3JAMW

Cryoem structure of 40s-eif1a-eif1 complex from yeast
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
129
structure length
129
Chain Sequence
TRTSVLADALNAINNAEKTGKRQVLIRPSSKVIIKFLQVMQKHGYIGEFEYIDDHRSGKIVVQLNGRLNKCGVISPRFNVKIADVEKWTANLLPARQFGYVILTTSAGIMDHEEAHRKHVSGKILGFVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 18S rRNA
publication title Conformational Differences between Open and Closed States of the Eukaryotic Translation Initiation Complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Translation
total genus 29
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
W PF00410 Ribosomal_S8 Ribosomal protein S8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.30 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 3jamW01
3.30.1490.10 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3jamW02
4JI0H 4DV5H 3J80W 3OTOH 4JYAH 4DUYH 1XNQH 4LF8H 4DV0H 4DR5H 4YY3H 4DR2H 2UXBH 4DR6H 4LF5H 3J81W 4AQYH 4K0KH 5LMNH 4LFCH 4OX9H 1I94H 4YHHH 2VQFH 2F4VH 1J5EH 5LMUH 5IWAH 4JV5H 4LF7H 1SEIA 5IT9W 3T1HH 5BR8H 3J7AK 1FJGH 4JI5H 1AN7A 4NXMH 2E5LH 4LF9H 1XMOH 4B3MH 4LF6H 3JAMW 5A2QW 4DR7H 4GKKH 1N36H 4GKJH 2UXDH 4B3RH 4KHPH 4X66H 1HNZH 1IBLH 4JI6H 2HHHH 4X62H 3T1YH 4JI3H 2UUBH 4DV1H 1HR0H 4X65H 1N32H 2ZM6H 4PDBA 4JI7H 4DV4H 1S03G 1IBMH 5LL6b 4X64H 4DV2H 2UXCH 4JI8H 1XMQH 4DR1H 4B3SH 4DV7H 4DR4H 4LF4H 2VQEH 4JI1H 4B3TH 4LFAH 4JI4H 1N34H 2UUAH 3RF2A 1XNRH 1N33H 4LFBH 4DR3H 1FKAH 4DUZH 4NXNH 4JI2H 1IBKH 2UUCH 1HNWH 5FLXW 4DV3H 2UU9H 4DV6H 1HNXH 1I6UA
chains in the Genus database with same CATH superfamily
4JI0H 1NXUA 2RDIA 3GILA 2C28A 3OETA 4RB3C 3PW2A 4O3PA 4OO1G 4HR7A 5C5JA 3RBDA 5KFEA 1X4MA 3TIIA 3FKIA 3H3VH 4ZOLF 4A3GG 2O03A 4UCRA 4AYBA 2BA0A 1K83A 3K3VA 1JX4A 5HBRB 4DV0H 1KEEA 3I4MG 2HVSA 2R7ZG 4YY3H 4J9PA 2YS6A 4TV9F 3R5XA 2RGVA 3NGDA 4U6PA 4ECWA 2CPQA 3WNZA 2AGOA 1X0AA 3BQ2A 2I8CA 5KX5F 2WAQE 4J0MA 4GC7A 3K5IA 4QIWA 4LFCH 4OX9H 2CWFA 1Y1VA 1MSZA 5KFWA 5FLMG 2XC9A 2ALZA 2HVRA 3VPDA 3KXYT 4Q8EA 3IN5A 3TINA 4QMFB 2Y0SA 4RAZA 2VA3A 2P0AA 5LMUH 5IWAH 3OSNA 4IR1A 5CA1F 4OD6A 2FP4B 3PW7A 3ETHA 4EC5A 4OCHA 3HOUG 5FD6A 4MA5A 3GLKA 1V51A 2DWCA 3R5FA 3G8CA 4A3JG 4ME6A 2R92A 4C2MA 4M9UA 5KT5A 1FJGH 2E2HA 2YZGA 2WB1A 1KHMA 3N42B 1AN7A 4LMYA 5FPRA 4MTEA 2NUAB 3VKEA 3UOEA 1B04A 4NXMH 3JZIA 3MR3A 4J9QA 3G6YA 2BQRA 1DV1A 4A2AA 4A3FG 3TQ1A 2JA8G 2Z0SA 1Z2IA 2JA6G 3FMAA 2XD4A 4ECSA 4ED7A 5DGAA 3DF7A 3JAMW 4C5AA 2R93A 5A2QW 5FPOA 4A3CG 2YRXA 5L9XA 4ECRA 5DT9A 2LTLA 4F4WA 2BQ3A 2JEAI 1EHIA 4E4TA 3KTMA 2UVRA 2JEJA 4XYMB 2J9GA 4KHPH 2GLTA 4JV2A 2CTMA 3Q8RB 1EZ1A 4Q43A 3KHHA 3BQ0A 1HNZH 2G8YA 1IBLH 3MJFA 5KFLA 3MR2A 1ZZKA 5CB4F 4YR3A 3QD7X 1BGWA 3Q8SB 3MR6A 3BQ1A 4BBSG 4J9KA 2LRRA 4NBQA 4X62H 3GKUA 2UUBH 1KJIA 1GO3E 2PN1A 2R7NA 4IZOA 1HR0H 4YR2A 3RV4A 1ZZJA 3HOYG 3LP8A 3U9SA 1WTJA 1WR2A 4IRKA 1BNCA 5C44G 2M6QA 2FK2A 4UCUA 5F9LA 3JRWA 1BJTA 4DV4H 5KG4A 3GIPA 4UCVA 1IBMH 4X64H 4J9NA 3U1KA 2UXCH 4O2BF 3M9NB 1Y14B 3UFXB 4O3SA 1XMQH 4B3SH 1UC8A 4DV7H 3V6HA 4E9JA 2X06A 1O75A 3I0PA 3VMMA 2W6QA 2FMRA 5DLGA 2VA2A 4I4TF 4UCSA 1WVNA 3U9TA 2JA5A 5LA6F 5KFOA 4GC6A 2CTJA 3KAKA 4RNNA 2P2RA 3RB6A 2DPJA 4BY7G 3K3PA 1N33H 1ULZA 2R7LA 3OSSD 4JV1A 3HBLA 2YZNA 4Q44A 5DGBA 1VBIA 4LIJA 1Z2PX 3ETJA 1AUVA 4YBZB 2V4QA 2HH2A 2V58A 3PR5B 4EYIB 2ZDGA 3GTOA 3KDGA 2NU8B 4HNVA 4RUCA 5KG7A 3H40A 4XYLB 4WALA 4RZRA 4G3IA 4FJSA 2FPGB 4B3RH 1HNXH 4TQRA 2R87A 3GIDA 4DV5H 1E4FT 2R82A 5KFSA 1ZTGA 1E4EB 1KJ8A 4ED1A 2C00A 3GIIA 3KHGA 3VPBA 4JUZA 1V8CA 1KBLA 3V4SA 1GSHA 1JDBB 1XNQH 2ASLA 3GTGA 1L2ZA 5JQWA 3H4BA 3AEVB 4ED2A 4WD3A 4CC5A 3V6JA 2C2RA 2FLNA 4DR5H 1A9XA 5GONF 4IR9A 3ORRA 2YRWA 4M7EA 3RB4A 3L7ZC 2KSWA 2PMZE 4DR2H 1WH2A 2UXBH 2YS7A 5KFXA 5KFNA 5EWGA 3RB0A 2ATLA 4I50F 2R8IA 1VIHA 1IOVA 4ED8A 2VPQA 1UG8A 4ZQIA 2NU9B 4ETSA 3T5HA 1M0TA 2R7KA 3M4IA 1OWTA 5KFCA 4DLKA 2V5AA 5C8YF 4F4XA 1K1GA 2VOBA 3BJYA 1I94H 1Z2NX 2R86A 4DL5A 1JXLA 4Q0YA 5KFMA 1CQJB 3HB9A 2I80A 5KG5A 1S0OA 4YHHH 1RJRA 4QWEA 5KT7A 4J9RA 3OHBA 2F4VH 3GIMA 1J5EH 4HNTA 3HKZE 1SEIA 1E4EA 2IA6A 1J5KA 3JSNA 2W7PA 2W6OA 4YQWA 1N56A 1S97A 3WO0A 4ED0A 4O4LF 2IMWP 4O2AF 4AIMA 5L1KA 3GTMA 2XCAA 4FU0A 1KJJA 2AGPA 1S0NA 3GR5A 5KFJA 3SB1A 2R84A 5JVDF 4G08A 1S68A 1WCMA 4IWXA 5KFVA 4EBEA 1WE8A 2JZXA 2PY9A 3JSLA 2RDJA 2AQ4A 2BR0A 3MWMA 4ECXA 4LSXA 3EPIA 1XMOH 4RUAA 2PVPA 5H80A 2VR1A 5DQHA 5KT3A 5BPFA 2V4RA 5D8DA 5BMVF 2FK1A 2W8KA 4GKKH 1T94A 1VS0A 2QYZA 2B63G 1GYFA 4JV0A 5LP6F 1VAJA 1TWGA 4JVYA 4MV8A 2J6UA 5KT6A 2D9IA 3HOWG 1I7NA 3I4NG 1Y1VG 1WHRA 3G6XA 3OUUA 4B8CD 4QWCA 2YCHA 3GIKA 2JEFA 3V6KA 2VUMG 4DV1H 2OH2A 5KFRA 2UVUA 4O4HF 4H8AA 1I7LA 2OLSA 4Q8FA 5HV6A 2W6PA 3KDKA 3LMLA 5KT2A 2JE6I 2O4CA 2VKCA 4MV3A 1E4GT 4BY1G 4DV2H 2CW7A 2DLNA 5KFGA 2NVYA 3MFHA 2FB9A 2IP4A 1TWHA 3L4KA 4F4YA 4YAKB 4J9OA 1M7JA 1FVIA 2Q2TA 2GPWA 2R8KA 5CA0F 3FDSA 2PQUA 2FPIB 4DR4H 3H0GG 2VQEH 4JI1H 4B3TH 4RB1A 4ED6A 2R6FA 4JI4H 5K36G 3ORQA 2CKZB 1RJQA 3VPCA 3RGZA 3RF2A 2R93G 4IHJF 2JA6A 3E5NA 4C5BA 1XNRH 4NLGA 4BWSC 2FFMA 3GTKA 3V4ZA 4FS2A 4LFBH 1JIHA 4QW9A 4ECYA 4O3NA 3GIJA 4Y8VB 3N44B 5KFTA 4DR3H 4DUZH 3N43B 4JI2H 3I12A 5KKNB 4MV1A 2UUCH 1HNWH 1C3OA 4MV4A 2YU9A 5FLXW 4DV3H 1DIKA 1KJ9A 3RIZA 4Q45A 1A0IA 3C0FB 3RTXA 2FPHX 5IP7G 2UU9H 4ECUA 4EEYA 4DV6H 2QNDA 1RYSA 2WAQA 5KFDA 5I47A 4MV7A 4F50A 3GTPA 1EUCB 2E2IA 1RJPA 1JLLB 1SCUB 3Q8QB 4IAJA 5KFAA 3GTJA 4O3RA 5K2MA 3OTOH 5C1PA 4C5CA 3UQ8A 4QWBA 4JYAH 3PR4A 2DPIA 1UNNC 3BAAA 4ZHQF 2XCPA 5FJ8G 3GTLA 3MWDA 2ZDHA 4RZQA 4B8TA 1MZBA 3PN1A 5JUMA 3M9OB 1ZETA 3SE7A 5KFQA 2VUGA 3WO1A 4ECZA 2R7MA 2NN6G 5KG6A 4QWDA 4ED3A 4MTDA 5KG3A 5CAEB 4EGQA 4MA0A 2XGQA 3EPGA 1V4YA 1BXRA 5KG2A 1VKZA 1CS0A 1ZHQA 1TUAA 2DGRA 1JKJB 1AUXA 4AQYH 4K0KH 3GIQA 4EEQA 3CQZA 3Q2OA 2W70A 1KC7A 2W6ZA 4YAJB 4FBTA 4YJ2F 2W9CB 4UFZA 2Y3MA 2V9WA 1I3QA 4BXXG 4O3QA 3MR5A 4RU9A 4A3MG 2VQFH 2QK4A 3PW0A 4IRDA 2WDTA 5IYDG 4JV5H 2OWOA 4LF7H 1TWFA 4AYBE 1T36A 5J2UF 5EOYA 5L1JA 1S20A 1B33N 1TWCA 5IYCG 4YJ3F 1V9NA 3GQCA 3QZ7A 2OPVA 2ZQEA 3RV3A 4DL6A 3J7AK 1F0XA 2DIKA 4JI5H 2CTLA 1M0WA 4LH7A 5D1OB 4JVHA 4I55F 3TIGA 4DL3A 5DG7A 2ASJA 1XDNA 2DZDA 3BA9A 3HOZG 2E5LH 4FBUA 4LF9H 1N48A 2JA7G 1UC9A 3KALA 4QIWE 2W8LA 1Y1WA 3H4DA 2C2EA 2MCTA 3HOVG 4B3MH 5KFBA 4DL4A 2XGPA 4DR7H 5EWEA 2Y0SE 2W7OA 1N36H 2R8GA 1DV2A 4EG0A 4EBDA 1S10A 4CC6A 2W9CA 4RB2C 4X66H 4QWAA 5LOVF 3GV8B 4BA1I 2ZJTA 1R9TA 1PQXA 3N6XA 5LYJF 4FJUA 2CZGA 1T3NA 3MFIA 4BA2I 4JI6H 2HGSA 4EYHB 2UVWA 2JEGA 2HJWA 2WB1E 5IYBG 2IBKA 1X9ZA 3CVZA 4X65H 2Q2UA 2E3UA 1N32H 1V9PA 4A3IG 3BA8A 1GGOA 4PDBA 3FKIG 2FE3A 2XIGA 2RF4A 2YYAA 3N40P 4MAMA 4PWQA 5D1PA 5KT4A 5D1OA 5KFYA 2YQRA 3TQTA 3HOXG 1JDEA 1K1SA 3LWBA 4IFDG 4RNMA 1ZQ7A 3Q8PB 3L4JA 3RBEA 1W96A 2X0SA 4TV8F 1CQIB 2W9BB 5KFIA 2ASDA 3KAJA 4JI8H 2RGRA 1I50A 4DR1H 5LXTF 4RNOA 2W6NA 5KFHA 1WCMG 5KFZA 5JH7F 4WBNF 2SCUB 3F8NA 2BQUA 4ZI7F 4J9LA 2UUAH 5EDWA 1DTJA 4A3BG 2FLPA 2AXYA 4DL2A 3OHAA 5T14A 3T5LA 5IP9G 2PBZA 4IWYA 1GSAA 2W9AA 2PMZA 2YL2A 4NXNH 1TWAA 5DQGA 3T5JA 1IBKH 4F4ZA 2B63A 4XZ3B 3H20A 1XRHA 2CW8A 2JVZA 1GSOA 2VPSA 2WYOA 4FM9A 2BL5A 1S9FA 1PX2A 4A2BA 3RGXA 4FS1A 2R92G 4EGJA 5KFKA 4ECVA 5KFPA 4APMA 2JEIA 3EYYA 3R23A 4DL7A 4NZRM 3J80W 5C1OA 2VUMA 3PVXA 2UVVA 4IRCA 2W9BA 1ZZIA 4YB8B 4EFBA 1VBGA 4DUYH 1DT4A 4UCOA 2ANRA 1WSCA 3HKZA 4LF8H 3T5KA 5DLFA 5C4XG 4WANA 5C0XG 4QW8A 3RAXA 4O3OA 2LTMA 2A1SA 1C30A 2NU6B 2WE6A 2FKLA 4DR6H 3JRXA 2NVXA 4TQSA 4YR0A 3H0GA 4HQ6A 4LF5H 3J81W 2CWHA 1EYZA 2VQDA 4ECTA 5LMNH 3QZ8A 2C22A 3IG0A 4YP3A 1S0MA 4A3DG 3RUPA 1ZHSA 3KHRA 1GLVA 3EZJA 5EZYF 2FPPB 1RK5A 2CTFA 3G6VA 1B6SA 4ECQA 3RJ0A 5KFFA 1RYRA 5IT9W 2HH3A 3PW4A 2CTKA 1K1QA 1P8LA 2M05A 3RAQA 5DQIA 1TA8A 3BG5A 2M8WA 4L1KA 3T1HH 5BR8H 5C3EG 4TUYF 2PT7G 2YW2A 1ODHA 4AM3A 1VBHA 3RB3A 5KFUA 4HYKA 3MWEA 3KHLA 3N8DA 5L1IA 4R8UB 4J9MA 5DG8A 1CE8A 2FMAA 3AYHB 1DGSA 4LH6A 2JA5G 3FAUA 3OSPA 4RAYA 3N41B 1SFOA 2J6SA 5JEAG 4O4IF 4LF6H 2CPMA 1TAEA 2MJHA 5JVLA 4LSAA 3QFFA 2R85A 4NZTM 4EFEA 2C2DA 2OPUA 4GKJH 1VIGA 2UXDH 1PK8A 4I7HA 2K1HA 2I87A 3PO3G 2J6TA 2ANNA 4MV6A 3PZPA 2FLLA 3HXLA 4BBRG 3PO2G 1EC6A 2HHHH 4JI3H 3T1YH 5J2TF 1Z2OX 4RB0A 5IYZF 5KG1A 2HVQA 4R7RA 3NCVA 3V69A 2ZM6H 2YZMA 1X4NA 4JI7H 4UCTA 2CQYA 4MV9A 2JA9A 4HNUA 2R8HA 5L1LA 1M6VA 2C35B 1S03G 2FJZA 5DG9A 1IOWA 3GV5B 4EBCA 5LL6b 3GTQA 1KJQA 4R8UA 3PW5A 3GABA 1EUDB 2GPSA 5KG0A 5EWFA 2JEBI 3L2PA 1X9NA 1W93A 2AU0A 2XCLA 4LF4H 4QJFA 3OUZA 2R7ZA 1Y1WG 4LFAH 3SI8A 1N34H 2JA7A 2NU7B 4XX0B 4A93G 3M9MB 1B6RA 4J9SA 2WTFA 2CTEA 2W71A 3R5HA 4A3EG 4U7CA 4GLXA 1FKAH 2W6MA 2ZDQA 3BABA 2R8JA 2LF0A 5BPHA 2W57A 1RK6A 5F9NA 1J4WA 3K5HA 1SYXB 3GV7B 2AGQA 2FK3A 3Q1KA 4A3LG 4A3KG 2V59A 3RFCA 1I6UA 5FD5A
chains in the Genus database with same CATH topology
4JI0H 4MV7A 3EYYA 4DV5H 1E4FT 4NZRM 3OETA 3J80W 4RB3C 4IAJA 3OTOH 3UQ8A 4JYAH 4EFBA 4DUYH 3BAAA 4UCOA 1XNQH 2O03A 4LF8H 4RZQA 4UCRA 1L2ZA 1MZBA 3K3VA 3PN1A 4CC5A 4DV0H 4DR5H 2VUGA 2HVSA 4YY3H 4M7EA 4MTDA 2KSWA 1X9NA 4DR2H 1WH2A 2UXBH 2WE6A 4DR6H 2RGVA 1ZHQA 4ETSA 4LF5H 3J81W 4APMA 4AQYH 4K0KH 1M0TA 5LMNH 4J0MA 3M4IA 4EEQA 3IG0A 4LFCH 4OX9H 1ZHSA 2VOBA 1I94H 1Z2NX 4UFZA 2HVRA 4Q0YA 3KXYT 2Y3MA 3EZJA 4YHHH 2VQFH 4RAZA 3RJ0A 2F4VH 1J5EH 2WDTA 5LMUH 5IWAH 4JV5H 4LF7H 2OWOA 1SEIA 5IT9W 4OD6A 5EOYA 3JSNA 4EC5A 4OCHA 1P8LA 5FD6A 2ZQEA 1TA8A 3T1HH 5BR8H 3J7AK 1F0XA 2PT7G 1FJGH 4JI5H 1ODHA 1M0WA 4LH7A 5D1OB 3GR5A 3N42B 4LMYA 1AN7A 1XDNA 3BA9A 5FPRA 4MTEA 3SB1A 1B04A 4G08A 2E5LH 4NXMH 1S68A 4LF9H 3JSLA 4LH6A 3MWMA 1DGSA 3KALA 4A2AA 4LSXA 3FAUA 1XMOH 3FMAA 4RAYA 2MCTA 3N41B 4B3MH 3DF7A 4LF6H 3JAMW 5A2QW 5FPOA 4DR7H 1TAEA 4GKKH 1VS0A 5DT9A 1N36H 4LSAA 1GYFA 4NZTM 4CC6A 4EFEA 4GKJH 2UXDH 4B3RH 2D9IA 4X66H 4KHPH 4I7HA 4RB2C 2ZJTA 1HNZH 1IBLH 3N6XA 4B8CD 3QD7X 1BGWA 4JI6H 2HGSA 3HXLA 2YCHA 2HHHH 4X62H 3T1YH 4JI3H 2UUBH 4DV1H 1Z2OX 1HR0H 4RB0A 1X9ZA 3CVZA 4X65H 2Q2UA 1N32H 1V9PA 2HVQA 4R7RA 3NCVA 2ZM6H 4PDBA 3BA8A 2FE3A 2XIGA 3N40P 3KDKA 3LMLA 4JI7H 4UCTA 4UCUA 5D1PA 2O4CA 2VKCA 4MV9A 5D1OA 1BJTA 4DV4H 3L4JA 1S03G 4UCVA 1E4GT 5LL6b 4X64H 1IBMH 4DV2H 2CW7A 2UXCH 3KAJA 3GABA 4JI8H 2RGRA 3L4KA 1XMQH 4DR1H 4B3SH 4DV7H 1FVIA 4E9JA 2Q2TA 1O75A 3L2PA 4DR4H 4LF4H 2VQEH 4JI1H 4B3TH 3F8NA 4RB1A 4LFAH 4JI4H 1N34H 2UUAH 4UCSA 3RGZA 3RF2A 3KAKA 1XNRH 4BWSC 1N33H 3OSSD 4LFBH 3N44B 4DR3H 4GLXA 1FKAH 4DUZH 4NXNH 1Z2PX 4JI2H 1IBKH 2LF0A 3BABA 3N43B 2UUCH 1HNWH 2W57A 3H20A 2CW8A 2WYOA 5FLXW 4DV3H 3KDGA 2VPSA 3RIZA 4FM9A 1A0IA 1SYXB 3C0FB 2FPHX 3RTXA 2UU9H 4A2BA 3RGXA 4DV6H 1HNXH 1I6UA 5FD5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI0 H;  4DV5 H;  3J80 W;  3OTO H;  4JYA H;  4DUY H;  1XNQ H;  4LF8 H;  4DV0 H;  4DR5 H;  4YY3 H;  4DR2 H;  2UXB H;  4DR6 H;  4LF5 H;  3J81 W;  4AQY H;  4K0K H;  5LMN H;  4LFC H;  4OX9 H;  1I94 H;  4YHH H;  2VQF H;  2F4V H;  1J5E H;  5LMU H;  5IWA H;  4JV5 H;  4LF7 H;  1SEI A;  5IT9 W;  3T1H H;  5BR8 H;  3J7A K;  1FJG H;  4JI5 H;  1AN7 A;  4NXM H;  2E5L H;  4LF9 H;  1XMO H;  4B3M H;  4LF6 H;  3JAM W;  5A2Q W;  4DR7 H;  4GKK H;  1N36 H;  4GKJ H;  2UXD H;  4B3R H;  4KHP H;  4X66 H;  1HNZ H;  1IBL H;  4JI6 H;  2HHH H;  4X62 H;  3T1Y H;  4JI3 H;  2UUB H;  4DV1 H;  1HR0 H;  4X65 H;  1N32 H;  2ZM6 H;  4PDB A;  4JI7 H;  4DV4 H;  1S03 G;  1IBM H;  5LL6 b;  4X64 H;  4DV2 H;  2UXC H;  4JI8 H;  1XMQ H;  4DR1 H;  4B3S H;  4DV7 H;  4DR4 H;  4LF4 H;  2VQE H;  4JI1 H;  4B3T H;  4LFA H;  4JI4 H;  1N34 H;  2UUA H;  3RF2 A;  1XNR H;  1N33 H;  4LFB H;  4DR3 H;  1FKA H;  4DUZ H;  4NXN H;  4JI2 H;  1IBK H;  2UUC H;  1HNW H;  5FLX W;  4DV3 H;  2UU9 H;  4DV6 H;  1HNX H;  1I6U A; 
#chains in the Genus database with same CATH topology
 4JI0 H;  1NXU A;  2RDI A;  3GIL A;  2C28 A;  3OET A;  4RB3 C;  3PW2 A;  4O3P A;  4OO1 G;  4HR7 A;  5C5J A;  3RBD A;  5KFE A;  1X4M A;  3TII A;  3FKI A;  3H3V H;  4ZOL F;  4A3G G;  2O03 A;  4UCR A;  4AYB A;  2BA0 A;  1K83 A;  3K3V A;  1JX4 A;  5HBR B;  4DV0 H;  1KEE A;  3I4M G;  2HVS A;  2R7Z G;  4YY3 H;  4J9P A;  2YS6 A;  4TV9 F;  3R5X A;  2RGV A;  3NGD A;  4U6P A;  4ECW A;  2CPQ A;  3WNZ A;  2AGO A;  1X0A A;  3BQ2 A;  2I8C A;  5KX5 F;  2WAQ E;  4J0M A;  4GC7 A;  3K5I A;  4QIW A;  4LFC H;  4OX9 H;  2CWF A;  1Y1V A;  1MSZ A;  5KFW A;  5FLM G;  2XC9 A;  2ALZ A;  2HVR A;  3VPD A;  3KXY T;  4Q8E A;  3IN5 A;  3TIN A;  4QMF B;  2Y0S A;  4RAZ A;  2VA3 A;  2P0A A;  5LMU H;  5IWA H;  3OSN A;  4IR1 A;  5CA1 F;  4OD6 A;  2FP4 B;  3PW7 A;  3ETH A;  4EC5 A;  4OCH A;  3HOU G;  5FD6 A;  4MA5 A;  3GLK A;  1V51 A;  2DWC A;  3R5F A;  3G8C A;  4A3J G;  4ME6 A;  2R92 A;  4C2M A;  4M9U A;  5KT5 A;  1FJG H;  2E2H A;  2YZG A;  2WB1 A;  1KHM A;  3N42 B;  1AN7 A;  4LMY A;  5FPR A;  4MTE A;  2NUA B;  3VKE A;  3UOE A;  1B04 A;  4NXM H;  3JZI A;  3MR3 A;  4J9Q A;  3G6Y A;  2BQR A;  1DV1 A;  4A2A A;  4A3F G;  3TQ1 A;  2JA8 G;  2Z0S A;  1Z2I A;  2JA6 G;  3FMA A;  2XD4 A;  4ECS A;  4ED7 A;  5DGA A;  3DF7 A;  3JAM W;  4C5A A;  2R93 A;  5A2Q W;  5FPO A;  4A3C G;  2YRX A;  5L9X A;  4ECR A;  5DT9 A;  2LTL A;  4F4W A;  2BQ3 A;  2JEA I;  1EHI A;  4E4T A;  3KTM A;  2UVR A;  2JEJ A;  4XYM B;  2J9G A;  4KHP H;  2GLT A;  4JV2 A;  2CTM A;  3Q8R B;  1EZ1 A;  4Q43 A;  3KHH A;  3BQ0 A;  1HNZ H;  2G8Y A;  1IBL H;  3MJF A;  5KFL A;  3MR2 A;  1ZZK A;  5CB4 F;  4YR3 A;  3QD7 X;  1BGW A;  3Q8S B;  3MR6 A;  3BQ1 A;  4BBS G;  4J9K A;  2LRR A;  4NBQ A;  4X62 H;  3GKU A;  2UUB H;  1KJI A;  1GO3 E;  2PN1 A;  2R7N A;  4IZO A;  1HR0 H;  4YR2 A;  3RV4 A;  1ZZJ A;  3HOY G;  3LP8 A;  3U9S A;  1WTJ A;  1WR2 A;  4IRK A;  1BNC A;  5C44 G;  2M6Q A;  2FK2 A;  4UCU A;  5F9L A;  3JRW A;  1BJT A;  4DV4 H;  5KG4 A;  3GIP A;  4UCV A;  1IBM H;  4X64 H;  4J9N A;  3U1K A;  2UXC H;  4O2B F;  3M9N B;  1Y14 B;  3UFX B;  4O3S A;  1XMQ H;  4B3S H;  1UC8 A;  4DV7 H;  3V6H A;  4E9J A;  2X06 A;  1O75 A;  3I0P A;  3VMM A;  2W6Q A;  2FMR A;  5DLG A;  2VA2 A;  4I4T F;  4UCS A;  1WVN A;  3U9T A;  2JA5 A;  5LA6 F;  5KFO A;  4GC6 A;  2CTJ A;  3KAK A;  4RNN A;  2P2R A;  3RB6 A;  2DPJ A;  4BY7 G;  3K3P A;  1N33 H;  1ULZ A;  2R7L A;  3OSS D;  4JV1 A;  3HBL A;  2YZN A;  4Q44 A;  5DGB A;  1VBI A;  4LIJ A;  1Z2P X;  3ETJ A;  1AUV A;  4YBZ B;  2V4Q A;  2HH2 A;  2V58 A;  3PR5 B;  4EYI B;  2ZDG A;  3GTO A;  3KDG A;  2NU8 B;  4HNV A;  4RUC A;  5KG7 A;  3H40 A;  4XYL B;  4WAL A;  4RZR A;  4G3I A;  4FJS A;  2FPG B;  4B3R H;  1HNX H;  4TQR A;  2R87 A;  3GID A;  4DV5 H;  1E4F T;  2R82 A;  5KFS A;  1ZTG A;  1E4E B;  1KJ8 A;  4ED1 A;  2C00 A;  3GII A;  3KHG A;  3VPB A;  4JUZ A;  1V8C A;  1KBL A;  3V4S A;  1GSH A;  1JDB B;  1XNQ H;  2ASL A;  3GTG A;  1L2Z A;  5JQW A;  3H4B A;  3AEV B;  4ED2 A;  4WD3 A;  4CC5 A;  3V6J A;  2C2R A;  2FLN A;  4DR5 H;  1A9X A;  5GON F;  4IR9 A;  3ORR A;  2YRW A;  4M7E A;  3RB4 A;  3L7Z C;  2KSW A;  2PMZ E;  4DR2 H;  1WH2 A;  2UXB H;  2YS7 A;  5KFX A;  5KFN A;  5EWG A;  3RB0 A;  2ATL A;  4I50 F;  2R8I A;  1VIH A;  1IOV A;  4ED8 A;  2VPQ A;  1UG8 A;  4ZQI A;  2NU9 B;  4ETS A;  3T5H A;  1M0T A;  2R7K A;  3M4I A;  1OWT A;  5KFC A;  4DLK A;  2V5A A;  5C8Y F;  4F4X A;  1K1G A;  2VOB A;  3BJY A;  1I94 H;  1Z2N X;  2R86 A;  4DL5 A;  1JXL A;  4Q0Y A;  5KFM A;  1CQJ B;  3HB9 A;  2I80 A;  5KG5 A;  1S0O A;  4YHH H;  1RJR A;  4QWE A;  5KT7 A;  4J9R A;  3OHB A;  2F4V H;  3GIM A;  1J5E H;  4HNT A;  3HKZ E;  1SEI A;  1E4E A;  2IA6 A;  1J5K A;  3JSN A;  2W7P A;  2W6O A;  4YQW A;  1N56 A;  1S97 A;  3WO0 A;  4ED0 A;  4O4L F;  2IMW P;  4O2A F;  4AIM A;  5L1K A;  3GTM A;  2XCA A;  4FU0 A;  1KJJ A;  2AGP A;  1S0N A;  3GR5 A;  5KFJ A;  3SB1 A;  2R84 A;  5JVD F;  4G08 A;  1S68 A;  1WCM A;  4IWX A;  5KFV A;  4EBE A;  1WE8 A;  2JZX A;  2PY9 A;  3JSL A;  2RDJ A;  2AQ4 A;  2BR0 A;  3MWM A;  4ECX A;  4LSX A;  3EPI A;  1XMO H;  4RUA A;  2PVP A;  5H80 A;  2VR1 A;  5DQH A;  5KT3 A;  5BPF A;  2V4R A;  5D8D A;  5BMV F;  2FK1 A;  2W8K A;  4GKK H;  1T94 A;  1VS0 A;  2QYZ A;  2B63 G;  1GYF A;  4JV0 A;  5LP6 F;  1VAJ A;  1TWG A;  4JVY A;  4MV8 A;  2J6U A;  5KT6 A;  2D9I A;  3HOW G;  1I7N A;  3I4N G;  1Y1V G;  1WHR A;  3G6X A;  3OUU A;  4B8C D;  4QWC A;  2YCH A;  3GIK A;  2JEF A;  3V6K A;  2VUM G;  4DV1 H;  2OH2 A;  5KFR A;  2UVU A;  4O4H F;  4H8A A;  1I7L A;  2OLS A;  4Q8F A;  5HV6 A;  2W6P A;  3KDK A;  3LML A;  5KT2 A;  2JE6 I;  2O4C A;  2VKC A;  4MV3 A;  1E4G T;  4BY1 G;  4DV2 H;  2CW7 A;  2DLN A;  5KFG A;  2NVY A;  3MFH A;  2FB9 A;  2IP4 A;  1TWH A;  3L4K A;  4F4Y A;  4YAK B;  4J9O A;  1M7J A;  1FVI A;  2Q2T A;  2GPW A;  2R8K A;  5CA0 F;  3FDS A;  2PQU A;  2FPI B;  4DR4 H;  3H0G G;  2VQE H;  4JI1 H;  4B3T H;  4RB1 A;  4ED6 A;  2R6F A;  4JI4 H;  5K36 G;  3ORQ A;  2CKZ B;  1RJQ A;  3VPC A;  3RGZ A;  3RF2 A;  2R93 G;  4IHJ F;  2JA6 A;  3E5N A;  4C5B A;  1XNR H;  4NLG A;  4BWS C;  2FFM A;  3GTK A;  3V4Z A;  4FS2 A;  4LFB H;  1JIH A;  4QW9 A;  4ECY A;  4O3N A;  3GIJ A;  4Y8V B;  3N44 B;  5KFT A;  4DR3 H;  4DUZ H;  3N43 B;  4JI2 H;  3I12 A;  5KKN B;  4MV1 A;  2UUC H;  1HNW H;  1C3O A;  4MV4 A;  2YU9 A;  5FLX W;  4DV3 H;  1DIK A;  1KJ9 A;  3RIZ A;  4Q45 A;  1A0I A;  3C0F B;  3RTX A;  2FPH X;  5IP7 G;  2UU9 H;  4ECU A;  4EEY A;  4DV6 H;  2QND A;  1RYS A;  2WAQ A;  5KFD A;  5I47 A;  4MV7 A;  4F50 A;  3GTP A;  1EUC B;  2E2I A;  1RJP A;  1JLL B;  1SCU B;  3Q8Q B;  4IAJ A;  5KFA A;  3GTJ A;  4O3R A;  5K2M A;  3OTO H;  5C1P A;  4C5C A;  3UQ8 A;  4QWB A;  4JYA H;  3PR4 A;  2DPI A;  1UNN C;  3BAA A;  4ZHQ F;  2XCP A;  5FJ8 G;  3GTL A;  3MWD A;  2ZDH A;  4RZQ A;  4B8T A;  1MZB A;  3PN1 A;  5JUM A;  3M9O B;  1ZET A;  3SE7 A;  5KFQ A;  2VUG A;  3WO1 A;  4ECZ A;  2R7M A;  2NN6 G;  5KG6 A;  4QWD A;  4ED3 A;  4MTD A;  5KG3 A;  5CAE B;  4EGQ A;  4MA0 A;  2XGQ A;  3EPG A;  1V4Y A;  1BXR A;  5KG2 A;  1VKZ A;  1CS0 A;  1ZHQ A;  1TUA A;  2DGR A;  1JKJ B;  1AUX A;  4AQY H;  4K0K H;  3GIQ A;  4EEQ A;  3CQZ A;  3Q2O A;  2W70 A;  1KC7 A;  2W6Z A;  4YAJ B;  4FBT A;  4YJ2 F;  2W9C B;  4UFZ A;  2Y3M A;  2V9W A;  1I3Q A;  4BXX G;  4O3Q A;  3MR5 A;  4RU9 A;  4A3M G;  2VQF H;  2QK4 A;  3PW0 A;  4IRD A;  2WDT A;  5IYD G;  4JV5 H;  2OWO A;  4LF7 H;  1TWF A;  4AYB E;  1T36 A;  5J2U F;  5EOY A;  5L1J A;  1S20 A;  1B33 N;  1TWC A;  5IYC G;  4YJ3 F;  1V9N A;  3GQC A;  3QZ7 A;  2OPV A;  2ZQE A;  3RV3 A;  4DL6 A;  3J7A K;  1F0X A;  2DIK A;  4JI5 H;  2CTL A;  1M0W A;  4LH7 A;  5D1O B;  4JVH A;  4I55 F;  3TIG A;  4DL3 A;  5DG7 A;  2ASJ A;  1XDN A;  2DZD A;  3BA9 A;  3HOZ G;  2E5L H;  4FBU A;  4LF9 H;  1N48 A;  2JA7 G;  1UC9 A;  3KAL A;  4QIW E;  2W8L A;  1Y1W A;  3H4D A;  2C2E A;  2MCT A;  3HOV G;  4B3M H;  5KFB A;  4DL4 A;  2XGP A;  4DR7 H;  5EWE A;  2Y0S E;  2W7O A;  1N36 H;  2R8G A;  1DV2 A;  4EG0 A;  4EBD A;  1S10 A;  4CC6 A;  2W9C A;  4RB2 C;  4X66 H;  4QWA A;  5LOV F;  3GV8 B;  4BA1 I;  2ZJT A;  1R9T A;  1PQX A;  3N6X A;  5LYJ F;  4FJU A;  2CZG A;  1T3N A;  3MFI A;  4BA2 I;  4JI6 H;  2HGS A;  4EYH B;  2UVW A;  2JEG A;  2HJW A;  2WB1 E;  5IYB G;  2IBK A;  1X9Z A;  3CVZ A;  4X65 H;  2Q2U A;  2E3U A;  1N32 H;  1V9P A;  4A3I G;  3BA8 A;  1GGO A;  4PDB A;  3FKI G;  2FE3 A;  2XIG A;  2RF4 A;  2YYA A;  3N40 P;  4MAM A;  4PWQ A;  5D1P A;  5KT4 A;  5D1O A;  5KFY A;  2YQR A;  3TQT A;  3HOX G;  1JDE A;  1K1S A;  3LWB A;  4IFD G;  4RNM A;  1ZQ7 A;  3Q8P B;  3L4J A;  3RBE A;  1W96 A;  2X0S A;  4TV8 F;  1CQI B;  2W9B B;  5KFI A;  2ASD A;  3KAJ A;  4JI8 H;  2RGR A;  1I50 A;  4DR1 H;  5LXT F;  4RNO A;  2W6N A;  5KFH A;  1WCM G;  5KFZ A;  5JH7 F;  4WBN F;  2SCU B;  3F8N A;  2BQU A;  4ZI7 F;  4J9L A;  2UUA H;  5EDW A;  1DTJ A;  4A3B G;  2FLP A;  2AXY A;  4DL2 A;  3OHA A;  5T14 A;  3T5L A;  5IP9 G;  2PBZ A;  4IWY A;  1GSA A;  2W9A A;  2PMZ A;  2YL2 A;  4NXN H;  1TWA A;  5DQG A;  3T5J A;  1IBK H;  4F4Z A;  2B63 A;  4XZ3 B;  3H20 A;  1XRH A;  2CW8 A;  2JVZ A;  1GSO A;  2VPS A;  2WYO A;  4FM9 A;  2BL5 A;  1S9F A;  1PX2 A;  4A2B A;  3RGX A;  4FS1 A;  2R92 G;  4EGJ A;  5KFK A;  4ECV A;  5KFP A;  4APM A;  2JEI A;  3EYY A;  3R23 A;  4DL7 A;  4NZR M;  3J80 W;  5C1O A;  2VUM A;  3PVX A;  2UVV A;  4IRC A;  2W9B A;  1ZZI A;  4YB8 B;  4EFB A;  1VBG A;  4DUY H;  1DT4 A;  4UCO A;  2ANR A;  1WSC A;  3HKZ A;  4LF8 H;  3T5K A;  5DLF A;  5C4X G;  4WAN A;  5C0X G;  4QW8 A;  3RAX A;  4O3O A;  2LTM A;  2A1S A;  1C30 A;  2NU6 B;  2WE6 A;  2FKL A;  4DR6 H;  3JRX A;  2NVX A;  4TQS A;  4YR0 A;  3H0G A;  4HQ6 A;  4LF5 H;  3J81 W;  2CWH A;  1EYZ A;  2VQD A;  4ECT A;  5LMN H;  3QZ8 A;  2C22 A;  3IG0 A;  4YP3 A;  1S0M A;  4A3D G;  3RUP A;  1ZHS A;  3KHR A;  1GLV A;  3EZJ A;  5EZY F;  2FPP B;  1RK5 A;  2CTF A;  3G6V A;  1B6S A;  4ECQ A;  3RJ0 A;  5KFF A;  1RYR A;  5IT9 W;  2HH3 A;  3PW4 A;  2CTK A;  1K1Q A;  1P8L A;  2M05 A;  3RAQ A;  5DQI A;  1TA8 A;  3BG5 A;  2M8W A;  4L1K A;  3T1H H;  5BR8 H;  5C3E G;  4TUY F;  2PT7 G;  2YW2 A;  1ODH A;  4AM3 A;  1VBH A;  3RB3 A;  5KFU A;  4HYK A;  3MWE A;  3KHL A;  3N8D A;  5L1I A;  4R8U B;  4J9M A;  5DG8 A;  1CE8 A;  2FMA A;  3AYH B;  1DGS A;  4LH6 A;  2JA5 G;  3FAU A;  3OSP A;  4RAY A;  3N41 B;  1SFO A;  2J6S A;  5JEA G;  4O4I F;  4LF6 H;  2CPM A;  1TAE A;  2MJH A;  5JVL A;  4LSA A;  3QFF A;  2R85 A;  4NZT M;  4EFE A;  2C2D A;  2OPU A;  4GKJ H;  1VIG A;  2UXD H;  1PK8 A;  4I7H A;  2K1H A;  2I87 A;  3PO3 G;  2J6T A;  2ANN A;  4MV6 A;  3PZP A;  2FLL A;  3HXL A;  4BBR G;  3PO2 G;  1EC6 A;  2HHH H;  4JI3 H;  3T1Y H;  5J2T F;  1Z2O X;  4RB0 A;  5IYZ F;  5KG1 A;  2HVQ A;  4R7R A;  3NCV A;  3V69 A;  2ZM6 H;  2YZM A;  1X4N A;  4JI7 H;  4UCT A;  2CQY A;  4MV9 A;  2JA9 A;  4HNU A;  2R8H A;  5L1L A;  1M6V A;  2C35 B;  1S03 G;  2FJZ A;  5DG9 A;  1IOW A;  3GV5 B;  4EBC A;  5LL6 b;  3GTQ A;  1KJQ A;  4R8U A;  3PW5 A;  3GAB A;  1EUD B;  2GPS A;  5KG0 A;  5EWF A;  2JEB I;  3L2P A;  1X9N A;  1W93 A;  2AU0 A;  2XCL A;  4LF4 H;  4QJF A;  3OUZ A;  2R7Z A;  1Y1W G;  4LFA H;  3SI8 A;  1N34 H;  2JA7 A;  2NU7 B;  4XX0 B;  4A93 G;  3M9M B;  1B6R A;  4J9S A;  2WTF A;  2CTE A;  2W71 A;  3R5H A;  4A3E G;  4U7C A;  4GLX A;  1FKA H;  2W6M A;  2ZDQ A;  3BAB A;  2R8J A;  2LF0 A;  5BPH A;  2W57 A;  1RK6 A;  5F9N A;  1J4W A;  3K5H A;  1SYX B;  3GV7 B;  2AGQ A;  2FK3 A;  3Q1K A;  4A3L G;  4A3K G;  2V59 A;  3RFC A;  1I6U A;  5FD5 A; 
#chains in the Genus database with same CATH homology
 4JI0 H;  4MV7 A;  3EYY A;  4DV5 H;  1E4F T;  4NZR M;  3OET A;  3J80 W;  4RB3 C;  4IAJ A;  3OTO H;  3UQ8 A;  4JYA H;  4EFB A;  4DUY H;  3BAA A;  4UCO A;  1XNQ H;  2O03 A;  4LF8 H;  4RZQ A;  4UCR A;  1L2Z A;  1MZB A;  3K3V A;  3PN1 A;  4CC5 A;  4DV0 H;  4DR5 H;  2VUG A;  2HVS A;  4YY3 H;  4M7E A;  4MTD A;  2KSW A;  1X9N A;  4DR2 H;  1WH2 A;  2UXB H;  2WE6 A;  4DR6 H;  2RGV A;  1ZHQ A;  4ETS A;  4LF5 H;  3J81 W;  4APM A;  4AQY H;  4K0K H;  1M0T A;  5LMN H;  4J0M A;  3M4I A;  4EEQ A;  3IG0 A;  4LFC H;  4OX9 H;  1ZHS A;  2VOB A;  1I94 H;  1Z2N X;  4UFZ A;  2HVR A;  4Q0Y A;  3KXY T;  2Y3M A;  3EZJ A;  4YHH H;  2VQF H;  4RAZ A;  3RJ0 A;  2F4V H;  1J5E H;  2WDT A;  5LMU H;  5IWA H;  4JV5 H;  4LF7 H;  2OWO A;  1SEI A;  5IT9 W;  4OD6 A;  5EOY A;  3JSN A;  4EC5 A;  4OCH A;  1P8L A;  5FD6 A;  2ZQE A;  1TA8 A;  3T1H H;  5BR8 H;  3J7A K;  1F0X A;  2PT7 G;  1FJG H;  4JI5 H;  1ODH A;  1M0W A;  4LH7 A;  5D1O B;  3GR5 A;  3N42 B;  4LMY A;  1AN7 A;  1XDN A;  3BA9 A;  5FPR A;  4MTE A;  3SB1 A;  1B04 A;  4G08 A;  2E5L H;  4NXM H;  1S68 A;  4LF9 H;  3JSL A;  4LH6 A;  3MWM A;  1DGS A;  3KAL A;  4A2A A;  4LSX A;  3FAU A;  1XMO H;  3FMA A;  4RAY A;  2MCT A;  3N41 B;  4B3M H;  3DF7 A;  4LF6 H;  3JAM W;  5A2Q W;  5FPO A;  4DR7 H;  1TAE A;  4GKK H;  1VS0 A;  5DT9 A;  1N36 H;  4LSA A;  1GYF A;  4NZT M;  4CC6 A;  4EFE A;  4GKJ H;  2UXD H;  4B3R H;  2D9I A;  4X66 H;  4KHP H;  4I7H A;  4RB2 C;  2ZJT A;  1HNZ H;  1IBL H;  3N6X A;  4B8C D;  3QD7 X;  1BGW A;  4JI6 H;  2HGS A;  3HXL A;  2YCH A;  2HHH H;  4X62 H;  3T1Y H;  4JI3 H;  2UUB H;  4DV1 H;  1Z2O X;  1HR0 H;  4RB0 A;  1X9Z A;  3CVZ A;  4X65 H;  2Q2U A;  1N32 H;  1V9P A;  2HVQ A;  4R7R A;  3NCV A;  2ZM6 H;  4PDB A;  3BA8 A;  2FE3 A;  2XIG A;  3N40 P;  3KDK A;  3LML A;  4JI7 H;  4UCT A;  4UCU A;  5D1P A;  2O4C A;  2VKC A;  4MV9 A;  5D1O A;  1BJT A;  4DV4 H;  3L4J A;  1S03 G;  4UCV A;  1E4G T;  5LL6 b;  4X64 H;  1IBM H;  4DV2 H;  2CW7 A;  2UXC H;  3KAJ A;  3GAB A;  4JI8 H;  2RGR A;  3L4K A;  1XMQ H;  4DR1 H;  4B3S H;  4DV7 H;  1FVI A;  4E9J A;  2Q2T A;  1O75 A;  3L2P A;  4DR4 H;  4LF4 H;  2VQE H;  4JI1 H;  4B3T H;  3F8N A;  4RB1 A;  4LFA H;  4JI4 H;  1N34 H;  2UUA H;  4UCS A;  3RGZ A;  3RF2 A;  3KAK A;  1XNR H;  4BWS C;  1N33 H;  3OSS D;  4LFB H;  3N44 B;  4DR3 H;  4GLX A;  1FKA H;  4DUZ H;  4NXN H;  1Z2P X;  4JI2 H;  1IBK H;  2LF0 A;  3BAB A;  3N43 B;  2UUC H;  1HNW H;  2W57 A;  3H20 A;  2CW8 A;  2WYO A;  5FLX W;  4DV3 H;  3KDG A;  2VPS A;  3RIZ A;  4FM9 A;  1A0I A;  1SYX B;  3C0F B;  2FPH X;  3RTX A;  2UU9 H;  4A2B A;  3RGX A;  4DV6 H;  1HNX H;  1I6U A;  5FD5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...