3JAMW

Cryoem structure of 40s-eif1a-eif1 complex from yeast
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
129
structure length
129
Chain Sequence
TRTSVLADALNAINNAEKTGKRQVLIRPSSKVIIKFLQVMQKHGYIGEFEYIDDHRSGKIVVQLNGRLNKCGVISPRFNVKIADVEKWTANLLPARQFGYVILTTSAGIMDHEEAHRKHVSGKILGFVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational Differences between Open and Closed States of the Eukaryotic Translation Initiation Complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Translation
molecule keywords 18S rRNA
total genus 29
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
W PF00410 Ribosomal_S8 Ribosomal protein S8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.30 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 3jamW01
3.30.1490.10 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3jamW02
1J5EH 2UUBH 4JI5H 4B3SH 4YHHH 4LF4H 4DR7H 4KHPH 1N33H 4JI2H 1AN7A 1HNWH 4JI0H 2UXBH 4LF8H 4AQYH 1HNZH 5FLXW 4DV1H 4JI1H 4B3MH 1I94H 4DR3H 5BR8H 3J7AK 4X62H 4JV5H 2HHHH 2UUAH 2UXDH 4GKKH 1SEIA 5LL6b 3J80W 1HR0H 4LFAH 1XMOH 1FJGH 4LFCH 4K0KH 3OTOH 1XNQH 5IWAH 4JI8H 4YY3H 1S03G 4DV4H 4B3TH 5LMUH 4OX9H 4DV3H 4DV0H 4DV7H 1N36H 1N34H 2UUCH 4DUYH 2VQEH 2VQFH 1XMQH 4DV6H 1I6UA 4B3RH 2UU9H 4DR4H 1FKAH 4DV2H 5IT9W 2ZM6H 4DV5H 5LMNH 4X65H 3J81W 4JI7H 5A2QW 1N32H 4DUZH 4DR6H 4JI3H 4JYAH 4GKJH 2E5LH 2UXCH 4X66H 3RF2A 4DR5H 4DR1H 4PDBA 2F4VH 4DR2H 4NXNH 4LF9H 4LFBH 1HNXH 4JI4H 4LF5H 4LF6H 3JAMW 3T1YH 1IBLH 1IBMH 4NXMH 4X64H 4LF7H 4JI6H 3T1HH 1IBKH 1XNRH
chains in the Genus database with same CATH superfamily
2C28A 3OSPA 1S97A 5KFCA 2UUBH 3HKZE 4YQWA 1EUDB 4MTEA 2R8KA 2R8IA 1ZTGA 3V6HA 2WTFA 1ZZIA 5KFUA 1Y1VG 1N33H 3RAXA 1N48A 5F9LA 2WYOA 5DLFA 2QYZA 5KFGA 2Q2UA 2QK4A 4JI0H 1J4WA 2UXBH 1IOWA 3EPGA 2R7MA 1Y1WA 1RYRA 4DV1H 2CPQA 2K1HA 2VUGA 4QIWE 5KT5A 4QW9A 4F50A 5IP9G 2ZJTA 3SE7A 5KG5A 3PR4A 2FB9A 3T5LA 3PW7A 4FBTA 2DWCA 2GPWA 4ED6A 3PO3G 4BBSG 4B8CD 3GTJA 1CQIB 4M7EA 1A9XA 5BR8H 3OETA 3J7AK 4J9QA 3HOYG 3MWMA 1ODHA 3PW0A 1JLLB 2O4CA 4E9JA 5LYJF 4J9RA 1M6VA 3PN1A 2C2EA 1JIHA 5C8YF 1I3QA 2VOBA 2LTMA 2R6FA 3Q1KA 4YJ3F 4BY1G 1EC6A 4MTDA 2UUAH 4EBEA 1JDEA 3GTMA 2NU9B 4TQRA 4MV4A 4LSAA 4ECSA 4ECQA 3MFIA 2JA5A 2CQYA 3LWBA 4IWXA 3J80W 5KFDA 2YQRA 1WTJA 1HR0H 3LP8A 4C5CA 4LFAH 1MZBA 5JVLA 5DGAA 1E4FT 3MR6A 1S20A 2VUMG 2UVRA 2GPSA 5FD6A 4A3DG 4FM9A 3KHRA 4K0KH 4BY7G 3KAJA 2HVRA 4ED3A 1XNQH 3NGDA 2DPIA 2R92G 2FPPB 1Y14B 2FP4B 4A2BA 5BMVF 3OUZA 5EWEA 4RNOA 4FS2A 4JV2A 2IBKA 4B3TH 3G8CA 4QWCA 4DL6A 3TIIA 4JUZA 2FMAA 4ZI7F 1F0XA 2VA2A 3VPBA 2JA7A 4DUYH 1GSAA 4DV6H 5KT4A 4J9LA 4F4YA 4A3GG 3HXLA 2W9BB 4UCOA 4A3BG 5KT2A 2AXYA 3AEVB 4DR4H 4O3NA 1S10A 2R8GA 1BGWA 1B04A 1TUAA 4BBRG 2DGRA 1FKAH 1SYXB 1TWHA 4EFEA 2AQ4A 1S9FA 4DV5H 2ZQEA 3KHLA 4A3LG 2W9AA 2LRRA 2FK2A 1X4MA 2R85A 3N43B 4RNMA 4X65H 4Q0YA 2HVQA 1K1QA 1A0IA 2R82A 4ED1A 4JI7H 5KFLA 4EEQA 1KEEA 4GC7A 4FBUA 4Q8FA 4QW8A 3EPIA 4ECZA 1GSHA 5KFPA 4DR6H 3U9TA 4RB2C 4G3IA 3N42B 4JVHA 5FPOA 2YRWA 2JZXA 4UCUA 4A3MG 2CTJA 2FPGB 1CQJB 2W9BA 4X66H 4XZ3B 3RF2A 2YW2A 2VKCA 4J0MA 1B33N 1GLVA 5CB4F 3T5KA 3RAQA 2F4VH 3V6KA 4NXNH 4UCRA 3MR2A 2R93G 2FE3A 3GTPA 4EGQA 4WBNF 1I7NA 1ZHSA 3JRXA 4IAJA 3KDKA 4QJFA 5J2UF 4JVYA 3T1YH 2PY9A 4IRKA 4IZOA 2JA9A 1Y1WG 2W71A 3K3PA 4ZQIA 5BPHA 2XGPA 4MA0A 4RB3C 3R5FA 4O4LF 2DPJA 2AGPA 5FJ8G 2JEAI 3GV8B 3L7ZC 3V69A 2HGSA 2R7ZG 1XNRH 3U1KA 5FPRA 2AGOA 5DLGA 5C44G 2ASDA 5K2MA 4A3KG 2W9CA 5IYCG 5KG3A 3H0GA 4CC6A 4LF4H 2Q2TA 4O3PA 3GILA 4QWAA 5T14A 3MWEA 1PX2A 2WDTA 1AN7A 2W6MA 3GIDA 2M8WA 1DGSA 1KBLA 3GV7B 4ECUA 2J6UA 5FLXW 2HH2A 2W7PA 4J9KA 4DL7A 4CC5A 4GC6A 3GTGA 3Q8SB 2C2RA 2XCAA 1I94H 2W57A 5DQIA 2NN6G 2LF0A 1V4YA 4I55F 5KFXA 3HBLA 3TINA 4Q43A 2R87A 2NVYA 5KFAA 2W8LA 2W9CB 1ZZKA 4X62H 3RFCA 5C1PA 5DT9A 3N41B 5K36G 2HH3A 2HVSA 4IRCA 2X0SA 3KAKA 4YP3A 5DG8A 3IN5A 3RB4A 1NXUA 2HHHH 2R84A 4AM3A 2FK3A 4DL5A 4BXXG 4A3EG 1EHIA 4O3RA 1JDBB 2UXDH 3U9SA 4ECRA 3WO0A 2NVXA 3K3VA 2AU0A 2XD4A 3BABA 4LSXA 1X9NA 3KDGA 3OHAA 2E3UA 3JRWA 3Q8QB 2FLNA 3V6JA 1E4GT 1R9TA 1Y1VA 2WAQE 5DQHA 5H80A 3VKEA 2UVVA 1OWTA 5LXTF 4F4ZA 3LMLA 3L4JA 2W6QA 2UVUA 3FKIG 2R93A 3OTOH 2ATLA 2R8JA 4HNTA 3UQ8A 2VA3A 1S03G 1DTJA 2DZDA 2XIGA 3RV4A 2JA8G 4DV4H 3JZIA 3UOEA 4BA2I 3NCVA 2B63G 1I50A 2JA7G 1N34H 3K5IA 3RB3A 2VQEH 1XMQH 4EGJA 5KFZA 1GSOA 2ANRA 4R8UA 1KJ9A 4LIJA 1Z2NX 3L2PA 4WALA 1B6RA 1S68A 2PBZA 5IYDG 2UU9H 4O2AF 4BWSC 4I7HA 2JEBI 2WB1E 5KFOA 5EWFA 4GLXA 4ED7A 2AGQA 2DLNA 2JEJA 1WR2A 2OH2A 1WH2A 5IT9W 2ZM6H 3ORRA 4O4HF 5D1OA 3QZ8A 2VUMA 2W70A 2Y0SA 4ECXA 1KHMA 5JH7F 3T5JA 3VPCA 5EDWA 4YR2A 4XYLB 3KALA 2OPUA 1TWAA 1ZQ7A 3RGZA 1UC9A 3C0FB 5C1OA 2E2IA 5KT3A 5L9XA 2Y0SE 4GKJH 2CW7A 5KFVA 1DV2A 4EFBA 4R8UB 4Q8EA 1TAEA 3FMAA 2C2DA 3V4SA 4NZRM 5L1KA 4DL2A 4DR5H 1T36A 2R8HA 4PDBA 4UCVA 2FK1A 3VMMA 2C00A 1VS0A 3RUPA 3N40P 4LF9H 4LFBH 1CE8A 4QWBA 4AYBE 4JI4H 2D9IA 4RZQA 3GTOA 4LF5H 2PQUA 2KSWA 5D1OB 5GONF 3V4ZA 5DGBA 3GTKA 4LF6H 5KFTA 1P8LA 3HB9A 1X4NA 3OHBA 2FPHX 4XX0B 3GIKA 2BQ3A 3GABA 2E2HA 1IBMH 3MWDA 4X64H 2RGVA 3BQ0A 3MR5A 2B63A 1EUCB 5KFEA 3GIPA 4FU0A 4RUCA 2ASJA 4O3QA 1IBKH 4LMYA 5CA0F 3K5HA 1V9NA 1GYFA 4IHJF 2I8CA 1W96A 1T94A 1J5EH 1PK8A 3N6XA 3PVXA 5KG0A 2IMWP 1PQXA 3N8DA 4Y8VB 4I50F 2JE6I 2V9WA 2P0AA 2CTFA 4HNVA 3HOVG 2ANNA 3GLKA 4MA5A 4KHPH 2V5AA 4MV8A 5JQWA 3H20A 3FDSA 5KFMA 4ECVA 1JX4A 3HKZA 2VR1A 2JEFA 3IG0A 1HNWH 1S0MA 1RYSA 4MAMA 4AQYH 5IP7G 3I0PA 3JSNA 4B3MH 1RK5A 3R23A 1BNCA 5I47A 1BXRA 2YS7A 3FKIA 5KX5F 2JEIA 1VIHA 4B8TA 3SB1A 2NU7B 4MV9A 4U6PA 1Z2OX 2BR0A 4JV1A 2XCLA 4HQ6A 4FJSA 2M05A 4YAJB 2IP4A 4JV0A 3WO1A 2R7ZA 1GGOA 2FMRA 2YCHA 1V9PA 4EG0A 5BPFA 5JVDF 3I4NG 4JV5H 4RUAA 5C5JA 2R86A 4ECYA 2VPQA 3N44B 2CWHA 2OPVA 3JSLA 2W8KA 5L1LA 4AIMA 4QWDA 4L1KA 3HOZG 2ZDGA 5IYBG 3PW4A 4GKKH 4BA1I 3H4BA 1VBIA 2OLSA 1K1SA 4EEYA 2C22A 4IR9A 3GKUA 2CPMA 1M7JA 2I80A 3MJFA 4TUYF 4AYBA 2ZDHA 4E4TA 5EOYA 4MV6A 2RDIA 3GTLA 4DL3A 1VIGA 1XMOH 5KG7A 1FJGH 5KT6A 4QWEA 5DG7A 3RB6A 4WANA 3PW5A 1ZZJA 5KG6A 2CW8A 2SCUB 5KFWA 3R5XA 2W6OA 2W6ZA 1TA8A 2WE6A 5FD5A 4J9OA 3ETJA 4OX9H 3RV3A 1JKJB 5CAEB 4DV3H 2J9GA 3BA8A 4DV7H 1N36H 1KJIA 4MV1A 2NU8B 4HYKA 5C0XG 4IFDG 2UUCH 1B6SA 1EYZA 2C35B 2OWOA 3QFFA 4B3RH 1UNNC 3H0GG 2MJHA 3RBEA 2CTEA 2PN1A 4QMFB 4H8AA 4M9UA 5KG4A 5LOVF 4RB1A 2V4RA 4R7RA 1Z2IA 3KHGA 1UG8A 2W6NA 1VAJA 4ETSA 4NZTM 4DV2H 1VKZA 4RAYA 4Q44A 2W7OA 2R7KA 5KFBA 2V58A 3G6YA 3GTQA 2JA6A 5LMNH 1BJTA 3SI8A 3BQ1A 3J81W 4O4IF 4ECWA 3BA9A 4F4XA 5A2QW 5DG9A 1V8CA 2I87A 1AUXA 2MCTA 2RGRA 3F8NA 4UFZA 4MV7A 5C3EG 4NLGA 4JI3H 4JYAH 2R92A 2YU9A 4YJ2F 1S0NA 2FLPA 2M6QA 1FVIA 4OD6A 2O03A 5EWGA 3UFXB 2RF4A 4DR1H 3GQCA 2X06A 3GV5B 2DIKA 3RBDA 2ALZA 2V4QA 2FFMA 4O3SA 4RU9A 3MFHA 1HNXH 4YAKB 4A3FG 2ASLA 4ZOLF 4J9SA 4A3CG 4FS1A 3R5HA 3H4DA 4J9PA 3JAMW 1TWCA 1WSCA 4OCHA 3T5HA 2BQUA 3M9OB 5KFKA 2UVWA 3GIMA 4YR0A 3BAAA 3RB0A 5HV6A 4EC5A 4LF7H 4A3IG 4JI6H 2GLTA 4UCSA 4IR1A 2YS6A 5KFHA 3CQZA 4ME6A 4DL4A 3HOUG 2R7NA 2IA6A 3Q2OA 2JA6G 3CVZA 3I4MG 3HOXG 4JI5H 3QZ7A 2J6TA 1GO3E 3G6VA 1AUVA 4U7CA 5D8DA 3GIQA 1ULZA 3M9NB 4QIWA 4EYHB 1N56A 5KG1A 2YZMA 4A93G 4B3SH 4YHHH 1WE8A 4DR7H 1RJQA 3M4IA 4HNUA 3OSNA 4LH7A 1I7LA 2XC9A 3I12A 2WB1A 4ED8A 4JI2H 2JA5G 5KFYA 1RK6A 5CA1F 4LF8H 1HNZH 2FPIB 3L4KA 4JI1H 4ECTA 1W93A 5C4XG 1CS0A 4UCTA 1ZHQA 2W6PA 2PMZE 2RDJA 3QD7X 3OUUA 2CTKA 4IWYA 2VPSA 4DLKA 4RNNA 3PW2A 2YL2A 4TQSA 4DR3H 2YYAA 4G08A 4TV9F 2Z0SA 1KJQA 4PWQA 2PMZA 4YB8B 2CZGA 4MV3A 4ZHQF 1VBGA 3MR3A 1IOVA 1E4EA 1MSZA 3RJ0A 2NU6B 4ED0A 4RAZA 3Q8PB 2YRXA 3ETHA 5KG2A 1SEIA 3FAUA 1DV1A 2LTLA 5LL6b 4YBZB 3TIGA 3VPDA 1EZ1A 5LP6F 5EZYF 1WVNA 4O2BF 1KC7A 4HR7A 5KFIA 2JVZA 2FLLA 2CWFA 1RJPA 5KFJA 3H40A 4APMA 5KFNA 1TWFA 4J9NA 2BA0A 2XCPA 2FKLA 3E5NA 2BQRA 4XYMB 4IRDA 3WNZA 2FJZA 4C5BA 4F4WA 4LFCH 1ZETA 4A3JG 1J5KA 2Y3MA 3GR5A 2HJWA 2CTMA 2G8YA 1E4EB 5IWAH 4JI8H 3EYYA 2PT7G 5HBRB 4C2MA 4I4TF 5KT7A 4YY3H 3KHHA 3BJYA 4EBDA 4Q45A 2VQDA 2WAQA 5LMUH 5FLMG 1C3OA 5D1PA 1DT4A 2P2RA 4DV0H 4RZRA 3ORQA 1X9ZA 3BQ2A 2YZNA 1K1GA 1O75A 2VQFH 3RTXA 1SFOA 1V51A 1I6UA 4WD3A 3RGXA 4RB0A 2JEGA 3M9MB 4NBQA 2PVPA 1K83A 1M0WA 3PZPA 1JXLA 2QNDA 3PR5B 5L1JA 4ED2A 1UC8A 2CTLA 3G6XA 5IYZF 1TWGA 2BL5A 5J2TF 4O3OA 2A1SA 1DIKA 1N32H 2ZDQA 4DUZH 3BG5A 5KFFA 3TQ1A 1L2ZA 4OO1G 5KFQA 3Q8RB 5LA6F 3H3VH 2E5LH 1RJRA 2UXCH 1WCMA 5JEAG 1M0TA 5KFRA 2NUAB 3TQTA 2YZGA 3KXYT 4FJUA 4DR2H 1WHRA 5KFSA 1XRHA 3DF7A 4TV8F 4A2AA 1Z2PX 1SCUB 3GIJA 4J9MA 1T3NA 2XGQA 1C30A 4YR3A 2R7LA 3RIZA 4EYIB 1S0OA 3HOWG 1KJ8A 1WCMG 3EZJA 1IBLH 1X0AA 3GIIA 4C5AA 3PO2G 4NXMH 2V59A 3OSSD 3KTMA 1VBHA 5KKNB 2J6SA 5DQGA 3T1HH 2CKZB 1XDNA 4LH6A 5JUMA 5L1IA 4EBCA 3AYHB 5F9NA 1KJJA
chains in the Genus database with same CATH topology
3CVZA 1J5EH 2UUBH 4JI5H 3N6XA 4MTEA 4CC6A 4B3SH 4YHHH 4LF4H 4DR7H 3M4IA 4UCRA 2Q2TA 4KHPH 1N33H 4LH7A 3H20A 2WYOA 2WDTA 3IG0A 1AN7A 4JI2H 1HNWH 4JI0H 2UXBH 2Q2UA 4LF8H 4AQYH 1HNZH 1DGSA 3L4KA 5FLXW 3JSNA 4DV1H 4JI1H 4B3MH 2VUGA 4CC5A 4UCTA 2ZJTA 1ZHQA 1I94H 2W57A 3QD7X 4B8CD 2VPSA 2LF0A 3SB1A 4MV9A 1Z2OX 4DR3H 4M7EA 4G08A 5BR8H 3OETA 3J7AK 4X62H 3MWMA 5DT9A 2YCHA 3N41B 1V9PA 1ODHA 3KAKA 4JV5H 2O4CA 4E9JA 3N44B 3JSLA 3PN1A 2HHHH 3RJ0A 2VOBA 4RAZA 4MTDA 2UUAH 2UXDH 4GKKH 1SEIA 3FAUA 5LL6b 3K3VA 4LSAA 3BABA 4LSXA 1X9NA 3KDGA 3J80W 1HR0H 5EOYA 4LFAH 1MZBA 4APMA 1E4GT 1E4FT 1XMOH 1FJGH 5FD6A 4LFCH 4K0KH 3LMLA 3L4JA 3KAJA 2HVRA 4FM9A 2Y3MA 3GR5A 3OTOH 1XNQH 3EYYA 2HVSA 5IWAH 4JI8H 2CW8A 2PT7G 4A2BA 3UQ8A 4YY3H 1S03G 1TA8A 2WE6A 2XIGA 5FD5A 4DV4H 4B3TH 5LMUH 4OX9H 5D1PA 4DV3H 4DV0H 3BA8A 4DV7H 1N36H 3NCVA 1F0XA 1X9ZA 1N34H 2UUCH 1O75A 4DUYH 2VQEH 2VQFH 1XMQH 4DV6H 3L2PA 1I6UA 4B3RH 1Z2NX 2OWOA 3HXLA 3RGXA 1S68A 4UCOA 4RB0A 2UU9H 4DR4H 4I7HA 4BWSC 4GLXA 1BGWA 1B04A 1M0WA 4RB1A 4R7RA 1FKAH 1SYXB 1WH2A 4EFEA 4ETSA 4NZTM 4DV2H 5IT9W 2ZM6H 2ZQEA 4DV5H 4RAYA 3N43B 5D1OA 5LMNH 4X65H 1BJTA 4Q0YA 3J81W 2HVQA 1A0IA 3BA9A 4JI7H 5A2QW 4EEQA 3KALA 1N32H 4DUZH 2MCTA 3RGZA 3C0FB 3F8NA 4UFZA 4DR6H 2RGRA 4MV7A 4RB2C 1L2ZA 3N42B 4JI3H 4JYAH 5FPOA 4GKJH 2CW7A 4EFBA 4UCUA 2E5LH 1TAEA 2UXCH 3FMAA 4NZRM 4X66H 3RF2A 4OD6A 2VKCA 1FVIA 4DR5H 1M0TA 2O03A 4J0MA 4DR1H 4PDBA 3KXYT 2F4VH 4UCVA 4DR2H 4NXNH 1VS0A 3N40P 4LF9H 4LFBH 2FE3A 3DF7A 1HNXH 4JI4H 2D9IA 1Z2PX 4RZQA 4LF5H 2KSWA 4A2AA 5D1OB 1ZHSA 4LF6H 3RIZA 4IAJA 3KDKA 3JAMW 1P8LA 4OCHA 2FPHX 3T1YH 3EZJA 1IBLH 3GABA 1IBMH 4NXMH 4X64H 3OSSD 2RGVA 4RB3C 3BAAA 4EC5A 4LF7H 4JI6H 4UCSA 3T1HH 1IBKH 4LMYA 4LH6A 1XDNA 2HGSA 1GYFA 3RTXA 1XNRH 5FPRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J5E H;  2UUB H;  4JI5 H;  4B3S H;  4YHH H;  4LF4 H;  4DR7 H;  4KHP H;  1N33 H;  4JI2 H;  1AN7 A;  1HNW H;  4JI0 H;  2UXB H;  4LF8 H;  4AQY H;  1HNZ H;  5FLX W;  4DV1 H;  4JI1 H;  4B3M H;  1I94 H;  4DR3 H;  5BR8 H;  3J7A K;  4X62 H;  4JV5 H;  2HHH H;  2UUA H;  2UXD H;  4GKK H;  1SEI A;  5LL6 b;  3J80 W;  1HR0 H;  4LFA H;  1XMO H;  1FJG H;  4LFC H;  4K0K H;  3OTO H;  1XNQ H;  5IWA H;  4JI8 H;  4YY3 H;  1S03 G;  4DV4 H;  4B3T H;  5LMU H;  4OX9 H;  4DV3 H;  4DV0 H;  4DV7 H;  1N36 H;  1N34 H;  2UUC H;  4DUY H;  2VQE H;  2VQF H;  1XMQ H;  4DV6 H;  1I6U A;  4B3R H;  2UU9 H;  4DR4 H;  1FKA H;  4DV2 H;  5IT9 W;  2ZM6 H;  4DV5 H;  5LMN H;  4X65 H;  3J81 W;  4JI7 H;  5A2Q W;  1N32 H;  4DUZ H;  4DR6 H;  4JI3 H;  4JYA H;  4GKJ H;  2E5L H;  2UXC H;  4X66 H;  3RF2 A;  4DR5 H;  4DR1 H;  4PDB A;  2F4V H;  4DR2 H;  4NXN H;  4LF9 H;  4LFB H;  1HNX H;  4JI4 H;  4LF5 H;  4LF6 H;  3JAM W;  3T1Y H;  1IBL H;  1IBM H;  4NXM H;  4X64 H;  4LF7 H;  4JI6 H;  3T1H H;  1IBK H;  1XNR H; 
#chains in the Genus database with same CATH topology
 2C28 A;  3OSP A;  1S97 A;  5KFC A;  2UUB H;  3HKZ E;  4YQW A;  1EUD B;  4MTE A;  2R8K A;  2R8I A;  1ZTG A;  3V6H A;  2WTF A;  1ZZI A;  5KFU A;  1Y1V G;  1N33 H;  3RAX A;  1N48 A;  5F9L A;  2WYO A;  5DLF A;  2QYZ A;  5KFG A;  2Q2U A;  2QK4 A;  4JI0 H;  1J4W A;  2UXB H;  1IOW A;  3EPG A;  2R7M A;  1Y1W A;  1RYR A;  4DV1 H;  2CPQ A;  2K1H A;  2VUG A;  4QIW E;  5KT5 A;  4QW9 A;  4F50 A;  5IP9 G;  2ZJT A;  3SE7 A;  5KG5 A;  3PR4 A;  2FB9 A;  3T5L A;  3PW7 A;  4FBT A;  2DWC A;  2GPW A;  4ED6 A;  3PO3 G;  4BBS G;  4B8C D;  3GTJ A;  1CQI B;  4M7E A;  1A9X A;  5BR8 H;  3OET A;  3J7A K;  4J9Q A;  3HOY G;  3MWM A;  1ODH A;  3PW0 A;  1JLL B;  2O4C A;  4E9J A;  5LYJ F;  4J9R A;  1M6V A;  3PN1 A;  2C2E A;  1JIH A;  5C8Y F;  1I3Q A;  2VOB A;  2LTM A;  2R6F A;  3Q1K A;  4YJ3 F;  4BY1 G;  1EC6 A;  4MTD A;  2UUA H;  4EBE A;  1JDE A;  3GTM A;  2NU9 B;  4TQR A;  4MV4 A;  4LSA A;  4ECS A;  4ECQ A;  3MFI A;  2JA5 A;  2CQY A;  3LWB A;  4IWX A;  3J80 W;  5KFD A;  2YQR A;  1WTJ A;  1HR0 H;  3LP8 A;  4C5C A;  4LFA H;  1MZB A;  5JVL A;  5DGA A;  1E4F T;  3MR6 A;  1S20 A;  2VUM G;  2UVR A;  2GPS A;  5FD6 A;  4A3D G;  4FM9 A;  3KHR A;  4K0K H;  4BY7 G;  3KAJ A;  2HVR A;  4ED3 A;  1XNQ H;  3NGD A;  2DPI A;  2R92 G;  2FPP B;  1Y14 B;  2FP4 B;  4A2B A;  5BMV F;  3OUZ A;  5EWE A;  4RNO A;  4FS2 A;  4JV2 A;  2IBK A;  4B3T H;  3G8C A;  4QWC A;  4DL6 A;  3TII A;  4JUZ A;  2FMA A;  4ZI7 F;  1F0X A;  2VA2 A;  3VPB A;  2JA7 A;  4DUY H;  1GSA A;  4DV6 H;  5KT4 A;  4J9L A;  4F4Y A;  4A3G G;  3HXL A;  2W9B B;  4UCO A;  4A3B G;  5KT2 A;  2AXY A;  3AEV B;  4DR4 H;  4O3N A;  1S10 A;  2R8G A;  1BGW A;  1B04 A;  1TUA A;  4BBR G;  2DGR A;  1FKA H;  1SYX B;  1TWH A;  4EFE A;  2AQ4 A;  1S9F A;  4DV5 H;  2ZQE A;  3KHL A;  4A3L G;  2W9A A;  2LRR A;  2FK2 A;  1X4M A;  2R85 A;  3N43 B;  4RNM A;  4X65 H;  4Q0Y A;  2HVQ A;  1K1Q A;  1A0I A;  2R82 A;  4ED1 A;  4JI7 H;  5KFL A;  4EEQ A;  1KEE A;  4GC7 A;  4FBU A;  4Q8F A;  4QW8 A;  3EPI A;  4ECZ A;  1GSH A;  5KFP A;  4DR6 H;  3U9T A;  4RB2 C;  4G3I A;  3N42 B;  4JVH A;  5FPO A;  2YRW A;  2JZX A;  4UCU A;  4A3M G;  2CTJ A;  2FPG B;  1CQJ B;  2W9B A;  4X66 H;  4XZ3 B;  3RF2 A;  2YW2 A;  2VKC A;  4J0M A;  1B33 N;  1GLV A;  5CB4 F;  3T5K A;  3RAQ A;  2F4V H;  3V6K A;  4NXN H;  4UCR A;  3MR2 A;  2R93 G;  2FE3 A;  3GTP A;  4EGQ A;  4WBN F;  1I7N A;  1ZHS A;  3JRX A;  4IAJ A;  3KDK A;  4QJF A;  5J2U F;  4JVY A;  3T1Y H;  2PY9 A;  4IRK A;  4IZO A;  2JA9 A;  1Y1W G;  2W71 A;  3K3P A;  4ZQI A;  5BPH A;  2XGP A;  4MA0 A;  4RB3 C;  3R5F A;  4O4L F;  2DPJ A;  2AGP A;  5FJ8 G;  2JEA I;  3GV8 B;  3L7Z C;  3V69 A;  2HGS A;  2R7Z G;  1XNR H;  3U1K A;  5FPR A;  2AGO A;  5DLG A;  5C44 G;  2ASD A;  5K2M A;  4A3K G;  2W9C A;  5IYC G;  5KG3 A;  3H0G A;  4CC6 A;  4LF4 H;  2Q2T A;  4O3P A;  3GIL A;  4QWA A;  5T14 A;  3MWE A;  1PX2 A;  2WDT A;  1AN7 A;  2W6M A;  3GID A;  2M8W A;  1DGS A;  1KBL A;  3GV7 B;  4ECU A;  2J6U A;  5FLX W;  2HH2 A;  2W7P A;  4J9K A;  4DL7 A;  4CC5 A;  4GC6 A;  3GTG A;  3Q8S B;  2C2R A;  2XCA A;  1I94 H;  2W57 A;  5DQI A;  2NN6 G;  2LF0 A;  1V4Y A;  4I55 F;  5KFX A;  3HBL A;  3TIN A;  4Q43 A;  2R87 A;  2NVY A;  5KFA A;  2W8L A;  2W9C B;  1ZZK A;  4X62 H;  3RFC A;  5C1P A;  5DT9 A;  3N41 B;  5K36 G;  2HH3 A;  2HVS A;  4IRC A;  2X0S A;  3KAK A;  4YP3 A;  5DG8 A;  3IN5 A;  3RB4 A;  1NXU A;  2HHH H;  2R84 A;  4AM3 A;  2FK3 A;  4DL5 A;  4BXX G;  4A3E G;  1EHI A;  4O3R A;  1JDB B;  2UXD H;  3U9S A;  4ECR A;  3WO0 A;  2NVX A;  3K3V A;  2AU0 A;  2XD4 A;  3BAB A;  4LSX A;  1X9N A;  3KDG A;  3OHA A;  2E3U A;  3JRW A;  3Q8Q B;  2FLN A;  3V6J A;  1E4G T;  1R9T A;  1Y1V A;  2WAQ E;  5DQH A;  5H80 A;  3VKE A;  2UVV A;  1OWT A;  5LXT F;  4F4Z A;  3LML A;  3L4J A;  2W6Q A;  2UVU A;  3FKI G;  2R93 A;  3OTO H;  2ATL A;  2R8J A;  4HNT A;  3UQ8 A;  2VA3 A;  1S03 G;  1DTJ A;  2DZD A;  2XIG A;  3RV4 A;  2JA8 G;  4DV4 H;  3JZI A;  3UOE A;  4BA2 I;  3NCV A;  2B63 G;  1I50 A;  2JA7 G;  1N34 H;  3K5I A;  3RB3 A;  2VQE H;  1XMQ H;  4EGJ A;  5KFZ A;  1GSO A;  2ANR A;  4R8U A;  1KJ9 A;  4LIJ A;  1Z2N X;  3L2P A;  4WAL A;  1B6R A;  1S68 A;  2PBZ A;  5IYD G;  2UU9 H;  4O2A F;  4BWS C;  4I7H A;  2JEB I;  2WB1 E;  5KFO A;  5EWF A;  4GLX A;  4ED7 A;  2AGQ A;  2DLN A;  2JEJ A;  1WR2 A;  2OH2 A;  1WH2 A;  5IT9 W;  2ZM6 H;  3ORR A;  4O4H F;  5D1O A;  3QZ8 A;  2VUM A;  2W70 A;  2Y0S A;  4ECX A;  1KHM A;  5JH7 F;  3T5J A;  3VPC A;  5EDW A;  4YR2 A;  4XYL B;  3KAL A;  2OPU A;  1TWA A;  1ZQ7 A;  3RGZ A;  1UC9 A;  3C0F B;  5C1O A;  2E2I A;  5KT3 A;  5L9X A;  2Y0S E;  4GKJ H;  2CW7 A;  5KFV A;  1DV2 A;  4EFB A;  4R8U B;  4Q8E A;  1TAE A;  3FMA A;  2C2D A;  3V4S A;  4NZR M;  5L1K A;  4DL2 A;  4DR5 H;  1T36 A;  2R8H A;  4PDB A;  4UCV A;  2FK1 A;  3VMM A;  2C00 A;  1VS0 A;  3RUP A;  3N40 P;  4LF9 H;  4LFB H;  1CE8 A;  4QWB A;  4AYB E;  4JI4 H;  2D9I A;  4RZQ A;  3GTO A;  4LF5 H;  2PQU A;  2KSW A;  5D1O B;  5GON F;  3V4Z A;  5DGB A;  3GTK A;  4LF6 H;  5KFT A;  1P8L A;  3HB9 A;  1X4N A;  3OHB A;  2FPH X;  4XX0 B;  3GIK A;  2BQ3 A;  3GAB A;  2E2H A;  1IBM H;  3MWD A;  4X64 H;  2RGV A;  3BQ0 A;  3MR5 A;  2B63 A;  1EUC B;  5KFE A;  3GIP A;  4FU0 A;  4RUC A;  2ASJ A;  4O3Q A;  1IBK H;  4LMY A;  5CA0 F;  3K5H A;  1V9N A;  1GYF A;  4IHJ F;  2I8C A;  1W96 A;  1T94 A;  1J5E H;  1PK8 A;  3N6X A;  3PVX A;  5KG0 A;  2IMW P;  1PQX A;  3N8D A;  4Y8V B;  4I50 F;  2JE6 I;  2V9W A;  2P0A A;  2CTF A;  4HNV A;  3HOV G;  2ANN A;  3GLK A;  4MA5 A;  4KHP H;  2V5A A;  4MV8 A;  5JQW A;  3H20 A;  3FDS A;  5KFM A;  4ECV A;  1JX4 A;  3HKZ A;  2VR1 A;  2JEF A;  3IG0 A;  1HNW H;  1S0M A;  1RYS A;  4MAM A;  4AQY H;  5IP7 G;  3I0P A;  3JSN A;  4B3M H;  1RK5 A;  3R23 A;  1BNC A;  5I47 A;  1BXR A;  2YS7 A;  3FKI A;  5KX5 F;  2JEI A;  1VIH A;  4B8T A;  3SB1 A;  2NU7 B;  4MV9 A;  4U6P A;  1Z2O X;  2BR0 A;  4JV1 A;  2XCL A;  4HQ6 A;  4FJS A;  2M05 A;  4YAJ B;  2IP4 A;  4JV0 A;  3WO1 A;  2R7Z A;  1GGO A;  2FMR A;  2YCH A;  1V9P A;  4EG0 A;  5BPF A;  5JVD F;  3I4N G;  4JV5 H;  4RUA A;  5C5J A;  2R86 A;  4ECY A;  2VPQ A;  3N44 B;  2CWH A;  2OPV A;  3JSL A;  2W8K A;  5L1L A;  4AIM A;  4QWD A;  4L1K A;  3HOZ G;  2ZDG A;  5IYB G;  3PW4 A;  4GKK H;  4BA1 I;  3H4B A;  1VBI A;  2OLS A;  1K1S A;  4EEY A;  2C22 A;  4IR9 A;  3GKU A;  2CPM A;  1M7J A;  2I80 A;  3MJF A;  4TUY F;  4AYB A;  2ZDH A;  4E4T A;  5EOY A;  4MV6 A;  2RDI A;  3GTL A;  4DL3 A;  1VIG A;  1XMO H;  5KG7 A;  1FJG H;  5KT6 A;  4QWE A;  5DG7 A;  3RB6 A;  4WAN A;  3PW5 A;  1ZZJ A;  5KG6 A;  2CW8 A;  2SCU B;  5KFW A;  3R5X A;  2W6O A;  2W6Z A;  1TA8 A;  2WE6 A;  5FD5 A;  4J9O A;  3ETJ A;  4OX9 H;  3RV3 A;  1JKJ B;  5CAE B;  4DV3 H;  2J9G A;  3BA8 A;  4DV7 H;  1N36 H;  1KJI A;  4MV1 A;  2NU8 B;  4HYK A;  5C0X G;  4IFD G;  2UUC H;  1B6S A;  1EYZ A;  2C35 B;  2OWO A;  3QFF A;  4B3R H;  1UNN C;  3H0G G;  2MJH A;  3RBE A;  2CTE A;  2PN1 A;  4QMF B;  4H8A A;  4M9U A;  5KG4 A;  5LOV F;  4RB1 A;  2V4R A;  4R7R A;  1Z2I A;  3KHG A;  1UG8 A;  2W6N A;  1VAJ A;  4ETS A;  4NZT M;  4DV2 H;  1VKZ A;  4RAY A;  4Q44 A;  2W7O A;  2R7K A;  5KFB A;  2V58 A;  3G6Y A;  3GTQ A;  2JA6 A;  5LMN H;  1BJT A;  3SI8 A;  3BQ1 A;  3J81 W;  4O4I F;  4ECW A;  3BA9 A;  4F4X A;  5A2Q W;  5DG9 A;  1V8C A;  2I87 A;  1AUX A;  2MCT A;  2RGR A;  3F8N A;  4UFZ A;  4MV7 A;  5C3E G;  4NLG A;  4JI3 H;  4JYA H;  2R92 A;  2YU9 A;  4YJ2 F;  1S0N A;  2FLP A;  2M6Q A;  1FVI A;  4OD6 A;  2O03 A;  5EWG A;  3UFX B;  2RF4 A;  4DR1 H;  3GQC A;  2X06 A;  3GV5 B;  2DIK A;  3RBD A;  2ALZ A;  2V4Q A;  2FFM A;  4O3S A;  4RU9 A;  3MFH A;  1HNX H;  4YAK B;  4A3F G;  2ASL A;  4ZOL F;  4J9S A;  4A3C G;  4FS1 A;  3R5H A;  3H4D A;  4J9P A;  3JAM W;  1TWC A;  1WSC A;  4OCH A;  3T5H A;  2BQU A;  3M9O B;  5KFK A;  2UVW A;  3GIM A;  4YR0 A;  3BAA A;  3RB0 A;  5HV6 A;  4EC5 A;  4LF7 H;  4A3I G;  4JI6 H;  2GLT A;  4UCS A;  4IR1 A;  2YS6 A;  5KFH A;  3CQZ A;  4ME6 A;  4DL4 A;  3HOU G;  2R7N A;  2IA6 A;  3Q2O A;  2JA6 G;  3CVZ A;  3I4M G;  3HOX G;  4JI5 H;  3QZ7 A;  2J6T A;  1GO3 E;  3G6V A;  1AUV A;  4U7C A;  5D8D A;  3GIQ A;  1ULZ A;  3M9N B;  4QIW A;  4EYH B;  1N56 A;  5KG1 A;  2YZM A;  4A93 G;  4B3S H;  4YHH H;  1WE8 A;  4DR7 H;  1RJQ A;  3M4I A;  4HNU A;  3OSN A;  4LH7 A;  1I7L A;  2XC9 A;  3I12 A;  2WB1 A;  4ED8 A;  4JI2 H;  2JA5 G;  5KFY A;  1RK6 A;  5CA1 F;  4LF8 H;  1HNZ H;  2FPI B;  3L4K A;  4JI1 H;  4ECT A;  1W93 A;  5C4X G;  1CS0 A;  4UCT A;  1ZHQ A;  2W6P A;  2PMZ E;  2RDJ A;  3QD7 X;  3OUU A;  2CTK A;  4IWY A;  2VPS A;  4DLK A;  4RNN A;  3PW2 A;  2YL2 A;  4TQS A;  4DR3 H;  2YYA A;  4G08 A;  4TV9 F;  2Z0S A;  1KJQ A;  4PWQ A;  2PMZ A;  4YB8 B;  2CZG A;  4MV3 A;  4ZHQ F;  1VBG A;  3MR3 A;  1IOV A;  1E4E A;  1MSZ A;  3RJ0 A;  2NU6 B;  4ED0 A;  4RAZ A;  3Q8P B;  2YRX A;  3ETH A;  5KG2 A;  1SEI A;  3FAU A;  1DV1 A;  2LTL A;  5LL6 b;  4YBZ B;  3TIG A;  3VPD A;  1EZ1 A;  5LP6 F;  5EZY F;  1WVN A;  4O2B F;  1KC7 A;  4HR7 A;  5KFI A;  2JVZ A;  2FLL A;  2CWF A;  1RJP A;  5KFJ A;  3H40 A;  4APM A;  5KFN A;  1TWF A;  4J9N A;  2BA0 A;  2XCP A;  2FKL A;  3E5N A;  2BQR A;  4XYM B;  4IRD A;  3WNZ A;  2FJZ A;  4C5B A;  4F4W A;  4LFC H;  1ZET A;  4A3J G;  1J5K A;  2Y3M A;  3GR5 A;  2HJW A;  2CTM A;  2G8Y A;  1E4E B;  5IWA H;  4JI8 H;  3EYY A;  2PT7 G;  5HBR B;  4C2M A;  4I4T F;  5KT7 A;  4YY3 H;  3KHH A;  3BJY A;  4EBD A;  4Q45 A;  2VQD A;  2WAQ A;  5LMU H;  5FLM G;  1C3O A;  5D1P A;  1DT4 A;  2P2R A;  4DV0 H;  4RZR A;  3ORQ A;  1X9Z A;  3BQ2 A;  2YZN A;  1K1G A;  1O75 A;  2VQF H;  3RTX A;  1SFO A;  1V51 A;  1I6U A;  4WD3 A;  3RGX A;  4RB0 A;  2JEG A;  3M9M B;  4NBQ A;  2PVP A;  1K83 A;  1M0W A;  3PZP A;  1JXL A;  2QND A;  3PR5 B;  5L1J A;  4ED2 A;  1UC8 A;  2CTL A;  3G6X A;  5IYZ F;  1TWG A;  2BL5 A;  5J2T F;  4O3O A;  2A1S A;  1DIK A;  1N32 H;  2ZDQ A;  4DUZ H;  3BG5 A;  5KFF A;  3TQ1 A;  1L2Z A;  4OO1 G;  5KFQ A;  3Q8R B;  5LA6 F;  3H3V H;  2E5L H;  1RJR A;  2UXC H;  1WCM A;  5JEA G;  1M0T A;  5KFR A;  2NUA B;  3TQT A;  2YZG A;  3KXY T;  4FJU A;  4DR2 H;  1WHR A;  5KFS A;  1XRH A;  3DF7 A;  4TV8 F;  4A2A A;  1Z2P X;  1SCU B;  3GIJ A;  4J9M A;  1T3N A;  2XGQ A;  1C30 A;  4YR3 A;  2R7L A;  3RIZ A;  4EYI B;  1S0O A;  3HOW G;  1KJ8 A;  1WCM G;  3EZJ A;  1IBL H;  1X0A A;  3GII A;  4C5A A;  3PO2 G;  4NXM H;  2V59 A;  3OSS D;  3KTM A;  1VBH A;  5KKN B;  2J6S A;  5DQG A;  3T1H H;  2CKZ B;  1XDN A;  4LH6 A;  5JUM A;  5L1I A;  4EBC A;  3AYH B;  5F9N A;  1KJJ A; 
#chains in the Genus database with same CATH homology
 3CVZ A;  1J5E H;  2UUB H;  4JI5 H;  3N6X A;  4MTE A;  4CC6 A;  4B3S H;  4YHH H;  4LF4 H;  4DR7 H;  3M4I A;  4UCR A;  2Q2T A;  4KHP H;  1N33 H;  4LH7 A;  3H20 A;  2WYO A;  2WDT A;  3IG0 A;  1AN7 A;  4JI2 H;  1HNW H;  4JI0 H;  2UXB H;  2Q2U A;  4LF8 H;  4AQY H;  1HNZ H;  1DGS A;  3L4K A;  5FLX W;  3JSN A;  4DV1 H;  4JI1 H;  4B3M H;  2VUG A;  4CC5 A;  4UCT A;  2ZJT A;  1ZHQ A;  1I94 H;  2W57 A;  3QD7 X;  4B8C D;  2VPS A;  2LF0 A;  3SB1 A;  4MV9 A;  1Z2O X;  4DR3 H;  4M7E A;  4G08 A;  5BR8 H;  3OET A;  3J7A K;  4X62 H;  3MWM A;  5DT9 A;  2YCH A;  3N41 B;  1V9P A;  1ODH A;  3KAK A;  4JV5 H;  2O4C A;  4E9J A;  3N44 B;  3JSL A;  3PN1 A;  2HHH H;  3RJ0 A;  2VOB A;  4RAZ A;  4MTD A;  2UUA H;  2UXD H;  4GKK H;  1SEI A;  3FAU A;  5LL6 b;  3K3V A;  4LSA A;  3BAB A;  4LSX A;  1X9N A;  3KDG A;  3J80 W;  1HR0 H;  5EOY A;  4LFA H;  1MZB A;  4APM A;  1E4G T;  1E4F T;  1XMO H;  1FJG H;  5FD6 A;  4LFC H;  4K0K H;  3LML A;  3L4J A;  3KAJ A;  2HVR A;  4FM9 A;  2Y3M A;  3GR5 A;  3OTO H;  1XNQ H;  3EYY A;  2HVS A;  5IWA H;  4JI8 H;  2CW8 A;  2PT7 G;  4A2B A;  3UQ8 A;  4YY3 H;  1S03 G;  1TA8 A;  2WE6 A;  2XIG A;  5FD5 A;  4DV4 H;  4B3T H;  5LMU H;  4OX9 H;  5D1P A;  4DV3 H;  4DV0 H;  3BA8 A;  4DV7 H;  1N36 H;  3NCV A;  1F0X A;  1X9Z A;  1N34 H;  2UUC H;  1O75 A;  4DUY H;  2VQE H;  2VQF H;  1XMQ H;  4DV6 H;  3L2P A;  1I6U A;  4B3R H;  1Z2N X;  2OWO A;  3HXL A;  3RGX A;  1S68 A;  4UCO A;  4RB0 A;  2UU9 H;  4DR4 H;  4I7H A;  4BWS C;  4GLX A;  1BGW A;  1B04 A;  1M0W A;  4RB1 A;  4R7R A;  1FKA H;  1SYX B;  1WH2 A;  4EFE A;  4ETS A;  4NZT M;  4DV2 H;  5IT9 W;  2ZM6 H;  2ZQE A;  4DV5 H;  4RAY A;  3N43 B;  5D1O A;  5LMN H;  4X65 H;  1BJT A;  4Q0Y A;  3J81 W;  2HVQ A;  1A0I A;  3BA9 A;  4JI7 H;  5A2Q W;  4EEQ A;  3KAL A;  1N32 H;  4DUZ H;  2MCT A;  3RGZ A;  3C0F B;  3F8N A;  4UFZ A;  4DR6 H;  2RGR A;  4MV7 A;  4RB2 C;  1L2Z A;  3N42 B;  4JI3 H;  4JYA H;  5FPO A;  4GKJ H;  2CW7 A;  4EFB A;  4UCU A;  2E5L H;  1TAE A;  2UXC H;  3FMA A;  4NZR M;  4X66 H;  3RF2 A;  4OD6 A;  2VKC A;  1FVI A;  4DR5 H;  1M0T A;  2O03 A;  4J0M A;  4DR1 H;  4PDB A;  3KXY T;  2F4V H;  4UCV A;  4DR2 H;  4NXN H;  1VS0 A;  3N40 P;  4LF9 H;  4LFB H;  2FE3 A;  3DF7 A;  1HNX H;  4JI4 H;  2D9I A;  1Z2P X;  4RZQ A;  4LF5 H;  2KSW A;  4A2A A;  5D1O B;  1ZHS A;  4LF6 H;  3RIZ A;  4IAJ A;  3KDK A;  3JAM W;  1P8L A;  4OCH A;  2FPH X;  3T1Y H;  3EZJ A;  1IBL H;  3GAB A;  1IBM H;  4NXM H;  4X64 H;  3OSS D;  2RGV A;  4RB3 C;  3BAA A;  4EC5 A;  4LF7 H;  4JI6 H;  4UCS A;  3T1H H;  1IBK H;  4LMY A;  4LH6 A;  1XDN A;  2HGS A;  1GYF A;  3RTX A;  1XNR H;  5FPR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...