3JAMW

Cryoem structure of 40s-eif1a-eif1 complex from yeast
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
129
structure length
129
Chain Sequence
TRTSVLADALNAINNAEKTGKRQVLIRPSSKVIIKFLQVMQKHGYIGEFEYIDDHRSGKIVVQLNGRLNKCGVISPRFNVKIADVEKWTANLLPARQFGYVILTTSAGIMDHEEAHRKHVSGKILGFVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 18S rRNA
publication title Conformational Differences between Open and Closed States of the Eukaryotic Translation Initiation Complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Translation
total genus 29
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
W PF00410 Ribosomal_S8 Ribosomal protein S8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.30 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 3jamW01
3.30.1490.10 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3jamW02
4X66H 4LF8H 1I94H 1S03G 5LMNH 4JI6H 2UUBH 4DV0H 4LF6H 5A2QW 4JI2H 4DR7H 2HHHH 4DV2H 1IBMH 4AQYH 1FKAH 3JAMW 1N32H 4JI3H 1XNRH 4DV6H 2VQEH 4X64H 4DUYH 4NXNH 4K0KH 4B3RH 1AN7A 4DV1H 1HNXH 4DV7H 2UU9H 4X62H 5LMUH 2ZM6H 4JI4H 3J81W 3RF2A 3OTOH 1IBKH 4DUZH 4DR2H 4DR1H 1SEIA 1J5EH 1I6UA 4JI0H 2E5LH 4KHPH 3J80W 4B3SH 5BR8H 4LF4H 1HNZH 4B3MH 2UXBH 4LFBH 2F4VH 4YY3H 4JI7H 4JV5H 1N33H 1N34H 4X65H 4YHHH 4LF5H 4GKJH 3T1HH 1XMOH 4JI8H 3J7AK 4LFAH 2UXCH 2UUCH 4B3TH 4GKKH 1XMQH 1IBLH 4OX9H 2UXDH 4PDBA 1HR0H 4DR5H 5LL6b 4NXMH 2UUAH 4LF7H 4LFCH 2VQFH 1N36H 5IT9W 3T1YH 1XNQH 4DV5H 4LF9H 5FLXW 4DR6H 4JI1H 4JYAH 4DR3H 4JI5H 5IWAH 1HNWH 4DV3H 4DV4H 1FJGH 4DR4H
chains in the Genus database with same CATH superfamily
5DG9A 3MJFA 2B63A 4MV9A 3EZJA 4F50A 4YP3A 5BPHA 1I94H 4RUCA 3RV3A 1UNNC 2IA6A 4ZQIA 2VUMA 4EEQA 2WDTA 4B8TA 1RYRA 4YAJB 4IZOA 2YW2A 2J6TA 3H20A 2IMWP 4DV0H 4LF6H 4LH7A 3PW2A 4JI2H 4DR7H 1VIHA 1TA8A 3HKZE 3TIIA 1K83A 4JV2A 5FPRA 5FPOA 4A3LG 5KG0A 4RU9A 2PY9A 2Q2UA 1FKAH 4WBNF 5CA1F 5JUMA 1N32H 2A1SA 1WCMG 2YQRA 3RIZA 2RF4A 1Y1WA 5IP7G 3V6JA 5K2MA 2JEAI 4DV6H 2NN6G 2JZXA 3EPGA 4K0KH 1GSOA 2X0SA 3RFCA 3FKIA 1WR2A 2Y0SE 4O2BF 1HNXH 5LYJF 2UU9H 5KFSA 5FD6A 1ZZIA 1TWHA 5KT5A 3RF2A 4MA5A 1ZHSA 4BA2I 3GTLA 1S68A 1SYXB 1TAEA 2FKLA 4EBDA 4C5AA 1EHIA 4L1KA 4BWSC 1Y14B 4MV8A 4XYMB 4EGJA 5KX5F 4IRDA 1SCUB 4EFEA 3KHLA 3GTPA 4DR1H 4R7RA 2IBKA 3G6VA 5LOVF 2E5LH 1TWCA 2GPWA 5J2UF 4QW9A 4DL4A 4KHPH 1ULZA 5J2TF 4UCVA 5KT2A 4ECYA 1I50A 1VAJA 5H80A 2FLLA 3M9NB 4AYBE 3BG5A 5L1IA 2VPQA 4LF4H 3F8NA 3MWDA 4Q44A 5L1KA 4B3MH 2UXBH 3I0PA 3PO2G 1RJQA 1B6RA 4UCSA 5D1PA 4ED3A 1X9NA 2WTFA 2E2HA 1CQIB 2F4VH 3T5JA 3BA8A 1X4MA 4JI7H 3G8CA 3JSLA 4I50F 4RNNA 3H3VH 1V9NA 2UVWA 2OPUA 4X65H 3G6YA 2PN1A 4ME6A 1E4EA 5KFYA 5IYCG 5JVLA 4Q45A 4J9LA 3V6KA 5DGAA 3ETJA 2W8KA 2UVUA 3FDSA 3TQTA 3T1HH 3VKEA 1L2ZA 4OO1G 1BGWA 1V51A 2CW7A 4JUZA 5LXTF 2PQUA 2V59A 3G6XA 1KBLA 4RZQA 4ED7A 2K1HA 1JX4A 5EDWA 4C2MA 4FBUA 4IR1A 2CWFA 4UCOA 3HB9A 4YR3A 4DR5H 5LL6b 3MR6A 1JLLB 2R7NA 4EYHB 2UVVA 2JEFA 2FLPA 4IRCA 2NU8B 3T5LA 2UUAH 2XCPA 4A3DG 3U9TA 1I7NA 3RBDA 2R7KA 4J9NA 4MTEA 1JDEA 2FE3A 3N42B 1S97A 2VQFH 4BBRG 1V8CA 3T1YH 4FU0A 4DV5H 1C3OA 2R84A 2JA7A 3R5XA 2YCHA 1ZZKA 3RV4A 2P2RA 5KFJA 4J9PA 3I4NG 2SCUB 3Q1KA 5KFDA 2GLTA 1V4YA 4DR3H 2DIKA 2R92A 1XDNA 4RAZA 1C30A 2Y0SA 5KG1A 5KFZA 1DV1A 4J9RA 4DV3H 3U1KA 4TQRA 4HYKA 1FJGH 1K1QA 2HVQA 1N56A 4NLGA 1Y1VA 4WANA 5D1OA 1O75A 2WYOA 2W70A 2JA6G 2W9BB 1Z2IA 1BJTA 3ORRA 3TIGA 3KHGA 3ORQA 1S03G 1M0WA 5LMNH 2OH2A 4LIJA 5JH7F 3RAQA 2J9GA 2W6QA 2B63G 2YRWA 2JA5A 3R5HA 5T14A 4ED8A 5C44G 2HVRA 5LA6F 2NU6B 3MR5A 2ZQEA 1KJ9A 2VUMG 3I12A 1VBIA 4LH6A 3GLKA 2ASDA 5LP6F 2V58A 2MCTA 3VPBA 5JVDF 3JAMW 5HBRB 4AYBA 4MV7A 3HOVG 3BJYA 4RB1A 1XNRH 5C5JA 4WALA 3ETHA 3V6HA 1TWGA 5KFFA 2HH3A 3HOZG 4DUYH 4LSAA 1X4NA 3PN1A 1ODHA 4B3RH 4O3SA 5C1OA 5IYDG 3EYYA 2CWHA 2Y3MA 5IYBG 5LMUH 4A3GG 4JI4H 2FMAA 1ZETA 3PO3G 3FKIG 4FS2A 2Q2TA 3GTOA 4YJ2F 4EYIB 2VA3A 1I7LA 1RK5A 4A2AA 4DL3A 4BY7G 3LMLA 4E9JA 3UFXB 3H0GG 4HNUA 2R93G 3VPCA 3WO1A 2CQYA 4QW8A 4JI0H 5C3EG 2R8IA 2AU0A 1BNCA 4FJSA 5DLGA 1ZTGA 2BQRA 1UC9A 4C5BA 2JE6I 5KFKA 4BXXG 1UC8A 4A3IG 2CTKA 2QYZA 1HNZH 4NZRM 3RJ0A 3IN5A 2JEJA 2I87A 3BABA 2XIGA 4YY3H 1VIGA 3KALA 4ZI7F 5KFTA 5KFNA 1N33H 2RDIA 1XRHA 3K5IA 3H40A 1S0MA 3RB6A 3GKUA 5DG8A 3QZ7A 4AM3A 5JQWA 4EG0A 2NVYA 2E3UA 4YHHH 4LF5H 4GKJH 1T94A 3HOXG 2WAQE 5BMVF 4UCTA 5CA0F 1IOWA 2CKZB 3HOUG 4LFAH 2YZNA 3JZIA 5KFVA 4F4YA 4EC5A 3JRXA 3DF7A 3K5HA 3OSSD 4GKKH 2JEGA 2FMRA 3L4KA 1KJJA 2XC9A 4JVHA 2XCLA 2W9CB 2CPMA 1IBLH 1Z2NX 4O4IF 5KT3A 2M6QA 4QWEA 1S0NA 5KFOA 4PDBA 4ECWA 2C2RA 1WSCA 4NXMH 2PVPA 5KFHA 2VA2A 2E2IA 4RZRA 1VS0A 1B04A 4ECVA 2DPIA 4LF7H 4DL6A 1MZBA 2R8JA 3GQCA 3QZ8A 3T5HA 4YB8B 1M7JA 3KHHA 2NVXA 3LWBA 3RTXA 4A93G 1TUAA 2CTJA 1N36H 4ECZA 2C22A 2VOBA 4G3IA 5F9NA 4DLKA 3K3PA 5EOYA 2R7ZA 4LF9H 1EZ1A 2PBZA 1SFOA 2JA8G 5KFEA 3BAAA 5KG2A 4IFDG 4EFBA 2JVZA 1W96A 5KKNB 3GIKA 2W9AA 4O4LF 1MSZA 5KG7A 2C28A 4XYLB 3PW5A 2HJWA 5IWAH 3FMAA 2WB1E 5KFWA 4JV0A 1CE8A 4A3CG 1HNWH 3KDKA 5DLFA 2X06A 3GTKA 2FJZA 4DR4H 3Q8SB 4FBTA 4M9UA 4X66H 1JIHA 2R7LA 3C0FB 4A3MG 5KFXA 2R87A 2QK4A 4R8UA 3M4IA 1J4WA 4BY1G 2W6OA 4QWAA 4JI6H 3OUUA 1BXRA 3KAJA 1Y1VG 2UUBH 3KTMA 4YR0A 2RGRA 2V5AA 5C4XG 1EC6A 2V4QA 2CPQA 4J0MA 2ZDGA 4IAJA 5FLMG 5DQHA 1IBMH 5KT7A 3PR5B 4ECTA 1GGOA 4M7EA 4RB2C 1KHMA 2CTEA 3SB1A 5KT4A 3GILA 2R8KA 3GTQA 4JI3H 4IR9A 2ZDHA 4OD6A 4XX0B 4JVYA 5KFAA 5HV6A 2BQUA 4QMFB 2UVRA 2XD4A 4MV1A 5EWEA 5D8DA 2DWCA 3PZPA 4X64H 2V4RA 4O3NA 1JDBB 2ANRA 2C2EA 2FK1A 3Q2OA 2I80A 2YS6A 3WNZA 2W9BA 2ALZA 2QNDA 1DT4A 1WVNA 5BPFA 4J9MA 4FM9A 1PQXA 2CZGA 3E5NA 2W57A 3LP8A 3UQ8A 3MFHA 4QIWE 3RB0A 1S9FA 4FJUA 2FK2A 3J81W 2WAQA 2YYAA 3OTOH 4A3FG 2R8GA 1A0IA 3IG0A 3I4MG 2M8WA 3AYHB 3VMMA 5EWFA 2YZMA 4ECUA 1VKZA 1JKJB 2MJHA 4RB0A 3Q8RB 1E4FT 3OUZA 2VPSA 1R9TA 1J5EH 2NUAB 3KDGA 4RNMA 2HVSA 4BBSG 1K1GA 2IP4A 4B8CD 2FPIB 2LTMA 2R7MA 4HNVA 3J80W 5K36G 5KFPA 3KAKA 2W7PA 1GO3E 4YBZB 2DLNA 3MR3A 2W6MA 3RGXA 3RB3A 2ASJA 4B3SH 4Q0YA 3V4ZA 1KJQA 4NZTM 4MV3A 1S0OA 5GONF 3HOWG 3NCVA 1PK8A 3Q8QB 1Y1WG 2VQDA 2ZDQA 3U9SA 2M05A 3N6XA 4YAKB 1N34H 2GPSA 4F4WA 3TINA 4MTDA 4O3QA 5KG6A 3OSNA 2VKCA 1T3NA 2WE6A 4I7HA 3MFIA 3MR2A 3H4DA 4AIMA 2XGPA 2DGRA 4UFZA 3J7AK 3GTMA 5KFCA 5CAEB 2WB1A 3BQ1A 4OCHA 3N41B 2O4CA 4ECRA 1XMQH 2AXYA 4TV9F 4DL7A 4OX9H 1PX2A 2HH2A 1RJPA 4QWBA 3GTJA 2UXDH 1W93A 2OWOA 2W71A 2W6NA 4IWXA 4LMYA 5KFIA 4TQSA 3N44B 2LF0A 5IP9G 2BL5A 2FB9A 5KFMA 4J9QA 3Q8PB 3H4BA 3GIDA 1N48A 3OHAA 2R8HA 4Q8FA 1RJRA 4J9OA 5IT9W 1RYSA 2R82A 1VBHA 2AGPA 3OSPA 3QFFA 5DQIA 3RAXA 3BQ2A 4EGQA 1RK6A 2YS7A 2R6FA 1DTJA 2W9CA 5KFUA 3JSNA 2PMZE 4JYAH 5CB4F 3V4SA 2AGQA 2R7ZG 4MAMA 1IOVA 4JI5H 1Z2OX 1V9PA 1AUXA 3K3VA 5KFBA 4F4XA 4ED2A 4DL5A 1JXLA 2W7OA 4QWCA 4C5CA 5KFQA 3L4JA 5C8YF 4F4ZA 4DV4H 4QIWA 1I3QA 3GV5B 3RGZA 1TWAA 1F0XA 2CTFA 5FD5A 4LF8H 2FPPB 4EBCA 3GV7B 2R85A 3MWEA 4O3OA 4I55F 3H0GA 3GV8B 1M0TA 4EBEA 1GLVA 2R93A 4MA0A 2FFMA 3GIJA 4A3EG 4Q43A 4Q8EA 1DIKA 1T36A 2C00A 2R86A 5A2QW 1A9XA 4ECSA 3TQ1A 4QJFA 1WCMA 4FS1A 5L9XA 2HHHH 4DV2H 3GIIA 1X9ZA 2ZJTA 1TWFA 1X0AA 5C1PA 3V69A 4AQYH 4EEYA 4RAYA 2HGSA 5IYZF 2YRXA 4ECQA 2FP4B 1UG8A 2JA7G 4TV8F 2P0AA 5DT9A 3T5KA 2JA9A 2VQEH 4O3PA 3OETA 1AUVA 4J9KA 4NXNH 5EZYF 3WO0A 2W6ZA 2FLNA 2R92G 1AN7A 4DV1H 3R23A 4ZHQF 2VUGA 4DV7H 2LRRA 2XGQA 5L1LA 3UOEA 4YR2A 4X62H 4WD3A 4JV1A 2ZM6H 1Z2PX 3GTGA 5EWGA 2D9IA 3L7ZC 3R5FA 3HXLA 4APMA 3PVXA 3PW4A 2RGVA 4HQ6A 3SI8A 2J6UA 2NU9B 2W6PA 2JEBI 1IBKH 1KJIA 2O03A 4DUZH 3N43B 3VPDA 4YQWA 2XCAA 2W8LA 3BQ0A 3JRWA 2C2DA 4O3RA 1E4EB 3BA9A 4DR2H 1VBGA 4IWYA 5KFLA 2ATLA 1SEIA 4A3KG 2YZGA 5KT6A 2AGOA 2LTLA 1I6UA 4HNTA 3GIQA 1ZQ7A 2YL2A 4NBQA 2DZDA 2JA5G 3HOYG 1DGSA 5DQGA 1P8LA 2OPVA 3PR4A 2V9WA 2KSWA 4ED6A 3QD7X 5KG4A 5BR8H 1GSHA 2CW8A 1EUDB 1S10A 1E4GT 1EUCB 3N40P 4ECXA 5DGBA 2J6SA 4ZOLF 4LFBH 5F9LA 2Z0SA 1WE8A 4QWDA 4JV5H 3HKZA 4RB3C 4CC6A 2I8CA 3GABA 4H8AA 2ASLA 1DV2A 3CQZA 4R8UB 4TUYF 2ANNA 2PMZA 4UCRA 2RDJA 2JEIA 1XMOH 4JI8H 3L2PA 5KFRA 2UXCH 5DG7A 1GYFA 1M6VA 2UUCH 4B3TH 1EYZA 4LSXA 4O2AF 3KHRA 3M9OB 4MV4A 3KXYT 2BQ3A 1KEEA 5KFGA 2OLSA 3CVZA 1ZZJA 1K1SA 4RUAA 4CC5A 4UCUA 4E4TA 3EPIA 4U6PA 5C0XG 1HR0H 2BR0A 4DL2A 4HR7A 3GR5A 2FK3A 3GIPA 4Y8VB 5FJ8G 3RUPA 5L1JA 4IHJF 1GSAA 4PWQA 4GC7A 4A3BG 3M9MB 5JEAG 2YU9A 4BA1I 5KG3A 1ZHQA 2C35B 3RBEA 4LFCH 5D1OB 3PW0A 4ED1A 1XNQH 4GLXA 2G8YA 1J5KA 2NU7B 2VR1A 3HBLA 1KJ8A 4I4TF 5I47A 1KC7A 3N8DA 3OHBA 3RB4A 3PW7A 4G08A 5FLXW 3AEVB 4MV6A 2DPJA 4DR6H 2BA0A 2FPHX 3SE7A 4RNOA 4JI1H 2FPGB 1WH2A 4O4HF 5KG5A 4U7CA 3NGDA 1B6SA 4GC6A 4A3JG 1OWTA 4YJ3F 2CTLA 4XZ3B 4ED0A 1WTJA 4ETSA 3MWMA 3GIMA 1S20A 4A2BA 4J9SA 2JA6A 1NXUA 2CTMA 1B33N 3FAUA 1FVIA 4IRKA 1CQJB 1CS0A 2AQ4A 2PT7G 1WHRA
chains in the Genus database with same CATH topology
1F0XA 4X66H 5D1OA 4MV9A 3EZJA 4LF8H 1O75A 2WYOA 1I94H 3C0FB 5FD5A 1BJTA 3M4IA 1S03G 1M0TA 5LMNH 1M0WA 2WDTA 4EEQA 4JI6H 3KAJA 2UUBH 3H20A 4DV0H 4LF6H 4LH7A 5A2QW 2RGRA 4JI2H 4J0MA 4IAJA 2HVRA 4DR7H 2ZQEA 2HHHH 4DV2H 1TA8A 1IBMH 1X9ZA 2ZJTA 4LH6A 5FPOA 5FPRA 2MCTA 4AQYH 1FKAH 4RAYA 4M7EA 3JAMW 2HGSA 4RB2C 3SB1A 1N32H 4JI3H 4MV7A 4OD6A 3RIZA 4RB1A 1XNRH 5DT9A 4DV6H 2VQEH 3OETA 4X64H 4DUYH 4NXNH 4K0KH 3PN1A 4LSAA 1ODHA 4B3RH 1AN7A 4DV1H 4FM9A 2VUGA 1HNXH 4DV7H 3EYYA 2Y3MA 2UU9H 3UQ8A 2W57A 4X62H 5LMUH 2ZM6H 4JI4H 5FD6A 1Z2PX 3J81W 2Q2TA 3RF2A 3OTOH 2D9IA 1ZHSA 4APMA 3HXLA 1S68A 1A0IA 1SYXB 1TAEA 2RGVA 3IG0A 1IBKH 2O03A 3LMLA 4E9JA 4DUZH 3N43B 4BWSC 4RB0A 3BA9A 4EFEA 4DR2H 4DR1H 1E4FT 4R7RA 1SEIA 2VPSA 1J5EH 3KDGA 4JI0H 1I6UA 2E5LH 2HVSA 4B8CD 4KHPH 1DGSA 3J80W 4UCVA 3KAKA 1P8LA 2Q2UA 2KSWA 3QD7X 3RGXA 4B3SH 4Q0YA 5BR8H 4LF4H 2CW8A 1HNZH 4NZRM 4B3MH 4NZTM 2UXBH 1E4GT 3F8NA 3N40P 4UCSA 5D1PA 3RJ0A 1X9NA 4LFBH 3NCVA 3BABA 2F4VH 2XIGA 4YY3H 4JI7H 3BA8A 3JSLA 3KALA 4JV5H 1N33H 3N6XA 4RB3C 1N34H 4CC6A 4MTDA 4X65H 3GABA 2VKCA 2WE6A 4YHHH 4LF5H 4GKJH 4I7HA 4UCRA 3T1HH 4UCTA 1L2ZA 1BGWA 1XMOH 4JI8H 2CW7A 3J7AK 4UFZA 4LFAH 2UXCH 3L2PA 1GYFA 4EC5A 4OCHA 2UUCH 3OSSD 4B3TH 3DF7A 4GKKH 3N41B 4RZQA 4LSXA 3L4KA 3KXYT 2O4CA 1XMQH 1IBLH 1Z2NX 3CVZA 4OX9H 4CC5A 4UCUA 4UCOA 2UXDH 4PDBA 2OWOA 1HR0H 4DR5H 5LL6b 4NXMH 3GR5A 4LMYA 3N44B 1VS0A 2LF0A 2UUAH 1B04A 4LF7H 1MZBA 1ZHQA 4MTEA 4LFCH 2FE3A 3N42B 5D1OB 3RTXA 2VQFH 1N36H 5IT9W 3T1YH 2VOBA 1XNQH 4DV5H 4GLXA 5EOYA 2YCHA 4LF9H 4G08A 5FLXW 4DR6H 2FPHX 3BAAA 3JSNA 4JI1H 4JYAH 1WH2A 4EFBA 4DR3H 3K3VA 4JI5H 1XDNA 1V9PA 1Z2OX 4RAZA 4ETSA 5IWAH 3FMAA 3MWMA 4A2BA 1HNWH 3L4JA 4DV3H 3FAUA 4DV4H 1FVIA 1FJGH 3KDKA 2HVQA 3RGZA 4A2AA 4DR4H 2PT7G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X66 H;  4LF8 H;  1I94 H;  1S03 G;  5LMN H;  4JI6 H;  2UUB H;  4DV0 H;  4LF6 H;  5A2Q W;  4JI2 H;  4DR7 H;  2HHH H;  4DV2 H;  1IBM H;  4AQY H;  1FKA H;  3JAM W;  1N32 H;  4JI3 H;  1XNR H;  4DV6 H;  2VQE H;  4X64 H;  4DUY H;  4NXN H;  4K0K H;  4B3R H;  1AN7 A;  4DV1 H;  1HNX H;  4DV7 H;  2UU9 H;  4X62 H;  5LMU H;  2ZM6 H;  4JI4 H;  3J81 W;  3RF2 A;  3OTO H;  1IBK H;  4DUZ H;  4DR2 H;  4DR1 H;  1SEI A;  1J5E H;  1I6U A;  4JI0 H;  2E5L H;  4KHP H;  3J80 W;  4B3S H;  5BR8 H;  4LF4 H;  1HNZ H;  4B3M H;  2UXB H;  4LFB H;  2F4V H;  4YY3 H;  4JI7 H;  4JV5 H;  1N33 H;  1N34 H;  4X65 H;  4YHH H;  4LF5 H;  4GKJ H;  3T1H H;  1XMO H;  4JI8 H;  3J7A K;  4LFA H;  2UXC H;  2UUC H;  4B3T H;  4GKK H;  1XMQ H;  1IBL H;  4OX9 H;  2UXD H;  4PDB A;  1HR0 H;  4DR5 H;  5LL6 b;  4NXM H;  2UUA H;  4LF7 H;  4LFC H;  2VQF H;  1N36 H;  5IT9 W;  3T1Y H;  1XNQ H;  4DV5 H;  4LF9 H;  5FLX W;  4DR6 H;  4JI1 H;  4JYA H;  4DR3 H;  4JI5 H;  5IWA H;  1HNW H;  4DV3 H;  4DV4 H;  1FJG H;  4DR4 H; 
#chains in the Genus database with same CATH topology
 5DG9 A;  3MJF A;  2B63 A;  4MV9 A;  3EZJ A;  4F50 A;  4YP3 A;  5BPH A;  1I94 H;  4RUC A;  3RV3 A;  1UNN C;  2IA6 A;  4ZQI A;  2VUM A;  4EEQ A;  2WDT A;  4B8T A;  1RYR A;  4YAJ B;  4IZO A;  2YW2 A;  2J6T A;  3H20 A;  2IMW P;  4DV0 H;  4LF6 H;  4LH7 A;  3PW2 A;  4JI2 H;  4DR7 H;  1VIH A;  1TA8 A;  3HKZ E;  3TII A;  1K83 A;  4JV2 A;  5FPR A;  5FPO A;  4A3L G;  5KG0 A;  4RU9 A;  2PY9 A;  2Q2U A;  1FKA H;  4WBN F;  5CA1 F;  5JUM A;  1N32 H;  2A1S A;  1WCM G;  2YQR A;  3RIZ A;  2RF4 A;  1Y1W A;  5IP7 G;  3V6J A;  5K2M A;  2JEA I;  4DV6 H;  2NN6 G;  2JZX A;  3EPG A;  4K0K H;  1GSO A;  2X0S A;  3RFC A;  3FKI A;  1WR2 A;  2Y0S E;  4O2B F;  1HNX H;  5LYJ F;  2UU9 H;  5KFS A;  5FD6 A;  1ZZI A;  1TWH A;  5KT5 A;  3RF2 A;  4MA5 A;  1ZHS A;  4BA2 I;  3GTL A;  1S68 A;  1SYX B;  1TAE A;  2FKL A;  4EBD A;  4C5A A;  1EHI A;  4L1K A;  4BWS C;  1Y14 B;  4MV8 A;  4XYM B;  4EGJ A;  5KX5 F;  4IRD A;  1SCU B;  4EFE A;  3KHL A;  3GTP A;  4DR1 H;  4R7R A;  2IBK A;  3G6V A;  5LOV F;  2E5L H;  1TWC A;  2GPW A;  5J2U F;  4QW9 A;  4DL4 A;  4KHP H;  1ULZ A;  5J2T F;  4UCV A;  5KT2 A;  4ECY A;  1I50 A;  1VAJ A;  5H80 A;  2FLL A;  3M9N B;  4AYB E;  3BG5 A;  5L1I A;  2VPQ A;  4LF4 H;  3F8N A;  3MWD A;  4Q44 A;  5L1K A;  4B3M H;  2UXB H;  3I0P A;  3PO2 G;  1RJQ A;  1B6R A;  4UCS A;  5D1P A;  4ED3 A;  1X9N A;  2WTF A;  2E2H A;  1CQI B;  2F4V H;  3T5J A;  3BA8 A;  1X4M A;  4JI7 H;  3G8C A;  3JSL A;  4I50 F;  4RNN A;  3H3V H;  1V9N A;  2UVW A;  2OPU A;  4X65 H;  3G6Y A;  2PN1 A;  4ME6 A;  1E4E A;  5KFY A;  5IYC G;  5JVL A;  4Q45 A;  4J9L A;  3V6K A;  5DGA A;  3ETJ A;  2W8K A;  2UVU A;  3FDS A;  3TQT A;  3T1H H;  3VKE A;  1L2Z A;  4OO1 G;  1BGW A;  1V51 A;  2CW7 A;  4JUZ A;  5LXT F;  2PQU A;  2V59 A;  3G6X A;  1KBL A;  4RZQ A;  4ED7 A;  2K1H A;  1JX4 A;  5EDW A;  4C2M A;  4FBU A;  4IR1 A;  2CWF A;  4UCO A;  3HB9 A;  4YR3 A;  4DR5 H;  5LL6 b;  3MR6 A;  1JLL B;  2R7N A;  4EYH B;  2UVV A;  2JEF A;  2FLP A;  4IRC A;  2NU8 B;  3T5L A;  2UUA H;  2XCP A;  4A3D G;  3U9T A;  1I7N A;  3RBD A;  2R7K A;  4J9N A;  4MTE A;  1JDE A;  2FE3 A;  3N42 B;  1S97 A;  2VQF H;  4BBR G;  1V8C A;  3T1Y H;  4FU0 A;  4DV5 H;  1C3O A;  2R84 A;  2JA7 A;  3R5X A;  2YCH A;  1ZZK A;  3RV4 A;  2P2R A;  5KFJ A;  4J9P A;  3I4N G;  2SCU B;  3Q1K A;  5KFD A;  2GLT A;  1V4Y A;  4DR3 H;  2DIK A;  2R92 A;  1XDN A;  4RAZ A;  1C30 A;  2Y0S A;  5KG1 A;  5KFZ A;  1DV1 A;  4J9R A;  4DV3 H;  3U1K A;  4TQR A;  4HYK A;  1FJG H;  1K1Q A;  2HVQ A;  1N56 A;  4NLG A;  1Y1V A;  4WAN A;  5D1O A;  1O75 A;  2WYO A;  2W70 A;  2JA6 G;  2W9B B;  1Z2I A;  1BJT A;  3ORR A;  3TIG A;  3KHG A;  3ORQ A;  1S03 G;  1M0W A;  5LMN H;  2OH2 A;  4LIJ A;  5JH7 F;  3RAQ A;  2J9G A;  2W6Q A;  2B63 G;  2YRW A;  2JA5 A;  3R5H A;  5T14 A;  4ED8 A;  5C44 G;  2HVR A;  5LA6 F;  2NU6 B;  3MR5 A;  2ZQE A;  1KJ9 A;  2VUM G;  3I12 A;  1VBI A;  4LH6 A;  3GLK A;  2ASD A;  5LP6 F;  2V58 A;  2MCT A;  3VPB A;  5JVD F;  3JAM W;  5HBR B;  4AYB A;  4MV7 A;  3HOV G;  3BJY A;  4RB1 A;  1XNR H;  5C5J A;  4WAL A;  3ETH A;  3V6H A;  1TWG A;  5KFF A;  2HH3 A;  3HOZ G;  4DUY H;  4LSA A;  1X4N A;  3PN1 A;  1ODH A;  4B3R H;  4O3S A;  5C1O A;  5IYD G;  3EYY A;  2CWH A;  2Y3M A;  5IYB G;  5LMU H;  4A3G G;  4JI4 H;  2FMA A;  1ZET A;  3PO3 G;  3FKI G;  4FS2 A;  2Q2T A;  3GTO A;  4YJ2 F;  4EYI B;  2VA3 A;  1I7L A;  1RK5 A;  4A2A A;  4DL3 A;  4BY7 G;  3LML A;  4E9J A;  3UFX B;  3H0G G;  4HNU A;  2R93 G;  3VPC A;  3WO1 A;  2CQY A;  4QW8 A;  4JI0 H;  5C3E G;  2R8I A;  2AU0 A;  1BNC A;  4FJS A;  5DLG A;  1ZTG A;  2BQR A;  1UC9 A;  4C5B A;  2JE6 I;  5KFK A;  4BXX G;  1UC8 A;  4A3I G;  2CTK A;  2QYZ A;  1HNZ H;  4NZR M;  3RJ0 A;  3IN5 A;  2JEJ A;  2I87 A;  3BAB A;  2XIG A;  4YY3 H;  1VIG A;  3KAL A;  4ZI7 F;  5KFT A;  5KFN A;  1N33 H;  2RDI A;  1XRH A;  3K5I A;  3H40 A;  1S0M A;  3RB6 A;  3GKU A;  5DG8 A;  3QZ7 A;  4AM3 A;  5JQW A;  4EG0 A;  2NVY A;  2E3U A;  4YHH H;  4LF5 H;  4GKJ H;  1T94 A;  3HOX G;  2WAQ E;  5BMV F;  4UCT A;  5CA0 F;  1IOW A;  2CKZ B;  3HOU G;  4LFA H;  2YZN A;  3JZI A;  5KFV A;  4F4Y A;  4EC5 A;  3JRX A;  3DF7 A;  3K5H A;  3OSS D;  4GKK H;  2JEG A;  2FMR A;  3L4K A;  1KJJ A;  2XC9 A;  4JVH A;  2XCL A;  2W9C B;  2CPM A;  1IBL H;  1Z2N X;  4O4I F;  5KT3 A;  2M6Q A;  4QWE A;  1S0N A;  5KFO A;  4PDB A;  4ECW A;  2C2R A;  1WSC A;  4NXM H;  2PVP A;  5KFH A;  2VA2 A;  2E2I A;  4RZR A;  1VS0 A;  1B04 A;  4ECV A;  2DPI A;  4LF7 H;  4DL6 A;  1MZB A;  2R8J A;  3GQC A;  3QZ8 A;  3T5H A;  4YB8 B;  1M7J A;  3KHH A;  2NVX A;  3LWB A;  3RTX A;  4A93 G;  1TUA A;  2CTJ A;  1N36 H;  4ECZ A;  2C22 A;  2VOB A;  4G3I A;  5F9N A;  4DLK A;  3K3P A;  5EOY A;  2R7Z A;  4LF9 H;  1EZ1 A;  2PBZ A;  1SFO A;  2JA8 G;  5KFE A;  3BAA A;  5KG2 A;  4IFD G;  4EFB A;  2JVZ A;  1W96 A;  5KKN B;  3GIK A;  2W9A A;  4O4L F;  1MSZ A;  5KG7 A;  2C28 A;  4XYL B;  3PW5 A;  2HJW A;  5IWA H;  3FMA A;  2WB1 E;  5KFW A;  4JV0 A;  1CE8 A;  4A3C G;  1HNW H;  3KDK A;  5DLF A;  2X06 A;  3GTK A;  2FJZ A;  4DR4 H;  3Q8S B;  4FBT A;  4M9U A;  4X66 H;  1JIH A;  2R7L A;  3C0F B;  4A3M G;  5KFX A;  2R87 A;  2QK4 A;  4R8U A;  3M4I A;  1J4W A;  4BY1 G;  2W6O A;  4QWA A;  4JI6 H;  3OUU A;  1BXR A;  3KAJ A;  1Y1V G;  2UUB H;  3KTM A;  4YR0 A;  2RGR A;  2V5A A;  5C4X G;  1EC6 A;  2V4Q A;  2CPQ A;  4J0M A;  2ZDG A;  4IAJ A;  5FLM G;  5DQH A;  1IBM H;  5KT7 A;  3PR5 B;  4ECT A;  1GGO A;  4M7E A;  4RB2 C;  1KHM A;  2CTE A;  3SB1 A;  5KT4 A;  3GIL A;  2R8K A;  3GTQ A;  4JI3 H;  4IR9 A;  2ZDH A;  4OD6 A;  4XX0 B;  4JVY A;  5KFA A;  5HV6 A;  2BQU A;  4QMF B;  2UVR A;  2XD4 A;  4MV1 A;  5EWE A;  5D8D A;  2DWC A;  3PZP A;  4X64 H;  2V4R A;  4O3N A;  1JDB B;  2ANR A;  2C2E A;  2FK1 A;  3Q2O A;  2I80 A;  2YS6 A;  3WNZ A;  2W9B A;  2ALZ A;  2QND A;  1DT4 A;  1WVN A;  5BPF A;  4J9M A;  4FM9 A;  1PQX A;  2CZG A;  3E5N A;  2W57 A;  3LP8 A;  3UQ8 A;  3MFH A;  4QIW E;  3RB0 A;  1S9F A;  4FJU A;  2FK2 A;  3J81 W;  2WAQ A;  2YYA A;  3OTO H;  4A3F G;  2R8G A;  1A0I A;  3IG0 A;  3I4M G;  2M8W A;  3AYH B;  3VMM A;  5EWF A;  2YZM A;  4ECU A;  1VKZ A;  1JKJ B;  2MJH A;  4RB0 A;  3Q8R B;  1E4F T;  3OUZ A;  2VPS A;  1R9T A;  1J5E H;  2NUA B;  3KDG A;  4RNM A;  2HVS A;  4BBS G;  1K1G A;  2IP4 A;  4B8C D;  2FPI B;  2LTM A;  2R7M A;  4HNV A;  3J80 W;  5K36 G;  5KFP A;  3KAK A;  2W7P A;  1GO3 E;  4YBZ B;  2DLN A;  3MR3 A;  2W6M A;  3RGX A;  3RB3 A;  2ASJ A;  4B3S H;  4Q0Y A;  3V4Z A;  1KJQ A;  4NZT M;  4MV3 A;  1S0O A;  5GON F;  3HOW G;  3NCV A;  1PK8 A;  3Q8Q B;  1Y1W G;  2VQD A;  2ZDQ A;  3U9S A;  2M05 A;  3N6X A;  4YAK B;  1N34 H;  2GPS A;  4F4W A;  3TIN A;  4MTD A;  4O3Q A;  5KG6 A;  3OSN A;  2VKC A;  1T3N A;  2WE6 A;  4I7H A;  3MFI A;  3MR2 A;  3H4D A;  4AIM A;  2XGP A;  2DGR A;  4UFZ A;  3J7A K;  3GTM A;  5KFC A;  5CAE B;  2WB1 A;  3BQ1 A;  4OCH A;  3N41 B;  2O4C A;  4ECR A;  1XMQ H;  2AXY A;  4TV9 F;  4DL7 A;  4OX9 H;  1PX2 A;  2HH2 A;  1RJP A;  4QWB A;  3GTJ A;  2UXD H;  1W93 A;  2OWO A;  2W71 A;  2W6N A;  4IWX A;  4LMY A;  5KFI A;  4TQS A;  3N44 B;  2LF0 A;  5IP9 G;  2BL5 A;  2FB9 A;  5KFM A;  4J9Q A;  3Q8P B;  3H4B A;  3GID A;  1N48 A;  3OHA A;  2R8H A;  4Q8F A;  1RJR A;  4J9O A;  5IT9 W;  1RYS A;  2R82 A;  1VBH A;  2AGP A;  3OSP A;  3QFF A;  5DQI A;  3RAX A;  3BQ2 A;  4EGQ A;  1RK6 A;  2YS7 A;  2R6F A;  1DTJ A;  2W9C A;  5KFU A;  3JSN A;  2PMZ E;  4JYA H;  5CB4 F;  3V4S A;  2AGQ A;  2R7Z G;  4MAM A;  1IOV A;  4JI5 H;  1Z2O X;  1V9P A;  1AUX A;  3K3V A;  5KFB A;  4F4X A;  4ED2 A;  4DL5 A;  1JXL A;  2W7O A;  4QWC A;  4C5C A;  5KFQ A;  3L4J A;  5C8Y F;  4F4Z A;  4DV4 H;  4QIW A;  1I3Q A;  3GV5 B;  3RGZ A;  1TWA A;  1F0X A;  2CTF A;  5FD5 A;  4LF8 H;  2FPP B;  4EBC A;  3GV7 B;  2R85 A;  3MWE A;  4O3O A;  4I55 F;  3H0G A;  3GV8 B;  1M0T A;  4EBE A;  1GLV A;  2R93 A;  4MA0 A;  2FFM A;  3GIJ A;  4A3E G;  4Q43 A;  4Q8E A;  1DIK A;  1T36 A;  2C00 A;  2R86 A;  5A2Q W;  1A9X A;  4ECS A;  3TQ1 A;  4QJF A;  1WCM A;  4FS1 A;  5L9X A;  2HHH H;  4DV2 H;  3GII A;  1X9Z A;  2ZJT A;  1TWF A;  1X0A A;  5C1P A;  3V69 A;  4AQY H;  4EEY A;  4RAY A;  2HGS A;  5IYZ F;  2YRX A;  4ECQ A;  2FP4 B;  1UG8 A;  2JA7 G;  4TV8 F;  2P0A A;  5DT9 A;  3T5K A;  2JA9 A;  2VQE H;  4O3P A;  3OET A;  1AUV A;  4J9K A;  4NXN H;  5EZY F;  3WO0 A;  2W6Z A;  2FLN A;  2R92 G;  1AN7 A;  4DV1 H;  3R23 A;  4ZHQ F;  2VUG A;  4DV7 H;  2LRR A;  2XGQ A;  5L1L A;  3UOE A;  4YR2 A;  4X62 H;  4WD3 A;  4JV1 A;  2ZM6 H;  1Z2P X;  3GTG A;  5EWG A;  2D9I A;  3L7Z C;  3R5F A;  3HXL A;  4APM A;  3PVX A;  3PW4 A;  2RGV A;  4HQ6 A;  3SI8 A;  2J6U A;  2NU9 B;  2W6P A;  2JEB I;  1IBK H;  1KJI A;  2O03 A;  4DUZ H;  3N43 B;  3VPD A;  4YQW A;  2XCA A;  2W8L A;  3BQ0 A;  3JRW A;  2C2D A;  4O3R A;  1E4E B;  3BA9 A;  4DR2 H;  1VBG A;  4IWY A;  5KFL A;  2ATL A;  1SEI A;  4A3K G;  2YZG A;  5KT6 A;  2AGO A;  2LTL A;  1I6U A;  4HNT A;  3GIQ A;  1ZQ7 A;  2YL2 A;  4NBQ A;  2DZD A;  2JA5 G;  3HOY G;  1DGS A;  5DQG A;  1P8L A;  2OPV A;  3PR4 A;  2V9W A;  2KSW A;  4ED6 A;  3QD7 X;  5KG4 A;  5BR8 H;  1GSH A;  2CW8 A;  1EUD B;  1S10 A;  1E4G T;  1EUC B;  3N40 P;  4ECX A;  5DGB A;  2J6S A;  4ZOL F;  4LFB H;  5F9L A;  2Z0S A;  1WE8 A;  4QWD A;  4JV5 H;  3HKZ A;  4RB3 C;  4CC6 A;  2I8C A;  3GAB A;  4H8A A;  2ASL A;  1DV2 A;  3CQZ A;  4R8U B;  4TUY F;  2ANN A;  2PMZ A;  4UCR A;  2RDJ A;  2JEI A;  1XMO H;  4JI8 H;  3L2P A;  5KFR A;  2UXC H;  5DG7 A;  1GYF A;  1M6V A;  2UUC H;  4B3T H;  1EYZ A;  4LSX A;  4O2A F;  3KHR A;  3M9O B;  4MV4 A;  3KXY T;  2BQ3 A;  1KEE A;  5KFG A;  2OLS A;  3CVZ A;  1ZZJ A;  1K1S A;  4RUA A;  4CC5 A;  4UCU A;  4E4T A;  3EPI A;  4U6P A;  5C0X G;  1HR0 H;  2BR0 A;  4DL2 A;  4HR7 A;  3GR5 A;  2FK3 A;  3GIP A;  4Y8V B;  5FJ8 G;  3RUP A;  5L1J A;  4IHJ F;  1GSA A;  4PWQ A;  4GC7 A;  4A3B G;  3M9M B;  5JEA G;  2YU9 A;  4BA1 I;  5KG3 A;  1ZHQ A;  2C35 B;  3RBE A;  4LFC H;  5D1O B;  3PW0 A;  4ED1 A;  1XNQ H;  4GLX A;  2G8Y A;  1J5K A;  2NU7 B;  2VR1 A;  3HBL A;  1KJ8 A;  4I4T F;  5I47 A;  1KC7 A;  3N8D A;  3OHB A;  3RB4 A;  3PW7 A;  4G08 A;  5FLX W;  3AEV B;  4MV6 A;  2DPJ A;  4DR6 H;  2BA0 A;  2FPH X;  3SE7 A;  4RNO A;  4JI1 H;  2FPG B;  1WH2 A;  4O4H F;  5KG5 A;  4U7C A;  3NGD A;  1B6S A;  4GC6 A;  4A3J G;  1OWT A;  4YJ3 F;  2CTL A;  4XZ3 B;  4ED0 A;  1WTJ A;  4ETS A;  3MWM A;  3GIM A;  1S20 A;  4A2B A;  4J9S A;  2JA6 A;  1NXU A;  2CTM A;  1B33 N;  3FAU A;  1FVI A;  4IRK A;  1CQJ B;  1CS0 A;  2AQ4 A;  2PT7 G;  1WHR A; 
#chains in the Genus database with same CATH homology
 1F0X A;  4X66 H;  5D1O A;  4MV9 A;  3EZJ A;  4LF8 H;  1O75 A;  2WYO A;  1I94 H;  3C0F B;  5FD5 A;  1BJT A;  3M4I A;  1S03 G;  1M0T A;  5LMN H;  1M0W A;  2WDT A;  4EEQ A;  4JI6 H;  3KAJ A;  2UUB H;  3H20 A;  4DV0 H;  4LF6 H;  4LH7 A;  5A2Q W;  2RGR A;  4JI2 H;  4J0M A;  4IAJ A;  2HVR A;  4DR7 H;  2ZQE A;  2HHH H;  4DV2 H;  1TA8 A;  1IBM H;  1X9Z A;  2ZJT A;  4LH6 A;  5FPO A;  5FPR A;  2MCT A;  4AQY H;  1FKA H;  4RAY A;  4M7E A;  3JAM W;  2HGS A;  4RB2 C;  3SB1 A;  1N32 H;  4JI3 H;  4MV7 A;  4OD6 A;  3RIZ A;  4RB1 A;  1XNR H;  5DT9 A;  4DV6 H;  2VQE H;  3OET A;  4X64 H;  4DUY H;  4NXN H;  4K0K H;  3PN1 A;  4LSA A;  1ODH A;  4B3R H;  1AN7 A;  4DV1 H;  4FM9 A;  2VUG A;  1HNX H;  4DV7 H;  3EYY A;  2Y3M A;  2UU9 H;  3UQ8 A;  2W57 A;  4X62 H;  5LMU H;  2ZM6 H;  4JI4 H;  5FD6 A;  1Z2P X;  3J81 W;  2Q2T A;  3RF2 A;  3OTO H;  2D9I A;  1ZHS A;  4APM A;  3HXL A;  1S68 A;  1A0I A;  1SYX B;  1TAE A;  2RGV A;  3IG0 A;  1IBK H;  2O03 A;  3LML A;  4E9J A;  4DUZ H;  3N43 B;  4BWS C;  4RB0 A;  3BA9 A;  4EFE A;  4DR2 H;  4DR1 H;  1E4F T;  4R7R A;  1SEI A;  2VPS A;  1J5E H;  3KDG A;  4JI0 H;  1I6U A;  2E5L H;  2HVS A;  4B8C D;  4KHP H;  1DGS A;  3J80 W;  4UCV A;  3KAK A;  1P8L A;  2Q2U A;  2KSW A;  3QD7 X;  3RGX A;  4B3S H;  4Q0Y A;  5BR8 H;  4LF4 H;  2CW8 A;  1HNZ H;  4NZR M;  4B3M H;  4NZT M;  2UXB H;  1E4G T;  3F8N A;  3N40 P;  4UCS A;  5D1P A;  3RJ0 A;  1X9N A;  4LFB H;  3NCV A;  3BAB A;  2F4V H;  2XIG A;  4YY3 H;  4JI7 H;  3BA8 A;  3JSL A;  3KAL A;  4JV5 H;  1N33 H;  3N6X A;  4RB3 C;  1N34 H;  4CC6 A;  4MTD A;  4X65 H;  3GAB A;  2VKC A;  2WE6 A;  4YHH H;  4LF5 H;  4GKJ H;  4I7H A;  4UCR A;  3T1H H;  4UCT A;  1L2Z A;  1BGW A;  1XMO H;  4JI8 H;  2CW7 A;  3J7A K;  4UFZ A;  4LFA H;  2UXC H;  3L2P A;  1GYF A;  4EC5 A;  4OCH A;  2UUC H;  3OSS D;  4B3T H;  3DF7 A;  4GKK H;  3N41 B;  4RZQ A;  4LSX A;  3L4K A;  3KXY T;  2O4C A;  1XMQ H;  1IBL H;  1Z2N X;  3CVZ A;  4OX9 H;  4CC5 A;  4UCU A;  4UCO A;  2UXD H;  4PDB A;  2OWO A;  1HR0 H;  4DR5 H;  5LL6 b;  4NXM H;  3GR5 A;  4LMY A;  3N44 B;  1VS0 A;  2LF0 A;  2UUA H;  1B04 A;  4LF7 H;  1MZB A;  1ZHQ A;  4MTE A;  4LFC H;  2FE3 A;  3N42 B;  5D1O B;  3RTX A;  2VQF H;  1N36 H;  5IT9 W;  3T1Y H;  2VOB A;  1XNQ H;  4DV5 H;  4GLX A;  5EOY A;  2YCH A;  4LF9 H;  4G08 A;  5FLX W;  4DR6 H;  2FPH X;  3BAA A;  3JSN A;  4JI1 H;  4JYA H;  1WH2 A;  4EFB A;  4DR3 H;  3K3V A;  4JI5 H;  1XDN A;  1V9P A;  1Z2O X;  4RAZ A;  4ETS A;  5IWA H;  3FMA A;  3MWM A;  4A2B A;  1HNW H;  3L4J A;  4DV3 H;  3FAU A;  4DV4 H;  1FVI A;  1FJG H;  3KDK A;  2HVQ A;  3RGZ A;  4A2A A;  4DR4 H;  2PT7 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...