3JAMW

Cryoem structure of 40s-eif1a-eif1 complex from yeast
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
129
structure length
129
Chain Sequence
b'TRTSVLADALNAINNAEKTGKRQVLIRPSSKVIIKFLQVMQKHGYIGEFEYIDDHRSGKIVVQLNGRLNKCGVISPRFNVKIADVEKWTANLLPARQFGYVILTTSAGIMDHEEAHRKHVSGKILGFVY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 18S rRNA
molecule tags Translation
source organism Saccharomyces cerevisiae
publication title Conformational Differences between Open and Closed States of the Eukaryotic Translation Initiation Complex.
pubmed doi rcsb
total genus 29
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
W PF00410 Ribosomal_S8 Ribosomal protein S8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.30 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 3jamW01
3.30.1490.10 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3jamW02
4B3MH 4LFAH 4B3RH 1N34H 4JI3H 1N36H 4DR4H 4DR1H 1HNWH 4KHPH 3J81W 4B3SH 5LL6b 3T1YH 4GKJH 4JYAH 4X64H 1HNXH 1I94H 4DV4H 4YY3H 1N32H 2UXDH 4JI5H 2UXCH 4LFCH 2VQFH 3JAMW 4DV0H 5IWAH 1N33H 4DUYH 1IBLH 5FLXW 4DR2H 4DV3H 4DR6H 2ZM6H 4NXMH 4X66H 4DV5H 2HHHH 4JI4H 4LF9H 4DV7H 4DV2H 4JI2H 4DR3H 2UUAH 1HNZH 2UU9H 1AN7A 1IBKH 1I6UA 4OX9H 4JI1H 5LMUH 4JI8H 4LFBH 4DR7H 4JI7H 4LF6H 1XMQH 5LMNH 2E5LH 1FJGH 4X65H 4DR5H 4NXNH 2UUBH 4DV6H 3OTOH 4DV1H 1FKAH 4B3TH 1SEIA 5BR8H 5A2QW 1XMOH 4K0KH 2F4VH 4LF7H 3RF2A 4PDBA 1HR0H 1S03G 3T1HH 1XNRH 4DUZH 4LF5H 4JI6H 5IT9W 4JV5H 4GKKH 2UXBH 2UUCH 3J7AK 4YHHH 2VQEH 1IBMH 4JI0H 4AQYH 3J80W 4X62H 1J5EH 4LF8H 4LF4H 1XNQH
chains in the Genus database with same CATH superfamily
3GTGA 3VPCA 4B3MH 2R7MA 4YJ2F 4Q44A 3T5JA 1N34H 4DR4H 2RDIA 3G6VA 5DGBA 4J9LA 2ANNA 4O2BF 4RZRA 2I8CA 3HOZG 3LWBA 3UOEA 4B3SH 5CA1F 2XCAA 2X0SA 3GIDA 1AUVA 4X64H 2CTEA 1HNXH 2FK2A 1I94H 1E4GT 2YRXA 2W8KA 2W6NA 1T3NA 3I4NG 4LFCH 2BQ3A 1GSHA 4FBUA 2WDTA 2XC9A 5J2TF 3V4SA 3GILA 4UCRA 3PVXA 3K3VA 1TA8A 3PR4A 4LIJA 4UCSA 4IRDA 1MSZA 5K36G 2NU7B 5KFQA 4DR2H 4F4YA 4TV9F 4J9QA 3Q1KA 4NLGA 2DWCA 3N42B 1N48A 2JE6I 2UVUA 1RJRA 2I87A 3FMAA 3MFHA 3CQZA 4A3GG 2ASLA 4JI4H 5HBRB 2J6UA 1UG8A 1C30A 1Y1WA 1X9ZA 1B04A 3PW2A 3OUUA 5KFLA 3T5LA 3TQTA 4IWXA 4ED0A 2W6ZA 5LYJF 3U9SA 3N41B 4ED2A 3MR6A 4GC7A 3HOYG 4IFDG 4FJSA 1IOWA 2W9AA 1WR2A 2XCLA 5LMUH 3UFXB 4EGJA 3AEVB 2R7ZG 1EUCB 2NU8B 5F9LA 2ZQEA 3BABA 4LFBH 4UCOA 1TWCA 3BA9A 2VPSA 3K3PA 4YR0A 2OPVA 2NU9B 3TINA 3EZJA 2Y0SE 3TIIA 3BQ1A 4MV4A 3ORQA 2CW7A 1WCMA 4ED7A 4X65H 2BR0A 4HNUA 4J9SA 3TQ1A 2AGPA 3H0GA 4WANA 1S10A 2VR1A 1Y14B 1M7JA 2WYOA 4RB3C 2RGRA 3KXYT 5EOYA 2W6QA 2BA0A 3DF7A 2QYZA 4RB0A 3JSLA 5KFWA 4AIMA 2VA2A 4BBRG 3GV7B 3KAKA 1V8CA 4ETSA 4ECWA 2JA9A 1EHIA 2R7KA 5KFUA 4LF7H 4DLKA 1PK8A 5D1OA 4YQWA 2IP4A 2W7OA 2BQUA 2R86A 2Y0SA 3HBLA 4ECXA 3QFFA 1CE8A 4R8UB 5L9XA 1VBHA 3G6XA 5JVDF 3T1HH 2OLSA 5IYCG 2VQDA 2XGPA 1SCUB 2WB1E 2CPMA 4C5BA 5DG8A 2JA5G 5D1OB 5KFFA 2UXBH 4IAJA 4RNMA 2P2RA 5EWEA 4PWQA 1S9FA 1X9NA 2JEBI 1DTJA 2V59A 2W71A 5KT7A 1IBMH 4JI0H 2DLNA 3N44B 4LSAA 2CTLA 5KFOA 4J9NA 5KG0A 1M0TA 3GTLA 2NVXA 1X0AA 3MWDA 3MWMA 2J6SA 4ECTA 5DLGA 1X4MA 3Q8SB 3KAJA 1Z2PX 3JZIA 5FD5A 5IYBG 4YP3A 2FK1A 2R84A 3BG5A 5KFIA 3EPGA 4MV8A 3PW5A 2AXYA 3RIZA 4YAKB 3PW7A 3RF2A 3HXLA 5IYZF 2W6OA 3NCVA 4CC6A 4RNOA 2YL2A 4LMYA 2W6MA 2CTFA 4HNTA 1VS0A 2YZNA 4EFBA 2ZDGA 4AYBA 2R92G 4A93G 1N36H 4ECZA 1WTJA 4KHPH 2YQRA 3G6YA 2V5AA 5DQGA 2WAQE 5FJ8G 3I4MG 3WO0A 4XYLB 3K5HA 2LRRA 5LL6b 4J0MA 2OH2A 5LA6F 3T1YH 3VPBA 3GIJA 3SE7A 2GLTA 3KDGA 1KC7A 3OSNA 1CS0A 4YY3H 2AQ4A 2C22A 3GTOA 1WHRA 1WVNA 2UXDH 4QIWE 2JZXA 2W57A 1DV2A 5KG1A 3SI8A 2UXCH 3HOUG 1TWGA 2VQFH 3MR3A 4AYBE 2AGQA 2R82A 4XYMB 5C1OA 1GSAA 1N33H 3RV4A 2R93A 2KSWA 3JRXA 4DUYH 1UC8A 4R7RA 4ED3A 2CWHA 1VIGA 3PW4A 5JH7F 2WAQA 5KFKA 3GIMA 2VKCA 3RJ0A 3OHAA 3Q2OA 2ZM6H 3R23A 4NXMH 4HQ6A 1GGOA 1JLLB 5C8YF 4DL4A 4UCVA 2DPJA 5EWGA 2R6FA 1UC9A 2HHHH 2C00A 1SYXB 1R9TA 2Q2TA 4DV7H 4RAYA 4Q8EA 3EYYA 4I55F 4IR1A 4DV2H 4J9RA 3BAAA 2K1HA 4MA0A 5BPFA 2WTFA 4DR3H 3OUZA 3MR2A 2UU9H 3HKZE 3GV8B 5L1JA 2IBKA 1IBKH 4IZOA 4JV2A 1S0MA 4QWAA 1I6UA 1RK6A 2PVPA 2VUGA 4OX9H 4A3BG 1T36A 1S68A 2O4CA 1ZHSA 2ASDA 4BA1I 1WSCA 4HR7A 2O03A 4C2MA 5JUMA 1CQIB 4MV1A 4YR2A 3PR5B 3PW0A 5F9NA 1JDBB 1EUDB 2E5LH 4FM9A 2FPHX 2JA7G 1ZQ7A 3BQ0A 4A3CG 1ULZA 1B33N 5K2MA 1ZZIA 2UUBH 3M9NB 2R8HA 5DGAA 1ZETA 4XZ3B 3Q8QB 4A3IG 2VUMG 2LF0A 4B8TA 4Q43A 3HOWG 1Z2IA 4QW8A 1DT4A 4NZTM 4YJ3F 4CC5A 4A3LG 4O3PA 4J9OA 5KFAA 4HNVA 2HVSA 1FKAH 3F8NA 2FB9A 3KTMA 3BQ2A 2HJWA 4Q8FA 3V69A 3GIQA 5KT5A 3OSPA 3PN1A 3H20A 2V4QA 2JA6G 1AUXA 2PBZA 5KFEA 3T5HA 4PDBA 2RF4A 3LMLA 4MTEA 2JEIA 2W70A 1S03G 5DG9A 1VKZA 4ECUA 4IRKA 1XNRH 4DUZH 3RUPA 3RGXA 3H3VH 4L1KA 5KFMA 2B63G 4ZHQF 1ZHQA 3M9MB 3ORRA 4RUCA 2XD4A 2M8WA 2E3UA 2RDJA 2UUCH 2LTMA 3KHGA 1K83A 2VQEH 4F4ZA 3RTXA 4RUAA 2FKLA 2M6QA 4AQYH 1ZTGA 2ZDQA 3FKIG 3N6XA 4TV8F 3J80W 4BBSG 4ED6A 1WE8A 1WCMG 1GYFA 2XCPA 4EBCA 1DGSA 1KJ9A 3H0GG 4J9KA 1M0WA 2YW2A 2ATLA 2QNDA 3EPIA 4DL7A 3GIIA 4MTDA 2FMRA 4LF4H 1ZZJA 4Q0YA 5DG7A 4EBEA 4JV0A 4B3RH 1TWFA 1TAEA 4JVYA 2RGVA 3N8DA 2FLNA 4DR1H 1HNWH 1VBIA 4UCTA 1GLVA 4ECQA 2Q2UA 1RK5A 3GIPA 2VA3A 4M9UA 4DL6A 4A2AA 4O3OA 2W6PA 3BJYA 3N40P 4G08A 3KHHA 1K1GA 2CTMA 4R8UA 5DQHA 3Q8RB 4Q45A 3GLKA 4IWYA 4GKJH 5JQWA 2C2RA 4JYAH 2OWOA 3GKUA 3HOXG 4APMA 1DIKA 4A2BA 1FVIA 4YB8B 5CB4F 2FK3A 4DV4H 2YZMA 2JEFA 4RAZA 4EEQA 4JI5H 5KFRA 3KHRA 3RBDA 2R8JA 2XGQA 2IMWP 4DV0H 2R8IA 3JRWA 4MV3A 1J4WA 3GTPA 4RZQA 1IBLH 2Z0SA 4M7EA 4DL2A 5FLXW 1EZ1A 3ETJA 4DV3H 4DR6H 3QZ7A 4YBZB 4O2AF 5KT3A 1KJ8A 4ED8A 1F0XA 4X66H 2C28A 1RJQA 1KEEA 1Y1WG 4QW9A 2DIKA 3C0FB 5KFGA 4ED1A 3V4ZA 4LF9H 5JEAG 4ZI7F 3OETA 3AYHB 1V9PA 2FP4B 2R8KA 4J9MA 3GTQA 4A3KG 2P0AA 2W7PA 4ECSA 1IOVA 4UCUA 2FLPA 4A3JG 4JI2H 1S97A 2CTJA 1HNZH 2GPWA 4C5AA 5LOVF 1W93A 4MAMA 1SFOA 2BQRA 2X06A 2CQYA 4QWDA 4JI8H 1Y1VG 3RB6A 2DZDA 5CAEB 2FLLA 4EYHB 3RAXA 3L7ZC 4LF6H 1K1SA 5LMNH 2FJZA 4B8CD 4JVHA 2YZGA 4IHJF 5KFYA 4YR3A 5D8DA 4DL3A 2W9CB 4I4TF 2R7NA 4RU9A 2C2EA 4EBDA 4HYKA 1XRHA 5L1KA 2C35B 4C5CA 3CVZA 2FPGB 4MV6A 3E5NA 1A9XA 3MR5A 4ZOLF 3GTKA 2CWFA 3GR5A 4EGQA 1N56A 5KFZA 2PY9A 3MWEA 2R85A 3ETHA 1BJTA 5KG4A 3L4KA 5C4XG 3VPDA 4DV1H 4I7HA 1SEIA 4OO1G 5D1PA 3HB9A 1KHMA 2QK4A 3WNZA 5A2QW 1I3QA 5FLMG 4WBNF 5H80A 4ECRA 2AGOA 4TUYF 4EEYA 5DQIA 3PZPA 1A0IA 4EFEA 3OHBA 1TWHA 4LH7A 4WD3A 1M6VA 4DL5A 3KHLA 2PMZA 5KFDA 4LF5H 5IYDG 1VIHA 2W9BA 3BA8A 1V51A 4ECVA 2AU0A 5JVLA 2JA6A 1DV1A 4JI6H 4QWBA 3I0PA 2WB1A 4EYIB 4U7CA 2J6TA 3FAUA 4JV5H 1CQJB 4QIWA 3Q8PB 1RYRA 3M4IA 3GTMA 2JA5A 3GIKA 2E2HA 3SB1A 2YCHA 4FU0A 3J7AK 4YHHH 5J2UF 2UVVA 5C44G 3V6HA 4O3SA 3R5HA 1I7LA 1OWTA 2YRWA 1I50A 2HH2A 2ALZA 2GPSA 4RB2C 3KDKA 1Z2OX 2CZGA 4QWEA 4GC6A 4GLXA 4G3IA 2JA7A 4MV7A 1BGWA 5KFCA 2UVRA 2SCUB 5KT4A 3QD7X 4WALA 3UQ8A 5T14A 4FBTA 3V6KA 4AM3A 1XNQH 5KFXA 3NGDA 2ZDHA 1J5KA 1GSOA 4LFAH 2HGSA 5C1PA 4BY7G 2R92A 2D9IA 2R8GA 1O75A 4JI3H 2IA6A 1RYSA 1KJQA 4O3RA 4JV1A 5CA0F 3J81W 3U9TA 4FS1A 4A3FG 4MA5A 1EC6A 1E4FT 3RGZA 2R7ZA 2PN1A 3I12A 5L1IA 3WO1A 2YU9A 1V4YA 1PX2A 3RB3A 3VKEA 4LSXA 2W9BB 4ME6A 4JUZA 3H4DA 2JEJA 2E2IA 4OCHA 5DT9A 1JIHA 2YS6A 2VOBA 1Z2NX 3N43B 1N32H 2UVWA 3PO3G 2A1SA 3T5KA 3TIGA 4RNNA 5I47A 4OD6A 1KJIA 3JAMW 2I80A 1E4EA 3MJFA 5IWAH 5KFPA 2VPQA 5KKNB 2HH3A 1S0OA 2R93G 2CPQA 1KBLA 1S0NA 3PO2G 4I50F 5KT2A 3OSSD 3H40A 1RJPA 4ZQIA 3L4JA 2FMAA 3R5XA 4XX0B 1XDNA 4O4HF 1S20A 1B6RA 4NBQA 1ZZKA 2JEAI 1K1QA 4FJUA 4DV5H 3JSNA 4O4LF 2CTKA 1E4EB 2V9WA 3RBEA 3GTJA 4FS2A 4A3MG 5C0XG 3H4BA 5KFHA 5EWFA 1JKJB 4UFZA 4QWCA 3HOVG 2OPUA 2YS7A 3R5FA 4O3NA 4H8AA 2C2DA 4YAJB 1L2ZA 2HVQA 3MFIA 3GQCA 5BMVF 2UUAH 4F4WA 2M05A 3LP8A 4BWSC 1AN7A 1TUAA 1X4NA 1VAJA 1V9NA 5KFJA 2HVRA 3FDSA 2CKZB 4JI1H 2ANRA 4NZRM 2CW8A 4BXXG 3K5IA 2W8LA 2YYAA 5LXTF 4DR7H 1XMQH 4JI7H 1JDEA 2NU6B 4IR9A 3VMMA 4O4IF 2JA8G 4LH6A 2ASJA 5KG6A 4TQRA 1FJGH 1Y1VA 3G8CA 5KG3A 1EYZA 3RB4A 2V58A 2Y3MA 4DR5H 5IP9G 4NXNH 5DLFA 2PMZE 5FPRA 1W96A 1PQXA 4DV6H 5IP7G 3GABA 2NN6G 1UNNC 2V4RA 1BXRA 5KFTA 4A3EG 2VUMA 4EC5A 1WH2A 3OTOH 4Y8VB 4E4TA 2LTLA 1ODHA 2W9CA 4B3TH 1T94A 2ZJTA 1I7NA 3GV5B 2DGRA 5BR8H 5KG2A 3HKZA 1XMOH 5C5JA 4K0KH 2F4VH 2FE3A 2R7LA 5LP6F 2JVZA 5KT6A 1TWAA 3U1KA 1HR0H 2WE6A 5KG7A 4F4XA 1B6SA 5HV6A 4IRCA 1NXUA 1BNCA 1GO3E 1VBGA 2FPPB 2R87A 4BA2I 3L2PA 2B63A 5BPHA 4A3DG 2J9GA 1KJJA 4RB1A 5EZYF 2PQUA 4EG0A 5EDWA 5IT9W 3QZ8A 5GONF 2G8YA 3RV3A 2FPIB 5FD6A 4U6PA 2DPIA 4GKKH 3RFCA 3RAQA 4O3QA 1P8LA 5KFSA 1C3OA 1JXLA 3IG0A 3FKIA 4J9PA 2MJHA 3RB0A 4QMFB 4BY1G 2MCTA 4MV9A 1J5EH 4X62H 2NUAB 5KFNA 5C3EG 2NVYA 2PT7G 5KFBA 3IN5A 1MZBA 5FPOA 2JEGA 2FFMA 5L1LA 4E9JA 3M9OB 3V6JA 5KG5A 5KX5F 4TQSA 4LF8H 2XIGA 5KFVA 4ECYA 4QJFA 3KALA 2BL5A 1JX4A 4F50A
chains in the Genus database with same CATH topology
4Q0YA 3NCVA 4CC6A 4B3MH 4LMYA 2HGSA 4LFAH 4B3RH 1N34H 1TAEA 1VS0A 2D9IA 2RGVA 4EFBA 1O75A 4JI3H 1N36H 4DR4H 4DR1H 1HNWH 2Q2UA 4UCTA 4KHPH 3J81W 4A2AA 1E4FT 4B3SH 3N40P 3RGZA 5LL6b 4G08A 4J0MA 2OWOA 3T1YH 4GKJH 4JYAH 4LSXA 4X64H 1HNXH 4APMA 3KDGA 4OCHA 1I94H 5DT9A 1E4GT 1FVIA 4A2BA 4DV4H 4YY3H 4RAZA 2VOBA 1Z2NX 3N43B 1N32H 2UXDH 4JI5H 2W57A 4EEQA 2UXCH 4LFCH 4OD6A 2VQFH 3JAMW 4DV0H 2WDTA 5IWAH 1N33H 2KSWA 4R7RA 4DUYH 4UCRA 3K3VA 1TA8A 4RZQA 1IBLH 4UCSA 3OSSD 4M7EA 5FLXW 3L4JA 4DR2H 4DV3H 2VKCA 4DR6H 1XDNA 3RJ0A 2ZM6H 3N42B 4NXMH 1F0XA 4X66H 3FMAA 3JSNA 4UCVA 4DV5H 2HHHH 4JI4H 3C0FB 4LF9H 1SYXB 1X9ZA 1B04A 2Q2TA 3OETA 4DV7H 4RAYA 1V9PA 3EYYA 4UFZA 1L2ZA 4DV2H 2HVQA 3BAAA 4UCUA 4JI2H 4DR3H 2UUAH 1HNZH 2UU9H 3N41B 4BWSC 1AN7A 1IBKH 1I6UA 2VUGA 2HVRA 4OX9H 4JI1H 5LMUH 4JI8H 4NZRM 1ZHSA 1S68A 2O4CA 2CW8A 2ZQEA 3BABA 4LFBH 4DR7H 1XMQH 4JI7H 4LF6H 5LMNH 2O03A 4B8CD 2VPSA 3BA9A 4UCOA 4LH6A 3EZJA 4FM9A 2E5LH 2FPHX 1FJGH 2CW7A 4X65H 2Y3MA 4DR5H 4NXNH 2UUBH 3CVZA 5FPRA 4RB3C 2WYOA 3KALA 4DV6H 2RGRA 2LF0A 3GABA 3KXYT 5EOYA 3GR5A 3DF7A 4EC5A 4NZTM 4RB0A 3L4KA 3JSLA 1BJTA 3OTOH 1WH2A 4CC5A 1ODHA 4DV1H 1FKAH 2HVSA 4B3TH 2ZJTA 3F8NA 1SEIA 4I7HA 3KAKA 5D1PA 4ETSA 5A2QW 5BR8H 1XMOH 4K0KH 2F4VH 4LF7H 2FE3A 3PN1A 3H20A 5D1OA 4PDBA 1HR0H 3LMLA 4MTEA 1A0IA 2WE6A 4EFEA 1S03G 4LH7A 4LF4H 3T1HH 1XNRH 4DUZH 4LF5H 3RGXA 3L2PA 3BA8A 4RB1A 4JI6H 5IT9W 3FAUA 4JV5H 1ZHQA 5FD6A 5D1OB 3M4IA 4GKKH 2UXBH 4IAJA 1P8LA 3SB1A 2UUCH 2YCHA 3J7AK 4YHHH 1X9NA 2VQEH 3IG0A 3RTXA 1IBMH 4JI0H 3N44B 4LSAA 4AQYH 3N6XA 1M0TA 2MCTA 4MV9A 1J5EH 3J80W 3KDKA 4X62H 1Z2OX 3MWMA 4RB2C 4GLXA 2PT7G 1GYFA 1DGSA 1BGWA 1Z2PX 3KAJA 1MZBA 4MV7A 5FD5A 1M0WA 5FPOA 4E9JA 4LF8H 3QD7X 3UQ8A 3RIZA 2XIGA 4MTDA 3RF2A 1XNQH 3HXLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B3M H;  4LFA H;  4B3R H;  1N34 H;  4JI3 H;  1N36 H;  4DR4 H;  4DR1 H;  1HNW H;  4KHP H;  3J81 W;  4B3S H;  5LL6 b;  3T1Y H;  4GKJ H;  4JYA H;  4X64 H;  1HNX H;  1I94 H;  4DV4 H;  4YY3 H;  1N32 H;  2UXD H;  4JI5 H;  2UXC H;  4LFC H;  2VQF H;  3JAM W;  4DV0 H;  5IWA H;  1N33 H;  4DUY H;  1IBL H;  5FLX W;  4DR2 H;  4DV3 H;  4DR6 H;  2ZM6 H;  4NXM H;  4X66 H;  4DV5 H;  2HHH H;  4JI4 H;  4LF9 H;  4DV7 H;  4DV2 H;  4JI2 H;  4DR3 H;  2UUA H;  1HNZ H;  2UU9 H;  1AN7 A;  1IBK H;  1I6U A;  4OX9 H;  4JI1 H;  5LMU H;  4JI8 H;  4LFB H;  4DR7 H;  4JI7 H;  4LF6 H;  1XMQ H;  5LMN H;  2E5L H;  1FJG H;  4X65 H;  4DR5 H;  4NXN H;  2UUB H;  4DV6 H;  3OTO H;  4DV1 H;  1FKA H;  4B3T H;  1SEI A;  5BR8 H;  5A2Q W;  1XMO H;  4K0K H;  2F4V H;  4LF7 H;  3RF2 A;  4PDB A;  1HR0 H;  1S03 G;  3T1H H;  1XNR H;  4DUZ H;  4LF5 H;  4JI6 H;  5IT9 W;  4JV5 H;  4GKK H;  2UXB H;  2UUC H;  3J7A K;  4YHH H;  2VQE H;  1IBM H;  4JI0 H;  4AQY H;  3J80 W;  4X62 H;  1J5E H;  4LF8 H;  4LF4 H;  1XNQ H; 
#chains in the Genus database with same CATH topology
 3GTG A;  3VPC A;  4B3M H;  2R7M A;  4YJ2 F;  4Q44 A;  3T5J A;  1N34 H;  4DR4 H;  2RDI A;  3G6V A;  5DGB A;  4J9L A;  2ANN A;  4O2B F;  4RZR A;  2I8C A;  3HOZ G;  3LWB A;  3UOE A;  4B3S H;  5CA1 F;  2XCA A;  2X0S A;  3GID A;  1AUV A;  4X64 H;  2CTE A;  1HNX H;  2FK2 A;  1I94 H;  1E4G T;  2YRX A;  2W8K A;  2W6N A;  1T3N A;  3I4N G;  4LFC H;  2BQ3 A;  1GSH A;  4FBU A;  2WDT A;  2XC9 A;  5J2T F;  3V4S A;  3GIL A;  4UCR A;  3PVX A;  3K3V A;  1TA8 A;  3PR4 A;  4LIJ A;  4UCS A;  4IRD A;  1MSZ A;  5K36 G;  2NU7 B;  5KFQ A;  4DR2 H;  4F4Y A;  4TV9 F;  4J9Q A;  3Q1K A;  4NLG A;  2DWC A;  3N42 B;  1N48 A;  2JE6 I;  2UVU A;  1RJR A;  2I87 A;  3FMA A;  3MFH A;  3CQZ A;  4A3G G;  2ASL A;  4JI4 H;  5HBR B;  2J6U A;  1UG8 A;  1C30 A;  1Y1W A;  1X9Z A;  1B04 A;  3PW2 A;  3OUU A;  5KFL A;  3T5L A;  3TQT A;  4IWX A;  4ED0 A;  2W6Z A;  5LYJ F;  3U9S A;  3N41 B;  4ED2 A;  3MR6 A;  4GC7 A;  3HOY G;  4IFD G;  4FJS A;  1IOW A;  2W9A A;  1WR2 A;  2XCL A;  5LMU H;  3UFX B;  4EGJ A;  3AEV B;  2R7Z G;  1EUC B;  2NU8 B;  5F9L A;  2ZQE A;  3BAB A;  4LFB H;  4UCO A;  1TWC A;  3BA9 A;  2VPS A;  3K3P A;  4YR0 A;  2OPV A;  2NU9 B;  3TIN A;  3EZJ A;  2Y0S E;  3TII A;  3BQ1 A;  4MV4 A;  3ORQ A;  2CW7 A;  1WCM A;  4ED7 A;  4X65 H;  2BR0 A;  4HNU A;  4J9S A;  3TQ1 A;  2AGP A;  3H0G A;  4WAN A;  1S10 A;  2VR1 A;  1Y14 B;  1M7J A;  2WYO A;  4RB3 C;  2RGR A;  3KXY T;  5EOY A;  2W6Q A;  2BA0 A;  3DF7 A;  2QYZ A;  4RB0 A;  3JSL A;  5KFW A;  4AIM A;  2VA2 A;  4BBR G;  3GV7 B;  3KAK A;  1V8C A;  4ETS A;  4ECW A;  2JA9 A;  1EHI A;  2R7K A;  5KFU A;  4LF7 H;  4DLK A;  1PK8 A;  5D1O A;  4YQW A;  2IP4 A;  2W7O A;  2BQU A;  2R86 A;  2Y0S A;  3HBL A;  4ECX A;  3QFF A;  1CE8 A;  4R8U B;  5L9X A;  1VBH A;  3G6X A;  5JVD F;  3T1H H;  2OLS A;  5IYC G;  2VQD A;  2XGP A;  1SCU B;  2WB1 E;  2CPM A;  4C5B A;  5DG8 A;  2JA5 G;  5D1O B;  5KFF A;  2UXB H;  4IAJ A;  4RNM A;  2P2R A;  5EWE A;  4PWQ A;  1S9F A;  1X9N A;  2JEB I;  1DTJ A;  2V59 A;  2W71 A;  5KT7 A;  1IBM H;  4JI0 H;  2DLN A;  3N44 B;  4LSA A;  2CTL A;  5KFO A;  4J9N A;  5KG0 A;  1M0T A;  3GTL A;  2NVX A;  1X0A A;  3MWD A;  3MWM A;  2J6S A;  4ECT A;  5DLG A;  1X4M A;  3Q8S B;  3KAJ A;  1Z2P X;  3JZI A;  5FD5 A;  5IYB G;  4YP3 A;  2FK1 A;  2R84 A;  3BG5 A;  5KFI A;  3EPG A;  4MV8 A;  3PW5 A;  2AXY A;  3RIZ A;  4YAK B;  3PW7 A;  3RF2 A;  3HXL A;  5IYZ F;  2W6O A;  3NCV A;  4CC6 A;  4RNO A;  2YL2 A;  4LMY A;  2W6M A;  2CTF A;  4HNT A;  1VS0 A;  2YZN A;  4EFB A;  2ZDG A;  4AYB A;  2R92 G;  4A93 G;  1N36 H;  4ECZ A;  1WTJ A;  4KHP H;  2YQR A;  3G6Y A;  2V5A A;  5DQG A;  2WAQ E;  5FJ8 G;  3I4M G;  3WO0 A;  4XYL B;  3K5H A;  2LRR A;  5LL6 b;  4J0M A;  2OH2 A;  5LA6 F;  3T1Y H;  3VPB A;  3GIJ A;  3SE7 A;  2GLT A;  3KDG A;  1KC7 A;  3OSN A;  1CS0 A;  4YY3 H;  2AQ4 A;  2C22 A;  3GTO A;  1WHR A;  1WVN A;  2UXD H;  4QIW E;  2JZX A;  2W57 A;  1DV2 A;  5KG1 A;  3SI8 A;  2UXC H;  3HOU G;  1TWG A;  2VQF H;  3MR3 A;  4AYB E;  2AGQ A;  2R82 A;  4XYM B;  5C1O A;  1GSA A;  1N33 H;  3RV4 A;  2R93 A;  2KSW A;  3JRX A;  4DUY H;  1UC8 A;  4R7R A;  4ED3 A;  2CWH A;  1VIG A;  3PW4 A;  5JH7 F;  2WAQ A;  5KFK A;  3GIM A;  2VKC A;  3RJ0 A;  3OHA A;  3Q2O A;  2ZM6 H;  3R23 A;  4NXM H;  4HQ6 A;  1GGO A;  1JLL B;  5C8Y F;  4DL4 A;  4UCV A;  2DPJ A;  5EWG A;  2R6F A;  1UC9 A;  2HHH H;  2C00 A;  1SYX B;  1R9T A;  2Q2T A;  4DV7 H;  4RAY A;  4Q8E A;  3EYY A;  4I55 F;  4IR1 A;  4DV2 H;  4J9R A;  3BAA A;  2K1H A;  4MA0 A;  5BPF A;  2WTF A;  4DR3 H;  3OUZ A;  3MR2 A;  2UU9 H;  3HKZ E;  3GV8 B;  5L1J A;  2IBK A;  1IBK H;  4IZO A;  4JV2 A;  1S0M A;  4QWA A;  1I6U A;  1RK6 A;  2PVP A;  2VUG A;  4OX9 H;  4A3B G;  1T36 A;  1S68 A;  2O4C A;  1ZHS A;  2ASD A;  4BA1 I;  1WSC A;  4HR7 A;  2O03 A;  4C2M A;  5JUM A;  1CQI B;  4MV1 A;  4YR2 A;  3PR5 B;  3PW0 A;  5F9N A;  1JDB B;  1EUD B;  2E5L H;  4FM9 A;  2FPH X;  2JA7 G;  1ZQ7 A;  3BQ0 A;  4A3C G;  1ULZ A;  1B33 N;  5K2M A;  1ZZI A;  2UUB H;  3M9N B;  2R8H A;  5DGA A;  1ZET A;  4XZ3 B;  3Q8Q B;  4A3I G;  2VUM G;  2LF0 A;  4B8T A;  4Q43 A;  3HOW G;  1Z2I A;  4QW8 A;  1DT4 A;  4NZT M;  4YJ3 F;  4CC5 A;  4A3L G;  4O3P A;  4J9O A;  5KFA A;  4HNV A;  2HVS A;  1FKA H;  3F8N A;  2FB9 A;  3KTM A;  3BQ2 A;  2HJW A;  4Q8F A;  3V69 A;  3GIQ A;  5KT5 A;  3OSP A;  3PN1 A;  3H20 A;  2V4Q A;  2JA6 G;  1AUX A;  2PBZ A;  5KFE A;  3T5H A;  4PDB A;  2RF4 A;  3LML A;  4MTE A;  2JEI A;  2W70 A;  1S03 G;  5DG9 A;  1VKZ A;  4ECU A;  4IRK A;  1XNR H;  4DUZ H;  3RUP A;  3RGX A;  3H3V H;  4L1K A;  5KFM A;  2B63 G;  4ZHQ F;  1ZHQ A;  3M9M B;  3ORR A;  4RUC A;  2XD4 A;  2M8W A;  2E3U A;  2RDJ A;  2UUC H;  2LTM A;  3KHG A;  1K83 A;  2VQE H;  4F4Z A;  3RTX A;  4RUA A;  2FKL A;  2M6Q A;  4AQY H;  1ZTG A;  2ZDQ A;  3FKI G;  3N6X A;  4TV8 F;  3J80 W;  4BBS G;  4ED6 A;  1WE8 A;  1WCM G;  1GYF A;  2XCP A;  4EBC A;  1DGS A;  1KJ9 A;  3H0G G;  4J9K A;  1M0W A;  2YW2 A;  2ATL A;  2QND A;  3EPI A;  4DL7 A;  3GII A;  4MTD A;  2FMR A;  4LF4 H;  1ZZJ A;  4Q0Y A;  5DG7 A;  4EBE A;  4JV0 A;  4B3R H;  1TWF A;  1TAE A;  4JVY A;  2RGV A;  3N8D A;  2FLN A;  4DR1 H;  1HNW H;  1VBI A;  4UCT A;  1GLV A;  4ECQ A;  2Q2U A;  1RK5 A;  3GIP A;  2VA3 A;  4M9U A;  4DL6 A;  4A2A A;  4O3O A;  2W6P A;  3BJY A;  3N40 P;  4G08 A;  3KHH A;  1K1G A;  2CTM A;  4R8U A;  5DQH A;  3Q8R B;  4Q45 A;  3GLK A;  4IWY A;  4GKJ H;  5JQW A;  2C2R A;  4JYA H;  2OWO A;  3GKU A;  3HOX G;  4APM A;  1DIK A;  4A2B A;  1FVI A;  4YB8 B;  5CB4 F;  2FK3 A;  4DV4 H;  2YZM A;  2JEF A;  4RAZ A;  4EEQ A;  4JI5 H;  5KFR A;  3KHR A;  3RBD A;  2R8J A;  2XGQ A;  2IMW P;  4DV0 H;  2R8I A;  3JRW A;  4MV3 A;  1J4W A;  3GTP A;  4RZQ A;  1IBL H;  2Z0S A;  4M7E A;  4DL2 A;  5FLX W;  1EZ1 A;  3ETJ A;  4DV3 H;  4DR6 H;  3QZ7 A;  4YBZ B;  4O2A F;  5KT3 A;  1KJ8 A;  4ED8 A;  1F0X A;  4X66 H;  2C28 A;  1RJQ A;  1KEE A;  1Y1W G;  4QW9 A;  2DIK A;  3C0F B;  5KFG A;  4ED1 A;  3V4Z A;  4LF9 H;  5JEA G;  4ZI7 F;  3OET A;  3AYH B;  1V9P A;  2FP4 B;  2R8K A;  4J9M A;  3GTQ A;  4A3K G;  2P0A A;  2W7P A;  4ECS A;  1IOV A;  4UCU A;  2FLP A;  4A3J G;  4JI2 H;  1S97 A;  2CTJ A;  1HNZ H;  2GPW A;  4C5A A;  5LOV F;  1W93 A;  4MAM A;  1SFO A;  2BQR A;  2X06 A;  2CQY A;  4QWD A;  4JI8 H;  1Y1V G;  3RB6 A;  2DZD A;  5CAE B;  2FLL A;  4EYH B;  3RAX A;  3L7Z C;  4LF6 H;  1K1S A;  5LMN H;  2FJZ A;  4B8C D;  4JVH A;  2YZG A;  4IHJ F;  5KFY A;  4YR3 A;  5D8D A;  4DL3 A;  2W9C B;  4I4T F;  2R7N A;  4RU9 A;  2C2E A;  4EBD A;  4HYK A;  1XRH A;  5L1K A;  2C35 B;  4C5C A;  3CVZ A;  2FPG B;  4MV6 A;  3E5N A;  1A9X A;  3MR5 A;  4ZOL F;  3GTK A;  2CWF A;  3GR5 A;  4EGQ A;  1N56 A;  5KFZ A;  2PY9 A;  3MWE A;  2R85 A;  3ETH A;  1BJT A;  5KG4 A;  3L4K A;  5C4X G;  3VPD A;  4DV1 H;  4I7H A;  1SEI A;  4OO1 G;  5D1P A;  3HB9 A;  1KHM A;  2QK4 A;  3WNZ A;  5A2Q W;  1I3Q A;  5FLM G;  4WBN F;  5H80 A;  4ECR A;  2AGO A;  4TUY F;  4EEY A;  5DQI A;  3PZP A;  1A0I A;  4EFE A;  3OHB A;  1TWH A;  4LH7 A;  4WD3 A;  1M6V A;  4DL5 A;  3KHL A;  2PMZ A;  5KFD A;  4LF5 H;  5IYD G;  1VIH A;  2W9B A;  3BA8 A;  1V51 A;  4ECV A;  2AU0 A;  5JVL A;  2JA6 A;  1DV1 A;  4JI6 H;  4QWB A;  3I0P A;  2WB1 A;  4EYI B;  4U7C A;  2J6T A;  3FAU A;  4JV5 H;  1CQJ B;  4QIW A;  3Q8P B;  1RYR A;  3M4I A;  3GTM A;  2JA5 A;  3GIK A;  2E2H A;  3SB1 A;  2YCH A;  4FU0 A;  3J7A K;  4YHH H;  5J2U F;  2UVV A;  5C44 G;  3V6H A;  4O3S A;  3R5H A;  1I7L A;  1OWT A;  2YRW A;  1I50 A;  2HH2 A;  2ALZ A;  2GPS A;  4RB2 C;  3KDK A;  1Z2O X;  2CZG A;  4QWE A;  4GC6 A;  4GLX A;  4G3I A;  2JA7 A;  4MV7 A;  1BGW A;  5KFC A;  2UVR A;  2SCU B;  5KT4 A;  3QD7 X;  4WAL A;  3UQ8 A;  5T14 A;  4FBT A;  3V6K A;  4AM3 A;  1XNQ H;  5KFX A;  3NGD A;  2ZDH A;  1J5K A;  1GSO A;  4LFA H;  2HGS A;  5C1P A;  4BY7 G;  2R92 A;  2D9I A;  2R8G A;  1O75 A;  4JI3 H;  2IA6 A;  1RYS A;  1KJQ A;  4O3R A;  4JV1 A;  5CA0 F;  3J81 W;  3U9T A;  4FS1 A;  4A3F G;  4MA5 A;  1EC6 A;  1E4F T;  3RGZ A;  2R7Z A;  2PN1 A;  3I12 A;  5L1I A;  3WO1 A;  2YU9 A;  1V4Y A;  1PX2 A;  3RB3 A;  3VKE A;  4LSX A;  2W9B B;  4ME6 A;  4JUZ A;  3H4D A;  2JEJ A;  2E2I A;  4OCH A;  5DT9 A;  1JIH A;  2YS6 A;  2VOB A;  1Z2N X;  3N43 B;  1N32 H;  2UVW A;  3PO3 G;  2A1S A;  3T5K A;  3TIG A;  4RNN A;  5I47 A;  4OD6 A;  1KJI A;  3JAM W;  2I80 A;  1E4E A;  3MJF A;  5IWA H;  5KFP A;  2VPQ A;  5KKN B;  2HH3 A;  1S0O A;  2R93 G;  2CPQ A;  1KBL A;  1S0N A;  3PO2 G;  4I50 F;  5KT2 A;  3OSS D;  3H40 A;  1RJP A;  4ZQI A;  3L4J A;  2FMA A;  3R5X A;  4XX0 B;  1XDN A;  4O4H F;  1S20 A;  1B6R A;  4NBQ A;  1ZZK A;  2JEA I;  1K1Q A;  4FJU A;  4DV5 H;  3JSN A;  4O4L F;  2CTK A;  1E4E B;  2V9W A;  3RBE A;  3GTJ A;  4FS2 A;  4A3M G;  5C0X G;  3H4B A;  5KFH A;  5EWF A;  1JKJ B;  4UFZ A;  4QWC A;  3HOV G;  2OPU A;  2YS7 A;  3R5F A;  4O3N A;  4H8A A;  2C2D A;  4YAJ B;  1L2Z A;  2HVQ A;  3MFI A;  3GQC A;  5BMV F;  2UUA H;  4F4W A;  2M05 A;  3LP8 A;  4BWS C;  1AN7 A;  1TUA A;  1X4N A;  1VAJ A;  1V9N A;  5KFJ A;  2HVR A;  3FDS A;  2CKZ B;  4JI1 H;  2ANR A;  4NZR M;  2CW8 A;  4BXX G;  3K5I A;  2W8L A;  2YYA A;  5LXT F;  4DR7 H;  1XMQ H;  4JI7 H;  1JDE A;  2NU6 B;  4IR9 A;  3VMM A;  4O4I F;  2JA8 G;  4LH6 A;  2ASJ A;  5KG6 A;  4TQR A;  1FJG H;  1Y1V A;  3G8C A;  5KG3 A;  1EYZ A;  3RB4 A;  2V58 A;  2Y3M A;  4DR5 H;  5IP9 G;  4NXN H;  5DLF A;  2PMZ E;  5FPR A;  1W96 A;  1PQX A;  4DV6 H;  5IP7 G;  3GAB A;  2NN6 G;  1UNN C;  2V4R A;  1BXR A;  5KFT A;  4A3E G;  2VUM A;  4EC5 A;  1WH2 A;  3OTO H;  4Y8V B;  4E4T A;  2LTL A;  1ODH A;  2W9C A;  4B3T H;  1T94 A;  2ZJT A;  1I7N A;  3GV5 B;  2DGR A;  5BR8 H;  5KG2 A;  3HKZ A;  1XMO H;  5C5J A;  4K0K H;  2F4V H;  2FE3 A;  2R7L A;  5LP6 F;  2JVZ A;  5KT6 A;  1TWA A;  3U1K A;  1HR0 H;  2WE6 A;  5KG7 A;  4F4X A;  1B6S A;  5HV6 A;  4IRC A;  1NXU A;  1BNC A;  1GO3 E;  1VBG A;  2FPP B;  2R87 A;  4BA2 I;  3L2P A;  2B63 A;  5BPH A;  4A3D G;  2J9G A;  1KJJ A;  4RB1 A;  5EZY F;  2PQU A;  4EG0 A;  5EDW A;  5IT9 W;  3QZ8 A;  5GON F;  2G8Y A;  3RV3 A;  2FPI B;  5FD6 A;  4U6P A;  2DPI A;  4GKK H;  3RFC A;  3RAQ A;  4O3Q A;  1P8L A;  5KFS A;  1C3O A;  1JXL A;  3IG0 A;  3FKI A;  4J9P A;  2MJH A;  3RB0 A;  4QMF B;  4BY1 G;  2MCT A;  4MV9 A;  1J5E H;  4X62 H;  2NUA B;  5KFN A;  5C3E G;  2NVY A;  2PT7 G;  5KFB A;  3IN5 A;  1MZB A;  5FPO A;  2JEG A;  2FFM A;  5L1L A;  4E9J A;  3M9O B;  3V6J A;  5KG5 A;  5KX5 F;  4TQS A;  4LF8 H;  2XIG A;  5KFV A;  4ECY A;  4QJF A;  3KAL A;  2BL5 A;  1JX4 A;  4F50 A; 
#chains in the Genus database with same CATH homology
 4Q0Y A;  3NCV A;  4CC6 A;  4B3M H;  4LMY A;  2HGS A;  4LFA H;  4B3R H;  1N34 H;  1TAE A;  1VS0 A;  2D9I A;  2RGV A;  4EFB A;  1O75 A;  4JI3 H;  1N36 H;  4DR4 H;  4DR1 H;  1HNW H;  2Q2U A;  4UCT A;  4KHP H;  3J81 W;  4A2A A;  1E4F T;  4B3S H;  3N40 P;  3RGZ A;  5LL6 b;  4G08 A;  4J0M A;  2OWO A;  3T1Y H;  4GKJ H;  4JYA H;  4LSX A;  4X64 H;  1HNX H;  4APM A;  3KDG A;  4OCH A;  1I94 H;  5DT9 A;  1E4G T;  1FVI A;  4A2B A;  4DV4 H;  4YY3 H;  4RAZ A;  2VOB A;  1Z2N X;  3N43 B;  1N32 H;  2UXD H;  4JI5 H;  2W57 A;  4EEQ A;  2UXC H;  4LFC H;  4OD6 A;  2VQF H;  3JAM W;  4DV0 H;  2WDT A;  5IWA H;  1N33 H;  2KSW A;  4R7R A;  4DUY H;  4UCR A;  3K3V A;  1TA8 A;  4RZQ A;  1IBL H;  4UCS A;  3OSS D;  4M7E A;  5FLX W;  3L4J A;  4DR2 H;  4DV3 H;  2VKC A;  4DR6 H;  1XDN A;  3RJ0 A;  2ZM6 H;  3N42 B;  4NXM H;  1F0X A;  4X66 H;  3FMA A;  3JSN A;  4UCV A;  4DV5 H;  2HHH H;  4JI4 H;  3C0F B;  4LF9 H;  1SYX B;  1X9Z A;  1B04 A;  2Q2T A;  3OET A;  4DV7 H;  4RAY A;  1V9P A;  3EYY A;  4UFZ A;  1L2Z A;  4DV2 H;  2HVQ A;  3BAA A;  4UCU A;  4JI2 H;  4DR3 H;  2UUA H;  1HNZ H;  2UU9 H;  3N41 B;  4BWS C;  1AN7 A;  1IBK H;  1I6U A;  2VUG A;  2HVR A;  4OX9 H;  4JI1 H;  5LMU H;  4JI8 H;  4NZR M;  1ZHS A;  1S68 A;  2O4C A;  2CW8 A;  2ZQE A;  3BAB A;  4LFB H;  4DR7 H;  1XMQ H;  4JI7 H;  4LF6 H;  5LMN H;  2O03 A;  4B8C D;  2VPS A;  3BA9 A;  4UCO A;  4LH6 A;  3EZJ A;  4FM9 A;  2E5L H;  2FPH X;  1FJG H;  2CW7 A;  4X65 H;  2Y3M A;  4DR5 H;  4NXN H;  2UUB H;  3CVZ A;  5FPR A;  4RB3 C;  2WYO A;  3KAL A;  4DV6 H;  2RGR A;  2LF0 A;  3GAB A;  3KXY T;  5EOY A;  3GR5 A;  3DF7 A;  4EC5 A;  4NZT M;  4RB0 A;  3L4K A;  3JSL A;  1BJT A;  3OTO H;  1WH2 A;  4CC5 A;  1ODH A;  4DV1 H;  1FKA H;  2HVS A;  4B3T H;  2ZJT A;  3F8N A;  1SEI A;  4I7H A;  3KAK A;  5D1P A;  4ETS A;  5A2Q W;  5BR8 H;  1XMO H;  4K0K H;  2F4V H;  4LF7 H;  2FE3 A;  3PN1 A;  3H20 A;  5D1O A;  4PDB A;  1HR0 H;  3LML A;  4MTE A;  1A0I A;  2WE6 A;  4EFE A;  1S03 G;  4LH7 A;  4LF4 H;  3T1H H;  1XNR H;  4DUZ H;  4LF5 H;  3RGX A;  3L2P A;  3BA8 A;  4RB1 A;  4JI6 H;  5IT9 W;  3FAU A;  4JV5 H;  1ZHQ A;  5FD6 A;  5D1O B;  3M4I A;  4GKK H;  2UXB H;  4IAJ A;  1P8L A;  3SB1 A;  2UUC H;  2YCH A;  3J7A K;  4YHH H;  1X9N A;  2VQE H;  3IG0 A;  3RTX A;  1IBM H;  4JI0 H;  3N44 B;  4LSA A;  4AQY H;  3N6X A;  1M0T A;  2MCT A;  4MV9 A;  1J5E H;  3J80 W;  3KDK A;  4X62 H;  1Z2O X;  3MWM A;  4RB2 C;  4GLX A;  2PT7 G;  1GYF A;  1DGS A;  1BGW A;  1Z2P X;  3KAJ A;  1MZB A;  4MV7 A;  5FD5 A;  1M0W A;  5FPO A;  4E9J A;  4LF8 H;  3QD7 X;  3UQ8 A;  3RIZ A;  2XIG A;  4MTD A;  3RF2 A;  1XNQ H;  3HXL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...