94 M;  1XMQ M;  4JI3 M;  4JI8 M;  2EA0 A;  2F4V M;  4DUY M;  3TWM A;  1HNW M;  4ITQ A;  3J81 S;  4K0K M;  1TDZ A;  4MB7 A;  4DR1 M;  4X62 M;  4DV5 M;  4JI6 M;  4JI7 M;  3GPP A;  3U6E A;  3T1Y M;  4G4R A;  3W0F A;  1N32 M;  1IBK M;  1HNX M;  3JR4 A;  2UXD M;  3U6S A;  3VK7 A;  1XNR M;  4DV3 M;  1L2B A;  1HR0 M;  3OTO M;  4NRV A;  4PDG A;  1N34 M;  4JI5 M;  4JI0 M;  2UUA M;  2F5S A;  2UUC M;  1NNJ A;  1R2Y A;  1K3X A;  3JR5 A;  1Q3C A;  3DOA A;  5ITT A;  3GPU A;  3U6Q A;  4LFB M;  5IT9 S;  1L1T A;  2F5N A;  1N36 M;  2HKJ A;  3SAR A;  1MU5 A;  4PDI A;  3GQ5 A;  4DV1 M;  1L2C A;  3U6C A;  2UU9 M;  2UXB M;  1PJI A;  5ITU A;  3SAW A;  2OPF A;  4DUZ M;  4JI2 M;  4GKJ M;  3JAM S;  4DR3 M;  4DR6 M;  4JV5 M;  1MX0 A;  1XMO M;  4LF9 M;  4LF8 M;  3TWL A;  1PJJ A;  3TWK A;  3VK8 A;  4LF5 M;  4JYA M;  1L2D A;  1Z5A A;  2VQF M;  2XZF A;  1PM5 A;  2F5O A;  2ZBK B;  1Q39 A;  3SAS A;  4NXM M;  1XNQ M;  5A2Q S;  4LF4 M;  4X66 M;  1EE8 A;  4LF7 M;  3J7A S;  4B3S M;  4PCZ A;  4OX9 M;  4NXN M;  4NRW A;  3SAT A;  4G4N A;  3GPY A;  3U6O A;  4PD2 A;  1K82 A;  5ITY A;  5BR8 M;  1IBM M;  5FLX S;  1KFV A;  1N33 M;  5IWA M;  4DR2 M;  2HHH M;  3J80 S;  5ITQ A;  3GQ3 A; 
#chains in the Genus database with same CATH topology
 2WSC F;  3HHW A;  3FYC A;  5BPV A;  2QBY B;  4MGH A;  1QUS A;  4LFA M;  3RFW A;  2EKF A;  4LJ9 A;  2CE7 A;  5C1B A;  2B3T A;  4B3T M;  1WR1 B;  3LMM A;  4LJ4 A;  4GHA A;  4KT0 F;  1QDT A;  3QWL A;  2I7P A;  1VDD A;  3UGJ A;  3GQ4 A;  4DR5 M;  2XZU A;  3GPX A;  2FS1 A;  3TQS A;  2L4F A;  2Z4S A;  4DV6 M;  3U60 B;  2K9D A;  1QZM A;  2LHG A;  4S12 A;  2XFT A;  5ITX A;  3GLH A;  3IG8 A;  1ZMW A;  2F5Q A;  4G4O A;  1D0K A;  1PRB A;  1VEG A;  3L2A A;  4MGZ E;  2J5Y A;  3T1H M;  2DNA A;  3VFD A;  5FTJ A;  3CGW A;  2CEA A;  5LMU M;  3DA1 A;  5KQD A;  4GEW A;  2HWJ A;  3A45 A;  4LCB A;  1OFH A;  4Z8X A;  1ZQ9 A;  1OJL A;  1Y8G A;  3Q8G A;  3GRR A;  2VDB B;  4M9X A;  4IBG A;  5DFL A;  3LVW A;  3U6P A;  4LJA A;  2D7E A;  3LQQ A;  2DAE A;  4QHS A;  3UJN A;  1TGU A;  2X4A A;  2XH9 A;  4D82 A;  1QAO A;  2RGH A;  2CHG A;  1OIP A;  1SXJ B;  2DVW B;  3E4R A;  2UXC M;  1Q3B A;  2Y0T A;  4JI4 M;  3GLI B;  1PJT A;  2ZAN A;  1HNW M;  4ITQ A;  1FNN A;  4LGY A;  4LJ8 A;  2EKK A;  2BWB A;  2H5X A;  4IBF A;  4MB7 A;  2R4J A;  3W0F A;  2JZ0 A;  3VLF B;  3JR4 A;  1GJS A;  2W82 A;  4KO8 A;  2KNA A;  1L2B A;  1XXH A;  5JI2 E;  1PJQ A;  2O5R A;  5EQT A;  4PDG A;  2O01 F;  3IG5 A;  2EO2 A;  3ZQJ A;  2F5S A;  3J27 B;  4HL4 A;  2UUA M;  4GHL A;  3U5Z A;  1JB0 F;  4RF1 A;  3L27 A;  1GVN A;  1QAQ A;  3B74 A;  1S3S A;  4L16 A;  4XK8 F;  1VEK A;  3GPU A;  4LFB M;  3UZU A;  3NBI A;  3HHZ A;  5IT9 S;  2EUC A;  2HKJ A;  1E9S A;  1OAO C;  4IBB A;  3J2P B;  3GLI E;  1N36 M;  2OO9 A;  2UU9 M;  1N75 A;  1H6U A;  5KQ8 A;  1IN6 A;  2UXB M;  3HJS A;  2I7N A;  3SAW A;  1JR3 A;  2OPF A;  2O25 A;  1WGL A;  2C5R A;  1VQ1 A;  3W0L B;  1IXZ A;  2KNZ A;  3JAM S;  4DR6 M;  2QSF X;  4LF8 M;  2GNO A;  1PJJ A;  3TWK A;  2R44 A;  3VDP A;  4CGY B;  1F4I A;  3GLF A;  1R7R A;  1Z5A A;  3KOY E;  2C9O A;  2XZF A;  1G4A E;  1Q39 A;  3WHL A;  1AUA A;  2V1C A;  4HEO A;  4NL4 H;  4OW0 A;  2Y21 A;  1CUK A;  3AOE A;  4PCZ A;  1GL7 A;  1WIV A;  3FRI A;  5IZ7 D;  4G4N A;  3FD9 A;  1G3I A;  2JA2 A;  2X8A A;  1AIP C;  5IWA M;  4D81 A;  2M5Z A;  3SHG B;  4LRT A;  3B9P A;  2JUJ A;  1XC8 A;  3IEC A;  1IBL M;  1V33 A;  4LF6 M;  4KOD A;  2JXN A;  5FTM A;  2JZ1 A;  3J7B A;  4GMQ A;  2WSF F;  1TDH A;  3HHY A;  1HNZ M;  2DAM A;  1WJ7 A;  4YY3 M;  4G3O A;  2OOA A;  5KPZ A;  3UMM A;  2CV2 A;  5EJC A;  3U6L A;  4W5W A;  3E21 A;  5EXP A;  1T3T A;  3PVS A;  5KO3 A;  4L78 A;  2CV1 A;  4KHP M;  3GQ3 A;  3C58 A;  4DBG B;  5FTK A;  2L2D A;  3L26 A;  1WXQ A;  1W5T A;  3L29 A;  4CHT B;  2Z7J A;  4LFC M;  2Y20 A;  2VF7 A;  4IJF A;  4XBO A;  3M0E A;  2APL A;  5FTL A;  4CIS A;  3A46 A;  5LMN M;  2UUB M;  4DV2 M;  4B7H A;  3KS8 A;  4JI1 M;  1QZE A;  1N77 A;  1Z5B A;  3GO8 A;  3HU2 A;  2QQ8 A;  1ZMU A;  1PGY A;  1GAB A;  8CAT A;  3KSJ A;  4NOO B;  2QBY A;  2DZL A;  3PNV A;  4IJE A;  4QOS A;  3SBJ A;  4NSO B;  4ANR A;  3BXW A;  3AV0 A;  1HJP A;  1ZAE A;  5EP2 A;  2KZU A;  3VKH A;  2KDL A;  3U60 A;  2XGN A;  4Y28 F;  2V6Z M;  2D7G A;  3LW5 F;  2LVA A;  2K0B X;  2DHY A;  1P3Q Q;  2MH8 A;  1NJG A;  2P5T A;  2F4V M;  5EP1 A;  3CF0 A;  3TWM A;  3FE3 A;  1XHB A;  1TDZ A;  5C18 A;  4JI6 M;  3U6E A;  2DZN B;  4IIW A;  3EIE A;  2YR0 A;  1HNX M;  1IN4 A;  2LTU A;  4FWG A;  4WW0 A;  2G5G X;  3VK7 A;  3FUX A;  4MGY E;  3I4V A;  4GIP A;  2G3Q A;  1VG5 A;  3OTO M;  2LXE A;  4NRV A;  4JI5 M;  4JI0 M;  1ZMV A;  3B7Z A;  1SXJ A;  2LVO C;  1IM2 A;  3CF2 A;  4P17 A;  2BJW A;  2DEN A;  4AW4 A;  3GLI A;  1L1T A;  2F5N A;  3RGP A;  2VF8 A;  1EIJ A;  1SXJ C;  1MU5 A;  1NJF A;  2XFS A;  3FUU A;  2CWB A;  2LVQ D;  3MJ5 A;  5DYG A;  4PDI A;  1D2N A;  2KRK A;  4DV1 M;  3HU1 A;  1PJI A;  2CHQ A;  2R4E A;  3KVW A;  4M0W A;  1SXJ D;  1IN7 A;  2MJ5 B;  4ZPX A;  2BJV A;  4AKH A;  2L09 A;  2DXI A;  3K8Z A;  2DWL A;  3I01 M;  4GKJ M;  4DR3 M;  3C3D A;  1MX0 A;  1XMO M;  3TPZ A;  2R45 A;  4QNR A;  3K9P A;  2XF3 A;  2YQZ A;  2R65 A;  4L6V 6;  4MH0 E;  4LF5 M;  2JY8 A;  3RE8 A;  3HX3 A;  4B08 A;  4NC6 A;  4FWH A;  2F5O A;  2ZBK B;  3PXG A;  4A3V B;  2DAG A;  5A2Q S;  3HHX A;  2DHR A;  2LH0 A;  2YNM D;  4JXJ A;  4FWD A;  4AKI A;  1V34 A;  2JP7 A;  5DYI A;  1HT1 E;  1J7K A;  2XSZ A;  3U6O A;  4LG2 A;  3W67 A;  3QAU A;  4OVZ B;  1NO1 A;  2FH0 A;  3KOW E;  4Q7J A;  5ITY A;  5FLX S;  1XWI A;  5EXX A;  1KFV A;  1TH2 A;  1N33 M;  3D8B A;  1MJG M;  1OQY A;  4R3D A;  5ITQ A;  1GJT A;  1YUB A;  4FCV A;  1RU3 A;  3T15 A;  2N35 A;  3C9P A;  2K47 A;  2WSE F;  1LV7 A;  3FUW A;  4LY6 A;  3A98 B;  1KSF X;  2YFQ A;  3K92 A;  4IBD A;  2LVN C;  2XSZ D;  3B7Q A;  1A5T A;  3W68 A;  2ZTD A;  3L25 A;  3GP1 A;  4FCW A;  1N78 A;  1E32 A;  1GKI A;  4TUW A;  1ZV1 A;  3FKE A;  1LTM A;  3IHP A;  1JR3 D;  3M6A A;  3FUV A;  2QNJ A;  3VDU A;  4X65 M;  3HZJ A;  2OQ4 A;  4OU7 A;  1VEJ A;  2Y0Q A;  2E5L M;  4DR4 M;  4JN6 A;  2JY7 A;  4GH9 A;  2DZO B;  4YHH M;  1G41 A;  3KP1 E;  1OIZ A;  4M9Z A;  3E9S A;  4I81 A;  4DV4 M;  4GKK M;  2KA6 B;  4IBJ A;  3AOE C;  2C98 A;  1UFZ A;  2R18 A;  4IBE A;  1IY1 A;  2C99 A;  2MGW A;  3U6D A;  1XXH E;  5F3W A;  2ERC A;  4II7 A;  3RGS A;  4I8O A;  3HGI A;  1UM8 A;  1I4W A;  2K6B A;  2L7I A;  2QEN A;  2QHO B;  2KZS A;  2R62 A;  3K2L A;  1HT2 E;  2Q2E B;  4IBI A;  3U6M A;  3ZH9 B;  4LGM A;  5E26 A;  1IXR C;  3D8L A;  2XLJ A;  2VQE M;  1T6O A;  2AHM A;  1I94 M;  1NY5 A;  4LJ6 A;  2EA0 A;  2DAI A;  3KOZ E;  4LJ5 A;  4L4U A;  1IN5 A;  3KW6 A;  1Q02 A;  1Z6T A;  3AL0 C;  4X62 M;  4DV5 M;  2BNK A;  1NSF A;  2QP9 X;  3GPP A;  2NQ8 C;  3K9O A;  4G4R A;  3VKG A;  1N32 M;  2BWE A;  2CP8 A;  3L28 A;  3GRU A;  4IBC A;  4BB9 A;  2UXD M;  4NSR A;  1R5L A;  1C7Y A;  3GRV A;  1C1K A;  1HR0 M;  4L15 A;  1DGH A;  2XEP A;  3GLG B;  1N34 M;  3FTD A;  2V1U A;  1DGH B;  3KFU G;  2UUC M;  1OFI A;  1DGG A;  1R2Y A;  3QYE A;  3JR5 A;  3DOA A;  2R0I A;  5ITT A;  2ZAM A;  4KLN A;  5EXS A;  3AKZ A;  1YE9 A;  2KW0 A;  1HQC A;  1QYR A;  2Z3X A;  2DWZ B;  4P16 A;  3PFI A;  3THG A;  2MR9 A;  1QVR A;  5GKN A;  3T6P A;  5DNY A;  3GQ5 A;  2DI0 A;  3KDS E;  3U6C A;  1L2C A;  1NHG C;  3C3E A;  1NNU C;  2KHH A;  1QAM A;  4GC9 A;  4LZZ A;  4R7G A;  2CHV A;  2R6F A;  5KPT A;  2Z4R A;  1IXS B;  5ITU A;  4AKG A;  1IY2 A;  3I51 A;  4FVM A;  3CTW B;  1J09 A;  2A5Y B;  4GC5 A;  3FTF A;  4JI2 M;  4PT5 A;  3MMP A;  4IBK A;  3SMP A;  3SHF A;  2HCB A;  4BLC A;  3TWL A;  1DV0 A;  1T43 A;  1BVS A;  3GLG E;  2JY6 B;  1GLN A;  2QPA A;  3E46 A;  1G59 A;  4F2L A;  4RNA A;  2VQF M;  4JYA M;  1PM5 A;  2HAK A;  1NY6 A;  1D0M A;  1PJS A;  4AZF A;  1XNQ M;  3SAS A;  3LVV A;  1EFU B;  3GLH B;  4WP2 A;  3HJQ A;  4LF7 M;  3J7A S;  4AI6 A;  1DO2 A;  1NV9 A;  2ZAO A;  3KSX A;  3SAT A;  4L8R C;  2L4E A;  3SC3 A;  1X37 A;  3QYB A;  4PD2 A;  1IBM M;  2Z8Y M;  3MK6 A;  3CF6 E;  3KP0 E;  5H37 D;  2HHH M;  2EJS A;  3J80 S;  5IRE B;  2M60 A;  3Q8X A;  4EIW A;  2JWS A;  1G8P A;  1E9R A;  1DGF A;  1Z59 A;  2OOB A;  3A42 A;  4QHT A;  5ITR A;  3SAU A;  1K3W A;  3HKP A;  2CV0 A;  4DV7 M;  2F5P A;  5JI3 E;  1R2Z A;  1DGB A;  4DV0 M;  2ZM6 M;  4R71 A;  4B7F A;  1TR8 A;  2FE8 A;  4FW9 A;  4GIT A;  5E6J A;  1YLA A;  3WHK A;  4DR7 M;  1Z5C A;  1FJG M;  5EP3 A;  5ITX E;  3NWL A;  2KXE A;  2VII A;  2ZTC A;  3GLH E;  2LBC A;  1GO5 A;  2FNA A;  3FUT A;  4MGI E;  3PNY A;  1JQJ C;  3GRY A;  4CIZ A;  3SAV A;  2J7O A;  4LRS A;  4OVZ A;  1WHC A;  4AQY M;  2DKL A;  1GL6 A;  5FSW A;  3TE6 A;  4B3M M;  3HU3 A;  3KXE C;  1L1Z A;  1QQW A;  3KOX E;  3AOG A;  4BBA A;  2CFO A;  4X64 M;  4FCT A;  1XXH B;  3DFZ A;  3ILK A;  3V76 A;  2CRU A;  1TF0 B;  1TH3 A;  3EIH A;  4G4Q A;  3KS4 A;  2R46 A;  4HLQ A;  4B3R M;  1J5E M;  4B7G A;  2HL7 A;  2L6O A;  3R8F A;  1SXJ E;  5KPR A;  3U5Z B;  2LNH C;  3UK6 A;  3HY5 A;  3H4J A;  1XMQ M;  1OAI A;  3FRH A;  4JI3 M;  4Z6Y A;  4JI8 M;  2CUZ A;  4DUY M;  1VDL A;  2MRO B;  1NV8 A;  3J81 S;  2D7H A;  3LCV B;  4K0K M;  4MGK E;  3R9X B;  4DR1 M;  1TTE A;  3SYL A;  4JI7 M;  3LCU A;  1NVM A;  2X49 A;  3T1Y M;  2LVP C;  2WZJ A;  2G8L A;  4REZ A;  1IBK M;  3HJ8 A;  5EXT A;  4AG5 A;  1L8Q A;  3U6S A;  1XNR M;  4D80 A;  4DV3 M;  1V92 A;  2RGO A;  2FOI C;  1R4G A;  4QNM A;  3T38 A;  5FTN A;  4MM3 B;  4QOZ C;  3FYD A;  1OTR A;  2JY5 A;  4XGI A;  2J7N A;  3GLF B;  1NNJ A;  3MHV C;  1K3X A;  1Q3C A;  1R6B X;  2C96 A;  3F92 A;  1TH4 A;  4LZJ A;  4M9S A;  1YSY A;  3FTE A;  2DWN A;  2C9C A;  2DAK A;  1NHW C;  3U6Q A;  2KNV A;  1OKS A;  1HQY E;  4CJ6 A;  4GRI A;  3SMS A;  3SAR A;  2DWM A;  4F1I A;  1QDR A;  2KRU A;  3SYK A;  3B89 A;  3LQR A;  4I5S A;  3SFZ A;  4I4L A;  1JR3 E;  3M7G A;  1SG9 A;  1WGN A;  3ZC7 B;  4LJ7 A;  4DUZ M;  1W5S A;  2KEB A;  1G71 A;  1QUT A;  3FTC A;  3K1J A;  4RKU F;  2QCU A;  4M0D A;  5L8R F;  3AFH A;  1KYI A;  2QZ4 A;  4JV5 M;  4LF9 M;  1IY0 A;  3GLG A;  1IN8 A;  3VK8 A;  3AJI B;  1D0L A;  3BOS A;  3I4Y A;  1L2D A;  3ZCB B;  3GLF E;  1IQP A;  3TL4 X;  3I04 M;  7CAT A;  2FFJ A;  1DO0 A;  2GQF A;  2RKO A;  3H4M A;  4NXM M;  1MN3 A;  5EP4 A;  2LHC A;  3NBX X;  1E94 E;  3U61 A;  4LF4 M;  4X66 M;  1EE8 A;  3B7N A;  2JNH A;  4RF0 A;  3U61 B;  4B3S M;  4OX9 M;  1XB2 B;  4UN2 B;  4NXN M;  2LWX A;  4NRW A;  3GPY A;  4AG6 A;  1K82 A;  3DZD A;  5BR8 M;  4FD2 A;  4G6Z A;  2H1R A;  4WUR A;  2L7H A;  2RRU A;  1IXS A;  3HWS A;  4DR2 M;  1IFY A;  1QAN A;  3BBZ A;  1ORY B; 
#chains in the Genus database with same CATH homology
 3HHW A;  3FYC A;  5BPV A;  2QBY B;  4MGH A;  3RFW A;  4LFA M;  4LJ9 A;  2CE7 A;  5C1B A;  4B3T M;  3LMM A;  4LJ4 A;  4GHA A;  3QWL A;  2I7P A;  1VDD A;  3UGJ A;  3GQ4 A;  4DR5 M;  2XZU A;  3GPX A;  3TQS A;  2Z4S A;  4DV6 M;  3U60 B;  1QZM A;  4S12 A;  2XFT A;  5ITX A;  3GLH A;  3IG8 A;  2F5Q A;  4G4O A;  3L2A A;  4MGZ E;  3T1H M;  3VFD A;  5FTJ A;  2CEA A;  5LMU M;  3DA1 A;  5KQD A;  3A45 A;  4LCB A;  1OFH A;  4Z8X A;  1ZQ9 A;  1OJL A;  3GRR A;  4M9X A;  4IBG A;  3LVW A;  3U6P A;  4LJA A;  2D7E A;  3LQQ A;  4QHS A;  3UJN A;  1TGU A;  2X4A A;  2XH9 A;  4D82 A;  1QAO A;  2RGH A;  2CHG A;  1SXJ B;  2DVW B;  3E4R A;  2UXC M;  1Q3B A;  2Y0T A;  4JI4 M;  3GLI B;  2ZAN A;  1HNW M;  4ITQ A;  1FNN A;  4LGY A;  4LJ8 A;  4IBF A;  4MB7 A;  2R4J A;  3W0F A;  3VLF B;  3JR4 A;  2W82 A;  4KO8 A;  1L2B A;  1XXH A;  5JI2 E;  2O5R A;  5EQT A;  4PDG A;  3IG5 A;  2EO2 A;  2F5S A;  2UUA M;  3J27 B;  4HL4 A;  4GHL A;  3U5Z A;  4RF1 A;  3L27 A;  1GVN A;  1QAQ A;  4L16 A;  1S3S A;  3GPU A;  4LFB M;  3UZU A;  3NBI A;  3HHZ A;  5IT9 S;  2EUC A;  2HKJ A;  1E9S A;  4IBB A;  1N36 M;  3J2P B;  2UU9 M;  1N75 A;  1H6U A;  5KQ8 A;  1IN6 A;  2UXB M;  3HJS A;  2I7N A;  3SAW A;  1JR3 A;  2OPF A;  2C5R A;  3W0L B;  1IXZ A;  3JAM S;  4DR6 M;  4LF8 M;  1PJJ A;  3TWK A;  3VDP A;  4CGY B;  3GLF A;  1R7R A;  1Z5A A;  3KOY E;  2C9O A;  2XZF A;  1G4A E;  1Q39 A;  3WHL A;  2V1C A;  4NL4 H;  4OW0 A;  2Y21 A;  3AOE A;  4PCZ A;  1GL7 A;  5IZ7 D;  4G4N A;  3FD9 A;  1G3I A;  2JA2 A;  2X8A A;  5IWA M;  4D81 A;  2M5Z A;  3SHG B;  4LRT A;  3B9P A;  1XC8 A;  1IBL M;  4LF6 M;  4KOD A;  5FTM A;  3J7B A;  4GMQ A;  1TDH A;  3HHY A;  1HNZ M;  4YY3 M;  5KPZ A;  3UMM A;  2CV2 A;  5EJC A;  3U6L A;  4W5W A;  5EXP A;  5KO3 A;  1T3T A;  3PVS A;  4L78 A;  2CV1 A;  4KHP M;  3GQ3 A;  3C58 A;  5FTK A;  3L26 A;  1WXQ A;  1W5T A;  3L29 A;  4CHT B;  2Z7J A;  4LFC M;  2Y20 A;  4IJF A;  4XBO A;  3M0E A;  5FTL A;  4CIS A;  3A46 A;  5LMN M;  2UUB M;  4DV2 M;  4B7H A;  3KS8 A;  4JI1 M;  1N77 A;  1Z5B A;  3GO8 A;  3HU2 A;  8CAT A;  3KSJ A;  4NOO B;  2QBY A;  3PNV A;  4IJE A;  4QOS A;  3SBJ A;  4NSO B;  3AV0 A;  1ZAE A;  5EP2 A;  2KZU A;  3VKH A;  3U60 A;  2XGN A;  2V6Z M;  2D7G A;  1NJG A;  2P5T A;  2F4V M;  5EP1 A;  3CF0 A;  3TWM A;  1XHB A;  1TDZ A;  5C18 A;  4JI6 M;  3U6E A;  2DZN B;  4IIW A;  3EIE A;  2YR0 A;  1HNX M;  1IN4 A;  4FWG A;  4WW0 A;  2G5G X;  3VK7 A;  3FUX A;  4MGY E;  3I4V A;  4GIP A;  3OTO M;  2LXE A;  4NRV A;  4JI5 M;  4JI0 M;  1SXJ A;  1IM2 A;  3CF2 A;  2BJW A;  4AW4 A;  3GLI A;  1L1T A;  2F5N A;  3RGP A;  1SXJ C;  1MU5 A;  1NJF A;  2XFS A;  3FUU A;  3MJ5 A;  5DYG A;  4PDI A;  4DV1 M;  1D2N A;  2KRK A;  3HU1 A;  1PJI A;  2CHQ A;  2R4E A;  3KVW A;  4M0W A;  1SXJ D;  1IN7 A;  4ZPX A;  2BJV A;  4AKH A;  2L09 A;  2DXI A;  3K8Z A;  2DWL A;  4GKJ M;  4DR3 M;  1MX0 A;  1XMO M;  3TPZ A;  2R45 A;  4QNR A;  2XF3 A;  2YQZ A;  2R65 A;  4MH0 E;  4LF5 M;  3RE8 A;  4B08 A;  2F5O A;  4FWH A;  2ZBK B;  3PXG A;  4A3V B;  5A2Q S;  3HHX A;  2DHR A;  2LH0 A;  2YNM D;  4JXJ A;  4FWD A;  4AKI A;  5DYI A;  1HT1 E;  1J7K A;  2XSZ A;  3U6O A;  4LG2 A;  3QAU A;  4OVZ B;  5ITY A;  3KOW E;  5FLX S;  1XWI A;  5EXX A;  1KFV A;  1TH2 A;  1N33 M;  3D8B A;  4R3D A;  5ITQ A;  1YUB A;  4FCV A;  3T15 A;  2K47 A;  3FUW A;  1LV7 A;  4LY6 A;  3A98 B;  1KSF X;  2YFQ A;  3K92 A;  4IBD A;  2XSZ D;  3L25 A;  3GP1 A;  4FCW A;  1N78 A;  1E32 A;  1GKI A;  4TUW A;  3FKE A;  1JR3 D;  3M6A A;  3FUV A;  3VDU A;  4X65 M;  2OQ4 A;  4DR4 M;  4OU7 A;  2Y0Q A;  2E5L M;  4JN6 A;  4GH9 A;  2DZO B;  4YHH M;  1G41 A;  3KP1 E;  4M9Z A;  3E9S A;  4I81 A;  4DV4 M;  4GKK M;  2KA6 B;  4IBJ A;  3AOE C;  2C98 A;  2R18 A;  4IBE A;  1IY1 A;  2C99 A;  3U6D A;  5F3W A;  2ERC A;  4II7 A;  3RGS A;  4I8O A;  3HGI A;  1UM8 A;  1I4W A;  2L7I A;  2QEN A;  2KZS A;  2R62 A;  3K2L A;  1HT2 E;  2Q2E B;  4IBI A;  3U6M A;  3ZH9 B;  4LGM A;  5E26 A;  1IXR C;  3D8L A;  2XLJ A;  2VQE M;  2AHM A;  1I94 M;  1NY5 A;  4LJ6 A;  2EA0 A;  3KOZ E;  4LJ5 A;  4L4U A;  1IN5 A;  3KW6 A;  1Z6T A;  3AL0 C;  4X62 M;  4DV5 M;  2BNK A;  1NSF A;  2QP9 X;  3GPP A;  2NQ8 C;  4G4R A;  3VKG A;  1N32 M;  3L28 A;  3GRU A;  4IBC A;  4BB9 A;  2UXD M;  4NSR A;  3GRV A;  1C1K A;  1HR0 M;  4L15 A;  1DGH A;  2XEP A;  3GLG B;  1N34 M;  3FTD A;  2V1U A;  1DGH B;  3KFU G;  2UUC M;  1OFI A;  1DGG A;  1R2Y A;  3JR5 A;  3DOA A;  5ITT A;  2ZAM A;  4KLN A;  5EXS A;  3AKZ A;  1YE9 A;  2KW0 A;  1HQC A;  1QYR A;  2Z3X A;  2DWZ B;  4P16 A;  3PFI A;  3THG A;  1QVR A;  5GKN A;  5DNY A;  3GQ5 A;  1L2C A;  3U6C A;  3KDS E;  1NHG C;  1NNU C;  1QAM A;  4GC9 A;  4LZZ A;  4R7G A;  2CHV A;  5KPT A;  5ITU A;  2Z4R A;  1IXS B;  4AKG A;  1IY2 A;  3I51 A;  4FVM A;  3CTW B;  1J09 A;  2A5Y B;  4GC5 A;  3FTF A;  4JI2 M;  4PT5 A;  4IBK A;  3SMP A;  3SHF A;  2HCB A;  4BLC A;  3TWL A;  1GLN A;  2QPA A;  1G59 A;  4JYA M;  4RNA A;  2VQF M;  1PM5 A;  1NY6 A;  4AZF A;  1XNQ M;  3SAS A;  3LVV A;  3GLH B;  3HJQ A;  4LF7 M;  3J7A S;  4AI6 A;  1DO2 A;  2ZAO A;  3KSX A;  3SAT A;  4L8R C;  3SC3 A;  1X37 A;  4PD2 A;  1IBM M;  3MK6 A;  3CF6 E;  3KP0 E;  5H37 D;  2HHH M;  3J80 S;  5IRE B;  2M60 A;  3Q8X A;  4EIW A;  1G8P A;  1E9R A;  1DGF A;  1Z59 A;  4QHT A;  3A42 A;  5ITR A;  1K3W A;  3SAU A;  2CV0 A;  3HKP A;  2F5P A;  4DV7 M;  5JI3 E;  1R2Z A;  1DGB A;  4DV0 M;  2ZM6 M;  4B7F A;  2FE8 A;  4FW9 A;  4GIT A;  5E6J A;  3WHK A;  4DR7 M;  1Z5C A;  1FJG M;  5EP3 A;  5ITX E;  3NWL A;  2KXE A;  2VII A;  2FNA A;  3FUT A;  4MGI E;  3PNY A;  1JQJ C;  3GRY A;  3SAV A;  2J7O A;  4LRS A;  4OVZ A;  4AQY M;  1GL6 A;  5FSW A;  3TE6 A;  4B3M M;  3HU3 A;  3KXE C;  1L1Z A;  1QQW A;  3KOX E;  3AOG A;  4BBA A;  2CFO A;  4X64 M;  4FCT A;  1XXH B;  3DFZ A;  3ILK A;  4G4Q A;  1TH3 A;  3EIH A;  3KS4 A;  2R46 A;  4HLQ A;  4B3R M;  1J5E M;  4B7G A;  2HL7 A;  2L6O A;  3R8F A;  1SXJ E;  5KPR A;  3U5Z B;  2LNH C;  3UK6 A;  1XMQ M;  4JI3 M;  4Z6Y A;  4JI8 M;  2CUZ A;  4DUY M;  3J81 S;  2D7H A;  4K0K M;  4MGK E;  3R9X B;  4DR1 M;  4JI7 M;  3SYL A;  1NVM A;  2X49 A;  3T1Y M;  2G8L A;  4REZ A;  1IBK M;  3HJ8 A;  5EXT A;  4AG5 A;  1L8Q A;  3U6S A;  1XNR M;  4D80 A;  4DV3 M;  2RGO A;  2FOI C;  4QNM A;  3T38 A;  5FTN A;  4MM3 B;  4QOZ C;  3FYD A;  4XGI A;  2J7N A;  3GLF B;  1NNJ A;  3MHV C;  1K3X A;  1Q3C A;  1R6B X;  2C96 A;  4LZJ A;  1TH4 A;  4M9S A;  1YSY A;  3FTE A;  2DWN A;  2C9C A;  1NHW C;  3U6Q A;  1HQY E;  4GRI A;  3SMS A;  3SAR A;  2DWM A;  2KRU A;  3SYK A;  3LQR A;  4I5S A;  3SFZ A;  4I4L A;  3M7G A;  3ZC7 B;  4DUZ M;  4LJ7 A;  1W5S A;  2KEB A;  3FTC A;  3K1J A;  2QCU A;  4M0D A;  3AFH A;  1KYI A;  2QZ4 A;  4JV5 M;  4LF9 M;  1IY0 A;  3GLG A;  1IN8 A;  3VK8 A;  3AJI B;  3BOS A;  3I4Y A;  1L2D A;  3ZCB B;  1IQP A;  3TL4 X;  7CAT A;  2FFJ A;  1DO0 A;  2RKO A;  3H4M A;  4NXM M;  5EP4 A;  1E94 E;  3U61 A;  4LF4 M;  4X66 M;  1EE8 A;  3U61 B;  4RF0 A;  4B3S M;  4OX9 M;  4NXN M;  2LWX A;  4NRW A;  3GPY A;  4AG6 A;  1K82 A;  3DZD A;  5BR8 M;  4FD2 A;  4G6Z A;  2H1R A;  4WUR A;  2L7H A;  3HWS A;  4DR2 M;  1QAN A;  1ORY B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...