3JAMW

Cryoem structure of 40s-eif1a-eif1 complex from yeast
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
129
structure length
129
Chain Sequence
TRTSVLADALNAINNAEKTGKRQVLIRPSSKVIIKFLQVMQKHGYIGEFEYIDDHRSGKIVVQLNGRLNKCGVISPRFNVKIADVEKWTANLLPARQFGYVILTTSAGIMDHEEAHRKHVSGKILGFVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational Differences between Open and Closed States of the Eukaryotic Translation Initiation Complex.
pubmed doi rcsb
molecule keywords 18S rRNA
source organism Saccharomyces cerevisiae
molecule tags Translation
total genus 29
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
W PF00410 Ribosomal_S8 Ribosomal protein S8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.30 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 3jamW01
3.30.1490.10 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3jamW02
4LF8H 4X65H 3T1YH 4LF9H 1HNWH 2UUCH 4B3RH 4K0KH 4DV4H 4DV2H 4LFAH 3T1HH 4DR7H 2UU9H 1I6UA 1N33H 2UXBH 2VQFH 5LL6b 4GKJH 5A2QW 1FKAH 1IBMH 4DV6H 4B3MH 4X66H 4JI6H 1N32H 1HNZH 4B3SH 2VQEH 2E5LH 1N34H 5BR8H 4JI7H 3J80W 4NXMH 4DR2H 1XNRH 2F4VH 1HNXH 1XMQH 4X64H 4DV3H 1I94H 4KHPH 4OX9H 1XMOH 4DV1H 2UXDH 5LMUH 4LFBH 4YY3H 4DV0H 1FJGH 4LF5H 4GKKH 4DV5H 2UXCH 4JI4H 4LF7H 4DV7H 4DR5H 3J81W 1N36H 4JV5H 4JI3H 1S03G 2HHHH 2ZM6H 4DR3H 4B3TH 3OTOH 4JYAH 4DR4H 3JAMW 1IBLH 1AN7A 4LFCH 3J7AK 5LMNH 3RF2A 2UUAH 4LF6H 4AQYH 4JI8H 4NXNH 4X62H 1J5EH 1SEIA 5IT9W 1HR0H 5IWAH 5FLXW 4DUYH 1IBKH 4DUZH 4JI1H 4JI0H 4JI5H 4DR1H 1XNQH 4JI2H 4YHHH 2UUBH 4LF4H 4DR6H 4PDBA
chains in the Genus database with same CATH superfamily
3K3VA 2FK1A 5BMVF 2B63G 4A3IG 2HVSA 3UFXB 3T1YH 5EWFA 1CQIB 4O3OA 1AUVA 2W9CA 2WAQA 4YR0A 2XD4A 4B3RH 2Y0SA 1KJJA 4YAJB 5C3EG 4DV2H 2ASDA 3N8DA 3N43B 4DR7H 3U9SA 2CKZB 3MJFA 1I6UA 4Q43A 1PK8A 1N33H 2JA5A 2C2EA 2WE6A 3GTJA 1EUCB 1M0WA 1CE8A 3V4SA 3R5XA 5C8YF 2BR0A 2YQRA 1Z2OX 4GKJH 4C5AA 1K83A 1VIGA 1WH2A 1DT4A 3CQZA 3JRWA 2CPQA 2JA9A 2NU8B 2OPVA 1TWCA 3GIQA 3BG5A 4QW9A 3QFFA 4J9PA 2RGRA 3KAJA 4BY1G 4HNUA 3N44B 1Y1WA 1EHIA 2FK2A 3WO0A 3PO2G 4XX0B 2OPUA 2SCUB 4BBRG 3FAUA 3KHRA 4DL2A 2PMZE 1L2ZA 3RIZA 2FLPA 5KFGA 2W8KA 3M9NB 4Q44A 5KFCA 4JI7H 2YW2A 1VBIA 4OD6A 3J80W 3FKIG 3PW4A 2UVRA 2QK4A 3JRXA 4YR2A 5IYCG 2R8IA 3RGXA 2RDJA 2R7ZA 1W96A 2JEAI 2IBKA 1TUAA 4MV3A 2WYOA 2B63A 4JVYA 4RB1A 1XNRH 5J2TF 1HNXH 5DGAA 3HBLA 4DV3H 5JQWA 2FMRA 5KFEA 4OX9H 4MAMA 2W70A 4LSAA 5KFSA 5KG4A 4DV1H 2J6SA 4EG0A 2XCAA 4EBDA 3PZPA 1BXRA 2M8WA 1CS0A 3C0FB 1P8LA 3R23A 4IRKA 5FPOA 4B8TA 2HH3A 4UCTA 4EYIB 5KFFA 4JV1A 3RV3A 4IRCA 5EWEA 4IR9A 2AQ4A 4DL6A 1TWFA 4M7EA 2CW8A 5KT4A 3ETHA 4ED3A 2XGQA 4EBEA 2R86A 4EC5A 4LMYA 4ECTA 2V9WA 3GIKA 1AUXA 1SCUB 3G6YA 5L1IA 1X9ZA 2M05A 4XYMB 2R92A 4OCHA 2YZGA 4DR5H 3VPCA 4MV7A 4FJSA 1E4FT 1WCMA 2KSWA 2OWOA 1I7LA 4A3KG 5KFAA 3PW2A 4BY7G 5HV6A 3U1KA 4JI3H 3BA9A 2LTMA 2ANRA 1S03G 5I47A 5KT3A 4ECVA 2ZM6H 4GLXA 2AGQA 3LWBA 2W6OA 4B3TH 1M7JA 2XCPA 4AIMA 4JYAH 5KFZA 4GC6A 4DR4H 3JAMW 5HBRB 4HNVA 2NUAB 3RBEA 1XRHA 3J7AK 3VPDA 5KFTA 2UUAH 3N6XA 5KFQA 4YJ2F 3MR6A 1UC8A 4YBZB 5D1OB 3GTGA 1J5EH 1WR2A 2YYAA 5IT9W 4ETSA 2RDIA 4G08A 5F9LA 3CVZA 3PW0A 4O4HF 4O2BF 4OO1G 4R7RA 4XYLB 1ZZIA 3GTQA 4ECQA 4BA2I 2FK3A 1IBKH 4J9RA 4APMA 2LRRA 2W57A 2JA6G 5KFHA 1VIHA 2WAQE 1Y1VG 3JSLA 4HNTA 2Y0SE 5FPRA 2XGPA 1A9XA 3H0GG 2E3UA 2W9BA 3RB3A 1C3OA 5KFMA 2YZNA 1ULZA 4O2AF 3ORRA 1S20A 4JI2H 2YU9A 4YHHH 1JX4A 4A2AA 4I50F 1V4YA 4DR6H 1E4GT 2NU6B 5KG2A 4WALA 4YP3A 3AEVB 4UCVA 4LF8H 3GIIA 1K1GA 4ED2A 4YB8B 4A93G 3RTXA 2ZDGA 4LF9H 1GLVA 2NN6G 4EEYA 2FMAA 2NU9B 4JUZA 4LFAH 3PN1A 1E4EA 3GV7B 4ECXA 2X06A 3NCVA 5KFKA 2FLNA 5C0XG 3MFHA 2UU9H 3KHGA 5KFXA 5GONF 3L2PA 2VQFH 3KTMA 3KXYT 4E9JA 5JVDF 4ED0A 1TWHA 5DLFA 2R7MA 1S0NA 3Q1KA 1JDEA 2Z0SA 4QWAA 3H4DA 3GTMA 1IBMH 2A1SA 1I50A 4ED7A 4Q0YA 3OSSD 2DLNA 4GC7A 2ZDQA 4RAZA 2AXYA 1MSZA 1JIHA 4IFDG 3BAAA 3RJ0A 3GKUA 5L1LA 4DL4A 2IA6A 1N32H 3Q8SB 4AM3A 5C1OA 1ZQ7A 5IP9G 3I12A 3G6XA 3BQ1A 4B3SH 4UCOA 4UCUA 2R93G 2VQEH 4UFZA 1FVIA 2MCTA 2E5LH 1W93A 3U9TA 5BR8H 1TA8A 4RUCA 4EYHB 3QZ7A 4DL7A 4IWYA 1EZ1A 4MTDA 4HYKA 4ZI7F 4ZHQF 2BQRA 1Y14B 2R84A 3Q8QB 5IYZF 3GLKA 4A3BG 1IOVA 4J9OA 1KBLA 2F4VH 4R8UA 2XIGA 3MR5A 1I94H 4KHPH 2PT7G 4I4TF 3H40A 3KHLA 1X9NA 5C44G 1GO3E 1ZHSA 5H80A 2V4RA 2OH2A 3OSPA 5KFBA 3F8NA 2UXDH 3LP8A 4QW8A 1DV2A 4ECYA 2CW7A 2VPQA 5FJ8G 5EZYF 3GIJA 3SB1A 4JV0A 4I7HA 4EBCA 5L1JA 5IYDG 4YY3H 3PR4A 5JVLA 5KFLA 2W9CB 4RUAA 1VBHA 5KFOA 4TV9F 4RU9A 2VUMG 1FJGH 5F9NA 3V69A 1I7NA 1CQJB 2P2RA 4GKKH 3M4IA 4O3QA 5KG6A 4O3SA 2C2RA 5KT7A 1X4NA 1N48A 2UXCH 4RAYA 4FM9A 2VOBA 3I0PA 4BWSC 2ANNA 2RF4A 1KJ8A 3J81W 5FD5A 2CWFA 3BABA 3LMLA 5JUMA 3MR3A 3T5LA 1JLLB 1BJTA 5LOVF 2W6ZA 2R8JA 2HHHH 2W9AA 4J9KA 2JA7G 2R82A 3AYHB 2YL2A 4QJFA 5CA1F 4NLGA 2R7LA 2W6NA 3VMMA 4WBNF 4RB0A 2V59A 4C5CA 1IBLH 3WO1A 4WD3A 1AN7A 3GIMA 3RB6A 5DG9A 4A3DG 2R8KA 2YS6A 1KJIA 1JXLA 2C00A 4QWBA 4LF6H 3PVXA 3HOZG 2JEGA 5KG0A 4JI8H 1T36A 4IWXA 2D9IA 4U6PA 4EGJA 3L7ZC 3DF7A 5IWAH 4LH7A 5K2MA 1Z2PX 2VR1A 2QNDA 1RJQA 3IG0A 2ATLA 4JVHA 5FLXW 5DQIA 3EZJA 3L4JA 1KEEA 3H4BA 1DIKA 4DUZH 1TWAA 4JI0H 1M6VA 1ODHA 4DR1H 2PY9A 3QD7X 5LXTF 1RYSA 1XNQH 1A0IA 4O3NA 2UUBH 3MWDA 4C5BA 3FKIA 1UC9A 3PO3G 3VPBA 2CTEA 2DPJA 2PN1A 1GSAA 1M0TA 1ZETA 2JVZA 3K3PA 2RGVA 2HVRA 3HXLA 4X65H 3HOUG 2BA0A 3OSNA 2NU7B 4YJ3F 2ASJA 2QYZA 4TUYF 3KAKA 2OLSA 3T1HH 5IYBG 2CTLA 4J9MA 1XDNA 3HOYG 2HGSA 5CAEB 4XZ3B 4LH6A 3GABA 1ZTGA 5KFDA 2VKCA 2UXBH 5KFNA 3RBDA 4BBSG 2JE6I 5LL6b 3H20A 4Y8VB 1X4MA 5A2QW 2CZGA 3IN5A 3PW7A 4TQRA 4O3RA 4CC6A 1FKAH 5L1KA 2V5AA 1VKZA 4MV1A 3HKZA 1TAEA 1IOWA 4DV6H 2CTJA 4RZQA 1S0OA 4B3MH 2CTMA 1B33N 1C30A 2UVWA 3GTPA 3GR5A 4JI6H 4MV6A 3GTKA 1RJRA 4A3CG 4RNOA 1GSHA 5KFUA 4BXXG 2VPSA 2AGOA 1S97A 1S0MA 2FPGB 1N34H 3NGDA 2WDTA 3BJYA 3RAXA 5EDWA 4NZTM 2J6UA 2W7OA 2IMWP 4NXMH 4U7CA 3PR5B 1KJ9A 4BA1I 3Q8RB 2UVUA 3FMAA 3RFCA 2W8LA 2GLTA 2FLLA 1XMQH 4X64H 1BGWA 2VUGA 2V4QA 2W9BB 1B6RA 5KX5F 4A3JG 4M9UA 1PX2A 1XMOH 3RV4A 4FBUA 2JA5G 5CA0F 4O4LF 1JKJB 4UCRA 2XCLA 5D1PA 4FU0A 4ZOLF 1DV1A 2VA2A 3G8CA 1V51A 4ECSA 4UCSA 4LFBH 5CB4F 3GIDA 4F4WA 5BPFA 1R9TA 1JDBB 5KFRA 5DLGA 5BPHA 3BQ0A 3V6JA 2JEIA 2AU0A 2R85A 1NXUA 2P0AA 5IP7G 5L9XA 2AGPA 2Q2UA 2JA6A 1Y1VA 3Q2OA 3EYYA 3OETA 5D8DA 4C2MA 1ZZKA 2CWHA 3H0GA 3MFIA 5DT9A 1Y1WG 5KKNB 4AYBA 4DV5H 2XC9A 1SYXB 3M9OB 2R8HA 3T5KA 3MWEA 4QWDA 2C22A 4RZRA 4ECZA 3BA8A 1KHMA 3I4NG 1N36H 4JV5H 1RK6A 3TIGA 2DZDA 2FPPB 4J9NA 4Q8EA 1OWTA 3HB9A 3SE7A 2FP4B 2R7ZG 3L4KA 4DR3H 5DQHA 5KG7A 4ZQIA 1I3QA 5DG8A 2W6QA 5KFVA 5C1PA 1BNCA 4DLKA 4F4XA 3BQ2A 1DTJA 2R87A 1X0AA 2PQUA 2W6PA 3ORQA 4FBTA 4A3EG 4DL3A 4NXNH 4MA5A 4J9QA 1SEIA 4F50A 1HR0H 1EYZA 1GGOA 1EC6A 4Q45A 4A3GG 2I80A 3R5HA 2FPIB 5KFIA 1UG8A 3FDSA 3M9MB 1J5KA 4WANA 2PVPA 4ED1A 3RB0A 2GPSA 2C2DA 4ECWA 4ECRA 4H8AA 4JI1H 4R8UB 2DIKA 5EWGA 3RAQA 5KG5A 2R93A 4NBQA 3HOWG 2O03A 3K5IA 4QIWA 3TQTA 4RB2C 2YRXA 4LF4H 2CPMA 2DGRA 3KALA 3TINA 4IR1A 5JEAG 2R92G 2E2HA 3N42B 4FJUA 3E5NA 5FLMG 4DL5A 1WCMG 3GILA 2IP4A 1O75A 4MV9A 5KG3A 5KFPA 2R8GA 4YQWA 5DQGA 1HNWH 1KJQA 2UVVA 3H3VH 1WE8A 2UUCH 1RK5A 4B8CD 4K0KH 4DV4H 2BQ3A 2ASLA 3HKZE 5EOYA 2E2IA 4MV8A 4RB3C 4A3FG 2JEBI 2W71A 4FS1A 1K1SA 3TIIA 2JZXA 1S68A 2YCHA 4O4IF 4EEQA 1WVNA 2CQYA 4QWCA 4Q8FA 3GTLA 1B6SA 3HOXG 4J9LA 3VKEA 4QWEA 4MV4A 1UNNC 1Z2IA 2CTFA 5DGBA 2VUMA 1VAJA 5KFWA 2ALZA 2VQDA 3N41B 3K5HA 2C35B 3RB4A 3UOEA 4ME6A 3N40P 2Y3MA 4CC5A 4X66H 1RYRA 4HR7A 3OUZA 1WTJA 2WB1E 2HH2A 4TV8F 1HNZH 4MA0A 1RJPA 3KHHA 2R7NA 2MJHA 1V9PA 1VS0A 3WNZA 4IRDA 5D1OA 2VA3A 1T3NA 2JEJA 3RUPA 5KFJA 3G6VA 2LTLA 1K1QA 3PW5A 5FD6A 5LYJF 2YRWA 4IZOA 4ED6A 4J0MA 5K36G 4TQSA 2JA7A 1S10A 3HOVG 2R6FA 2ZDHA 2ZJTA 4IHJF 4DR2H 2PMZA 2JEFA 1N56A 1T94A 3JZIA 4IAJA 1SFOA 4MTEA 5DG7A 2G8YA 1ZHQA 4L1KA 1F0XA 1VBGA 2FB9A 2V58A 3GV5B 2JA8G 1J4WA 4AYBE 3EPIA 3QZ8A 4EFEA 3EPGA 1PQXA 2BQUA 5LMUH 4PWQA 1TWGA 2R7KA 4F4YA 4LSXA 3KDKA 3UQ8A 1B04A 2HJWA 3OHAA 2YZMA 4DV0H 3GQCA 1MZBA 4LF5H 5KT5A 4E4TA 3I4MG 4EFBA 4JI4H 4LF7H 2FKLA 2W6MA 4JV2A 4NZRM 2CTKA 4DV7H 3GIPA 5C4XG 4I55F 2FJZA 4ED8A 4G3IA 2WB1A 4YAKB 3SI8A 2NVXA 5KT6A 2FPHX 1Z2NX 2W7PA 4A3LG 2J9GA 3JSNA 4RNNA 2X0SA 3GV8B 2LF0A 1V8CA 4HQ6A 4ECUA 2C28A 3GTOA 2K1HA 2NVYA 3OHBA 4J9SA 4A3MG 3OTOH 3OUUA 1WSCA 3V6KA 2FE3A 3MR2A 2DWCA 4FS2A 2FFMA 5KG1A 2BL5A 4LFCH 3MWMA 5LMNH 2J6TA 3RF2A 2Q2TA 2ZQEA 5T14A 2GPWA 2O4CA 2I8CA 5JH7F 1WHRA 4AQYH 4YR3A 5LA6F 5KT2A 5KFYA 5LP6F 4X62H 1KC7A 4QIWE 3V6HA 2DPIA 3TQ1A 1GSOA 3KDGA 1E4EB 1ZZJA 2I87A 5J2UF 1GYFA 3ETJA 4LIJA 5C5JA 1V9NA 3T5JA 4EGQA 3T5HA 3Q8PB 1S9FA 4DUYH 2YS7A 2M6QA 3R5FA 2PBZA 3RGZA 4F4ZA 1DGSA 2WTFA 4JI5H 4PDBA 1EUDB 3V4ZA 4RNMA 2HVQA 4O3PA 4QMFB 4A2BA
chains in the Genus database with same CATH topology
3K3VA 3N42B 2HVRA 1M0TA 4UCVA 4LF8H 2RGVA 1O75A 3HXLA 4X65H 3T1YH 4MV9A 3RTXA 4LF9H 1HNWH 2HVSA 2UUCH 4B8CD 4B3RH 4K0KH 4DV4H 4DV2H 3KAKA 4LFAH 3T1HH 3PN1A 3N43B 4DR7H 1XDNA 5EOYA 3NCVA 4RB3C 2HGSA 2UU9H 1I6UA 3GABA 4LH6A 2VKCA 1N33H 2UXBH 2WE6A 3L2PA 2VQFH 5LL6b 4E9JA 1M0WA 3KXYT 3H20A 1Z2OX 4GKJH 5A2QW 1S68A 2YCHA 1WH2A 4EEQA 4CC6A 1FKAH 1IBMH 4Q0YA 3OSSD 1TAEA 4RAZA 2RGRA 4DV6H 3KAJA 3N41B 4RZQA 3BAAA 3N44B 3N40P 4B3MH 3RJ0A 2Y3MA 4CC5A 4X66H 3FAUA 3GR5A 4JI6H 1N32H 1HNZH 1L2ZA 4B3SH 3KALA 2VPSA 4UCOA 4UCUA 3RIZA 2VQEH 1V9PA 1FVIA 1VS0A 4UFZA 2MCTA 2E5LH 1N34H 5D1OA 2WDTA 5BR8H 4JI7H 1TA8A 4NZTM 4OD6A 3J80W 4NXMH 5FD6A 4MTDA 3RGXA 4J0MA 3FMAA 2WYOA 2ZJTA 4DR2H 4RB1A 1XNRH 2F4VH 1HNXH 4IAJA 1XMQH 2XIGA 1X9NA 4X64H 4DV3H 2PT7G 1I94H 4OX9H 4KHPH 1BGWA 2VUGA 1ZHQA 4MTEA 1F0XA 1XMOH 4DV1H 4LSAA 1ZHSA 4UCRA 5D1PA 4EFEA 3C0FB 2UXDH 1P8LA 3F8NA 5LMUH 4UCSA 4LFBH 5FPOA 4UCTA 2CW7A 4LSXA 3SB1A 3KDKA 4I7HA 3UQ8A 1B04A 4YY3H 4M7EA 2Q2UA 2CW8A 4DV0H 1FJGH 1MZBA 3EYYA 3OETA 4LF5H 4GKKH 5DT9A 3M4IA 4DV5H 1SYXB 4EC5A 4LMYA 2UXCH 4JI4H 4LF7H 4RAYA 2VOBA 4EFBA 4NZRM 4DV7H 4FM9A 1X9ZA 4BWSC 4OCHA 3BA8A 4DR5H 4MV7A 1E4FT 3J81W 2KSWA 5FD5A 2OWOA 3BABA 1N36H 2FPHX 4JV5H 1Z2NX 3LMLA 4JI3H 3BA9A 3JSNA 1S03G 1BJTA 2LF0A 2HHHH 2ZM6H 4GLXA 3L4KA 4DR3H 4B3TH 3OTOH 4JYAH 2FE3A 4RB0A 4DR4H 3JAMW 1IBLH 1AN7A 4LFCH 3J7AK 3MWMA 5LMNH 2Q2TA 3RF2A 2UUAH 2ZQEA 4LF6H 3N6XA 2O4CA 4AQYH 5D1OB 4JI8H 4NXNH 4X62H 1J5EH 1SEIA 5IT9W 2D9IA 4ETSA 3KDGA 4G08A 1HR0H 3CVZA 5IWAH 3DF7A 4LH7A 1GYFA 1Z2PX 4R7RA 3IG0A 5FLXW 4DUYH 3EZJA 3L4JA 1IBKH 4APMA 2W57A 4DUZH 4JI1H 3JSLA 3RGZA 4JI0H 1DGSA 5FPRA 1ODHA 4JI5H 4DR1H 3QD7X 1XNQH 4JI2H 1A0IA 2O03A 4YHHH 2UUBH 4RB2C 4A2AA 4LF4H 2HVQA 4DR6H 4PDBA 4A2BA 1E4GT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF8 H;  4X65 H;  3T1Y H;  4LF9 H;  1HNW H;  2UUC H;  4B3R H;  4K0K H;  4DV4 H;  4DV2 H;  4LFA H;  3T1H H;  4DR7 H;  2UU9 H;  1I6U A;  1N33 H;  2UXB H;  2VQF H;  5LL6 b;  4GKJ H;  5A2Q W;  1FKA H;  1IBM H;  4DV6 H;  4B3M H;  4X66 H;  4JI6 H;  1N32 H;  1HNZ H;  4B3S H;  2VQE H;  2E5L H;  1N34 H;  5BR8 H;  4JI7 H;  3J80 W;  4NXM H;  4DR2 H;  1XNR H;  2F4V H;  1HNX H;  1XMQ H;  4X64 H;  4DV3 H;  1I94 H;  4KHP H;  4OX9 H;  1XMO H;  4DV1 H;  2UXD H;  5LMU H;  4LFB H;  4YY3 H;  4DV0 H;  1FJG H;  4LF5 H;  4GKK H;  4DV5 H;  2UXC H;  4JI4 H;  4LF7 H;  4DV7 H;  4DR5 H;  3J81 W;  1N36 H;  4JV5 H;  4JI3 H;  1S03 G;  2HHH H;  2ZM6 H;  4DR3 H;  4B3T H;  3OTO H;  4JYA H;  4DR4 H;  3JAM W;  1IBL H;  1AN7 A;  4LFC H;  3J7A K;  5LMN H;  3RF2 A;  2UUA H;  4LF6 H;  4AQY H;  4JI8 H;  4NXN H;  4X62 H;  1J5E H;  1SEI A;  5IT9 W;  1HR0 H;  5IWA H;  5FLX W;  4DUY H;  1IBK H;  4DUZ H;  4JI1 H;  4JI0 H;  4JI5 H;  4DR1 H;  1XNQ H;  4JI2 H;  4YHH H;  2UUB H;  4LF4 H;  4DR6 H;  4PDB A; 
#chains in the Genus database with same CATH topology
 3K3V A;  2FK1 A;  5BMV F;  2B63 G;  4A3I G;  2HVS A;  3UFX B;  3T1Y H;  5EWF A;  1CQI B;  4O3O A;  1AUV A;  2W9C A;  2WAQ A;  4YR0 A;  2XD4 A;  4B3R H;  2Y0S A;  1KJJ A;  4YAJ B;  5C3E G;  4DV2 H;  2ASD A;  3N8D A;  3N43 B;  4DR7 H;  3U9S A;  2CKZ B;  3MJF A;  1I6U A;  4Q43 A;  1PK8 A;  1N33 H;  2JA5 A;  2C2E A;  2WE6 A;  3GTJ A;  1EUC B;  1M0W A;  1CE8 A;  3V4S A;  3R5X A;  5C8Y F;  2BR0 A;  2YQR A;  1Z2O X;  4GKJ H;  4C5A A;  1K83 A;  1VIG A;  1WH2 A;  1DT4 A;  3CQZ A;  3JRW A;  2CPQ A;  2JA9 A;  2NU8 B;  2OPV A;  1TWC A;  3GIQ A;  3BG5 A;  4QW9 A;  3QFF A;  4J9P A;  2RGR A;  3KAJ A;  4BY1 G;  4HNU A;  3N44 B;  1Y1W A;  1EHI A;  2FK2 A;  3WO0 A;  3PO2 G;  4XX0 B;  2OPU A;  2SCU B;  4BBR G;  3FAU A;  3KHR A;  4DL2 A;  2PMZ E;  1L2Z A;  3RIZ A;  2FLP A;  5KFG A;  2W8K A;  3M9N B;  4Q44 A;  5KFC A;  4JI7 H;  2YW2 A;  1VBI A;  4OD6 A;  3J80 W;  3FKI G;  3PW4 A;  2UVR A;  2QK4 A;  3JRX A;  4YR2 A;  5IYC G;  2R8I A;  3RGX A;  2RDJ A;  2R7Z A;  1W96 A;  2JEA I;  2IBK A;  1TUA A;  4MV3 A;  2WYO A;  2B63 A;  4JVY A;  4RB1 A;  1XNR H;  5J2T F;  1HNX H;  5DGA A;  3HBL A;  4DV3 H;  5JQW A;  2FMR A;  5KFE A;  4OX9 H;  4MAM A;  2W70 A;  4LSA A;  5KFS A;  5KG4 A;  4DV1 H;  2J6S A;  4EG0 A;  2XCA A;  4EBD A;  3PZP A;  1BXR A;  2M8W A;  1CS0 A;  3C0F B;  1P8L A;  3R23 A;  4IRK A;  5FPO A;  4B8T A;  2HH3 A;  4UCT A;  4EYI B;  5KFF A;  4JV1 A;  3RV3 A;  4IRC A;  5EWE A;  4IR9 A;  2AQ4 A;  4DL6 A;  1TWF A;  4M7E A;  2CW8 A;  5KT4 A;  3ETH A;  4ED3 A;  2XGQ A;  4EBE A;  2R86 A;  4EC5 A;  4LMY A;  4ECT A;  2V9W A;  3GIK A;  1AUX A;  1SCU B;  3G6Y A;  5L1I A;  1X9Z A;  2M05 A;  4XYM B;  2R92 A;  4OCH A;  2YZG A;  4DR5 H;  3VPC A;  4MV7 A;  4FJS A;  1E4F T;  1WCM A;  2KSW A;  2OWO A;  1I7L A;  4A3K G;  5KFA A;  3PW2 A;  4BY7 G;  5HV6 A;  3U1K A;  4JI3 H;  3BA9 A;  2LTM A;  2ANR A;  1S03 G;  5I47 A;  5KT3 A;  4ECV A;  2ZM6 H;  4GLX A;  2AGQ A;  3LWB A;  2W6O A;  4B3T H;  1M7J A;  2XCP A;  4AIM A;  4JYA H;  5KFZ A;  4GC6 A;  4DR4 H;  3JAM W;  5HBR B;  4HNV A;  2NUA B;  3RBE A;  1XRH A;  3J7A K;  3VPD A;  5KFT A;  2UUA H;  3N6X A;  5KFQ A;  4YJ2 F;  3MR6 A;  1UC8 A;  4YBZ B;  5D1O B;  3GTG A;  1J5E H;  1WR2 A;  2YYA A;  5IT9 W;  4ETS A;  2RDI A;  4G08 A;  5F9L A;  3CVZ A;  3PW0 A;  4O4H F;  4O2B F;  4OO1 G;  4R7R A;  4XYL B;  1ZZI A;  3GTQ A;  4ECQ A;  4BA2 I;  2FK3 A;  1IBK H;  4J9R A;  4APM A;  2LRR A;  2W57 A;  2JA6 G;  5KFH A;  1VIH A;  2WAQ E;  1Y1V G;  3JSL A;  4HNT A;  2Y0S E;  5FPR A;  2XGP A;  1A9X A;  3H0G G;  2E3U A;  2W9B A;  3RB3 A;  1C3O A;  5KFM A;  2YZN A;  1ULZ A;  4O2A F;  3ORR A;  1S20 A;  4JI2 H;  2YU9 A;  4YHH H;  1JX4 A;  4A2A A;  4I50 F;  1V4Y A;  4DR6 H;  1E4G T;  2NU6 B;  5KG2 A;  4WAL A;  4YP3 A;  3AEV B;  4UCV A;  4LF8 H;  3GII A;  1K1G A;  4ED2 A;  4YB8 B;  4A93 G;  3RTX A;  2ZDG A;  4LF9 H;  1GLV A;  2NN6 G;  4EEY A;  2FMA A;  2NU9 B;  4JUZ A;  4LFA H;  3PN1 A;  1E4E A;  3GV7 B;  4ECX A;  2X06 A;  3NCV A;  5KFK A;  2FLN A;  5C0X G;  3MFH A;  2UU9 H;  3KHG A;  5KFX A;  5GON F;  3L2P A;  2VQF H;  3KTM A;  3KXY T;  4E9J A;  5JVD F;  4ED0 A;  1TWH A;  5DLF A;  2R7M A;  1S0N A;  3Q1K A;  1JDE A;  2Z0S A;  4QWA A;  3H4D A;  3GTM A;  1IBM H;  2A1S A;  1I50 A;  4ED7 A;  4Q0Y A;  3OSS D;  2DLN A;  4GC7 A;  2ZDQ A;  4RAZ A;  2AXY A;  1MSZ A;  1JIH A;  4IFD G;  3BAA A;  3RJ0 A;  3GKU A;  5L1L A;  4DL4 A;  2IA6 A;  1N32 H;  3Q8S B;  4AM3 A;  5C1O A;  1ZQ7 A;  5IP9 G;  3I12 A;  3G6X A;  3BQ1 A;  4B3S H;  4UCO A;  4UCU A;  2R93 G;  2VQE H;  4UFZ A;  1FVI A;  2MCT A;  2E5L H;  1W93 A;  3U9T A;  5BR8 H;  1TA8 A;  4RUC A;  4EYH B;  3QZ7 A;  4DL7 A;  4IWY A;  1EZ1 A;  4MTD A;  4HYK A;  4ZI7 F;  4ZHQ F;  2BQR A;  1Y14 B;  2R84 A;  3Q8Q B;  5IYZ F;  3GLK A;  4A3B G;  1IOV A;  4J9O A;  1KBL A;  2F4V H;  4R8U A;  2XIG A;  3MR5 A;  1I94 H;  4KHP H;  2PT7 G;  4I4T F;  3H40 A;  3KHL A;  1X9N A;  5C44 G;  1GO3 E;  1ZHS A;  5H80 A;  2V4R A;  2OH2 A;  3OSP A;  5KFB A;  3F8N A;  2UXD H;  3LP8 A;  4QW8 A;  1DV2 A;  4ECY A;  2CW7 A;  2VPQ A;  5FJ8 G;  5EZY F;  3GIJ A;  3SB1 A;  4JV0 A;  4I7H A;  4EBC A;  5L1J A;  5IYD G;  4YY3 H;  3PR4 A;  5JVL A;  5KFL A;  2W9C B;  4RUA A;  1VBH A;  5KFO A;  4TV9 F;  4RU9 A;  2VUM G;  1FJG H;  5F9N A;  3V69 A;  1I7N A;  1CQJ B;  2P2R A;  4GKK H;  3M4I A;  4O3Q A;  5KG6 A;  4O3S A;  2C2R A;  5KT7 A;  1X4N A;  1N48 A;  2UXC H;  4RAY A;  4FM9 A;  2VOB A;  3I0P A;  4BWS C;  2ANN A;  2RF4 A;  1KJ8 A;  3J81 W;  5FD5 A;  2CWF A;  3BAB A;  3LML A;  5JUM A;  3MR3 A;  3T5L A;  1JLL B;  1BJT A;  5LOV F;  2W6Z A;  2R8J A;  2HHH H;  2W9A A;  4J9K A;  2JA7 G;  2R82 A;  3AYH B;  2YL2 A;  4QJF A;  5CA1 F;  4NLG A;  2R7L A;  2W6N A;  3VMM A;  4WBN F;  4RB0 A;  2V59 A;  4C5C A;  1IBL H;  3WO1 A;  4WD3 A;  1AN7 A;  3GIM A;  3RB6 A;  5DG9 A;  4A3D G;  2R8K A;  2YS6 A;  1KJI A;  1JXL A;  2C00 A;  4QWB A;  4LF6 H;  3PVX A;  3HOZ G;  2JEG A;  5KG0 A;  4JI8 H;  1T36 A;  4IWX A;  2D9I A;  4U6P A;  4EGJ A;  3L7Z C;  3DF7 A;  5IWA H;  4LH7 A;  5K2M A;  1Z2P X;  2VR1 A;  2QND A;  1RJQ A;  3IG0 A;  2ATL A;  4JVH A;  5FLX W;  5DQI A;  3EZJ A;  3L4J A;  1KEE A;  3H4B A;  1DIK A;  4DUZ H;  1TWA A;  4JI0 H;  1M6V A;  1ODH A;  4DR1 H;  2PY9 A;  3QD7 X;  5LXT F;  1RYS A;  1XNQ H;  1A0I A;  4O3N A;  2UUB H;  3MWD A;  4C5B A;  3FKI A;  1UC9 A;  3PO3 G;  3VPB A;  2CTE A;  2DPJ A;  2PN1 A;  1GSA A;  1M0T A;  1ZET A;  2JVZ A;  3K3P A;  2RGV A;  2HVR A;  3HXL A;  4X65 H;  3HOU G;  2BA0 A;  3OSN A;  2NU7 B;  4YJ3 F;  2ASJ A;  2QYZ A;  4TUY F;  3KAK A;  2OLS A;  3T1H H;  5IYB G;  2CTL A;  4J9M A;  1XDN A;  3HOY G;  2HGS A;  5CAE B;  4XZ3 B;  4LH6 A;  3GAB A;  1ZTG A;  5KFD A;  2VKC A;  2UXB H;  5KFN A;  3RBD A;  4BBS G;  2JE6 I;  5LL6 b;  3H20 A;  4Y8V B;  1X4M A;  5A2Q W;  2CZG A;  3IN5 A;  3PW7 A;  4TQR A;  4O3R A;  4CC6 A;  1FKA H;  5L1K A;  2V5A A;  1VKZ A;  4MV1 A;  3HKZ A;  1TAE A;  1IOW A;  4DV6 H;  2CTJ A;  4RZQ A;  1S0O A;  4B3M H;  2CTM A;  1B33 N;  1C30 A;  2UVW A;  3GTP A;  3GR5 A;  4JI6 H;  4MV6 A;  3GTK A;  1RJR A;  4A3C G;  4RNO A;  1GSH A;  5KFU A;  4BXX G;  2VPS A;  2AGO A;  1S97 A;  1S0M A;  2FPG B;  1N34 H;  3NGD A;  2WDT A;  3BJY A;  3RAX A;  5EDW A;  4NZT M;  2J6U A;  2W7O A;  2IMW P;  4NXM H;  4U7C A;  3PR5 B;  1KJ9 A;  4BA1 I;  3Q8R B;  2UVU A;  3FMA A;  3RFC A;  2W8L A;  2GLT A;  2FLL A;  1XMQ H;  4X64 H;  1BGW A;  2VUG A;  2V4Q A;  2W9B B;  1B6R A;  5KX5 F;  4A3J G;  4M9U A;  1PX2 A;  1XMO H;  3RV4 A;  4FBU A;  2JA5 G;  5CA0 F;  4O4L F;  1JKJ B;  4UCR A;  2XCL A;  5D1P A;  4FU0 A;  4ZOL F;  1DV1 A;  2VA2 A;  3G8C A;  1V51 A;  4ECS A;  4UCS A;  4LFB H;  5CB4 F;  3GID A;  4F4W A;  5BPF A;  1R9T A;  1JDB B;  5KFR A;  5DLG A;  5BPH A;  3BQ0 A;  3V6J A;  2JEI A;  2AU0 A;  2R85 A;  1NXU A;  2P0A A;  5IP7 G;  5L9X A;  2AGP A;  2Q2U A;  2JA6 A;  1Y1V A;  3Q2O A;  3EYY A;  3OET A;  5D8D A;  4C2M A;  1ZZK A;  2CWH A;  3H0G A;  3MFI A;  5DT9 A;  1Y1W G;  5KKN B;  4AYB A;  4DV5 H;  2XC9 A;  1SYX B;  3M9O B;  2R8H A;  3T5K A;  3MWE A;  4QWD A;  2C22 A;  4RZR A;  4ECZ A;  3BA8 A;  1KHM A;  3I4N G;  1N36 H;  4JV5 H;  1RK6 A;  3TIG A;  2DZD A;  2FPP B;  4J9N A;  4Q8E A;  1OWT A;  3HB9 A;  3SE7 A;  2FP4 B;  2R7Z G;  3L4K A;  4DR3 H;  5DQH A;  5KG7 A;  4ZQI A;  1I3Q A;  5DG8 A;  2W6Q A;  5KFV A;  5C1P A;  1BNC A;  4DLK A;  4F4X A;  3BQ2 A;  1DTJ A;  2R87 A;  1X0A A;  2PQU A;  2W6P A;  3ORQ A;  4FBT A;  4A3E G;  4DL3 A;  4NXN H;  4MA5 A;  4J9Q A;  1SEI A;  4F50 A;  1HR0 H;  1EYZ A;  1GGO A;  1EC6 A;  4Q45 A;  4A3G G;  2I80 A;  3R5H A;  2FPI B;  5KFI A;  1UG8 A;  3FDS A;  3M9M B;  1J5K A;  4WAN A;  2PVP A;  4ED1 A;  3RB0 A;  2GPS A;  2C2D A;  4ECW A;  4ECR A;  4H8A A;  4JI1 H;  4R8U B;  2DIK A;  5EWG A;  3RAQ A;  5KG5 A;  2R93 A;  4NBQ A;  3HOW G;  2O03 A;  3K5I A;  4QIW A;  3TQT A;  4RB2 C;  2YRX A;  4LF4 H;  2CPM A;  2DGR A;  3KAL A;  3TIN A;  4IR1 A;  5JEA G;  2R92 G;  2E2H A;  3N42 B;  4FJU A;  3E5N A;  5FLM G;  4DL5 A;  1WCM G;  3GIL A;  2IP4 A;  1O75 A;  4MV9 A;  5KG3 A;  5KFP A;  2R8G A;  4YQW A;  5DQG A;  1HNW H;  1KJQ A;  2UVV A;  3H3V H;  1WE8 A;  2UUC H;  1RK5 A;  4B8C D;  4K0K H;  4DV4 H;  2BQ3 A;  2ASL A;  3HKZ E;  5EOY A;  2E2I A;  4MV8 A;  4RB3 C;  4A3F G;  2JEB I;  2W71 A;  4FS1 A;  1K1S A;  3TII A;  2JZX A;  1S68 A;  2YCH A;  4O4I F;  4EEQ A;  1WVN A;  2CQY A;  4QWC A;  4Q8F A;  3GTL A;  1B6S A;  3HOX G;  4J9L A;  3VKE A;  4QWE A;  4MV4 A;  1UNN C;  1Z2I A;  2CTF A;  5DGB A;  2VUM A;  1VAJ A;  5KFW A;  2ALZ A;  2VQD A;  3N41 B;  3K5H A;  2C35 B;  3RB4 A;  3UOE A;  4ME6 A;  3N40 P;  2Y3M A;  4CC5 A;  4X66 H;  1RYR A;  4HR7 A;  3OUZ A;  1WTJ A;  2WB1 E;  2HH2 A;  4TV8 F;  1HNZ H;  4MA0 A;  1RJP A;  3KHH A;  2R7N A;  2MJH A;  1V9P A;  1VS0 A;  3WNZ A;  4IRD A;  5D1O A;  2VA3 A;  1T3N A;  2JEJ A;  3RUP A;  5KFJ A;  3G6V A;  2LTL A;  1K1Q A;  3PW5 A;  5FD6 A;  5LYJ F;  2YRW A;  4IZO A;  4ED6 A;  4J0M A;  5K36 G;  4TQS A;  2JA7 A;  1S10 A;  3HOV G;  2R6F A;  2ZDH A;  2ZJT A;  4IHJ F;  4DR2 H;  2PMZ A;  2JEF A;  1N56 A;  1T94 A;  3JZI A;  4IAJ A;  1SFO A;  4MTE A;  5DG7 A;  2G8Y A;  1ZHQ A;  4L1K A;  1F0X A;  1VBG A;  2FB9 A;  2V58 A;  3GV5 B;  2JA8 G;  1J4W A;  4AYB E;  3EPI A;  3QZ8 A;  4EFE A;  3EPG A;  1PQX A;  2BQU A;  5LMU H;  4PWQ A;  1TWG A;  2R7K A;  4F4Y A;  4LSX A;  3KDK A;  3UQ8 A;  1B04 A;  2HJW A;  3OHA A;  2YZM A;  4DV0 H;  3GQC A;  1MZB A;  4LF5 H;  5KT5 A;  4E4T A;  3I4M G;  4EFB A;  4JI4 H;  4LF7 H;  2FKL A;  2W6M A;  4JV2 A;  4NZR M;  2CTK A;  4DV7 H;  3GIP A;  5C4X G;  4I55 F;  2FJZ A;  4ED8 A;  4G3I A;  2WB1 A;  4YAK B;  3SI8 A;  2NVX A;  5KT6 A;  2FPH X;  1Z2N X;  2W7P A;  4A3L G;  2J9G A;  3JSN A;  4RNN A;  2X0S A;  3GV8 B;  2LF0 A;  1V8C A;  4HQ6 A;  4ECU A;  2C28 A;  3GTO A;  2K1H A;  2NVY A;  3OHB A;  4J9S A;  4A3M G;  3OTO H;  3OUU A;  1WSC A;  3V6K A;  2FE3 A;  3MR2 A;  2DWC A;  4FS2 A;  2FFM A;  5KG1 A;  2BL5 A;  4LFC H;  3MWM A;  5LMN H;  2J6T A;  3RF2 A;  2Q2T A;  2ZQE A;  5T14 A;  2GPW A;  2O4C A;  2I8C A;  5JH7 F;  1WHR A;  4AQY H;  4YR3 A;  5LA6 F;  5KT2 A;  5KFY A;  5LP6 F;  4X62 H;  1KC7 A;  4QIW E;  3V6H A;  2DPI A;  3TQ1 A;  1GSO A;  3KDG A;  1E4E B;  1ZZJ A;  2I87 A;  5J2U F;  1GYF A;  3ETJ A;  4LIJ A;  5C5J A;  1V9N A;  3T5J A;  4EGQ A;  3T5H A;  3Q8P B;  1S9F A;  4DUY H;  2YS7 A;  2M6Q A;  3R5F A;  2PBZ A;  3RGZ A;  4F4Z A;  1DGS A;  2WTF A;  4JI5 H;  4PDB A;  1EUD B;  3V4Z A;  4RNM A;  2HVQ A;  4O3P A;  4QMF B;  4A2B A; 
#chains in the Genus database with same CATH homology
 3K3V A;  3N42 B;  2HVR A;  1M0T A;  4UCV A;  4LF8 H;  2RGV A;  1O75 A;  3HXL A;  4X65 H;  3T1Y H;  4MV9 A;  3RTX A;  4LF9 H;  1HNW H;  2HVS A;  2UUC H;  4B8C D;  4B3R H;  4K0K H;  4DV4 H;  4DV2 H;  3KAK A;  4LFA H;  3T1H H;  3PN1 A;  3N43 B;  4DR7 H;  1XDN A;  5EOY A;  3NCV A;  4RB3 C;  2HGS A;  2UU9 H;  1I6U A;  3GAB A;  4LH6 A;  2VKC A;  1N33 H;  2UXB H;  2WE6 A;  3L2P A;  2VQF H;  5LL6 b;  4E9J A;  1M0W A;  3KXY T;  3H20 A;  1Z2O X;  4GKJ H;  5A2Q W;  1S68 A;  2YCH A;  1WH2 A;  4EEQ A;  4CC6 A;  1FKA H;  1IBM H;  4Q0Y A;  3OSS D;  1TAE A;  4RAZ A;  2RGR A;  4DV6 H;  3KAJ A;  3N41 B;  4RZQ A;  3BAA A;  3N44 B;  3N40 P;  4B3M H;  3RJ0 A;  2Y3M A;  4CC5 A;  4X66 H;  3FAU A;  3GR5 A;  4JI6 H;  1N32 H;  1HNZ H;  1L2Z A;  4B3S H;  3KAL A;  2VPS A;  4UCO A;  4UCU A;  3RIZ A;  2VQE H;  1V9P A;  1FVI A;  1VS0 A;  4UFZ A;  2MCT A;  2E5L H;  1N34 H;  5D1O A;  2WDT A;  5BR8 H;  4JI7 H;  1TA8 A;  4NZT M;  4OD6 A;  3J80 W;  4NXM H;  5FD6 A;  4MTD A;  3RGX A;  4J0M A;  3FMA A;  2WYO A;  2ZJT A;  4DR2 H;  4RB1 A;  1XNR H;  2F4V H;  1HNX H;  4IAJ A;  1XMQ H;  2XIG A;  1X9N A;  4X64 H;  4DV3 H;  2PT7 G;  1I94 H;  4OX9 H;  4KHP H;  1BGW A;  2VUG A;  1ZHQ A;  4MTE A;  1F0X A;  1XMO H;  4DV1 H;  4LSA A;  1ZHS A;  4UCR A;  5D1P A;  4EFE A;  3C0F B;  2UXD H;  1P8L A;  3F8N A;  5LMU H;  4UCS A;  4LFB H;  5FPO A;  4UCT A;  2CW7 A;  4LSX A;  3SB1 A;  3KDK A;  4I7H A;  3UQ8 A;  1B04 A;  4YY3 H;  4M7E A;  2Q2U A;  2CW8 A;  4DV0 H;  1FJG H;  1MZB A;  3EYY A;  3OET A;  4LF5 H;  4GKK H;  5DT9 A;  3M4I A;  4DV5 H;  1SYX B;  4EC5 A;  4LMY A;  2UXC H;  4JI4 H;  4LF7 H;  4RAY A;  2VOB A;  4EFB A;  4NZR M;  4DV7 H;  4FM9 A;  1X9Z A;  4BWS C;  4OCH A;  3BA8 A;  4DR5 H;  4MV7 A;  1E4F T;  3J81 W;  2KSW A;  5FD5 A;  2OWO A;  3BAB A;  1N36 H;  2FPH X;  4JV5 H;  1Z2N X;  3LML A;  4JI3 H;  3BA9 A;  3JSN A;  1S03 G;  1BJT A;  2LF0 A;  2HHH H;  2ZM6 H;  4GLX A;  3L4K A;  4DR3 H;  4B3T H;  3OTO H;  4JYA H;  2FE3 A;  4RB0 A;  4DR4 H;  3JAM W;  1IBL H;  1AN7 A;  4LFC H;  3J7A K;  3MWM A;  5LMN H;  2Q2T A;  3RF2 A;  2UUA H;  2ZQE A;  4LF6 H;  3N6X A;  2O4C A;  4AQY H;  5D1O B;  4JI8 H;  4NXN H;  4X62 H;  1J5E H;  1SEI A;  5IT9 W;  2D9I A;  4ETS A;  3KDG A;  4G08 A;  1HR0 H;  3CVZ A;  5IWA H;  3DF7 A;  4LH7 A;  1GYF A;  1Z2P X;  4R7R A;  3IG0 A;  5FLX W;  4DUY H;  3EZJ A;  3L4J A;  1IBK H;  4APM A;  2W57 A;  4DUZ H;  4JI1 H;  3JSL A;  3RGZ A;  4JI0 H;  1DGS A;  5FPR A;  1ODH A;  4JI5 H;  4DR1 H;  3QD7 X;  1XNQ H;  4JI2 H;  1A0I A;  2O03 A;  4YHH H;  2UUB H;  4RB2 C;  4A2A A;  4LF4 H;  2HVQ A;  4DR6 H;  4PDB A;  4A2B A;  1E4G T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...