3JAMZ

Cryoem structure of 40s-eif1a-eif1 complex from yeast
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
70
structure length
70
Chain Sequence
AKHAVVLDQDKFDRIMKEAPTYRYVSVSVLVDRFKLGGSLARVALRHLENEGIIKPVSKHSKQAIYTRAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational Differences between Open and Closed States of the Eukaryotic Translation Initiation Complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Translation
molecule keywords 18S rRNA
total genus 8
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF03297 Ribosomal_S25 S25 ribosomal protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3jamZ00
3OOPA 2HZTA 2XUBA 1XSVA 1XCBA 4M6XA 3JW4A 3KLOA 1U5TB 2FBHA 2K02A 2WV0A 4CICA 3COAC 5ICCA 2FQ3A 4G7OF 4IJAA 2DO7A 3T5XA 4YFNF 4P96A 4RGSA 3T8TA 3ZN1A 4KN7X 1Q1HA 2OQGA 2XRNA 3I54A 2IPQX 3HIFA 1LEBA 3ROUA 1C0WA 2XAFA 2OAZA 1U8RA 3TO7A 4HV6A 4LLGF 3R4KA 1XN7A 2EV0A 2XAQA 2H6BA 2EB7A 4M71A 3ZMZA 2GIVA 4CZZA 5E1ZB 2E1CA 2HWVA 2V6CA 5FB2A 1T0FA 2XROA 2V1DA 1RNLA 1MJ9A 2GAUA 2R7FA 4KIFA 4M73A 1ZLJA 2MBFA 4HBLA 1ZGAA 2RGVA 2H09A 4O3MA 4HOBA 2XAHA 1AWCA 1ZLKA 4N9IA 2NRAC 2F2EA 1REPC 4L9TA 3KEOA 4ENNA 5CJ9A 1LDDA 1GVJA 1P92A 4AIHA 3CUQA 4LG0B 3C18A 2GXBA 3RPQA 5E1WA 3ABTA 1BI3A 5BS6A 4U7DA 5DD8A 5HS8A 3IRQA 4ZYHA 4H0EA 4IXAA 2OU2A 4M9SA 3Q9VA 1JGSA 2ZNZA 3DKWA 5HLHA 2MH9A 3RKYA 1BIBA 2CG4A 2UWMA 2IA1A 3DQVC 3WTUC 3VB2A 2VC0A 3FF5A 2COMA 3EUHA 2DT5A 1SFXA 3KLNA 4MHGA 5FO5A 4HX4A 4UUVA 3IC7A 2P6SA 4F7ZA 3WE2A 4KMFA 3P9CA 3GFJA 4ON0A 2VBYA 2L01A 2CGPA 3B02A 3E97A 3F22A 3GXOA 4OIPF 1WRJA 1DP7P 1RI7A 3AAFA 1SD6A 4EJTA 1HKSA 3F6OA 3I5UA 3WGHA 1LVAA 3O2PE 5D4RA 4RAZA 2EJRA 5D8KB 1P4WA 4UHTA 1QQIA 5HS7A 5LGNA 4CHUA 4MTEA 2XHKA 4I0AA 1ULYA 2F5CA 2DK5A 3K0LA 3JTHA 3E3VA 1D3YA 3FM3A 2GXGA 4KN4X 2DFIA 2V1XA 1PUEE 2KIMA 2O0YA 4GO1A 2GA2A 4YIFA 2KKOA 4JBAA 4FHTA 1R1UA 2HDCA 1SD4A 3K69A 5L3FA 4UV9A 5L3GA 3IWZA 4EM1A 1STZA 4G6DA 1FYKA 4KMUX 2ACJA 4EMSA 3KETA 1ZRDA 2IP2A 1GXQA 1B9MA 5HVQC 2QBYB 5DUKA 1U5TA 4M74A 1ZG3A 4MEXF 4A6DA 1ODDA 5BQTA 2QZ8A 3SQNA 5LGTA 4P9FA 1LNWA 2J5OA 4BAYA 3RKWA 2ZJ2A 1ZRCA 4BHBA 1ON2A 2F5DA 4G94A 1OYWA 2Z3YA 4HX8A 2HEOA 1SAXA 1FBSA 3BPVA 1RUOA 5IT3A 3QRFF 3KP3A 5KVRA 5H20A 3O6BB 4U0YA 5DV5A 2DQLA 2NNYA 1IAWA 1LB2A 2NS0A 3KE2A 3BJOA 3HOSA 1B59A 3I58A 4IHSA 3DV8A 4IRIA 3WU1B 3HOTA 2JZYA 3CUQB 4LG0A 4AD9A 4KUMA 1IW7F 2LSOA 1CGPA 3CDHA 3QOPA 1ZYRF 4OIRF 1JE8A 1B1BA 2PQ8A 2IJLA 1B6AA 2ZXJA 2CFXA 4S05A 1D8JA 4CO8A 2CQKA 3M1EA 4Q48A 4BHCA 4EVIA 3TOAA 3K9TA 2QBYA 1QPMA 3LAJA 1EH7A 5HOOA 1LJ9A 3VFZA 2A5YB 3DEUA 3GWZA 1F5TA 4I01A 2V1UA 1J0RA 4Y15A 5E8GA 1XB4A 2BE5F 3ZMSA 1KU7A 2P5VA 1IUYA 2KIUA 3I64A 2XAJA 2A69F 2ESHA 2KIFA 1U78A 2DU9A 1LDJA 1QZZA 2FMYA 2FNPA 4A6EA 2EFPA 4WXHA 2O3FA 1Z9CA 2VE9A 4KICA 2H94A 4LMYA 2HR3A 3KP5A 1J5YA 3F23A 3KP2A 4M72A 5E8IA 4EM2A 3FM5A 3QP5A 1MZBA 2RDPA 3RDIA 3K2ZA 1UB9A 3I4PA 3W6KB 3U9GA 4EM0B 4A0XA 1K7AA 2VOOA 4KDPA 3TOBA 5HLGA 3WODF 3HRUA 3F8CA 3CO6C 2EK5A 3FMQA 5LGUA 2A68F 2TDXA 2ADUA 1HW2A 5J6XA 1MDMA 2DAOA 4NB5A 2FRHA 1GHCA 1BIAA 3VEPA 5CVUA 4YIIA 3ABUA 2VBWA 1TW3A 2JPBA 5FFXA 2FBKA 2P4WA 3K1NA 2ZMEA 3SZPA 4HF2A 5DCMB 2LF7A 1IN6A 4Q47A 1S7AA 2VE8A 1H9GA 4IRGA 1F4KA 4QLCU 2A6HF 5J8FA 3HYIA 2PBIA 3SHFA 4AVPA 2W25A 3Q5FA 5ICFA 2CSOA 1YW7A 3LFKA 2DTRA 1IN5A 2CW0F 2D1VA 5L3DA 1S6LA 5K5RA 3QPTA 1Z7UA 2RV8A 3WTZA 1YFHA 2VBZA 2PN6A 4EJOA 1G6NA 4Y13A 3PFIA 2E7XA 2L3DA 3GZ5A 4CYDA 1IRFA 1G3TA 3EDPA 4HA8A 4WWCA 2M5WA 1G3WA 3DPLC 5KK1A 2L02A 3K1MA 3H3UA 2HTJA 2V9VA 1B4AA 1HQCA 1QZYA 5A2QK 2R3SA 4HYEA 3M8FA 2HQRA 5TRDA 4N9HA 2FNAA 1RZ4A 2MLKA 3BP8A 3RPUA 4LLNA 3U1DA 4A5MA 2ZNYA 1UCRA 5EEHA 5ILSA 2XVCA 4U7BA 4BHPA 1TW2A 4AIKA 2VONA 1IXSB 2Q2EA 3LWFA 1U6GA 1G3YA 2QVOA 1BBYA 1HSJA 3HSFA 3V8JA 3F3XA 1XGSA 1IN4A 4MGRA 3J81Z 3I71A 4KYWA 3IHUA 4U0WA 4I98B 2QUFA 1TQIA 5EEGA 4RB2C 5BPIA 2G7HA 3EYIA 3GEZA 3ZMTA 4EJUA 1YYVA 3M8EA 1Z6TA 3BY6A 1J59A 2Y75A 3FX3A 2K86A 2X4HA 3GFMA 4KIBA 3SFZA 2HGCA 5CVRA 3V7RA 3JSOA 2PJPA 3FXUA 2EFWA 2G9WA 4BQAA 2RQPA 3N4MA 3WGGA 2HKXA 4WK8F 4I02A 4DNCA 2VXZA 4FX0A 1HBXG 1XMKA 4I7HA 1ZG1A 1OYIA 2YX7A 4HQEA 1QGPA 1UHWA 2OZUA 4M9ZA 3RYRA 5FD6A 4UVAA 3L2CA 2EA2A 2EV6A 4K2EA 1YIOA 3REOA 2QWWA 3PQJA 2BV6A 5F6FA 3WTYC 5DCFA 3CUOA 3R0JA 2B0LA 3WTXC 3VODA 3ZMDA 4GXOA 4PCQA 4LFUA 1ON1A 2PMUA 1P4XA 1KU9A 4I0BA 2ISZA 1SFEA 4MNUA 1FWZA 4U0VA 2AS5F 3I53A 2K27A 1ZH5A 2LNBA 2XAGA 4AWXB 4HLXA 4BYYA 1R36A 5LHGA 2IA0A 1FP2A 2H27A 2M30A 1WSUA 3DFGA 1I6XA 4D0PA 2JT1A 4LD5A 3HTUA 2QQAA 3GX4X 1W5TA 3WU0A 1BI2A 4GCVA 3D0SA 5HDKA 1HKQA 2CYYA 3HHHA 4IRHA 2XIGA 1U5TC 2UXNA 4ESFA 1BM9A 1L0OC 3RYPA 3V8KA 1O3QA 3D5LA 5LEKA 2FBIA 1KU3A 3DF8A 2EA4A 4RB3C 2STTA 4IF4A 2YSRA 1FBUA 4L18B 3R60A 5A2QZ 3KCCA 3F8NA 5LLQA 2MD5A 1QO0D 2XKPA 1GXPA 1W7PD 1E2XA 1J75A 1FT9A 3EETA 4OMYA 2YPRA 1U3EM 1EH6A 4U88A 4MQVA 1D8KA 2G7UA 1IZ1A 2FEZA 1E17A 4ZZDA 1K79A 1TNTA 1FPQA 3TKYA 2J5PA 4YFKF 3QPHA 5FFZA 2W57A 3HSRA 4KNYA 4OU0A 5E20A 4PZJA 2M87A 3TGNA 3TO9A 2OA4A 3JSPA 3GYHX 4I2OA 5FLXK 1KYZA 2GWRA 1SMTA 5CVJA 2XASA 4G9YA 2A6EF 5E1XA 2ZFWA 5H6QA 1T38A 4EV0A 3ECOA 3QP6A 2FMLA 2CWEA 4QWQA 2EFNA 1R58A 5ICGA 1TQPA 2VODA 1BOAA 1WQ2A 3ZQ7A 3V4GA 4EQQA 3W6JB 3HRMA 4LGWA 2KJCA 3RI4A 2BYVE 1XGMA 3GUDA 5LHHA 1BI0A 3R0AA 3CJNA 5L3EA 3RKXA 2W24A 4OINF 4MTDA 2W85A 3V7SA 1OR7A 3F8MA 4NHJA 1J7KA 2VN2A 1VTNC 4BXUA 1G4DA 2VOPA 1P2FA 1ZN2A 1QNTA 4OIQF 2ESNA 4ESBA 1KGSA 4HF0A 4EJWA 1USSA 4ZYGA 4S04A 3KFWX 3WTSC 3ZMUA 2Y0MA 4NQWA 1HW1A 2IT0A 3F6VA 2PMHA 5K5QA 4RGRA 3ISPA 1YTYA 2DW4A 4ENMA 1TQMA 1YS6A 1ONVA 1S3JA 3BWGA 2YR2A 1JHHA 3FWEA 4R79A 2ZCWA 3M7GA 1WWXA 3I59B 3P9KA 4UNOA 3KP4A 5L3CA 3L00A 4PDKA 4ZH4F 1TTYA 1BC7C 2GZWA 1AOYA 1YS7A 2LDUA 4WX9A 1O7FA 4UVBA 5AIPA 3BPXA 4XRFA 3FZVA 2QLZA 3MEXA 1USTA 4P55A 2P6TA 2OBPA 2Z9OA 2O6GE 1R1VA 3HRSA 2CO5A 3HTSB 1IF1A 3E5QA 1SD5A 4G8XA 3FXRA 1FYLA 1DPUA 3CLOA 4HLYA 3L09A 4JK1X 2BEOA 5TJJA 1FSEA 1G3SA 3JTGA 3OV8A 6PAXA 3BZ6A 1F1ZA 3ZPLA 3G3ZA 1XDSA 1O3TA 3GO5A 4LB5A 2VT2A 4ETSA 2DK8A 1XSDA 2JSCA 4HW0A 4YG2F 3HHGA 4A0ZA 1IN8A 2RVCA 1R00A 4L9JA 3EYYA 4HF1A 1IXCA 4ZYEA 1FBQA 2QQBA 4ESJA 2Q8KA 2R7DA 3BROA 3IWFA 4OIOF 5IT9Z 1YG2A 4R8HA 5ILUA 4RB1A 5JVTA 3NQOA 3C1DA 2M1BA 3GLXA 3Q9SA 5DYMA 1IN7A 2PI0A 1T2KA 4CDGA 1NHAA 4IHTA 3V7CA 5LHIA 2OZ6A 3P7NA 1SMYF 2Z5UA 3QU6A 5CLSA 5BPDA 2RN7A 4KT5C 4WXCA 1O7LA 2MH2A 4R1HA 4TV7A 3F8BA 4DQ2A 1YW8A 5BOXA 1ZG5A 2QENA 4RS8A 2O03A 3KEQA 1ZREA 3GFLA 2A3SA 4AIJA 3ML6A 4BNCA 3E6CC 3GZ6A 4IVNA 2DQRA 4RGXA 3E6MA 3DP7A 2JTVA 3QAHA 2NYXA 3SZTA 2O8XA 4GYGA 4XBFA 1BI1A 1YO5C 1CF7A 4GYIA 2RC4A 1JXSA 1F9NA 4L0ZB 4LB6B 2HQNA 2GA1A 1FLIA 1R5HA 2O61A 1HKTA 3L9FA 3MAJA 5LRRA 1S8NA 3N97A 3BJ6A 1H9TA 3TDUC 1R23A 3E5UA 4G7ZF 2D45A 4A5NA 2Y48A 5HDNA 2FXAA 1RIOH 3MCZA 2JRTA 1I1GA 3PQKA 5AIQA 3K1PA 4P9UA 3ERED 2OQRA 5ERIA 2LKPA 2XV4S 2KJBA 5HLIA 5DUIA 2UZKA 4EGYA 1IRGA 1L3LA 3F21A 1W7PB 2QM3A 2P5LC 1Z91A 3ZN0A 5DD4A 2K7LA 5CVIA 2ZBKA 4OOIA 3CO7C 1UHMA 3R61A 1Z05A 4ENJA 2LF8A 5JHUA 5D6EA 3F8FA 5H6RA 4KIGA 3LA3A 3WE3A 5E17F 2D2WA 1ZGJA 4B09A 2WC2A 5HDGA 3HRTA 3F72A 2YX4A 1JHFA 4MEYF 1V3FA 5K5OA 4I09A 1BN5A 2C6YA 2F5EA 1OMIA 3TO6A 5D6FA 5HS9A 2ZMEB 2WWYA 1J9IA 2ZO4A 2OD5A 3T1BA 5L3BA 2F5FA 1MDMB 2IRFG 3IL2A 3QU3A 1PDNC 2A61A 1H0MA 2HS5A 3NEUA 1V4RA 3IKTA 1DUXC 2DBBA 1FP1D 1W4MA 2HOEA 4PGHA 3TDZC 4A2UA 4EGZA 3LAPA 1XD7A 1Z1DA 4LJZF 2M45A 3E6BA 1XSXA 2FOKA 1T6SA 3C3WA 4G7HF 3MQ0A 3R6SA 3CTAA 2QYOA 3RTRA 2MA3A 4XSZF 3LQQA 1P4AA 3ECHA 3IRRA 5F64A 4L5IA 2EWNA 3DXJF 5LEJA 3GVAA 2P7VB 1FNNA 3BJAA 2EV5A 4WF2A 3RJPA 5DDGA 1O57A 3WTVC 1KA8A 4Z2YA 4LLLA 3O3KA 3CUQC 1T98A 3ZMVA 2IVMA 1Z6RA 1I27A 4WXDA 1XDUA 4RGUA 3WGIA 4XLNF 3WTWC 3MFKA 2IW5A 2BBYA 3NRVA 1EH8A 4HZFA 5D5VB 4L5JA 4HDUA 5F1RA 2FA5A 5JI6A 2D1HA 3J80K 2ELHA 2K4JA 3I0TA 1HW5A 4G6QA 1X3UA 5JR3A 1WKMA 2DI3A 4A0YA 4FT8A 1K6OA 2YU3A 2VC1A 1BJAA 1FZPB 2E1NA 2HYGD 1R1TA 2A07F 2L4AA 3EQLF 5D5XB 1TNSA 2FU4A 2PG4A 4O5VA 3KZYA 4O6JA 1TLHB 3WTTC 4XSXF 1FYMA 1S7OA 3SXYA 1OYYA 2VT3A 2EFOA 3ULQB 3E5XA 1MKMA 1FY7A 3GFIA 3BDDA 4IPAA 2XGXA 1BC8C 1R5GA 2GQQA 1UFMA 1LQ1A 1K78B 4PGGA 1I5ZA 1HSTA 1MGTA 1HXDA 4N0BA 1ZRFA 1B9NA 2L4MA 3JAMK 3E6DA 2DPUA 2V79A 5LBQA 3J80Z 2RKHA 1EV7A 5DCMA 1MJAA 3ZP5A 2XKOA 5CVVA 2M8EA 1FSHA 4L9NA 3I59A 4LK1F 2Q0OA 2UXXA 2WTEA 1RUNA 3RIRA 1CF7B 5FLXZ 3GW2A 2AXLA 2E7WA 2P8TA 2ZKZA 2W84A 1OKRA 1SD7A 1KU2A 4EJVA 1ZARA 2FE3A 1FOKA 2DLLA 3LA7A 3V8LA 3WG9A 4WCGA 3H92A 3FXQA 5ICEA 1O3SA 1P6RA 3VOEA 1D5VA 3U2RA 2QQ9A 2PEXA 3S2WA 1J2XA 3G73A 1U2WA 1XGNA 3TQNA 4E70A 1LDKB 5E18F 4M9XA 4Q5SF 4B8XA 3BOQA 4LK0F 1PP7U 4A12A 3GF2A 4ASNA 3C7JA 1LEAA 3JAMZ 2L54A 2H6CA 1MJBA 5BMZA 1DDNA 2DPDA 2K4BA 4Y17A 2HYFA 1PP8F 1W7PA 2PFBA 3FMSA 4RB0A 2ISYA 5K1YA 1S29A 1QBJA 4HAMA 3J7AO 1MD0A 4ZYDA 1O3RA 3T0YA 4P5OA 4JQFA 3P9IA 1I1SA 1XMAA 4M6YA 4MQ9F 3KP6A 1KQ0A 4RAYA 5CYVA 2PLYA 5D5WB 3KP7A 2Z33A 1XGOA 2Z99A 1OPCA 2RNJA 4BH9A 1ZHFA 4KA4A 1Y0UA 2IA2A 1FX7A 2KRFA 1YW9A 5ILVA 3H3ZA 3KZZA 2HKOA 1T39A 3L7WA 5AONA 4UVCA 3M9AA 1YQAA 1R22A 3IKVA 5J8CA 2MLGA 1KQ9A 4HX7A 2P7CB 1KYWA 4ENKA 2FF4A 1WI9A 2JPCA 1A04A 3LA2A 1IXRC 4FX4A 3ELKA 4GGGA 5IT9K 3J81K 3MZYA 4ZZLA 1TBXA 1DPRA 3B73A 5D4SA 2HFHA 4L0YB 4KFCA 2X0LA 1FC3A 4L9VA 1K78A 2FSWA 3LQRA 3FHZA 2ETHA 4CGZA 5D5UB 2NNNA 4HQMA 3HUGA 1YLFA 3DPTA 1SFUA 5JFRA 5ED4A 2EFQA 3LSTA 3T8RA 2NAZA 2VBXA 1KQ8A 4HV5A 3HSEA 2MC3A 5DEQA 3FMRA 4XLPF 4UV8A 1W5SA 3MZHA 4CXFA 4UXNA 1XCVA 5FD5A 2BGCA 1R7JA 2STWA 2P5KA 4HDVA 4YFXF 3MWMA 4OMZA 1ZAOA 5D8LB 2HTSA 5LRSA 5FGMA 4Q4ZF
chains in the Genus database with same CATH superfamily
4XNFA 4F92B 1JKPC 3OOPA 3FISA 4A3DJ 1UG2A 3FXJA 2HZTA 4A3BJ 2XUBA 3MKZA 2KT0A 1MNEA 5M3FJ 3TEDA 1B8IA 5EZHA 1CQTA 2DJNA 1LKXA 4RBOA 1XSVA 1XCBA 4M6XA 3JW4A 3KLOA 1MBKA 1U5TB 2FBHA 4E7KA 1MMGA 3QYBA 2K02A 4M6VA 5C3EJ 3OYFA 2WV0A 5FJ8J 4CICA 3COAC 3OL4A 1FTZA 2EILH 2W1OA 3BG3A 5ICCA 2FQ3A 3WU2C 4G7OF 1TWGJ 4IJAA 2DO7A 2VJJA 1SEUA 2VB6A 3GLLA 3T5XA 2XGEA 4YFNF 3CP8A 4P96A 3TW7A 1WJAA 4RGSA 3T8TA 2R5ZB 3ZN1A 1POGA 3ABLH 4KN7X 4G6TB 1Q1HA 4DYCA 2KPMA 2OQGA 2XRNA 3I54A 2IPQX 3HIFA 1LEBA 3BZCA 3ROUA 1C0WA 2XAFA 2OAZA 1U8RA 3TO7A 2X6OA 4FQGA 4HV6A 3HL2A 4LLGF 3R4KA 3H36A 3S1MJ 1XN7A 2EV0A 2XAQA 1S9HA 5M5WJ 1WPKA 2H6BA 2EB7A 3I4MJ 4M71A 3LSPA 3CCVI 4A3JJ 1X4OA 1OCZH 2GIVA 3ZMZA 4CZZA 1YHQI 1GT0C 4V19K 5E1ZB 2QKMB 2E1CA 2HWVA 2V6CA 3UNGC 5FB2A 3WHCA 1T0FA 5C4JJ 2X6WA 4PFPA 2XROA 2V1DA 1RNLA 4ZDPA 3HOZJ 5F0FA 2AQFA 1MJ9A 1DGWY 2KDZA 2GAUA 1MBHA 2R7FA 4KIFA 4M73A 1VQ7I 1ZLJA 3PNTA 2MBFA 4HBLA 1ZGAA 3JRHA 3IP4B 2O7OA 2H09A 2RGVA 4O3MA 4HOBA 3ERMA 2XAHA 1AWCA 3CP2A 1ZLKA 4N9IA 2NRAC 2Y9ZA 2F2EA 1REPC 3A01B 4L9TA 2Y0SN 1Z7LA 3KEOA 4ENNA 2JMWA 2CMPA 3HG9A 1UG0A 4HPQA 1V5EA 3FXMA 5CJ9A 3F9KA 4DIQA 3CMYA 3OYGA 3DWLE 1LDDA 1GVJA 1P92A 4AIHA 3CUQA 4C2UA 3C18A 4F93B 4LG0B 2GXBA 2QSGX 3RPQA 5E1WA 4Y33A 5EG0A 2X85A 3ABTA 3OYAA 1BI3A 5BS6A 5GPCA 4U7DA 2E71A 5DD8A 3FHNA 5HS8A 3IRQA 4ZYHA 4H0EA 4IXAA 1WCMJ 2OU2A 3PIOF 2K85A 3Q9VA 4M9SA 1TWAJ 2IGMA 3QYEA 1JGSA 2ZNZA 3DKWA 2WBMA 5HLHA 2MH9A 3RKYA 3JRBA 1BIBA 2CG4A 3A0HC 5CQEA 1YITI 4BDZA 2UWMA 3LFUA 4HSRA 2VLAA 4BEHA 2IA1A 3A4CA 1RETA 4FETA 5BNGA 3DQVC 2BHYA 3WTUC 1Y0NA 3VB2A 2VC0A 4AUXA 2IBDA 3FF5A 1FIAA 2KMUA 2COMA 3WHBA 4DBQA 4CCOA 3OYNA 3EUHA 3PUFA 2DT5A 1MMAA 4XIDA 1SFXA 2DDAA 1IC8A 4X0GA 1X3ZB 3KLNA 4MHGA 5FO5A 3ZQHA 4HX4A 4XN3A 4UUVA 2MFZA 3OR1C 3IC7A 2P6SA 4F7ZA 4A3IJ 3CLQA 3LL7A 3WE2A 5TISC 3OYLA 4KMFA 3VYTB 1XPXA 3P9CA 1V54H 3DKYA 3HKZA 3PO3J 3GFJA 3HOWJ 4ON0A 3BTCA 2VBYA 2L01A 2QKLB 1SC7A 2CGPA 3B02A 3E97A 3F22A 2JUCA 3GXOA 4OIPF 1WRJA 1DP7P 1RI7A 3A1YA 1WI3A 4M3EA 1SD6A 3AAFA 4EJTA 1HKSA 3F6OA 3I5UA 3WGHA 2X9DA 1LVAA 2YS9A 4IQJA 2OC6A 3O2PE 5D4RA 4RAZA 2EJRA 5D8KB 2ZXHA 1P4WA 4UHTA 1QQIA 5HS7A 5LGNA 4CHUA 4JOMA 1VFCA 1X19A 2DA5A 4MTEA 1AU7A 2XHKA 2O5RA 1UAAA 1X58A 4I0AA 1T56A 1ULYA 2F5CA 2LY1A 2DK5A 3K0LA 2WADA 3JTHA 4L5EA 3E3VA 1D3YA 3FM3A 2GXGA 4KN4X 2DFIA 1VQKI 4Y4RA 2JA5J 1FMVA 2V1XA 3MN2A 1PUEE 5FLVA 1V55H 2KIMA 2O0YA 2P0WA 4GO1A 2GA2A 2I5UA 3TW6A 4YIFA 2R7ZJ 3IV5A 2KKOA 4JBAA 4FHTA 1R1UA 2HDCA 1SD4A 1X1BA 3K69A 1R71A 1HC8A 2VJIA 1Z3XA 5L3FA 4UV9A 2RREA 5L3GA 2ZMEC 3IWZA 4HNVA 3LMMA 4F55A 4EM1A 1STZA 1TWFJ 2WAFA 4G6DA 1YJNI 4YEJA 2KFDA 4W97A 3HC7A 1FYKA 4KMUX 2ACJA 2L9NA 2XPUA 2W82A 1VZ0A 3HBLA 4EMSA 3KETA 1ZRDA 2IP2A 4F91B 1GXQA 1B9MA 1MBJA 5HVQC 2QBYB 5DUKA 3I4NJ 4XLEA 5IYCJ 1FOXA 1U5TA 4D9JA 4M74A 3SJMA 1ZG3A 2JVHA 3OY9A 4MEXF 4A6DA 1D1BA 1ODDA 5BQTA 3G6EI 3AL0B 1VQOI 4XLFA 1DP3A 2E34A 2FD5A 3K4KA 2QZ8A 3SQNA 5LGTA 4P9FA 2E2JJ 1LNWA 2DYSH 2J5OA 4BAYA 2KHMA 3RKWA 2ZJ2A 1ZRCA 5K7ZA 3AG3H 4BHBA 1ON2A 2F5DA 1XX5A 4G94A 1P7IA 1OYWA 2Z3YA 4HX8A 2HXOA 2L7ZA 4AYBN 5GAGJ 3IH2A 1JJ6C 4P1WA 4CCKA 2HEOA 3GTKJ 1FBSA 1SAXA 3BPVA 1RUOA 3K2AA 3K4CA 1QZEA 5IT3A 3QRFF 3KP3A 5KVRA 5H20A 4BACA 2M7AA 3O6BB 2IGNA 4BJ5C 4U0YA 4HNUA 2XF5A 2D5VA 5DV5A 1BR2A 3ZRGA 1OCCH 2DQLA 3PNYA 1YJWI 2NNYA 1R4NB 2NVYJ 1IAWA 2W00A 3BZKA 3A0BC 1LB2A 3SEQA 2NS0A 4IOCF 3KE2A 3BJOA 3HOSA 1ERDA 1B59A 3I58A 3RPUD 2AO9A 1MBFA 2MG4A 4IHSA 3DV8A 3WU1B 3HOTA 4IRIA 2JZYA 3BG9A 1OCRH 3CUQB 4LG0A 4BY7J 4AD9A 5FKLA 2HQAA 2H8WA 2KZVA 4KUMA 4H4KC 1IW7F 1JT0A 5CPRB 2LSOA 2I8DA 1CGPA 3CDHA 3QOPA 1PUFA 1VNDA 1W36D 3U1KA 1ZYRF 4M3BA 4OIRF 3NWSA 1JE8A 1B1BA 2PQ8A 1IG7A 1X1DA 5GADJ 2IJLA 1B6AA 3O8HA 3MKWB 2ZXJA 3DCFA 2M0MA 3TP0A 2CFXA 4ITVA 4S05A 1ZR2A 4CO8A 1D8JA 2CQKA 3M1EA 4Q48A 4BHCA 4EVIA 5KNLA 3TOAA 3K9TA 1QPMA 2TRTA 4C30A 2QBYA 3LAJA 3ESWB 1EH7A 4IHYA 5HOOA 4I76A 2XRLA 2R93J 4U87A 1LJ9A 3VFZA 2A5YB 3IH3A 3DEUA 2ZJRF 3GWZA 1F5TA 2KDOA 3C2HA 4I01A 1TT5B 2V1UA 2WAEA 1J0RA 4Y15A 5E8GA 1XB4A 1T08B 2BE5F 2DJIA 3G1LA 3ZMSA 1KU7A 5C4XJ 2P5VA 1IUYA 3ZR8X 2R7RA 4D7NA 2KIUA 3I64A 2XAJA 2A69F 2F6CA 3OYDA 2BY3A 3DU6A 2ESHA 2KIFA 1U78A 2IS1A 2ME6A 2WB1A 1D1AA 2DU9A 2LLKA 1LDJA 3JRFA 3D5SC 5C44J 1QZZA 1N25A 2FMYA 2FNPA 2MYSA 2CRGA 3HUGB 4ANJA 2BY2A 4A6EA 2EFPA 4WXHA 1Z77A 2O3FA 1XG1A 1Z9CA 2VE9A 2VIXA 4KICA 2H94A 4LMYA 2HR3A 5FRMA 2IS4A 2L7MP 3KP5A 1J5YA 3F23A 4IL6C 3KP2A 2H1LA 4M72A 5K7HA 5J40A 4BQNA 1R9TJ 5E8IA 5HNFA 4EM2A 3BT9A 2DN0A 2P81A 1HA8A 3FM5A 3QP5A 1MZBA 2RDPA 3RDIA 2B7EA 3K2ZA 4CCNA 2LD5A 1UB9A 3I4PA 3W6KB 1UJ8A 4X1EA 3U9GA 1S7EA 4EM0B 4A0XA 1BR1A 1OR7C 4MFEA 5J1RA 5DM7F 1K7AA 2VOOA 1HOMA 4KDPA 3TOBA 5KAFC 5HLGA 3WODF 1V5GA 1MBGA 3HRUA 2K3FA 3OSGA 2O9LA 2CU7A 3F8CA 2KISA 2JA7J 2X6XA 3CO6C 2EK5A 3FMQA 5LGUA 2A68F 3K4JA 2TDXA 1S5LC 3H9QA 4AVZA 2ADUA 2PMZA 2IXSA 5J6XA 1HW2A 2DAOA 4QPOA 5E3MA 1MDMA 2GOXB 4NB5A 2CJJA 2FRHA 1GV5A 2ZSHB 4CYCB 1GHCA 1BIAA 3VEPA 5CVUA 1VQ5I 1MMDA 3BQYA 4NC8A 4YIIA 3ABUA 3DEEA 2VBWA 3UKGA 1TW3A 2JPBA 5FFXA 4NNJA 2BOLA 2FBKA 2P4WA 2LTPA 3K1NA 2ZMEA 4BE0A 3SZPA 4HF2A 5DCMB 5FKNA 2LF7A 1IN6A 4Q47A 4E7IA 3S1QJ 2DOEA 2R7VA 1S7AA 3BTIA 2CH0A 2VE8A 1H9GA 4IRGA 1I50J 4LIVA 1F4KA 4QLCU 3GTPJ 2IAIA 2AQEA 1E3HA 2HZDA 2A6HF 2K9LA 5J8FA 3CC2I 3HYIA 2PBIA 3ZGKA 3SHFA 3CJRB 4AVPA 3CCLI 2W25A 2L7FP 1ZELA 4N4OB 2DA4A 3Q5FA 2ECBA 5ICFA 2CSOA 3MKYB 1YW7A 2UUZA 1SAUA 3LFKA 4A3GJ 2DTRA 1IN5A 5GAHJ 2CW0F 2IGKA 2D1VA 5L3DA 3TMOA 1S6LA 2QGUA 4II2A 5K5RA 3QPTA 5DM6F 4CUGA 1X2NA 2B63J 1Z7UA 2RV8A 4A3LJ 1IV8A 1FOWA 3WTZA 5HODA 2VBZA 2KQRA 2PN6A 1YFHA 3CCQI 4EJOA 1G6NA 4RMNA 4Y13A 3PFIA 2E7XA 2HYJA 2L3DA 3GZ5A 1TC3C 2DFEA 4CYDA 3JRDA 1IRFA 1G3TA 3L2WA 3EDPA 2DA3A 4HA8A 3K6GA 4WWCA 2M5WA 1G3WA 3DPLC 2WY8Q 3GTMJ 2B9SA 5KK1A 2L02A 3BR1A 3K1MA 3MKLA 4QPQA 5M3MJ 2JA6J 2ELJA 2M0CA 3H3UA 2F4MB 4PUSA 3A01A 2HTJA 2V9VA 2HPMA 1B4AA 3E0JB 2V6EA 1HQCA 1QZYA 3DBRB 5A2QK 2R3SA 2X1EA 4ZTFA 5M5XJ 1WJEA 4HYEA 3M8FA 3EPZA 2HQRA 2VPRA 5TRDA 1U8BA 2WY7Q 4N9HA 2DCEA 3CMEI 1SFKA 2FNAA 1RZ4A 2MLKA 1LFUP 4KISA 3BP8A 1WHUA 2QSFX 3RPUA 4LLNA 3U1DA 3LNQA 4J00A 4A5MA 2ZNYA 3OR2C 1Y1VJ 1WJBA 1UCRA 1JKRC 2EINH 3CJTB 2M4GA 5EEHA 5ILSA 4I99C 2XVCA 4U7BA 4BHPA 1TW2A 2CQ7A 4B43A 9ANTA 2ICWG 2ZXWH 2E5ZA 2XGDA 4AIKA 2VONA 4XICA 1IXSB 2Q2EA 1D5YA 2KLOA 1FEXA 3LWFA 3A2KA 1U6GA 1G3YA 4CYCA 2NS8A 2R5ZA 5J4YA 2QVOA 1BBYA 2R7QA 2JJ7A 4DBRA 1HSJA 2Y30A 3HSFA 1ETVA 3V8JA 3F3XA 5KAIC 1VQ4I 1VQPI 1XGSA 1IN4A 4MGRA 4UB8C 3VYRB 5EGOA 3KEYA 3J81Z 1N75A 2XF6A 3K70D 2WAQA 3I71A 3JCUC 4KYWA 2DT7B 3ABMH 5K7FA 1B72B 3IHUA 3GTOJ 4U0WA 4I98B 2QUFA 3OYKA 1TQIA 1NH3A 1X3WB 1U9NA 5EEGA 4NBQA 4RB2C 3OIPA 5BPIA 2OCEA 2G7HA 3EYIA 3GEZA 3ZMTA 3JREA 4EJUA 1YYVA 3M8EA 1Z6TA 2G0EA 3BY6A 4RLQA 3X2QH 1I6HJ 2JA8J 3J7AY 1J59A 2Y75A 3D1NI 3FX3A 2IEKA 2K86A 3VSKA 2DXIA 3KYDB 4BUPA 2X4HA 2IS2A 2TCTA 3BLYA 3GFMA 5J1UA 1K61A 4KIBA 3SFZA 2HGCA 2RQQA 5CVRA 4BQQA 1ETKA 3V7RA 3JSOA 2PJPA 3FXUA 2EFWA 4KT6A 2G9WA 3OL3A 2RQPA 4BQAA 3N4MA 3WGGA 2HKXA 3MVPA 1EJ9A 1LE8B 4WK8F 4I02A 2LH9A 3K4BA 1RESA 1HF0A 4DNCA 2VXZA 4FX0A 4XL9A 1HBXG 1XMKA 4I7HA 4BKXA 3IAM2 1ZG1A 1FMWA 2XF7A 1OYIA 2YX7A 3KYLA 4HQEA 3MZ8A 1QGPA 5IP9J 4J01A 1UHWA 2OZUA 4M9ZA 4XOTA 2Q2EB 3RYRA 4S0HB 3CCYA 2DMTA 5FD6A 3CMAI 1JJ8C 1RRJA 2DODA 2OV7A 2F5VA 2DA6A 3CQZJ 4UVAA 3L2CA 3GTGJ 2YU9J 2EA2A 1A36A 2EV6A 3BR2A 1ORKA 4JX4A 1RPWA 3M8JA 4K2EA 4Y7NJ 1YIOA 2FX0A 3REOA 2QWWA 3LSIA 5F08A 2GXAA 1SVOA 3PQJA 2BV6A 3PM1A 4Y52J 1EA3A 2W48A 4AM3A 2K9SA 5F6FA 3WTYC 2DMQA 5DCFA 3CUOA 4LITA 3R0JA 3RZDJ 5IYDJ 1OLTA 1WJFA 3QOEA 3OYIA 2B0LA 3WTXC 1J09A 2M9HA 5E3NA 3VODA 3G2BA 3ZMDA 4GXOA 4C3JJ 4X6AJ 4PCQA 4LFUA 1X1PA 4XRSG 1ON1A 2DFFA 2LR8A 2PMUA 1MH4A 1P4XA 3CC4I 3S32A 1KU9A 2VI6A 2DFHA 2W4SA 2Y2ZA 4I0BA 5E79C 2ISZA 1AA7A 3M07A 1SFEA 4MNUA 3PFYA 1FWZA 4U0VA 4E4HA 2AS5F 3I53A 3IAS2 2K27A 2K40A 1T95A 1ZH5A 2LNBA 2BW3A 2XAGA 2E1OA 4AWXB 3DTKA 4PJMA 1G8XA 4HLXA 4BYYA 2XSDC 2ZJQF 3S1NJ 5E3LA 1XTAA 5GTHC 1R36A 5F0CA 5LHGA 3I55I 3A03A 1VQ6I 2IA0A 1IDYA 1FP2A 4Y3OA 3JR9A 2AHQA 2HQ5A 2M30A 3DFGA 3K4LA 5FKKA 1I6XA 5JLXA 4D0PA 1WSUA 1T8IA 3PJRA 2R7UA 2JT1A 4KJZA 4LD5A 1JGGA 1DQUA 3HTUA 4CA0A 2QQAA 3S17J 3JRCA 1TWCJ 3GX4X 1W5TA 4XONA 3WU0A 1BI2A 4IOAF 4GCVA 4HG2A 1Y56A 3D0SA 3HOXJ 5HDKA 4HRIA 1HKQA 1LPQA 2CYYA 3HHHA 2LKXA 2DMPA 4IRHA 3U21A 2XIGA 1U5TC 2UXNA 4QTRA 1MNDA 1BM9A 3H5RA 4ESFA 3HOYJ 1L0OC 3RYPA 3H5NA 1UELB 4NDLA 3V8KA 1WZ2A 3N05A 2KL4A 1O3QA 3DLAA 3D5LA 5LEKA 3RQIA 2ID3A 3G1MA 2FBIA 5H2FC 1KU3A 4OWRB 3DF8A 2EA4A 4RB3C 2JA2A 2STTA 2HDWA 1D1CA 4IF4A 2JRMA 2YSRA 3DTIA 1FBUA 1WJ5A 1ETWA 2X48A 4L18B 3R60A 5A2QZ 3KCCA 3F8NA 1ZR4A 5LLQA 3G71I 2MD5A 4RM2A 3QPLA 1QO0D 2XKPA 2LBFB 1GXPA 1W7PD 1E2XA 1J75A 4AYBA 2LVSA 1Z3YA 4BJTA 1TL8A 2E1MB 2VXDA 4DJAA 1FT9A 4J19A 3EETA 3CJQB 2L0KA 4OMYA 1Z67A 2YPRA 4NUBA 1U3EM 1EH6A 4U88A 2V1NA 3OSFA 2ECCA 4JP0A 1F43A 4LOCA 4XKWA 4MQVA 1D8KA 3CCEI 2G7UA 5IP6A 3J7YJ 1ETQA 3E1SA 2Y31A 2K3PA 4HNTA 2LMDA 1H8AC 1IZ1A 2FEZA 2JN6A 2PMZN 1E17A 2LY2A 1OFCX 4ZZDA 1Z0XA 1K79A 1TNTA 2VJ5A 1FPQA 3TKYA 2J5PA 4YFKF 3OS2A 3DLLF 3QPHA 5FFZA 2W57A 1XMXA 3ZXSA 1R6RA 3HSRA 2Q1ZB 4KNYA 4OU0A 3MMYB 5E20A 4DW6A 4PZJA 3HPHA 2M87A 2M3AA 3TGNA 3TO9A 4GDFA 3BG7A 2OA4A 4QSHA 5JHFA 3JSPA 3GYHX 2MABA 2L9VA 1IJWC 4I2OA 5FLXK 4ZDOA 1KYZA 2DA7A 2GWRA 2JQ7A 1SMTA 3HPGA 5CVJA 4XR6A 2EQRA 1OCOH 2XASA 2OTLI 4G9YA 2CW7A 3OIQA 2A6EF 5E1XA 3HDDA 2EH3A 2QA4I 3S15J 2FJ1A 3OWTA 3AKZA 2ZFWA 2Y9YA 2E19A 5H6QA 4PFOA 1T38A 4EV0A 3ECOA 1B8IB 3QP6A 2FMLA 3QYFA 2CWEA 3OYHA 1JKQC 2GM4A 4QWQA 2EFNA 1R58A 1OCPA 3VYUB 5ICGA 3CMMA 3AG2H 1TQPA 3ZQIA 2H8RA 2VODA 1BOAA 1HCRA 1WFXA 1WQ2A 1WGXA 3ZQ7A 3V4GA 4EQQA 3W6JB 3HRMA 2HOTA 4LGWA 2KJCA 4RA2A 3OYEA 3RI4A 2BYVE 1XGMA 3GUDA 4B3AA 3DU5A 5LHHA 4EEFG 1BI0A 3R0AA 3CJNA 5L3EA 3RKXA 2W24A 1M1EB 4OINF 4MTDA 3W6VA 1NG7A 2HU9A 2W85A 2GBYA 2OCCH 1OR7A 2V9KA 3V7SA 3F8MA 4NHJA 4BXFA 5F27A 1BJZA 1J7KA 2VN2A 1VTNC 2ZFUA 4BXUA 3CCJI 2E35A 1G4DA 2VOPA 1P2FA 1X2MA 1ZN2A 1QNTA 2GLOA 4OIQF 1JUSA 3L2VA 2VPLA 5LD2C 4BBSJ 2ESNA 4ESBA 1DU0A 1ZTRA 1EF4A 4C3HJ 1KGSA 4HF0A 4XLAA 4A3CJ 3DPUA 4F52A 2HVRA 1A31A 3G4SI 4EJWA 1USSA 4ZYGA 4S04A 1VQ8I 3W2AA 4IHVA 3PL8A 3KFWX 3WTSC 3ZMUA 3PSIA 2Y0MA 4NQWA 1HW1A 4CH7A 2IT0A 3F6VA 5IOZA 2PMHA 4CSWA 5K5QA 3PNVA 4RGRA 3ISPA 1YTYA 3PSFA 3ZQFA 2DW4A 4ENMA 1TQMA 2ZSIB 1YS6A 4XRSA 1ONVA 1S3JA 2H27A 5HLTA 1JTYA 2DOAA 4C2TA 1LVKA 2BHZA 3BWGA 1KZHA 2ID6A 1JHHA 2LOOA 2YR2A 2ZXIA 3FWEA 4B48A 4R79A 2ZCWA 3M7GA 1YIJI 3TL4X 1WWXA 2PJRB 3I59B 1N78A 3P9KA 2DA1A 4ABZA 4PJJA 4UNOA 2F4OB 3KP4A 4XLCA 4BQOA 5M5YJ 2EZKA 2VKDA 3OS0A 1H89C 4B4CA 4IHXA 5EEAA 1WJDA 5L3CA 3L00A 1BL0A 4PDKA 4ZH4F 2VQGA 2GIZA 1TTYA 3Q3SA 3NWTA 2R4GA 3H35A 4C9YA 1BC7C 2GZWA 2LY9A 3OMYA 5B1BH 5GTIC 3BR0A 1YS7A 1AOYA 4FTHA 2BXYA 1GDTA 2LDUA 4WX9A 1O7FA 4V2FA 3L2RA 2DT6A 4UVBA 2XDVA 4BGDA 1QRYA 5AIPA 5GPAA 1E3OC 1G59A 1FOYA 3BPXA 2VQCA 4XRFA 5KHDA 3AL0C 2F48A 3FZVA 2QLZA 3MEXA 1USTA 4P55A 3VYSB 2P6TA 4XM3A 3H1CA 2ELKA 2OBPA 2Z9OA 5J3LA 1UHSA 2EBIA 3K4MA 2O6GE 3IUOA 3H5AA 3PIPF 1R1VA 1ACIA 3HRSA 2CO5A 4YELA 3SDBA 5IOYA 3HTSB 2NVQJ 1IF1A 2A5WA 3E5QA 4E7JA 1Y1WJ 1SD5A 1MIJA 2A05A 2Y0SA 4G8XA 4C3IJ 3FXRA 1FYLA 2EZLA 1A5JA 3CLOA 1DPUA 4HLYA 3L09A 4RM3A 1E0EA 1LFBA 4JK1X 1WJCA 2BEOA 5B5EC 5TJJA 1FSEA 1G3SA 1PYVA 5KCMA 2PJRA 4DOZA 3JTGA 2CUEA 4JYKA 4A69C 3OV8A 6PAXA 3BZ6A 1TP4A 1F1ZA 3FKIJ 1R4MB 3ZPLA 3G3ZA 1XDSA 1O3TA 5IYBJ 3Q0WA 3BR3A 3DBHB 3HGYA 1NTCA 3GO5A 3H9GA 4LB5A 4LG3A 2VT2A 4B44A 1LE8A 1UZCA 2DK8A 2E5NA 4ETSA 2VQLA 2NS7A 1XSDA 2JSCA 3BTLA 1Z21A 4HW0A 4A0ZA 3HHGA 4YG2F 1NG6A 1IN8A 3JRAA 2RVCA 3A02A 1R00A 4L9JA 1MMNA 3AFHA 3NAUA 1OCTC 2L2OA 3EYYA 4HF1A 1IO2A 1IXCA 1I3QJ 4XKCA 4ZYEA 1FBQA 1P9QC 2KP6A 1ENHA 2QQBA 1JKOC 4ESJA 2NVTJ 4A3FJ 2L9RA 1ETYA 3HEFA 3K4NA 5GP9A 2Q8KA 2R7DA 2OPTA 1IV6A 4IX7A 3BROA 3IWFA 1UMQA 4OIOF 5IT9Z 1YG2A 3AG4H 3DTEA 3FKJA 5FKMA 4R8HA 2MW8A 2HXIA 5ILUA 4RB1A 5JVTA 3NQOA 3C1DA 3M1CA 2M1BA 3KYCB 3S3NA 3CCRI 4W1UA 3GLXA 4D1QA 3Q9SA 5DYMA 1IN7A 2PI0A 1T2KA 4CDGA 1NHAA 3SDGA 4IHTA 3V7CA 5LHIA 1RKWA 3ZQCA 2OZ6A 3P7NA 2HVQA 5FKOA 1SMYF 2Z5UA 3FXOA 4PJLA 4B3XA 3QU6A 2CQXA 5CLSA 3V42A 5BPDA 2RN7A 4KT5C 4WXCA 1O7LA 2MH2A 4R1HA 4TV7A 3F8BA 3HB9A 1PVEA 4DQ2A 4II3A 3W3CA 3W2WA 2LRDA 4XKBA 1BW5A 1YW8A 1P7JA 1WH7A 5BOXA 1ZG5A 1VQLI 2QENA 3CF5F 4G12A 4HEA2 3J7ZI 2QEXI 1Q1VA 4RS8A 1N77A 1EKEA 2O03A 1BOBA 1YOVB 3KEQA 1ZREA 3GFLA 2A3SA 2M7BA 4AIJA 1Y8RB 3ML6A 4BNCA 2MGQA 3E6CC 3GZ6A 2XB0X 4IVNA 3GTJJ 3K7AJ 2DQRA 4XLHA 3B6AA 4RGXA 4DZPA 3E6MA 2ZB9A 1YRNA 3BC8A 3DP7A 2JTVA 3QAHA 2NYXA 3SZTA 2KIQA 2O8XA 4GYGA 1WH5A 4UB6C 4XOPA 4A93J 4XBFA 2I10A 1BI1A 4BE1A 1QPIA 1YO5C 1CF7A 4MIMA 4PSWA 4GYIA 4XORA 2RC4A 1JXSA 1OJLA 1F9NA 3IH4A 2R7WA 3S1RJ 4L0ZB 2R5YA 1YI2I 4LB6B 5F0HA 2HQNA 3EUKL 2GA1A 3OS1A 3GCMA 1FLIA 1R5HA 3VWBA 2LKSA 2XAUA 2O61A 1HKTA 3L9FA 3MAJA 5LRRA 4D5CA 4BE2A 1H88C 1S8NA 3N97A 3BJ6A 2FOWA 1H9TA 2DYRH 3TDUC 2Z2SB 1R23A 3E5UA 3QPSA 4G7ZF 3H9JA 2D45A 1VF9A 1MBEA 4A5NA 3FIWA 2Y48A 5HDNA 3FK6A 3GBGA 3K10A 2FXAA 1RIOH 2X1DA 1MH3A 4E7SA 1ETOA 2VKHA 2UV1A 3HJEA 4BY1J 3MCZA 1RC9A 4A3KJ 5JVGF 2JRTA 2VKEA 1G2HA 2HOAA 1ITYA 1I1GA 3PQKA 5AIQA 3K1PA 3LSGA 4P9UA 4OAYA 1QVUA 2ME0A 3ERED 2CUZA 2OQRA 5ERIA 2LKPA 1PJRA 2XV4S 2KJBA 5HLIA 5DUIA 4IZZA 2UZKA 2MC4A 4EGYA 2LP0A 4CCMA 1IRGA 4M3FA 1D0XA 4RDUA 5B3SH 1L3LA 1IGNA 4CCLA 3CD6I 1T0FC 3F21A 1W7PB 2QM3A 3SEZA 2P5LC 1Z91A 3ZN0A 5DD4A 1GVDA 3HOVJ 1FIPA 1XC5A 2K7LA 3LSMA 1O4XA 1BW6A 3BTJA 5CVIA 1IRXA 3TBIA 3W2VA 2IGOA 4AC0A 2ZBKA 4OOIA 3CO7C 1UHMA 2V4JC 3R61A 1Z05A 3FBIB 4ENJA 4UY8I 1IRZA 1ZKGA 2LF8A 2VASA 5JHUA 3CCMI 5D6EA 3F8FA 5H6RA 4UUTA 1BA5A 3WG7H 4KIGA 3LA3A 3WE3A 4IO9F 3C2GA 5E17F 3HZJA 1RKTA 2CFOA 5J47A 1W0TA 2D2WA 5JLWA 3I9V2 1ZGJA 4B09A 2XB5A 2WC2A 5HDGA 1X1CA 2BXZA 3HRTA 3F72A 1S72I 2YX4A 1JHFA 5CKTA 4MEYF 1XS9A 5IP7J 1TT0A 3CCSI 4ZJZA 5GAEJ 2XPVA 1V3FA 5EYRA 5K5OA 3BG6A 3HXLA 4I09A 1BN5A 2AXTC 2C6YA 2F5EA 1OMIA 2V9PA 3TO6A 2BY0A 3HGGA 5D6FA 5B66C 1Y8QB 5HS9A 2ZMEB 3PO2J 1ZQ3P 5HNHA 2WWYA 3BR6A 3HKZN 3FK7A 1J9IA 1NK3P 2CQNA 2ZO4A 3ZQGA 2OD5A 3T1BA 5L3BA 2F5FA 1YJ9I 5EG0B 2LBFA 3RCOA 1MDMB 2IRFG 3ASNH 3OOUA 3IL2A 3QU3A 2LFBA 2DOFA 3VSLA 1PDNC 2A61A 1H0MA 2WAQN 2HS5A 3NEUA 2VJ4A 2X51A 1V4RA 3IKTA 4ZC3A 2RNGA 4JX5A 1DUXC 1FTTA 2DBBA 1FP1D 3ZQLA 3OYBA 1W4MA 2HOEA 2HVSA 1HDPA 3M4OJ 4PGHA 1W36C 3S3MA 5B1AH 3TDZC 4A2UA 4EGZA 3S93A 3LAPA 1ZK8A 1XD7A 1Z1DA 4LJZF 1VI0A 2CV1A 3BR5A 2M45A 2EZHA 3LSRA 5DS9A 3E6BA 3QODA 1XSXA 2FOKA 1T6SA 3C3WA 4E7LA 3HM5A 2DA2A 2E60A 4G7HF 3S2DJ 2M34A 3MQ0A 3R6SA 3K70C 3CTAA 4RAGA 2QYOA 3RTRA 2MA3A 2E2HJ 4XSZF 1PUFB 3LQQA 1RR8C 1P4AA 2MD0A 3DBLB 3ECHA 1R5ID 4CZCA 4UUSB 5EF6A 3IRRA 1K4SA 2OJED 3ABKH 4NC7A 5F04A 1MW7A 4L5IA 5F64A 2EWNA 3DXJF 3FBNB 5LEJA 1K6YA 3ZCOA 3GVAA 2MSYA 2P7VB 3KZIC 4FE4A 2RAEA 2CUFA 3AG1H 1QU3A 1FNNA 2KZGA 2JK3A 3BJAA 1JUPA 3RSNA 2L9SA 3S3OA 2EV5A 2R7OA 4WF2A 3RJPA 4D7MA 5DDGA 1JTXA 1O57A 3CC7I 4JX6A 3WTVC 1KA8A 3M3YJ 3DKXA 4Z2YA 3CCUI 2OTJI 4LLLA 3O3KA 3CUQC 2JSPA 3F0CA 2R7SA 3GTQJ 5IY5H 1T98A 3ZMVA 2IVMA 4KITB 1Z6RA 1JUMA 1I27A 4LIUA 4WXDA 1XDUA 4D5FA 3L2UA 4RGUA 4PSXA 3C2BA 2COBA 4XRMA 1A6QA 2DDBA 3WGIA 1MSFC 4BU2A 3BG5A 1YX3A 4M3GA 4XLNF 3WTWC 3MFKA 2Z16A 2IW5A 2BBYA 2QF7A 2XPWA 2LK2A 1BR4A 1EH8A 3NRVA 4HZFA 5D5VB 2E1MC 3H3VK 4L5JA 4HDUA 5F1RA 1GUUA 3RKQA 3O8GA 4QIWN 4DYRA 1E3PA 3LOCA 5EZGA 3S14J 2FA5A 4AIDA 5JI6A 2D1HA 3J80K 2ELHA 2H1KA 2K4JA 3I0TA 1HW5A 4G6QA 1WVRA 1YE9A 1X3UA 5DTDA 1ZGWA 2DMNA 4FASD 2FQ4A 3OYJA 4Z6YA 5JR3A 1WKMA 2DI3A 2K9QA 4BXXJ 4A0YA 2W7NA 2PX9A 4FT8A 1K6OA 2YU3A 3CESA 2VC1A 1BJAA 2QQ8A 1FZPB 2FUG2 2E1NA 2HYGD 4E7ZA 1R1TA 5EGOB 2JWTA 2NVUB 2HNHA 2L4AA 2A07F 5J1YA 4DZJA 3VPRA 2K9MA 5TGTA 3EQLF 5D5XB 1TNSA 5LFAA 4B47A 2FU4A 4IKFA 1YX5A 2PG4A 4XN0A 4O5VA 4XK4A 3KZYA 2OUMA 4O6JA 1TLHB 3Q0VA 3WTTC 4XSXF 4AU7A 4CCJA 4IQ4A 1FYMA 1S7OA 3KPHA 2XGCA 3SXYA 2VL8A 2E36A 2JUGA 1LUJB 1OYYA 2VT3A 2EFOA 4BEHB 4A3EJ 3Q0UA 3ULQB 3KIOA 4A3MJ 3TP3A 1VQ9I 4XQFA 3BCAA 3E5XA 1MKMA 3ZQQA 2EPFA 1FY7A 1IUFA 1TWHJ 2GOMA 3OYCA 3GFIA 3BDDA 4XMYA 4NQWB 4I6ZA 4PK4A 4IPAA 1HLVA 2XGXA 1BC8C 2NOJB 1R5GA 2GQQA 5EDNA 2VUMJ 1UFMA 1LQ1A 1K78B 4GFBA 1GLNA 4MFDA 1K4TA 4PGGA 1I5ZA 1HSTA 1MGTA 1HXDA 4N0BA 1ZRFA 4ZDLA 1B9NA 2L4MA 1D0ZA 3JAMK 3E6DA 2DPUA 2V79A 5LBQA 4BDYA 3J80Z 2RKHA 5F1JA 2Z1DA 1EV7A 4XKVA 5DCMA 1I3AA 1MJAA 3ZP5A 3E7LA 2XKOA 4RLFA 3JRIA 4B1RA 5CVVA 2M8EA 2R7XA 4E7HA 2EIMH 1FSHA 4L9NA 4NC6A 3I59A 4LK1F 2Q0OA 2XC7A 2UXXA 4FE7A 3CF2A 1SVMA 1GV2A 2HPIA 2WTEA 4V2GA 1RUNA 3S8PA 3RIRA 1APLC 1CF7B 5FLXZ 2CQQA 3GW2A 1QA6A 2AXLA 2E7WA 1LFPA 5FLMJ 1QHHD 2IS6A 4DGWB 3UR3C 2P8TA 3H0GJ 3JRGA 2ZKZA 2W84A 1HDDC 1TZLA 1VQMI 1W0UA 3SYTA 2XSJC 3LSJA 1AKHA 3BQZA 1OKRA 1SD7A 3GZNB 1KU2A 4EJVA 1ZARA 1QHGA 1KONA 2FE3A 1SVLA 3KX2A 2LG4A 1FOKA 2DLLA 3LA7A 2CW8A 3FXLA 3V8LA 3WG9A 2EIKH 1MMSA 3LSHA 4WCGA 3H92A 4MO7A 3FXQA 5ICEA 2A6TA 3FDYA 1O3SA 1P6RA 2Y69H 3H0DA 1I39A 3HOUJ 3VOEA 1D5VA 3U2RA 2QQ9A 4ZYAA 2PEXA 3S2WA 2L7KA 1J2XA 3G73A 1AKHB 1SANA 1U2WA 1XGNA 1D0YA 2X1CA 1W5CC 2K5CA 3TQNA 3VDXA 3PUBA 4E70A 1LDKB 5E18F 4M9XA 4Q5SF 4B8XA 3BOQA 4LK0F 1PP7U 4A12A 1OQYA 2M8GX 2M2EA 2BVLA 3GF2A 2R0QC 1MSEC 1VQNI 4ASNA 3GMEA 3C7JA 1LEAA 3JAMZ 2L54A 3RQ4A 1DGRM 2H6CA 4M3DA 4DYQA 1MJBA 5BMZA 1DDNA 2DPDA 2K4BA 4Y17A 2HYFA 4FISA 1PP8F 1W7PA 1MNMC 2PFBA 1YRNB 3FMSA 1V5FA 4RB0A 2ISYA 3S2HJ 3I3LA 5K1YA 3B6CA 2LREA 1S29A 2NVXJ 1JT6A 1QVTA 3I56I 1QBJA 4BL0B 4HAMA 3J7AO 1MD0A 3CZ6A 1X4PA 4ZYDA 1Y6IA 3BCBA 1O3RA 3T0YA 4P5OA 4JQFA 3P9IA 1I1SA 1ETXA 1XMAA 4M6YA 4MQ9F 3KP6A 1SFOJ 2E2IJ 2HOSA 3S16J 1DU6A 1KQ0A 3RZOJ 4RAYA 5CYVA 4IHWA 5EJCA 4YIRX 2PLYA 2F4IA 2BVMA 2NOGA 2BY1A 3DEWA 2WB1N 2WA0A 4MLOA 5D5WB 2VKVA 3GTLJ 4EATA 5IPAA 3KP7A 2Z33A 3L2QA 2V7FA 1B72A 2QSHX 1XGOA 2Z99A 1OPCA 2RNJA 2O8KA 4BH9A 2NXNB 1ZHFA 4KA4A 1Y0UA 2IA2A 1FX7A 3OYMA 2KRFA 3NARA 1YW9A 5ILVA 3H3ZA 3KZZA 2HKOA 2CS3A 1R49A 2KRCA 4PJNA 3SFIA 4BJ6C 1T39A 2BW3B 3ONQA 3L7WA 5AONA 4UVCA 3M9AA 4BS9A 1Y39A 1YQAA 4GRIA 1R22A 3IKVA 3ZOBA 4C2MJ 5J8CA 2MLGA 1KQ9A 4HX7A 4PJ0C 2P7CB 1KYWA 4ENKA 2FF4A 1WI9A 2JPCA 2M4KA 1AHDP 1A04A 3LA2A 5FROA 1IXRC 3P5JA 1U0JA 4FX4A 4ZTJA 3FXKA 3ELKA 5J4VA 4GGGA 5IT9K 1OISA 3J81K 3CDLA 3MZYA 2KRHA 3OIOA 2L5QA 4ZZLA 3G1OA 1TBXA 1DPRA 2DTZA 4E6KG 3B73A 5D4SA 1F36A 2HFHA 4L0YB 4KFCA 3D5RC 2X0LA 1U9OA 1FC3A 4L9VA 1K78A 2FSWA 2BZTA 4OAZA 3LSKA 2YUSA 3LQRA 4IEJA 1W1WE 3EUHC 2ETHA 3FHZA 2CUJA 4CGZA 4N4NB 5D5UB 2EZIA 2CV0A 1IDZA 4FCYA 1A6IA 1NK2P 2WV1A 1RR7A 2NNNA 3L1PA 4BBRJ 2ZJPF 4HQMA 3QWLA 3EUAA 1K83J 2JVGA 2LYCA 1JI8A 3HUGA 2VQHA 2EIJH 1YLFA 2R5YB 3DPTA 1SFUA 5JFRA 3CDIA 5ED4A 2N8GA 2EFQA 3SZGA 2LC2A 3LSTA 3T8RA 2OF7A 2NAZA 2VBXA 5FRNA 4F3QA 2DMUA 1T33A 1KQ8A 4HV5A 4YRVA 3HSEA 1X1AA 2MC3A 1A35A 2QCOA 3FMRA 4RAFA 5DEQA 4XLPF 4UV8A 2X6YA 1W5SA 2K9NA 3ASOH 3MZHA 5E3OA 1FJLA 4CXFA 2HI3A 2R7TA 4UXNA 1XCVA 5CQGA 5FD5A 2BGCA 1R7JA 3QQAA 2STWA 2P5KA 4UUSA 2V26A 4HDVA 4YFXF 2HDDA 2R92J 3MWMA 4OMZA 1ZAOA 4HSTA 2ZC2A 2HTSA 3MD2A 5D8LB 5LRSA 5FGMA 4Q4ZF 2CV2A
chains in the Genus database with same CATH topology
3OOPA 2HZTA 2XUBA 1XSVA 1XCBA 4M6XA 3JW4A 3KLOA 1U5TB 2FBHA 2K02A 2WV0A 4CICA 3COAC 5ICCA 2FQ3A 4G7OF 4IJAA 2DO7A 3T5XA 4YFNF 4P96A 4RGSA 3T8TA 3ZN1A 4KN7X 1Q1HA 2OQGA 2XRNA 3I54A 2IPQX 3HIFA 1LEBA 3ROUA 1C0WA 2XAFA 2OAZA 1U8RA 3TO7A 4HV6A 4LLGF 3R4KA 1XN7A 2EV0A 2XAQA 2H6BA 2EB7A 4M71A 3ZMZA 2GIVA 4CZZA 5E1ZB 2E1CA 2HWVA 2V6CA 5FB2A 1T0FA 2XROA 2V1DA 1RNLA 1MJ9A 2GAUA 2R7FA 4KIFA 4M73A 1ZLJA 2MBFA 4HBLA 1ZGAA 2RGVA 2H09A 4O3MA 4HOBA 2XAHA 1AWCA 1ZLKA 4N9IA 2NRAC 2F2EA 1REPC 4L9TA 3KEOA 4ENNA 5CJ9A 1LDDA 1GVJA 1P92A 4AIHA 3CUQA 4LG0B 3C18A 2GXBA 3RPQA 5E1WA 3ABTA 1BI3A 5BS6A 4U7DA 5DD8A 5HS8A 3IRQA 4ZYHA 4H0EA 4IXAA 2OU2A 4M9SA 3Q9VA 1JGSA 2ZNZA 3DKWA 5HLHA 2MH9A 3RKYA 1BIBA 2CG4A 2UWMA 2IA1A 3DQVC 3WTUC 3VB2A 2VC0A 3FF5A 2COMA 3EUHA 2DT5A 1SFXA 3KLNA 4MHGA 5FO5A 4HX4A 4UUVA 3IC7A 2P6SA 4F7ZA 3WE2A 4KMFA 3P9CA 3GFJA 4ON0A 2VBYA 2L01A 2CGPA 3B02A 3E97A 3F22A 3GXOA 4OIPF 1WRJA 1DP7P 1RI7A 3AAFA 1SD6A 4EJTA 1HKSA 3F6OA 3I5UA 3WGHA 1LVAA 3O2PE 5D4RA 4RAZA 2EJRA 5D8KB 1P4WA 4UHTA 1QQIA 5HS7A 5LGNA 4CHUA 4MTEA 2XHKA 4I0AA 1ULYA 2F5CA 2DK5A 3K0LA 3JTHA 3E3VA 1D3YA 3FM3A 2GXGA 4KN4X 2DFIA 2V1XA 1PUEE 2KIMA 2O0YA 4GO1A 2GA2A 4YIFA 2KKOA 4JBAA 4FHTA 1R1UA 2HDCA 1SD4A 3K69A 5L3FA 4UV9A 5L3GA 3IWZA 4EM1A 1STZA 4G6DA 1FYKA 4KMUX 2ACJA 4EMSA 3KETA 1ZRDA 2IP2A 1GXQA 1B9MA 5HVQC 2QBYB 5DUKA 1U5TA 4M74A 1ZG3A 4MEXF 4A6DA 1ODDA 5BQTA 2QZ8A 3SQNA 5LGTA 4P9FA 1LNWA 2J5OA 4BAYA 3RKWA 2ZJ2A 1ZRCA 4BHBA 1ON2A 2F5DA 4G94A 1OYWA 2Z3YA 4HX8A 2HEOA 1SAXA 1FBSA 3BPVA 1RUOA 5IT3A 3QRFF 3KP3A 5KVRA 5H20A 3O6BB 4U0YA 5DV5A 2DQLA 2NNYA 1IAWA 1LB2A 2NS0A 3KE2A 3BJOA 3HOSA 1B59A 3I58A 4IHSA 3DV8A 4IRIA 3WU1B 3HOTA 2JZYA 3CUQB 4LG0A 4AD9A 4KUMA 1IW7F 2LSOA 1CGPA 3CDHA 3QOPA 1ZYRF 4OIRF 1JE8A 1B1BA 2PQ8A 2IJLA 1B6AA 2ZXJA 2CFXA 4S05A 1D8JA 4CO8A 2CQKA 3M1EA 4Q48A 4BHCA 4EVIA 3TOAA 3K9TA 2QBYA 1QPMA 3LAJA 1EH7A 5HOOA 1LJ9A 3VFZA 2A5YB 3DEUA 3GWZA 1F5TA 4I01A 2V1UA 1J0RA 4Y15A 5E8GA 1XB4A 2BE5F 3ZMSA 1KU7A 2P5VA 1IUYA 2KIUA 3I64A 2XAJA 2A69F 2ESHA 2KIFA 1U78A 2DU9A 1LDJA 1QZZA 2FMYA 2FNPA 4A6EA 2EFPA 4WXHA 2O3FA 1Z9CA 2VE9A 4KICA 2H94A 4LMYA 2HR3A 3KP5A 1J5YA 3F23A 3KP2A 4M72A 5E8IA 4EM2A 3FM5A 3QP5A 1MZBA 2RDPA 3RDIA 3K2ZA 1UB9A 3I4PA 3W6KB 3U9GA 4EM0B 4A0XA 1K7AA 2VOOA 4KDPA 3TOBA 5HLGA 3WODF 3HRUA 3F8CA 3CO6C 2EK5A 3FMQA 5LGUA 2A68F 2TDXA 2ADUA 1HW2A 5J6XA 1MDMA 2DAOA 4NB5A 2FRHA 1GHCA 1BIAA 3VEPA 5CVUA 4YIIA 3ABUA 2VBWA 1TW3A 2JPBA 5FFXA 2FBKA 2P4WA 3K1NA 2ZMEA 3SZPA 4HF2A 5DCMB 2LF7A 1IN6A 4Q47A 1S7AA 2VE8A 1H9GA 4IRGA 1F4KA 4QLCU 2A6HF 5J8FA 3HYIA 2PBIA 3SHFA 4AVPA 2W25A 3Q5FA 5ICFA 2CSOA 1YW7A 3LFKA 2DTRA 1IN5A 2CW0F 2D1VA 5L3DA 1S6LA 5K5RA 3QPTA 1Z7UA 2RV8A 3WTZA 1YFHA 2VBZA 2PN6A 4EJOA 1G6NA 4Y13A 3PFIA 2E7XA 2L3DA 3GZ5A 4CYDA 1IRFA 1G3TA 3EDPA 4HA8A 4WWCA 2M5WA 1G3WA 3DPLC 5KK1A 2L02A 3K1MA 3H3UA 2HTJA 2V9VA 1B4AA 1HQCA 1QZYA 5A2QK 2R3SA 4HYEA 3M8FA 2HQRA 5TRDA 4N9HA 2FNAA 1RZ4A 2MLKA 3BP8A 3RPUA 4LLNA 3U1DA 4A5MA 2ZNYA 1UCRA 5EEHA 5ILSA 2XVCA 4U7BA 4BHPA 1TW2A 4AIKA 2VONA 1IXSB 2Q2EA 3LWFA 1U6GA 1G3YA 2QVOA 1BBYA 1HSJA 3HSFA 3V8JA 3F3XA 1XGSA 1IN4A 4MGRA 3J81Z 3I71A 4KYWA 3IHUA 4U0WA 4I98B 2QUFA 1TQIA 5EEGA 4RB2C 5BPIA 2G7HA 3EYIA 3GEZA 3ZMTA 4EJUA 1YYVA 3M8EA 1Z6TA 3BY6A 1J59A 2Y75A 3FX3A 2K86A 2X4HA 3GFMA 4KIBA 3SFZA 2HGCA 5CVRA 3V7RA 3JSOA 2PJPA 3FXUA 2EFWA 2G9WA 4BQAA 2RQPA 3N4MA 3WGGA 2HKXA 4WK8F 4I02A 4DNCA 2VXZA 4FX0A 1HBXG 1XMKA 4I7HA 1ZG1A 1OYIA 2YX7A 4HQEA 1QGPA 1UHWA 2OZUA 4M9ZA 3RYRA 5FD6A 4UVAA 3L2CA 2EA2A 2EV6A 4K2EA 1YIOA 3REOA 2QWWA 3PQJA 2BV6A 5F6FA 3WTYC 5DCFA 3CUOA 3R0JA 2B0LA 3WTXC 3VODA 3ZMDA 4GXOA 4PCQA 4LFUA 1ON1A 2PMUA 1P4XA 1KU9A 4I0BA 2ISZA 1SFEA 4MNUA 1FWZA 4U0VA 2AS5F 3I53A 2K27A 1ZH5A 2LNBA 2XAGA 4AWXB 4HLXA 4BYYA 1R36A 5LHGA 2IA0A 1FP2A 2H27A 2M30A 1WSUA 3DFGA 1I6XA 4D0PA 2JT1A 4LD5A 3HTUA 2QQAA 3GX4X 1W5TA 3WU0A 1BI2A 4GCVA 3D0SA 5HDKA 1HKQA 2CYYA 3HHHA 4IRHA 2XIGA 1U5TC 2UXNA 4ESFA 1BM9A 1L0OC 3RYPA 3V8KA 1O3QA 3D5LA 5LEKA 2FBIA 1KU3A 3DF8A 2EA4A 4RB3C 2STTA 4IF4A 2YSRA 1FBUA 4L18B 3R60A 5A2QZ 3KCCA 3F8NA 5LLQA 2MD5A 1QO0D 2XKPA 1GXPA 1W7PD 1E2XA 1J75A 1FT9A 3EETA 4OMYA 2YPRA 1U3EM 1EH6A 4U88A 4MQVA 1D8KA 2G7UA 1IZ1A 2FEZA 1E17A 4ZZDA 1K79A 1TNTA 1FPQA 3TKYA 2J5PA 4YFKF 3QPHA 5FFZA 2W57A 3HSRA 4KNYA 4OU0A 5E20A 4PZJA 2M87A 3TGNA 3TO9A 2OA4A 3JSPA 3GYHX 4I2OA 5FLXK 1KYZA 2GWRA 1SMTA 5CVJA 2XASA 4G9YA 2A6EF 5E1XA 2ZFWA 5H6QA 1T38A 4EV0A 3ECOA 3QP6A 2FMLA 2CWEA 4QWQA 2EFNA 1R58A 5ICGA 1TQPA 2VODA 1BOAA 1WQ2A 3ZQ7A 3V4GA 4EQQA 3W6JB 3HRMA 4LGWA 2KJCA 3RI4A 2BYVE 1XGMA 3GUDA 5LHHA 1BI0A 3R0AA 3CJNA 5L3EA 3RKXA 2W24A 4OINF 4MTDA 2W85A 3V7SA 1OR7A 3F8MA 4NHJA 1J7KA 2VN2A 1VTNC 4BXUA 1G4DA 2VOPA 1P2FA 1ZN2A 1QNTA 4OIQF 2ESNA 4ESBA 1KGSA 4HF0A 4EJWA 1USSA 4ZYGA 4S04A 3KFWX 3WTSC 3ZMUA 2Y0MA 4NQWA 1HW1A 2IT0A 3F6VA 2PMHA 5K5QA 4RGRA 3ISPA 1YTYA 2DW4A 4ENMA 1TQMA 1YS6A 1ONVA 1S3JA 3BWGA 2YR2A 1JHHA 3FWEA 4R79A 2ZCWA 3M7GA 1WWXA 3I59B 3P9KA 4UNOA 3KP4A 5L3CA 3L00A 4PDKA 4ZH4F 1TTYA 1BC7C 2GZWA 1AOYA 1YS7A 2LDUA 4WX9A 1O7FA 4UVBA 5AIPA 3BPXA 4XRFA 3FZVA 2QLZA 3MEXA 1USTA 4P55A 2P6TA 2OBPA 2Z9OA 2O6GE 1R1VA 3HRSA 2CO5A 3HTSB 1IF1A 3E5QA 1SD5A 4G8XA 3FXRA 1FYLA 1DPUA 3CLOA 4HLYA 3L09A 4JK1X 2BEOA 5TJJA 1FSEA 1G3SA 3JTGA 3OV8A 6PAXA 3BZ6A 1F1ZA 3ZPLA 3G3ZA 1XDSA 1O3TA 3GO5A 4LB5A 2VT2A 4ETSA 2DK8A 1XSDA 2JSCA 4HW0A 4YG2F 3HHGA 4A0ZA 1IN8A 2RVCA 1R00A 4L9JA 3EYYA 4HF1A 1IXCA 4ZYEA 1FBQA 2QQBA 4ESJA 2Q8KA 2R7DA 3BROA 3IWFA 4OIOF 5IT9Z 1YG2A 4R8HA 5ILUA 4RB1A 5JVTA 3NQOA 3C1DA 2M1BA 3GLXA 3Q9SA 5DYMA 1IN7A 2PI0A 1T2KA 4CDGA 1NHAA 4IHTA 3V7CA 5LHIA 2OZ6A 3P7NA 1SMYF 2Z5UA 3QU6A 5CLSA 5BPDA 2RN7A 4KT5C 4WXCA 1O7LA 2MH2A 4R1HA 4TV7A 3F8BA 4DQ2A 1YW8A 5BOXA 1ZG5A 2QENA 4RS8A 2O03A 3KEQA 1ZREA 3GFLA 2A3SA 4AIJA 3ML6A 4BNCA 3E6CC 3GZ6A 4IVNA 2DQRA 4RGXA 3E6MA 3DP7A 2JTVA 3QAHA 2NYXA 3SZTA 2O8XA 4GYGA 4XBFA 1BI1A 1YO5C 1CF7A 4GYIA 2RC4A 1JXSA 1F9NA 4L0ZB 4LB6B 2HQNA 2GA1A 1FLIA 1R5HA 2O61A 1HKTA 3L9FA 3MAJA 5LRRA 1S8NA 3N97A 3BJ6A 1H9TA 3TDUC 1R23A 3E5UA 4G7ZF 2D45A 4A5NA 2Y48A 5HDNA 2FXAA 1RIOH 3MCZA 2JRTA 1I1GA 3PQKA 5AIQA 3K1PA 4P9UA 3ERED 2OQRA 5ERIA 2LKPA 2XV4S 2KJBA 5HLIA 5DUIA 2UZKA 4EGYA 1IRGA 1L3LA 3F21A 1W7PB 2QM3A 2P5LC 1Z91A 3ZN0A 5DD4A 2K7LA 5CVIA 2ZBKA 4OOIA 3CO7C 1UHMA 3R61A 1Z05A 4ENJA 2LF8A 5JHUA 5D6EA 3F8FA 5H6RA 4KIGA 3LA3A 3WE3A 5E17F 2D2WA 1ZGJA 4B09A 2WC2A 5HDGA 3HRTA 3F72A 2YX4A 1JHFA 4MEYF 1V3FA 5K5OA 4I09A 1BN5A 2C6YA 2F5EA 1OMIA 3TO6A 5D6FA 5HS9A 2ZMEB 2WWYA 1J9IA 2ZO4A 2OD5A 3T1BA 5L3BA 2F5FA 1MDMB 2IRFG 3IL2A 3QU3A 1PDNC 2A61A 1H0MA 2HS5A 3NEUA 1V4RA 3IKTA 1DUXC 2DBBA 1FP1D 1W4MA 2HOEA 4PGHA 3TDZC 4A2UA 4EGZA 3LAPA 1XD7A 1Z1DA 4LJZF 2M45A 3E6BA 1XSXA 2FOKA 1T6SA 3C3WA 4G7HF 3MQ0A 3R6SA 3CTAA 2QYOA 3RTRA 2MA3A 4XSZF 3LQQA 1P4AA 3ECHA 3IRRA 5F64A 4L5IA 2EWNA 3DXJF 5LEJA 3GVAA 2P7VB 1FNNA 3BJAA 2EV5A 4WF2A 3RJPA 5DDGA 1O57A 3WTVC 1KA8A 4Z2YA 4LLLA 3O3KA 3CUQC 1T98A 3ZMVA 2IVMA 1Z6RA 1I27A 4WXDA 1XDUA 4RGUA 3WGIA 4XLNF 3WTWC 3MFKA 2IW5A 2BBYA 3NRVA 1EH8A 4HZFA 5D5VB 4L5JA 4HDUA 5F1RA 2FA5A 5JI6A 2D1HA 3J80K 2ELHA 2K4JA 3I0TA 1HW5A 4G6QA 1X3UA 5JR3A 1WKMA 2DI3A 4A0YA 4FT8A 1K6OA 2YU3A 2VC1A 1BJAA 1FZPB 2E1NA 2HYGD 1R1TA 2A07F 2L4AA 3EQLF 5D5XB 1TNSA 2FU4A 2PG4A 4O5VA 3KZYA 4O6JA 1TLHB 3WTTC 4XSXF 1FYMA 1S7OA 3SXYA 1OYYA 2VT3A 2EFOA 3ULQB 3E5XA 1MKMA 1FY7A 3GFIA 3BDDA 4IPAA 2XGXA 1BC8C 1R5GA 2GQQA 1UFMA 1LQ1A 1K78B 4PGGA 1I5ZA 1HSTA 1MGTA 1HXDA 4N0BA 1ZRFA 1B9NA 2L4MA 3JAMK 3E6DA 2DPUA 2V79A 5LBQA 3J80Z 2RKHA 1EV7A 5DCMA 1MJAA 3ZP5A 2XKOA 5CVVA 2M8EA 1FSHA 4L9NA 3I59A 4LK1F 2Q0OA 2UXXA 2WTEA 1RUNA 3RIRA 1CF7B 5FLXZ 3GW2A 2AXLA 2E7WA 2P8TA 2ZKZA 2W84A 1OKRA 1SD7A 1KU2A 4EJVA 1ZARA 2FE3A 1FOKA 2DLLA 3LA7A 3V8LA 3WG9A 4WCGA 3H92A 3FXQA 5ICEA 1O3SA 1P6RA 3VOEA 1D5VA 3U2RA 2QQ9A 2PEXA 3S2WA 1J2XA 3G73A 1U2WA 1XGNA 3TQNA 4E70A 1LDKB 5E18F 4M9XA 4Q5SF 4B8XA 3BOQA 4LK0F 1PP7U 4A12A 3GF2A 4ASNA 3C7JA 1LEAA 3JAMZ 2L54A 2H6CA 1MJBA 5BMZA 1DDNA 2DPDA 2K4BA 4Y17A 2HYFA 1PP8F 1W7PA 2PFBA 3FMSA 4RB0A 2ISYA 5K1YA 1S29A 1QBJA 4HAMA 3J7AO 1MD0A 4ZYDA 1O3RA 3T0YA 4P5OA 4JQFA 3P9IA 1I1SA 1XMAA 4M6YA 4MQ9F 3KP6A 1KQ0A 4RAYA 5CYVA 2PLYA 5D5WB 3KP7A 2Z33A 1XGOA 2Z99A 1OPCA 2RNJA 4BH9A 1ZHFA 4KA4A 1Y0UA 2IA2A 1FX7A 2KRFA 1YW9A 5ILVA 3H3ZA 3KZZA 2HKOA 1T39A 3L7WA 5AONA 4UVCA 3M9AA 1YQAA 1R22A 3IKVA 5J8CA 2MLGA 1KQ9A 4HX7A 2P7CB 1KYWA 4ENKA 2FF4A 1WI9A 2JPCA 1A04A 3LA2A 1IXRC 4FX4A 3ELKA 4GGGA 5IT9K 3J81K 3MZYA 4ZZLA 1TBXA 1DPRA 3B73A 5D4SA 2HFHA 4L0YB 4KFCA 2X0LA 1FC3A 4L9VA 1K78A 2FSWA 3LQRA 3FHZA 2ETHA 4CGZA 5D5UB 2NNNA 4HQMA 3HUGA 1YLFA 3DPTA 1SFUA 5JFRA 5ED4A 2EFQA 3LSTA 3T8RA 2NAZA 2VBXA 1KQ8A 4HV5A 3HSEA 2MC3A 5DEQA 3FMRA 4XLPF 4UV8A 1W5SA 3MZHA 4CXFA 4UXNA 1XCVA 5FD5A 2BGCA 1R7JA 2STWA 2P5KA 4HDVA 4YFXF 3MWMA 4OMZA 1ZAOA 5D8LB 2HTSA 5LRSA 5FGMA 4Q4ZF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OOP A;  2HZT A;  2XUB A;  1XSV A;  1XCB A;  4M6X A;  3JW4 A;  3KLO A;  1U5T B;  2FBH A;  2K02 A;  2WV0 A;  4CIC A;  3COA C;  5ICC A;  2FQ3 A;  4G7O F;  4IJA A;  2DO7 A;  3T5X A;  4YFN F;  4P96 A;  4RGS A;  3T8T A;  3ZN1 A;  4KN7 X;  1Q1H A;  2OQG A;  2XRN A;  3I54 A;  2IPQ X;  3HIF A;  1LEB A;  3ROU A;  1C0W A;  2XAF A;  2OAZ A;  1U8R A;  3TO7 A;  4HV6 A;  4LLG F;  3R4K A;  1XN7 A;  2EV0 A;  2XAQ A;  2H6B A;  2EB7 A;  4M71 A;  3ZMZ A;  2GIV A;  4CZZ A;  5E1Z B;  2E1C A;  2HWV A;  2V6C A;  5FB2 A;  1T0F A;  2XRO A;  2V1D A;  1RNL A;  1MJ9 A;  2GAU A;  2R7F A;  4KIF A;  4M73 A;  1ZLJ A;  2MBF A;  4HBL A;  1ZGA A;  2RGV A;  2H09 A;  4O3M A;  4HOB A;  2XAH A;  1AWC A;  1ZLK A;  4N9I A;  2NRA C;  2F2E A;  1REP C;  4L9T A;  3KEO A;  4ENN A;  5CJ9 A;  1LDD A;  1GVJ A;  1P92 A;  4AIH A;  3CUQ A;  4LG0 B;  3C18 A;  2GXB A;  3RPQ A;  5E1W A;  3ABT A;  1BI3 A;  5BS6 A;  4U7D A;  5DD8 A;  5HS8 A;  3IRQ A;  4ZYH A;  4H0E A;  4IXA A;  2OU2 A;  4M9S A;  3Q9V A;  1JGS A;  2ZNZ A;  3DKW A;  5HLH A;  2MH9 A;  3RKY A;  1BIB A;  2CG4 A;  2UWM A;  2IA1 A;  3DQV C;  3WTU C;  3VB2 A;  2VC0 A;  3FF5 A;  2COM A;  3EUH A;  2DT5 A;  1SFX A;  3KLN A;  4MHG A;  5FO5 A;  4HX4 A;  4UUV A;  3IC7 A;  2P6S A;  4F7Z A;  3WE2 A;  4KMF A;  3P9C A;  3GFJ A;  4ON0 A;  2VBY A;  2L01 A;  2CGP A;  3B02 A;  3E97 A;  3F22 A;  3GXO A;  4OIP F;  1WRJ A;  1DP7 P;  1RI7 A;  3AAF A;  1SD6 A;  4EJT A;  1HKS A;  3F6O A;  3I5U A;  3WGH A;  1LVA A;  3O2P E;  5D4R A;  4RAZ A;  2EJR A;  5D8K B;  1P4W A;  4UHT A;  1QQI A;  5HS7 A;  5LGN A;  4CHU A;  4MTE A;  2XHK A;  4I0A A;  1ULY A;  2F5C A;  2DK5 A;  3K0L A;  3JTH A;  3E3V A;  1D3Y A;  3FM3 A;  2GXG A;  4KN4 X;  2DFI A;  2V1X A;  1PUE E;  2KIM A;  2O0Y A;  4GO1 A;  2GA2 A;  4YIF A;  2KKO A;  4JBA A;  4FHT A;  1R1U A;  2HDC A;  1SD4 A;  3K69 A;  5L3F A;  4UV9 A;  5L3G A;  3IWZ A;  4EM1 A;  1STZ A;  4G6D A;  1FYK A;  4KMU X;  2ACJ A;  4EMS A;  3KET A;  1ZRD A;  2IP2 A;  1GXQ A;  1B9M A;  5HVQ C;  2QBY B;  5DUK A;  1U5T A;  4M74 A;  1ZG3 A;  4MEX F;  4A6D A;  1ODD A;  5BQT A;  2QZ8 A;  3SQN A;  5LGT A;  4P9F A;  1LNW A;  2J5O A;  4BAY A;  3RKW A;  2ZJ2 A;  1ZRC A;  4BHB A;  1ON2 A;  2F5D A;  4G94 A;  1OYW A;  2Z3Y A;  4HX8 A;  2HEO A;  1SAX A;  1FBS A;  3BPV A;  1RUO A;  5IT3 A;  3QRF F;  3KP3 A;  5KVR A;  5H20 A;  3O6B B;  4U0Y A;  5DV5 A;  2DQL A;  2NNY A;  1IAW A;  1LB2 A;  2NS0 A;  3KE2 A;  3BJO A;  3HOS A;  1B59 A;  3I58 A;  4IHS A;  3DV8 A;  4IRI A;  3WU1 B;  3HOT A;  2JZY A;  3CUQ B;  4LG0 A;  4AD9 A;  4KUM A;  1IW7 F;  2LSO A;  1CGP A;  3CDH A;  3QOP A;  1ZYR F;  4OIR F;  1JE8 A;  1B1B A;  2PQ8 A;  2IJL A;  1B6A A;  2ZXJ A;  2CFX A;  4S05 A;  1D8J A;  4CO8 A;  2CQK A;  3M1E A;  4Q48 A;  4BHC A;  4EVI A;  3TOA A;  3K9T A;  2QBY A;  1QPM A;  3LAJ A;  1EH7 A;  5HOO A;  1LJ9 A;  3VFZ A;  2A5Y B;  3DEU A;  3GWZ A;  1F5T A;  4I01 A;  2V1U A;  1J0R A;  4Y15 A;  5E8G A;  1XB4 A;  2BE5 F;  3ZMS A;  1KU7 A;  2P5V A;  1IUY A;  2KIU A;  3I64 A;  2XAJ A;  2A69 F;  2ESH A;  2KIF A;  1U78 A;  2DU9 A;  1LDJ A;  1QZZ A;  2FMY A;  2FNP A;  4A6E A;  2EFP A;  4WXH A;  2O3F A;  1Z9C A;  2VE9 A;  4KIC A;  2H94 A;  4LMY A;  2HR3 A;  3KP5 A;  1J5Y A;  3F23 A;  3KP2 A;  4M72 A;  5E8I A;  4EM2 A;  3FM5 A;  3QP5 A;  1MZB A;  2RDP A;  3RDI A;  3K2Z A;  1UB9 A;  3I4P A;  3W6K B;  3U9G A;  4EM0 B;  4A0X A;  1K7A A;  2VOO A;  4KDP A;  3TOB A;  5HLG A;  3WOD F;  3HRU A;  3F8C A;  3CO6 C;  2EK5 A;  3FMQ A;  5LGU A;  2A68 F;  2TDX A;  2ADU A;  1HW2 A;  5J6X A;  1MDM A;  2DAO A;  4NB5 A;  2FRH A;  1GHC A;  1BIA A;  3VEP A;  5CVU A;  4YII A;  3ABU A;  2VBW A;  1TW3 A;  2JPB A;  5FFX A;  2FBK A;  2P4W A;  3K1N A;  2ZME A;  3SZP A;  4HF2 A;  5DCM B;  2LF7 A;  1IN6 A;  4Q47 A;  1S7A A;  2VE8 A;  1H9G A;  4IRG A;  1F4K A;  4QLC U;  2A6H F;  5J8F A;  3HYI A;  2PBI A;  3SHF A;  4AVP A;  2W25 A;  3Q5F A;  5ICF A;  2CSO A;  1YW7 A;  3LFK A;  2DTR A;  1IN5 A;  2CW0 F;  2D1V A;  5L3D A;  1S6L A;  5K5R A;  3QPT A;  1Z7U A;  2RV8 A;  3WTZ A;  1YFH A;  2VBZ A;  2PN6 A;  4EJO A;  1G6N A;  4Y13 A;  3PFI A;  2E7X A;  2L3D A;  3GZ5 A;  4CYD A;  1IRF A;  1G3T A;  3EDP A;  4HA8 A;  4WWC A;  2M5W A;  1G3W A;  3DPL C;  5KK1 A;  2L02 A;  3K1M A;  3H3U A;  2HTJ A;  2V9V A;  1B4A A;  1HQC A;  1QZY A;  5A2Q K;  2R3S A;  4HYE A;  3M8F A;  2HQR A;  5TRD A;  4N9H A;  2FNA A;  1RZ4 A;  2MLK A;  3BP8 A;  3RPU A;  4LLN A;  3U1D A;  4A5M A;  2ZNY A;  1UCR A;  5EEH A;  5ILS A;  2XVC A;  4U7B A;  4BHP A;  1TW2 A;  4AIK A;  2VON A;  1IXS B;  2Q2E A;  3LWF A;  1U6G A;  1G3Y A;  2QVO A;  1BBY A;  1HSJ A;  3HSF A;  3V8J A;  3F3X A;  1XGS A;  1IN4 A;  4MGR A;  3J81 Z;  3I71 A;  4KYW A;  3IHU A;  4U0W A;  4I98 B;  2QUF A;  1TQI A;  5EEG A;  4RB2 C;  5BPI A;  2G7H A;  3EYI A;  3GEZ A;  3ZMT A;  4EJU A;  1YYV A;  3M8E A;  1Z6T A;  3BY6 A;  1J59 A;  2Y75 A;  3FX3 A;  2K86 A;  2X4H A;  3GFM A;  4KIB A;  3SFZ A;  2HGC A;  5CVR A;  3V7R A;  3JSO A;  2PJP A;  3FXU A;  2EFW A;  2G9W A;  4BQA A;  2RQP A;  3N4M A;  3WGG A;  2HKX A;  4WK8 F;  4I02 A;  4DNC A;  2VXZ A;  4FX0 A;  1HBX G;  1XMK A;  4I7H A;  1ZG1 A;  1OYI A;  2YX7 A;  4HQE A;  1QGP A;  1UHW A;  2OZU A;  4M9Z A;  3RYR A;  5FD6 A;  4UVA A;  3L2C A;  2EA2 A;  2EV6 A;  4K2E A;  1YIO A;  3REO A;  2QWW A;  3PQJ A;  2BV6 A;  5F6F A;  3WTY C;  5DCF A;  3CUO A;  3R0J A;  2B0L A;  3WTX C;  3VOD A;  3ZMD A;  4GXO A;  4PCQ A;  4LFU A;  1ON1 A;  2PMU A;  1P4X A;  1KU9 A;  4I0B A;  2ISZ A;  1SFE A;  4MNU A;  1FWZ A;  4U0V A;  2AS5 F;  3I53 A;  2K27 A;  1ZH5 A;  2LNB A;  2XAG A;  4AWX B;  4HLX A;  4BYY A;  1R36 A;  5LHG A;  2IA0 A;  1FP2 A;  2H27 A;  2M30 A;  1WSU A;  3DFG A;  1I6X A;  4D0P A;  2JT1 A;  4LD5 A;  3HTU A;  2QQA A;  3GX4 X;  1W5T A;  3WU0 A;  1BI2 A;  4GCV A;  3D0S A;  5HDK A;  1HKQ A;  2CYY A;  3HHH A;  4IRH A;  2XIG A;  1U5T C;  2UXN A;  4ESF A;  1BM9 A;  1L0O C;  3RYP A;  3V8K A;  1O3Q A;  3D5L A;  5LEK A;  2FBI A;  1KU3 A;  3DF8 A;  2EA4 A;  4RB3 C;  2STT A;  4IF4 A;  2YSR A;  1FBU A;  4L18 B;  3R60 A;  5A2Q Z;  3KCC A;  3F8N A;  5LLQ A;  2MD5 A;  1QO0 D;  2XKP A;  1GXP A;  1W7P D;  1E2X A;  1J75 A;  1FT9 A;  3EET A;  4OMY A;  2YPR A;  1U3E M;  1EH6 A;  4U88 A;  4MQV A;  1D8K A;  2G7U A;  1IZ1 A;  2FEZ A;  1E17 A;  4ZZD A;  1K79 A;  1TNT A;  1FPQ A;  3TKY A;  2J5P A;  4YFK F;  3QPH A;  5FFZ A;  2W57 A;  3HSR A;  4KNY A;  4OU0 A;  5E20 A;  4PZJ A;  2M87 A;  3TGN A;  3TO9 A;  2OA4 A;  3JSP A;  3GYH X;  4I2O A;  5FLX K;  1KYZ A;  2GWR A;  1SMT A;  5CVJ A;  2XAS A;  4G9Y A;  2A6E F;  5E1X A;  2ZFW A;  5H6Q A;  1T38 A;  4EV0 A;  3ECO A;  3QP6 A;  2FML A;  2CWE A;  4QWQ A;  2EFN A;  1R58 A;  5ICG A;  1TQP A;  2VOD A;  1BOA A;  1WQ2 A;  3ZQ7 A;  3V4G A;  4EQQ A;  3W6J B;  3HRM A;  4LGW A;  2KJC A;  3RI4 A;  2BYV E;  1XGM A;  3GUD A;  5LHH A;  1BI0 A;  3R0A A;  3CJN A;  5L3E A;  3RKX A;  2W24 A;  4OIN F;  4MTD A;  2W85 A;  3V7S A;  1OR7 A;  3F8M A;  4NHJ A;  1J7K A;  2VN2 A;  1VTN C;  4BXU A;  1G4D A;  2VOP A;  1P2F A;  1ZN2 A;  1QNT A;  4OIQ F;  2ESN A;  4ESB A;  1KGS A;  4HF0 A;  4EJW A;  1USS A;  4ZYG A;  4S04 A;  3KFW X;  3WTS C;  3ZMU A;  2Y0M A;  4NQW A;  1HW1 A;  2IT0 A;  3F6V A;  2PMH A;  5K5Q A;  4RGR A;  3ISP A;  1YTY A;  2DW4 A;  4ENM A;  1TQM A;  1YS6 A;  1ONV A;  1S3J A;  3BWG A;  2YR2 A;  1JHH A;  3FWE A;  4R79 A;  2ZCW A;  3M7G A;  1WWX A;  3I59 B;  3P9K A;  4UNO A;  3KP4 A;  5L3C A;  3L00 A;  4PDK A;  4ZH4 F;  1TTY A;  1BC7 C;  2GZW A;  1AOY A;  1YS7 A;  2LDU A;  4WX9 A;  1O7F A;  4UVB A;  5AIP A;  3BPX A;  4XRF A;  3FZV A;  2QLZ A;  3MEX A;  1UST A;  4P55 A;  2P6T A;  2OBP A;  2Z9O A;  2O6G E;  1R1V A;  3HRS A;  2CO5 A;  3HTS B;  1IF1 A;  3E5Q A;  1SD5 A;  4G8X A;  3FXR A;  1FYL A;  1DPU A;  3CLO A;  4HLY A;  3L09 A;  4JK1 X;  2BEO A;  5TJJ A;  1FSE A;  1G3S A;  3JTG A;  3OV8 A;  6PAX A;  3BZ6 A;  1F1Z A;  3ZPL A;  3G3Z A;  1XDS A;  1O3T A;  3GO5 A;  4LB5 A;  2VT2 A;  4ETS A;  2DK8 A;  1XSD A;  2JSC A;  4HW0 A;  4YG2 F;  3HHG A;  4A0Z A;  1IN8 A;  2RVC A;  1R00 A;  4L9J A;  3EYY A;  4HF1 A;  1IXC A;  4ZYE A;  1FBQ A;  2QQB A;  4ESJ A;  2Q8K A;  2R7D A;  3BRO A;  3IWF A;  4OIO F;  5IT9 Z;  1YG2 A;  4R8H A;  5ILU A;  4RB1 A;  5JVT A;  3NQO A;  3C1D A;  2M1B A;  3GLX A;  3Q9S A;  5DYM A;  1IN7 A;  2PI0 A;  1T2K A;  4CDG A;  1NHA A;  4IHT A;  3V7C A;  5LHI A;  2OZ6 A;  3P7N A;  1SMY F;  2Z5U A;  3QU6 A;  5CLS A;  5BPD A;  2RN7 A;  4KT5 C;  4WXC A;  1O7L A;  2MH2 A;  4R1H A;  4TV7 A;  3F8B A;  4DQ2 A;  1YW8 A;  5BOX A;  1ZG5 A;  2QEN A;  4RS8 A;  2O03 A;  3KEQ A;  1ZRE A;  3GFL A;  2A3S A;  4AIJ A;  3ML6 A;  4BNC A;  3E6C C;  3GZ6 A;  4IVN A;  2DQR A;  4RGX A;  3E6M A;  3DP7 A;  2JTV A;  3QAH A;  2NYX A;  3SZT A;  2O8X A;  4GYG A;  4XBF A;  1BI1 A;  1YO5 C;  1CF7 A;  4GYI A;  2RC4 A;  1JXS A;  1F9N A;  4L0Z B;  4LB6 B;  2HQN A;  2GA1 A;  1FLI A;  1R5H A;  2O61 A;  1HKT A;  3L9F A;  3MAJ A;  5LRR A;  1S8N A;  3N97 A;  3BJ6 A;  1H9T A;  3TDU C;  1R23 A;  3E5U A;  4G7Z F;  2D45 A;  4A5N A;  2Y48 A;  5HDN A;  2FXA A;  1RIO H;  3MCZ A;  2JRT A;  1I1G A;  3PQK A;  5AIQ A;  3K1P A;  4P9U A;  3ERE D;  2OQR A;  5ERI A;  2LKP A;  2XV4 S;  2KJB A;  5HLI A;  5DUI A;  2UZK A;  4EGY A;  1IRG A;  1L3L A;  3F21 A;  1W7P B;  2QM3 A;  2P5L C;  1Z91 A;  3ZN0 A;  5DD4 A;  2K7L A;  5CVI A;  2ZBK A;  4OOI A;  3CO7 C;  1UHM A;  3R61 A;  1Z05 A;  4ENJ A;  2LF8 A;  5JHU A;  5D6E A;  3F8F A;  5H6R A;  4KIG A;  3LA3 A;  3WE3 A;  5E17 F;  2D2W A;  1ZGJ A;  4B09 A;  2WC2 A;  5HDG A;  3HRT A;  3F72 A;  2YX4 A;  1JHF A;  4MEY F;  1V3F A;  5K5O A;  4I09 A;  1BN5 A;  2C6Y A;  2F5E A;  1OMI A;  3TO6 A;  5D6F A;  5HS9 A;  2ZME B;  2WWY A;  1J9I A;  2ZO4 A;  2OD5 A;  3T1B A;  5L3B A;  2F5F A;  1MDM B;  2IRF G;  3IL2 A;  3QU3 A;  1PDN C;  2A61 A;  1H0M A;  2HS5 A;  3NEU A;  1V4R A;  3IKT A;  1DUX C;  2DBB A;  1FP1 D;  1W4M A;  2HOE A;  4PGH A;  3TDZ C;  4A2U A;  4EGZ A;  3LAP A;  1XD7 A;  1Z1D A;  4LJZ F;  2M45 A;  3E6B A;  1XSX A;  2FOK A;  1T6S A;  3C3W A;  4G7H F;  3MQ0 A;  3R6S A;  3CTA A;  2QYO A;  3RTR A;  2MA3 A;  4XSZ F;  3LQQ A;  1P4A A;  3ECH A;  3IRR A;  5F64 A;  4L5I A;  2EWN A;  3DXJ F;  5LEJ A;  3GVA A;  2P7V B;  1FNN A;  3BJA A;  2EV5 A;  4WF2 A;  3RJP A;  5DDG A;  1O57 A;  3WTV C;  1KA8 A;  4Z2Y A;  4LLL A;  3O3K A;  3CUQ C;  1T98 A;  3ZMV A;  2IVM A;  1Z6R A;  1I27 A;  4WXD A;  1XDU A;  4RGU A;  3WGI A;  4XLN F;  3WTW C;  3MFK A;  2IW5 A;  2BBY A;  3NRV A;  1EH8 A;  4HZF A;  5D5V B;  4L5J A;  4HDU A;  5F1R A;  2FA5 A;  5JI6 A;  2D1H A;  3J80 K;  2ELH A;  2K4J A;  3I0T A;  1HW5 A;  4G6Q A;  1X3U A;  5JR3 A;  1WKM A;  2DI3 A;  4A0Y A;  4FT8 A;  1K6O A;  2YU3 A;  2VC1 A;  1BJA A;  1FZP B;  2E1N A;  2HYG D;  1R1T A;  2A07 F;  2L4A A;  3EQL F;  5D5X B;  1TNS A;  2FU4 A;  2PG4 A;  4O5V A;  3KZY A;  4O6J A;  1TLH B;  3WTT C;  4XSX F;  1FYM A;  1S7O A;  3SXY A;  1OYY A;  2VT3 A;  2EFO A;  3ULQ B;  3E5X A;  1MKM A;  1FY7 A;  3GFI A;  3BDD A;  4IPA A;  2XGX A;  1BC8 C;  1R5G A;  2GQQ A;  1UFM A;  1LQ1 A;  1K78 B;  4PGG A;  1I5Z A;  1HST A;  1MGT A;  1HXD A;  4N0B A;  1ZRF A;  1B9N A;  2L4M A;  3JAM K;  3E6D A;  2DPU A;  2V79 A;  5LBQ A;  3J80 Z;  2RKH A;  1EV7 A;  5DCM A;  1MJA A;  3ZP5 A;  2XKO A;  5CVV A;  2M8E A;  1FSH A;  4L9N A;  3I59 A;  4LK1 F;  2Q0O A;  2UXX A;  2WTE A;  1RUN A;  3RIR A;  1CF7 B;  5FLX Z;  3GW2 A;  2AXL A;  2E7W A;  2P8T A;  2ZKZ A;  2W84 A;  1OKR A;  1SD7 A;  1KU2 A;  4EJV A;  1ZAR A;  2FE3 A;  1FOK A;  2DLL A;  3LA7 A;  3V8L A;  3WG9 A;  4WCG A;  3H92 A;  3FXQ A;  5ICE A;  1O3S A;  1P6R A;  3VOE A;  1D5V A;  3U2R A;  2QQ9 A;  2PEX A;  3S2W A;  1J2X A;  3G73 A;  1U2W A;  1XGN A;  3TQN A;  4E70 A;  1LDK B;  5E18 F;  4M9X A;  4Q5S F;  4B8X A;  3BOQ A;  4LK0 F;  1PP7 U;  4A12 A;  3GF2 A;  4ASN A;  3C7J A;  1LEA A;  3JAM Z;  2L54 A;  2H6C A;  1MJB A;  5BMZ A;  1DDN A;  2DPD A;  2K4B A;  4Y17 A;  2HYF A;  1PP8 F;  1W7P A;  2PFB A;  3FMS A;  4RB0 A;  2ISY A;  5K1Y A;  1S29 A;  1QBJ A;  4HAM A;  3J7A O;  1MD0 A;  4ZYD A;  1O3R A;  3T0Y A;  4P5O A;  4JQF A;  3P9I A;  1I1S A;  1XMA A;  4M6Y A;  4MQ9 F;  3KP6 A;  1KQ0 A;  4RAY A;  5CYV A;  2PLY A;  5D5W B;  3KP7 A;  2Z33 A;  1XGO A;  2Z99 A;  1OPC A;  2RNJ A;  4BH9 A;  1ZHF A;  4KA4 A;  1Y0U A;  2IA2 A;  1FX7 A;  2KRF A;  1YW9 A;  5ILV A;  3H3Z A;  3KZZ A;  2HKO A;  1T39 A;  3L7W A;  5AON A;  4UVC A;  3M9A A;  1YQA A;  1R22 A;  3IKV A;  5J8C A;  2MLG A;  1KQ9 A;  4HX7 A;  2P7C B;  1KYW A;  4ENK A;  2FF4 A;  1WI9 A;  2JPC A;  1A04 A;  3LA2 A;  1IXR C;  4FX4 A;  3ELK A;  4GGG A;  5IT9 K;  3J81 K;  3MZY A;  4ZZL A;  1TBX A;  1DPR A;  3B73 A;  5D4S A;  2HFH A;  4L0Y B;  4KFC A;  2X0L A;  1FC3 A;  4L9V A;  1K78 A;  2FSW A;  3LQR A;  3FHZ A;  2ETH A;  4CGZ A;  5D5U B;  2NNN A;  4HQM A;  3HUG A;  1YLF A;  3DPT A;  1SFU A;  5JFR A;  5ED4 A;  2EFQ A;  3LST A;  3T8R A;  2NAZ A;  2VBX A;  1KQ8 A;  4HV5 A;  3HSE A;  2MC3 A;  5DEQ A;  3FMR A;  4XLP F;  4UV8 A;  1W5S A;  3MZH A;  4CXF A;  4UXN A;  1XCV A;  5FD5 A;  2BGC A;  1R7J A;  2STW A;  2P5K A;  4HDV A;  4YFX F;  3MWM A;  4OMZ A;  1ZAO A;  5D8L B;  2HTS A;  5LRS A;  5FGM A;  4Q4Z F; 
#chains in the Genus database with same CATH topology
 4XNF A;  4F92 B;  1JKP C;  3OOP A;  3FIS A;  4A3D J;  1UG2 A;  3FXJ A;  2HZT A;  4A3B J;  2XUB A;  3MKZ A;  2KT0 A;  1MNE A;  5M3F J;  3TED A;  1B8I A;  5EZH A;  1CQT A;  2DJN A;  1LKX A;  4RBO A;  1XSV A;  1XCB A;  4M6X A;  3JW4 A;  3KLO A;  1MBK A;  1U5T B;  2FBH A;  4E7K A;  1MMG A;  3QYB A;  2K02 A;  4M6V A;  5C3E J;  3OYF A;  2WV0 A;  5FJ8 J;  4CIC A;  3COA C;  3OL4 A;  1FTZ A;  2EIL H;  2W1O A;  3BG3 A;  5ICC A;  2FQ3 A;  3WU2 C;  4G7O F;  1TWG J;  4IJA A;  2DO7 A;  2VJJ A;  1SEU A;  2VB6 A;  3GLL A;  3T5X A;  2XGE A;  4YFN F;  3CP8 A;  4P96 A;  3TW7 A;  1WJA A;  4RGS A;  3T8T A;  2R5Z B;  3ZN1 A;  1POG A;  3ABL H;  4KN7 X;  4G6T B;  1Q1H A;  4DYC A;  2KPM A;  2OQG A;  2XRN A;  3I54 A;  2IPQ X;  3HIF A;  1LEB A;  3BZC A;  3ROU A;  1C0W A;  2XAF A;  2OAZ A;  1U8R A;  3TO7 A;  2X6O A;  4FQG A;  4HV6 A;  3HL2 A;  4LLG F;  3R4K A;  3H36 A;  3S1M J;  1XN7 A;  2EV0 A;  2XAQ A;  1S9H A;  5M5W J;  1WPK A;  2H6B A;  2EB7 A;  3I4M J;  4M71 A;  3LSP A;  3CCV I;  4A3J J;  1X4O A;  1OCZ H;  2GIV A;  3ZMZ A;  4CZZ A;  1YHQ I;  1GT0 C;  4V19 K;  5E1Z B;  2QKM B;  2E1C A;  2HWV A;  2V6C A;  3UNG C;  5FB2 A;  3WHC A;  1T0F A;  5C4J J;  2X6W A;  4PFP A;  2XRO A;  2V1D A;  1RNL A;  4ZDP A;  3HOZ J;  5F0F A;  2AQF A;  1MJ9 A;  1DGW Y;  2KDZ A;  2GAU A;  1MBH A;  2R7F A;  4KIF A;  4M73 A;  1VQ7 I;  1ZLJ A;  3PNT A;  2MBF A;  4HBL A;  1ZGA A;  3JRH A;  3IP4 B;  2O7O A;  2H09 A;  2RGV A;  4O3M A;  4HOB A;  3ERM A;  2XAH A;  1AWC A;  3CP2 A;  1ZLK A;  4N9I A;  2NRA C;  2Y9Z A;  2F2E A;  1REP C;  3A01 B;  4L9T A;  2Y0S N;  1Z7L A;  3KEO A;  4ENN A;  2JMW A;  2CMP A;  3HG9 A;  1UG0 A;  4HPQ A;  1V5E A;  3FXM A;  5CJ9 A;  3F9K A;  4DIQ A;  3CMY A;  3OYG A;  3DWL E;  1LDD A;  1GVJ A;  1P92 A;  4AIH A;  3CUQ A;  4C2U A;  3C18 A;  4F93 B;  4LG0 B;  2GXB A;  2QSG X;  3RPQ A;  5E1W A;  4Y33 A;  5EG0 A;  2X85 A;  3ABT A;  3OYA A;  1BI3 A;  5BS6 A;  5GPC A;  4U7D A;  2E71 A;  5DD8 A;  3FHN A;  5HS8 A;  3IRQ A;  4ZYH A;  4H0E A;  4IXA A;  1WCM J;  2OU2 A;  3PIO F;  2K85 A;  3Q9V A;  4M9S A;  1TWA J;  2IGM A;  3QYE A;  1JGS A;  2ZNZ A;  3DKW A;  2WBM A;  5HLH A;  2MH9 A;  3RKY A;  3JRB A;  1BIB A;  2CG4 A;  3A0H C;  5CQE A;  1YIT I;  4BDZ A;  2UWM A;  3LFU A;  4HSR A;  2VLA A;  4BEH A;  2IA1 A;  3A4C A;  1RET A;  4FET A;  5BNG A;  3DQV C;  2BHY A;  3WTU C;  1Y0N A;  3VB2 A;  2VC0 A;  4AUX A;  2IBD A;  3FF5 A;  1FIA A;  2KMU A;  2COM A;  3WHB A;  4DBQ A;  4CCO A;  3OYN A;  3EUH A;  3PUF A;  2DT5 A;  1MMA A;  4XID A;  1SFX A;  2DDA A;  1IC8 A;  4X0G A;  1X3Z B;  3KLN A;  4MHG A;  5FO5 A;  3ZQH A;  4HX4 A;  4XN3 A;  4UUV A;  2MFZ A;  3OR1 C;  3IC7 A;  2P6S A;  4F7Z A;  4A3I J;  3CLQ A;  3LL7 A;  3WE2 A;  5TIS C;  3OYL A;  4KMF A;  3VYT B;  1XPX A;  3P9C A;  1V54 H;  3DKY A;  3HKZ A;  3PO3 J;  3GFJ A;  3HOW J;  4ON0 A;  3BTC A;  2VBY A;  2L01 A;  2QKL B;  1SC7 A;  2CGP A;  3B02 A;  3E97 A;  3F22 A;  2JUC A;  3GXO A;  4OIP F;  1WRJ A;  1DP7 P;  1RI7 A;  3A1Y A;  1WI3 A;  4M3E A;  1SD6 A;  3AAF A;  4EJT A;  1HKS A;  3F6O A;  3I5U A;  3WGH A;  2X9D A;  1LVA A;  2YS9 A;  4IQJ A;  2OC6 A;  3O2P E;  5D4R A;  4RAZ A;  2EJR A;  5D8K B;  2ZXH A;  1P4W A;  4UHT A;  1QQI A;  5HS7 A;  5LGN A;  4CHU A;  4JOM A;  1VFC A;  1X19 A;  2DA5 A;  4MTE A;  1AU7 A;  2XHK A;  2O5R A;  1UAA A;  1X58 A;  4I0A A;  1T56 A;  1ULY A;  2F5C A;  2LY1 A;  2DK5 A;  3K0L A;  2WAD A;  3JTH A;  4L5E A;  3E3V A;  1D3Y A;  3FM3 A;  2GXG A;  4KN4 X;  2DFI A;  1VQK I;  4Y4R A;  2JA5 J;  1FMV A;  2V1X A;  3MN2 A;  1PUE E;  5FLV A;  1V55 H;  2KIM A;  2O0Y A;  2P0W A;  4GO1 A;  2GA2 A;  2I5U A;  3TW6 A;  4YIF A;  2R7Z J;  3IV5 A;  2KKO A;  4JBA A;  4FHT A;  1R1U A;  2HDC A;  1SD4 A;  1X1B A;  3K69 A;  1R71 A;  1HC8 A;  2VJI A;  1Z3X A;  5L3F A;  4UV9 A;  2RRE A;  5L3G A;  2ZME C;  3IWZ A;  4HNV A;  3LMM A;  4F55 A;  4EM1 A;  1STZ A;  1TWF J;  2WAF A;  4G6D A;  1YJN I;  4YEJ A;  2KFD A;  4W97 A;  3HC7 A;  1FYK A;  4KMU X;  2ACJ A;  2L9N A;  2XPU A;  2W82 A;  1VZ0 A;  3HBL A;  4EMS A;  3KET A;  1ZRD A;  2IP2 A;  4F91 B;  1GXQ A;  1B9M A;  1MBJ A;  5HVQ C;  2QBY B;  5DUK A;  3I4N J;  4XLE A;  5IYC J;  1FOX A;  1U5T A;  4D9J A;  4M74 A;  3SJM A;  1ZG3 A;  2JVH A;  3OY9 A;  4MEX F;  4A6D A;  1D1B A;  1ODD A;  5BQT A;  3G6E I;  3AL0 B;  1VQO I;  4XLF A;  1DP3 A;  2E34 A;  2FD5 A;  3K4K A;  2QZ8 A;  3SQN A;  5LGT A;  4P9F A;  2E2J J;  1LNW A;  2DYS H;  2J5O A;  4BAY A;  2KHM A;  3RKW A;  2ZJ2 A;  1ZRC A;  5K7Z A;  3AG3 H;  4BHB A;  1ON2 A;  2F5D A;  1XX5 A;  4G94 A;  1P7I A;  1OYW A;  2Z3Y A;  4HX8 A;  2HXO A;  2L7Z A;  4AYB N;  5GAG J;  3IH2 A;  1JJ6 C;  4P1W A;  4CCK A;  2HEO A;  3GTK J;  1FBS A;  1SAX A;  3BPV A;  1RUO A;  3K2A A;  3K4C A;  1QZE A;  5IT3 A;  3QRF F;  3KP3 A;  5KVR A;  5H20 A;  4BAC A;  2M7A A;  3O6B B;  2IGN A;  4BJ5 C;  4U0Y A;  4HNU A;  2XF5 A;  2D5V A;  5DV5 A;  1BR2 A;  3ZRG A;  1OCC H;  2DQL A;  3PNY A;  1YJW I;  2NNY A;  1R4N B;  2NVY J;  1IAW A;  2W00 A;  3BZK A;  3A0B C;  1LB2 A;  3SEQ A;  2NS0 A;  4IOC F;  3KE2 A;  3BJO A;  3HOS A;  1ERD A;  1B59 A;  3I58 A;  3RPU D;  2AO9 A;  1MBF A;  2MG4 A;  4IHS A;  3DV8 A;  3WU1 B;  3HOT A;  4IRI A;  2JZY A;  3BG9 A;  1OCR H;  3CUQ B;  4LG0 A;  4BY7 J;  4AD9 A;  5FKL A;  2HQA A;  2H8W A;  2KZV A;  4KUM A;  4H4K C;  1IW7 F;  1JT0 A;  5CPR B;  2LSO A;  2I8D A;  1CGP A;  3CDH A;  3QOP A;  1PUF A;  1VND A;  1W36 D;  3U1K A;  1ZYR F;  4M3B A;  4OIR F;  3NWS A;  1JE8 A;  1B1B A;  2PQ8 A;  1IG7 A;  1X1D A;  5GAD J;  2IJL A;  1B6A A;  3O8H A;  3MKW B;  2ZXJ A;  3DCF A;  2M0M A;  3TP0 A;  2CFX A;  4ITV A;  4S05 A;  1ZR2 A;  4CO8 A;  1D8J A;  2CQK A;  3M1E A;  4Q48 A;  4BHC A;  4EVI A;  5KNL A;  3TOA A;  3K9T A;  1QPM A;  2TRT A;  4C30 A;  2QBY A;  3LAJ A;  3ESW B;  1EH7 A;  4IHY A;  5HOO A;  4I76 A;  2XRL A;  2R93 J;  4U87 A;  1LJ9 A;  3VFZ A;  2A5Y B;  3IH3 A;  3DEU A;  2ZJR F;  3GWZ A;  1F5T A;  2KDO A;  3C2H A;  4I01 A;  1TT5 B;  2V1U A;  2WAE A;  1J0R A;  4Y15 A;  5E8G A;  1XB4 A;  1T08 B;  2BE5 F;  2DJI A;  3G1L A;  3ZMS A;  1KU7 A;  5C4X J;  2P5V A;  1IUY A;  3ZR8 X;  2R7R A;  4D7N A;  2KIU A;  3I64 A;  2XAJ A;  2A69 F;  2F6C A;  3OYD A;  2BY3 A;  3DU6 A;  2ESH A;  2KIF A;  1U78 A;  2IS1 A;  2ME6 A;  2WB1 A;  1D1A A;  2DU9 A;  2LLK A;  1LDJ A;  3JRF A;  3D5S C;  5C44 J;  1QZZ A;  1N25 A;  2FMY A;  2FNP A;  2MYS A;  2CRG A;  3HUG B;  4ANJ A;  2BY2 A;  4A6E A;  2EFP A;  4WXH A;  1Z77 A;  2O3F A;  1XG1 A;  1Z9C A;  2VE9 A;  2VIX A;  4KIC A;  2H94 A;  4LMY A;  2HR3 A;  5FRM A;  2IS4 A;  2L7M P;  3KP5 A;  1J5Y A;  3F23 A;  4IL6 C;  3KP2 A;  2H1L A;  4M72 A;  5K7H A;  5J40 A;  4BQN A;  1R9T J;  5E8I A;  5HNF A;  4EM2 A;  3BT9 A;  2DN0 A;  2P81 A;  1HA8 A;  3FM5 A;  3QP5 A;  1MZB A;  2RDP A;  3RDI A;  2B7E A;  3K2Z A;  4CCN A;  2LD5 A;  1UB9 A;  3I4P A;  3W6K B;  1UJ8 A;  4X1E A;  3U9G A;  1S7E A;  4EM0 B;  4A0X A;  1BR1 A;  1OR7 C;  4MFE A;  5J1R A;  5DM7 F;  1K7A A;  2VOO A;  1HOM A;  4KDP A;  3TOB A;  5KAF C;  5HLG A;  3WOD F;  1V5G A;  1MBG A;  3HRU A;  2K3F A;  3OSG A;  2O9L A;  2CU7 A;  3F8C A;  2KIS A;  2JA7 J;  2X6X A;  3CO6 C;  2EK5 A;  3FMQ A;  5LGU A;  2A68 F;  3K4J A;  2TDX A;  1S5L C;  3H9Q A;  4AVZ A;  2ADU A;  2PMZ A;  2IXS A;  5J6X A;  1HW2 A;  2DAO A;  4QPO A;  5E3M A;  1MDM A;  2GOX B;  4NB5 A;  2CJJ A;  2FRH A;  1GV5 A;  2ZSH B;  4CYC B;  1GHC A;  1BIA A;  3VEP A;  5CVU A;  1VQ5 I;  1MMD A;  3BQY A;  4NC8 A;  4YII A;  3ABU A;  3DEE A;  2VBW A;  3UKG A;  1TW3 A;  2JPB A;  5FFX A;  4NNJ A;  2BOL A;  2FBK A;  2P4W A;  2LTP A;  3K1N A;  2ZME A;  4BE0 A;  3SZP A;  4HF2 A;  5DCM B;  5FKN A;  2LF7 A;  1IN6 A;  4Q47 A;  4E7I A;  3S1Q J;  2DOE A;  2R7V A;  1S7A A;  3BTI A;  2CH0 A;  2VE8 A;  1H9G A;  4IRG A;  1I50 J;  4LIV A;  1F4K A;  4QLC U;  3GTP J;  2IAI A;  2AQE A;  1E3H A;  2HZD A;  2A6H F;  2K9L A;  5J8F A;  3CC2 I;  3HYI A;  2PBI A;  3ZGK A;  3SHF A;  3CJR B;  4AVP A;  3CCL I;  2W25 A;  2L7F P;  1ZEL A;  4N4O B;  2DA4 A;  3Q5F A;  2ECB A;  5ICF A;  2CSO A;  3MKY B;  1YW7 A;  2UUZ A;  1SAU A;  3LFK A;  4A3G J;  2DTR A;  1IN5 A;  5GAH J;  2CW0 F;  2IGK A;  2D1V A;  5L3D A;  3TMO A;  1S6L A;  2QGU A;  4II2 A;  5K5R A;  3QPT A;  5DM6 F;  4CUG A;  1X2N A;  2B63 J;  1Z7U A;  2RV8 A;  4A3L J;  1IV8 A;  1FOW A;  3WTZ A;  5HOD A;  2VBZ A;  2KQR A;  2PN6 A;  1YFH A;  3CCQ I;  4EJO A;  1G6N A;  4RMN A;  4Y13 A;  3PFI A;  2E7X A;  2HYJ A;  2L3D A;  3GZ5 A;  1TC3 C;  2DFE A;  4CYD A;  3JRD A;  1IRF A;  1G3T A;  3L2W A;  3EDP A;  2DA3 A;  4HA8 A;  3K6G A;  4WWC A;  2M5W A;  1G3W A;  3DPL C;  2WY8 Q;  3GTM J;  2B9S A;  5KK1 A;  2L02 A;  3BR1 A;  3K1M A;  3MKL A;  4QPQ A;  5M3M J;  2JA6 J;  2ELJ A;  2M0C A;  3H3U A;  2F4M B;  4PUS A;  3A01 A;  2HTJ A;  2V9V A;  2HPM A;  1B4A A;  3E0J B;  2V6E A;  1HQC A;  1QZY A;  3DBR B;  5A2Q K;  2R3S A;  2X1E A;  4ZTF A;  5M5X J;  1WJE A;  4HYE A;  3M8F A;  3EPZ A;  2HQR A;  2VPR A;  5TRD A;  1U8B A;  2WY7 Q;  4N9H A;  2DCE A;  3CME I;  1SFK A;  2FNA A;  1RZ4 A;  2MLK A;  1LFU P;  4KIS A;  3BP8 A;  1WHU A;  2QSF X;  3RPU A;  4LLN A;  3U1D A;  3LNQ A;  4J00 A;  4A5M A;  2ZNY A;  3OR2 C;  1Y1V J;  1WJB A;  1UCR A;  1JKR C;  2EIN H;  3CJT B;  2M4G A;  5EEH A;  5ILS A;  4I99 C;  2XVC A;  4U7B A;  4BHP A;  1TW2 A;  2CQ7 A;  4B43 A;  9ANT A;  2ICW G;  2ZXW H;  2E5Z A;  2XGD A;  4AIK A;  2VON A;  4XIC A;  1IXS B;  2Q2E A;  1D5Y A;  2KLO A;  1FEX A;  3LWF A;  3A2K A;  1U6G A;  1G3Y A;  4CYC A;  2NS8 A;  2R5Z A;  5J4Y A;  2QVO A;  1BBY A;  2R7Q A;  2JJ7 A;  4DBR A;  1HSJ A;  2Y30 A;  3HSF A;  1ETV A;  3V8J A;  3F3X A;  5KAI C;  1VQ4 I;  1VQP I;  1XGS A;  1IN4 A;  4MGR A;  4UB8 C;  3VYR B;  5EGO A;  3KEY A;  3J81 Z;  1N75 A;  2XF6 A;  3K70 D;  2WAQ A;  3I71 A;  3JCU C;  4KYW A;  2DT7 B;  3ABM H;  5K7F A;  1B72 B;  3IHU A;  3GTO J;  4U0W A;  4I98 B;  2QUF A;  3OYK A;  1TQI A;  1NH3 A;  1X3W B;  1U9N A;  5EEG A;  4NBQ A;  4RB2 C;  3OIP A;  5BPI A;  2OCE A;  2G7H A;  3EYI A;  3GEZ A;  3ZMT A;  3JRE A;  4EJU A;  1YYV A;  3M8E A;  1Z6T A;  2G0E A;  3BY6 A;  4RLQ A;  3X2Q H;  1I6H J;  2JA8 J;  3J7A Y;  1J59 A;  2Y75 A;  3D1N I;  3FX3 A;  2IEK A;  2K86 A;  3VSK A;  2DXI A;  3KYD B;  4BUP A;  2X4H A;  2IS2 A;  2TCT A;  3BLY A;  3GFM A;  5J1U A;  1K61 A;  4KIB A;  3SFZ A;  2HGC A;  2RQQ A;  5CVR A;  4BQQ A;  1ETK A;  3V7R A;  3JSO A;  2PJP A;  3FXU A;  2EFW A;  4KT6 A;  2G9W A;  3OL3 A;  2RQP A;  4BQA A;  3N4M A;  3WGG A;  2HKX A;  3MVP A;  1EJ9 A;  1LE8 B;  4WK8 F;  4I02 A;  2LH9 A;  3K4B A;  1RES A;  1HF0 A;  4DNC A;  2VXZ A;  4FX0 A;  4XL9 A;  1HBX G;  1XMK A;  4I7H A;  4BKX A;  3IAM 2;  1ZG1 A;  1FMW A;  2XF7 A;  1OYI A;  2YX7 A;  3KYL A;  4HQE A;  3MZ8 A;  1QGP A;  5IP9 J;  4J01 A;  1UHW A;  2OZU A;  4M9Z A;  4XOT A;  2Q2E B;  3RYR A;  4S0H B;  3CCY A;  2DMT A;  5FD6 A;  3CMA I;  1JJ8 C;  1RRJ A;  2DOD A;  2OV7 A;  2F5V A;  2DA6 A;  3CQZ J;  4UVA A;  3L2C A;  3GTG J;  2YU9 J;  2EA2 A;  1A36 A;  2EV6 A;  3BR2 A;  1ORK A;  4JX4 A;  1RPW A;  3M8J A;  4K2E A;  4Y7N J;  1YIO A;  2FX0 A;  3REO A;  2QWW A;  3LSI A;  5F08 A;  2GXA A;  1SVO A;  3PQJ A;  2BV6 A;  3PM1 A;  4Y52 J;  1EA3 A;  2W48 A;  4AM3 A;  2K9S A;  5F6F A;  3WTY C;  2DMQ A;  5DCF A;  3CUO A;  4LIT A;  3R0J A;  3RZD J;  5IYD J;  1OLT A;  1WJF A;  3QOE A;  3OYI A;  2B0L A;  3WTX C;  1J09 A;  2M9H A;  5E3N A;  3VOD A;  3G2B A;  3ZMD A;  4GXO A;  4C3J J;  4X6A J;  4PCQ A;  4LFU A;  1X1P A;  4XRS G;  1ON1 A;  2DFF A;  2LR8 A;  2PMU A;  1MH4 A;  1P4X A;  3CC4 I;  3S32 A;  1KU9 A;  2VI6 A;  2DFH A;  2W4S A;  2Y2Z A;  4I0B A;  5E79 C;  2ISZ A;  1AA7 A;  3M07 A;  1SFE A;  4MNU A;  3PFY A;  1FWZ A;  4U0V A;  4E4H A;  2AS5 F;  3I53 A;  3IAS 2;  2K27 A;  2K40 A;  1T95 A;  1ZH5 A;  2LNB A;  2BW3 A;  2XAG A;  2E1O A;  4AWX B;  3DTK A;  4PJM A;  1G8X A;  4HLX A;  4BYY A;  2XSD C;  2ZJQ F;  3S1N J;  5E3L A;  1XTA A;  5GTH C;  1R36 A;  5F0C A;  5LHG A;  3I55 I;  3A03 A;  1VQ6 I;  2IA0 A;  1IDY A;  1FP2 A;  4Y3O A;  3JR9 A;  2AHQ A;  2HQ5 A;  2M30 A;  3DFG A;  3K4L A;  5FKK A;  1I6X A;  5JLX A;  4D0P A;  1WSU A;  1T8I A;  3PJR A;  2R7U A;  2JT1 A;  4KJZ A;  4LD5 A;  1JGG A;  1DQU A;  3HTU A;  4CA0 A;  2QQA A;  3S17 J;  3JRC A;  1TWC J;  3GX4 X;  1W5T A;  4XON A;  3WU0 A;  1BI2 A;  4IOA F;  4GCV A;  4HG2 A;  1Y56 A;  3D0S A;  3HOX J;  5HDK A;  4HRI A;  1HKQ A;  1LPQ A;  2CYY A;  3HHH A;  2LKX A;  2DMP A;  4IRH A;  3U21 A;  2XIG A;  1U5T C;  2UXN A;  4QTR A;  1MND A;  1BM9 A;  3H5R A;  4ESF A;  3HOY J;  1L0O C;  3RYP A;  3H5N A;  1UEL B;  4NDL A;  3V8K A;  1WZ2 A;  3N05 A;  2KL4 A;  1O3Q A;  3DLA A;  3D5L A;  5LEK A;  3RQI A;  2ID3 A;  3G1M A;  2FBI A;  5H2F C;  1KU3 A;  4OWR B;  3DF8 A;  2EA4 A;  4RB3 C;  2JA2 A;  2STT A;  2HDW A;  1D1C A;  4IF4 A;  2JRM A;  2YSR A;  3DTI A;  1FBU A;  1WJ5 A;  1ETW A;  2X48 A;  4L18 B;  3R60 A;  5A2Q Z;  3KCC A;  3F8N A;  1ZR4 A;  5LLQ A;  3G71 I;  2MD5 A;  4RM2 A;  3QPL A;  1QO0 D;  2XKP A;  2LBF B;  1GXP A;  1W7P D;  1E2X A;  1J75 A;  4AYB A;  2LVS A;  1Z3Y A;  4BJT A;  1TL8 A;  2E1M B;  2VXD A;  4DJA A;  1FT9 A;  4J19 A;  3EET A;  3CJQ B;  2L0K A;  4OMY A;  1Z67 A;  2YPR A;  4NUB A;  1U3E M;  1EH6 A;  4U88 A;  2V1N A;  3OSF A;  2ECC A;  4JP0 A;  1F43 A;  4LOC A;  4XKW A;  4MQV A;  1D8K A;  3CCE I;  2G7U A;  5IP6 A;  3J7Y J;  1ETQ A;  3E1S A;  2Y31 A;  2K3P A;  4HNT A;  2LMD A;  1H8A C;  1IZ1 A;  2FEZ A;  2JN6 A;  2PMZ N;  1E17 A;  2LY2 A;  1OFC X;  4ZZD A;  1Z0X A;  1K79 A;  1TNT A;  2VJ5 A;  1FPQ A;  3TKY A;  2J5P A;  4YFK F;  3OS2 A;  3DLL F;  3QPH A;  5FFZ A;  2W57 A;  1XMX A;  3ZXS A;  1R6R A;  3HSR A;  2Q1Z B;  4KNY A;  4OU0 A;  3MMY B;  5E20 A;  4DW6 A;  4PZJ A;  3HPH A;  2M87 A;  2M3A A;  3TGN A;  3TO9 A;  4GDF A;  3BG7 A;  2OA4 A;  4QSH A;  5JHF A;  3JSP A;  3GYH X;  2MAB A;  2L9V A;  1IJW C;  4I2O A;  5FLX K;  4ZDO A;  1KYZ A;  2DA7 A;  2GWR A;  2JQ7 A;  1SMT A;  3HPG A;  5CVJ A;  4XR6 A;  2EQR A;  1OCO H;  2XAS A;  2OTL I;  4G9Y A;  2CW7 A;  3OIQ A;  2A6E F;  5E1X A;  3HDD A;  2EH3 A;  2QA4 I;  3S15 J;  2FJ1 A;  3OWT A;  3AKZ A;  2ZFW A;  2Y9Y A;  2E19 A;  5H6Q A;  4PFO A;  1T38 A;  4EV0 A;  3ECO A;  1B8I B;  3QP6 A;  2FML A;  3QYF A;  2CWE A;  3OYH A;  1JKQ C;  2GM4 A;  4QWQ A;  2EFN A;  1R58 A;  1OCP A;  3VYU B;  5ICG A;  3CMM A;  3AG2 H;  1TQP A;  3ZQI A;  2H8R A;  2VOD A;  1BOA A;  1HCR A;  1WFX A;  1WQ2 A;  1WGX A;  3ZQ7 A;  3V4G A;  4EQQ A;  3W6J B;  3HRM A;  2HOT A;  4LGW A;  2KJC A;  4RA2 A;  3OYE A;  3RI4 A;  2BYV E;  1XGM A;  3GUD A;  4B3A A;  3DU5 A;  5LHH A;  4EEF G;  1BI0 A;  3R0A A;  3CJN A;  5L3E A;  3RKX A;  2W24 A;  1M1E B;  4OIN F;  4MTD A;  3W6V A;  1NG7 A;  2HU9 A;  2W85 A;  2GBY A;  2OCC H;  1OR7 A;  2V9K A;  3V7S A;  3F8M A;  4NHJ A;  4BXF A;  5F27 A;  1BJZ A;  1J7K A;  2VN2 A;  1VTN C;  2ZFU A;  4BXU A;  3CCJ I;  2E35 A;  1G4D A;  2VOP A;  1P2F A;  1X2M A;  1ZN2 A;  1QNT A;  2GLO A;  4OIQ F;  1JUS A;  3L2V A;  2VPL A;  5LD2 C;  4BBS J;  2ESN A;  4ESB A;  1DU0 A;  1ZTR A;  1EF4 A;  4C3H J;  1KGS A;  4HF0 A;  4XLA A;  4A3C J;  3DPU A;  4F52 A;  2HVR A;  1A31 A;  3G4S I;  4EJW A;  1USS A;  4ZYG A;  4S04 A;  1VQ8 I;  3W2A A;  4IHV A;  3PL8 A;  3KFW X;  3WTS C;  3ZMU A;  3PSI A;  2Y0M A;  4NQW A;  1HW1 A;  4CH7 A;  2IT0 A;  3F6V A;  5IOZ A;  2PMH A;  4CSW A;  5K5Q A;  3PNV A;  4RGR A;  3ISP A;  1YTY A;  3PSF A;  3ZQF A;  2DW4 A;  4ENM A;  1TQM A;  2ZSI B;  1YS6 A;  4XRS A;  1ONV A;  1S3J A;  2H27 A;  5HLT A;  1JTY A;  2DOA A;  4C2T A;  1LVK A;  2BHZ A;  3BWG A;  1KZH A;  2ID6 A;  1JHH A;  2LOO A;  2YR2 A;  2ZXI A;  3FWE A;  4B48 A;  4R79 A;  2ZCW A;  3M7G A;  1YIJ I;  3TL4 X;  1WWX A;  2PJR B;  3I59 B;  1N78 A;  3P9K A;  2DA1 A;  4ABZ A;  4PJJ A;  4UNO A;  2F4O B;  3KP4 A;  4XLC A;  4BQO A;  5M5Y J;  2EZK A;  2VKD A;  3OS0 A;  1H89 C;  4B4C A;  4IHX A;  5EEA A;  1WJD A;  5L3C A;  3L00 A;  1BL0 A;  4PDK A;  4ZH4 F;  2VQG A;  2GIZ A;  1TTY A;  3Q3S A;  3NWT A;  2R4G A;  3H35 A;  4C9Y A;  1BC7 C;  2GZW A;  2LY9 A;  3OMY A;  5B1B H;  5GTI C;  3BR0 A;  1YS7 A;  1AOY A;  4FTH A;  2BXY A;  1GDT A;  2LDU A;  4WX9 A;  1O7F A;  4V2F A;  3L2R A;  2DT6 A;  4UVB A;  2XDV A;  4BGD A;  1QRY A;  5AIP A;  5GPA A;  1E3O C;  1G59 A;  1FOY A;  3BPX A;  2VQC A;  4XRF A;  5KHD A;  3AL0 C;  2F48 A;  3FZV A;  2QLZ A;  3MEX A;  1UST A;  4P55 A;  3VYS B;  2P6T A;  4XM3 A;  3H1C A;  2ELK A;  2OBP A;  2Z9O A;  5J3L A;  1UHS A;  2EBI A;  3K4M A;  2O6G E;  3IUO A;  3H5A A;  3PIP F;  1R1V A;  1ACI A;  3HRS A;  2CO5 A;  4YEL A;  3SDB A;  5IOY A;  3HTS B;  2NVQ J;  1IF1 A;  2A5W A;  3E5Q A;  4E7J A;  1Y1W J;  1SD5 A;  1MIJ A;  2A05 A;  2Y0S A;  4G8X A;  4C3I J;  3FXR A;  1FYL A;  2EZL A;  1A5J A;  3CLO A;  1DPU A;  4HLY A;  3L09 A;  4RM3 A;  1E0E A;  1LFB A;  4JK1 X;  1WJC A;  2BEO A;  5B5E C;  5TJJ A;  1FSE A;  1G3S A;  1PYV A;  5KCM A;  2PJR A;  4DOZ A;  3JTG A;  2CUE A;  4JYK A;  4A69 C;  3OV8 A;  6PAX A;  3BZ6 A;  1TP4 A;  1F1Z A;  3FKI J;  1R4M B;  3ZPL A;  3G3Z A;  1XDS A;  1O3T A;  5IYB J;  3Q0W A;  3BR3 A;  3DBH B;  3HGY A;  1NTC A;  3GO5 A;  3H9G A;  4LB5 A;  4LG3 A;  2VT2 A;  4B44 A;  1LE8 A;  1UZC A;  2DK8 A;  2E5N A;  4ETS A;  2VQL A;  2NS7 A;  1XSD A;  2JSC A;  3BTL A;  1Z21 A;  4HW0 A;  4A0Z A;  3HHG A;  4YG2 F;  1NG6 A;  1IN8 A;  3JRA A;  2RVC A;  3A02 A;  1R00 A;  4L9J A;  1MMN A;  3AFH A;  3NAU A;  1OCT C;  2L2O A;  3EYY A;  4HF1 A;  1IO2 A;  1IXC A;  1I3Q J;  4XKC A;  4ZYE A;  1FBQ A;  1P9Q C;  2KP6 A;  1ENH A;  2QQB A;  1JKO C;  4ESJ A;  2NVT J;  4A3F J;  2L9R A;  1ETY A;  3HEF A;  3K4N A;  5GP9 A;  2Q8K A;  2R7D A;  2OPT A;  1IV6 A;  4IX7 A;  3BRO A;  3IWF A;  1UMQ A;  4OIO F;  5IT9 Z;  1YG2 A;  3AG4 H;  3DTE A;  3FKJ A;  5FKM A;  4R8H A;  2MW8 A;  2HXI A;  5ILU A;  4RB1 A;  5JVT A;  3NQO A;  3C1D A;  3M1C A;  2M1B A;  3KYC B;  3S3N A;  3CCR I;  4W1U A;  3GLX A;  4D1Q A;  3Q9S A;  5DYM A;  1IN7 A;  2PI0 A;  1T2K A;  4CDG A;  1NHA A;  3SDG A;  4IHT A;  3V7C A;  5LHI A;  1RKW A;  3ZQC A;  2OZ6 A;  3P7N A;  2HVQ A;  5FKO A;  1SMY F;  2Z5U A;  3FXO A;  4PJL A;  4B3X A;  3QU6 A;  2CQX A;  5CLS A;  3V42 A;  5BPD A;  2RN7 A;  4KT5 C;  4WXC A;  1O7L A;  2MH2 A;  4R1H A;  4TV7 A;  3F8B A;  3HB9 A;  1PVE A;  4DQ2 A;  4II3 A;  3W3C A;  3W2W A;  2LRD A;  4XKB A;  1BW5 A;  1YW8 A;  1P7J A;  1WH7 A;  5BOX A;  1ZG5 A;  1VQL I;  2QEN A;  3CF5 F;  4G12 A;  4HEA 2;  3J7Z I;  2QEX I;  1Q1V A;  4RS8 A;  1N77 A;  1EKE A;  2O03 A;  1BOB A;  1YOV B;  3KEQ A;  1ZRE A;  3GFL A;  2A3S A;  2M7B A;  4AIJ A;  1Y8R B;  3ML6 A;  4BNC A;  2MGQ A;  3E6C C;  3GZ6 A;  2XB0 X;  4IVN A;  3GTJ J;  3K7A J;  2DQR A;  4XLH A;  3B6A A;  4RGX A;  4DZP A;  3E6M A;  2ZB9 A;  1YRN A;  3BC8 A;  3DP7 A;  2JTV A;  3QAH A;  2NYX A;  3SZT A;  2KIQ A;  2O8X A;  4GYG A;  1WH5 A;  4UB6 C;  4XOP A;  4A93 J;  4XBF A;  2I10 A;  1BI1 A;  4BE1 A;  1QPI A;  1YO5 C;  1CF7 A;  4MIM A;  4PSW A;  4GYI A;  4XOR A;  2RC4 A;  1JXS A;  1OJL A;  1F9N A;  3IH4 A;  2R7W A;  3S1R J;  4L0Z B;  2R5Y A;  1YI2 I;  4LB6 B;  5F0H A;  2HQN A;  3EUK L;  2GA1 A;  3OS1 A;  3GCM A;  1FLI A;  1R5H A;  3VWB A;  2LKS A;  2XAU A;  2O61 A;  1HKT A;  3L9F A;  3MAJ A;  5LRR A;  4D5C A;  4BE2 A;  1H88 C;  1S8N A;  3N97 A;  3BJ6 A;  2FOW A;  1H9T A;  2DYR H;  3TDU C;  2Z2S B;  1R23 A;  3E5U A;  3QPS A;  4G7Z F;  3H9J A;  2D45 A;  1VF9 A;  1MBE A;  4A5N A;  3FIW A;  2Y48 A;  5HDN A;  3FK6 A;  3GBG A;  3K10 A;  2FXA A;  1RIO H;  2X1D A;  1MH3 A;  4E7S A;  1ETO A;  2VKH A;  2UV1 A;  3HJE A;  4BY1 J;  3MCZ A;  1RC9 A;  4A3K J;  5JVG F;  2JRT A;  2VKE A;  1G2H A;  2HOA A;  1ITY A;  1I1G A;  3PQK A;  5AIQ A;  3K1P A;  3LSG A;  4P9U A;  4OAY A;  1QVU A;  2ME0 A;  3ERE D;  2CUZ A;  2OQR A;  5ERI A;  2LKP A;  1PJR A;  2XV4 S;  2KJB A;  5HLI A;  5DUI A;  4IZZ A;  2UZK A;  2MC4 A;  4EGY A;  2LP0 A;  4CCM A;  1IRG A;  4M3F A;  1D0X A;  4RDU A;  5B3S H;  1L3L A;  1IGN A;  4CCL A;  3CD6 I;  1T0F C;  3F21 A;  1W7P B;  2QM3 A;  3SEZ A;  2P5L C;  1Z91 A;  3ZN0 A;  5DD4 A;  1GVD A;  3HOV J;  1FIP A;  1XC5 A;  2K7L A;  3LSM A;  1O4X A;  1BW6 A;  3BTJ A;  5CVI A;  1IRX A;  3TBI A;  3W2V A;  2IGO A;  4AC0 A;  2ZBK A;  4OOI A;  3CO7 C;  1UHM A;  2V4J C;  3R61 A;  1Z05 A;  3FBI B;  4ENJ A;  4UY8 I;  1IRZ A;  1ZKG A;  2LF8 A;  2VAS A;  5JHU A;  3CCM I;  5D6E A;  3F8F A;  5H6R A;  4UUT A;  1BA5 A;  3WG7 H;  4KIG A;  3LA3 A;  3WE3 A;  4IO9 F;  3C2G A;  5E17 F;  3HZJ A;  1RKT A;  2CFO A;  5J47 A;  1W0T A;  2D2W A;  5JLW A;  3I9V 2;  1ZGJ A;  4B09 A;  2XB5 A;  2WC2 A;  5HDG A;  1X1C A;  2BXZ A;  3HRT A;  3F72 A;  1S72 I;  2YX4 A;  1JHF A;  5CKT A;  4MEY F;  1XS9 A;  5IP7 J;  1TT0 A;  3CCS I;  4ZJZ A;  5GAE J;  2XPV A;  1V3F A;  5EYR A;  5K5O A;  3BG6 A;  3HXL A;  4I09 A;  1BN5 A;  2AXT C;  2C6Y A;  2F5E A;  1OMI A;  2V9P A;  3TO6 A;  2BY0 A;  3HGG A;  5D6F A;  5B66 C;  1Y8Q B;  5HS9 A;  2ZME B;  3PO2 J;  1ZQ3 P;  5HNH A;  2WWY A;  3BR6 A;  3HKZ N;  3FK7 A;  1J9I A;  1NK3 P;  2CQN A;  2ZO4 A;  3ZQG A;  2OD5 A;  3T1B A;  5L3B A;  2F5F A;  1YJ9 I;  5EG0 B;  2LBF A;  3RCO A;  1MDM B;  2IRF G;  3ASN H;  3OOU A;  3IL2 A;  3QU3 A;  2LFB A;  2DOF A;  3VSL A;  1PDN C;  2A61 A;  1H0M A;  2WAQ N;  2HS5 A;  3NEU A;  2VJ4 A;  2X51 A;  1V4R A;  3IKT A;  4ZC3 A;  2RNG A;  4JX5 A;  1DUX C;  1FTT A;  2DBB A;  1FP1 D;  3ZQL A;  3OYB A;  1W4M A;  2HOE A;  2HVS A;  1HDP A;  3M4O J;  4PGH A;  1W36 C;  3S3M A;  5B1A H;  3TDZ C;  4A2U A;  4EGZ A;  3S93 A;  3LAP A;  1ZK8 A;  1XD7 A;  1Z1D A;  4LJZ F;  1VI0 A;  2CV1 A;  3BR5 A;  2M45 A;  2EZH A;  3LSR A;  5DS9 A;  3E6B A;  3QOD A;  1XSX A;  2FOK A;  1T6S A;  3C3W A;  4E7L A;  3HM5 A;  2DA2 A;  2E60 A;  4G7H F;  3S2D J;  2M34 A;  3MQ0 A;  3R6S A;  3K70 C;  3CTA A;  4RAG A;  2QYO A;  3RTR A;  2MA3 A;  2E2H J;  4XSZ F;  1PUF B;  3LQQ A;  1RR8 C;  1P4A A;  2MD0 A;  3DBL B;  3ECH A;  1R5I D;  4CZC A;  4UUS B;  5EF6 A;  3IRR A;  1K4S A;  2OJE D;  3ABK H;  4NC7 A;  5F04 A;  1MW7 A;  4L5I A;  5F64 A;  2EWN A;  3DXJ F;  3FBN B;  5LEJ A;  1K6Y A;  3ZCO A;  3GVA A;  2MSY A;  2P7V B;  3KZI C;  4FE4 A;  2RAE A;  2CUF A;  3AG1 H;  1QU3 A;  1FNN A;  2KZG A;  2JK3 A;  3BJA A;  1JUP A;  3RSN A;  2L9S A;  3S3O A;  2EV5 A;  2R7O A;  4WF2 A;  3RJP A;  4D7M A;  5DDG A;  1JTX A;  1O57 A;  3CC7 I;  4JX6 A;  3WTV C;  1KA8 A;  3M3Y J;  3DKX A;  4Z2Y A;  3CCU I;  2OTJ I;  4LLL A;  3O3K A;  3CUQ C;  2JSP A;  3F0C A;  2R7S A;  3GTQ J;  5IY5 H;  1T98 A;  3ZMV A;  2IVM A;  4KIT B;  1Z6R A;  1JUM A;  1I27 A;  4LIU A;  4WXD A;  1XDU A;  4D5F A;  3L2U A;  4RGU A;  4PSX A;  3C2B A;  2COB A;  4XRM A;  1A6Q A;  2DDB A;  3WGI A;  1MSF C;  4BU2 A;  3BG5 A;  1YX3 A;  4M3G A;  4XLN F;  3WTW C;  3MFK A;  2Z16 A;  2IW5 A;  2BBY A;  2QF7 A;  2XPW A;  2LK2 A;  1BR4 A;  1EH8 A;  3NRV A;  4HZF A;  5D5V B;  2E1M C;  3H3V K;  4L5J A;  4HDU A;  5F1R A;  1GUU A;  3RKQ A;  3O8G A;  4QIW N;  4DYR A;  1E3P A;  3LOC A;  5EZG A;  3S14 J;  2FA5 A;  4AID A;  5JI6 A;  2D1H A;  3J80 K;  2ELH A;  2H1K A;  2K4J A;  3I0T A;  1HW5 A;  4G6Q A;  1WVR A;  1YE9 A;  1X3U A;  5DTD A;  1ZGW A;  2DMN A;  4FAS D;  2FQ4 A;  3OYJ A;  4Z6Y A;  5JR3 A;  1WKM A;  2DI3 A;  2K9Q A;  4BXX J;  4A0Y A;  2W7N A;  2PX9 A;  4FT8 A;  1K6O A;  2YU3 A;  3CES A;  2VC1 A;  1BJA A;  2QQ8 A;  1FZP B;  2FUG 2;  2E1N A;  2HYG D;  4E7Z A;  1R1T A;  5EGO B;  2JWT A;  2NVU B;  2HNH A;  2L4A A;  2A07 F;  5J1Y A;  4DZJ A;  3VPR A;  2K9M A;  5TGT A;  3EQL F;  5D5X B;  1TNS A;  5LFA A;  4B47 A;  2FU4 A;  4IKF A;  1YX5 A;  2PG4 A;  4XN0 A;  4O5V A;  4XK4 A;  3KZY A;  2OUM A;  4O6J A;  1TLH B;  3Q0V A;  3WTT C;  4XSX F;  4AU7 A;  4CCJ A;  4IQ4 A;  1FYM A;  1S7O A;  3KPH A;  2XGC A;  3SXY A;  2VL8 A;  2E36 A;  2JUG A;  1LUJ B;  1OYY A;  2VT3 A;  2EFO A;  4BEH B;  4A3E J;  3Q0U A;  3ULQ B;  3KIO A;  4A3M J;  3TP3 A;  1VQ9 I;  4XQF A;  3BCA A;  3E5X A;  1MKM A;  3ZQQ A;  2EPF A;  1FY7 A;  1IUF A;  1TWH J;  2GOM A;  3OYC A;  3GFI A;  3BDD A;  4XMY A;  4NQW B;  4I6Z A;  4PK4 A;  4IPA A;  1HLV A;  2XGX A;  1BC8 C;  2NOJ B;  1R5G A;  2GQQ A;  5EDN A;  2VUM J;  1UFM A;  1LQ1 A;  1K78 B;  4GFB A;  1GLN A;  4MFD A;  1K4T A;  4PGG A;  1I5Z A;  1HST A;  1MGT A;  1HXD A;  4N0B A;  1ZRF A;  4ZDL A;  1B9N A;  2L4M A;  1D0Z A;  3JAM K;  3E6D A;  2DPU A;  2V79 A;  5LBQ A;  4BDY A;  3J80 Z;  2RKH A;  5F1J A;  2Z1D A;  1EV7 A;  4XKV A;  5DCM A;  1I3A A;  1MJA A;  3ZP5 A;  3E7L A;  2XKO A;  4RLF A;  3JRI A;  4B1R A;  5CVV A;  2M8E A;  2R7X A;  4E7H A;  2EIM H;  1FSH A;  4L9N A;  4NC6 A;  3I59 A;  4LK1 F;  2Q0O A;  2XC7 A;  2UXX A;  4FE7 A;  3CF2 A;  1SVM A;  1GV2 A;  2HPI A;  2WTE A;  4V2G A;  1RUN A;  3S8P A;  3RIR A;  1APL C;  1CF7 B;  5FLX Z;  2CQQ A;  3GW2 A;  1QA6 A;  2AXL A;  2E7W A;  1LFP A;  5FLM J;  1QHH D;  2IS6 A;  4DGW B;  3UR3 C;  2P8T A;  3H0G J;  3JRG A;  2ZKZ A;  2W84 A;  1HDD C;  1TZL A;  1VQM I;  1W0U A;  3SYT A;  2XSJ C;  3LSJ A;  1AKH A;  3BQZ A;  1OKR A;  1SD7 A;  3GZN B;  1KU2 A;  4EJV A;  1ZAR A;  1QHG A;  1KON A;  2FE3 A;  1SVL A;  3KX2 A;  2LG4 A;  1FOK A;  2DLL A;  3LA7 A;  2CW8 A;  3FXL A;  3V8L A;  3WG9 A;  2EIK H;  1MMS A;  3LSH A;  4WCG A;  3H92 A;  4MO7 A;  3FXQ A;  5ICE A;  2A6T A;  3FDY A;  1O3S A;  1P6R A;  2Y69 H;  3H0D A;  1I39 A;  3HOU J;  3VOE A;  1D5V A;  3U2R A;  2QQ9 A;  4ZYA A;  2PEX A;  3S2W A;  2L7K A;  1J2X A;  3G73 A;  1AKH B;  1SAN A;  1U2W A;  1XGN A;  1D0Y A;  2X1C A;  1W5C C;  2K5C A;  3TQN A;  3VDX A;  3PUB A;  4E70 A;  1LDK B;  5E18 F;  4M9X A;  4Q5S F;  4B8X A;  3BOQ A;  4LK0 F;  1PP7 U;  4A12 A;  1OQY A;  2M8G X;  2M2E A;  2BVL A;  3GF2 A;  2R0Q C;  1MSE C;  1VQN I;  4ASN A;  3GME A;  3C7J A;  1LEA A;  3JAM Z;  2L54 A;  3RQ4 A;  1DGR M;  2H6C A;  4M3D A;  4DYQ A;  1MJB A;  5BMZ A;  1DDN A;  2DPD A;  2K4B A;  4Y17 A;  2HYF A;  4FIS A;  1PP8 F;  1W7P A;  1MNM C;  2PFB A;  1YRN B;  3FMS A;  1V5F A;  4RB0 A;  2ISY A;  3S2H J;  3I3L A;  5K1Y A;  3B6C A;  2LRE A;  1S29 A;  2NVX J;  1JT6 A;  1QVT A;  3I56 I;  1QBJ A;  4BL0 B;  4HAM A;  3J7A O;  1MD0 A;  3CZ6 A;  1X4P A;  4ZYD A;  1Y6I A;  3BCB A;  1O3R A;  3T0Y A;  4P5O A;  4JQF A;  3P9I A;  1I1S A;  1ETX A;  1XMA A;  4M6Y A;  4MQ9 F;  3KP6 A;  1SFO J;  2E2I J;  2HOS A;  3S16 J;  1DU6 A;  1KQ0 A;  3RZO J;  4RAY A;  5CYV A;  4IHW A;  5EJC A;  4YIR X;  2PLY A;  2F4I A;  2BVM A;  2NOG A;  2BY1 A;  3DEW A;  2WB1 N;  2WA0 A;  4MLO A;  5D5W B;  2VKV A;  3GTL J;  4EAT A;  5IPA A;  3KP7 A;  2Z33 A;  3L2Q A;  2V7F A;  1B72 A;  2QSH X;  1XGO A;  2Z99 A;  1OPC A;  2RNJ A;  2O8K A;  4BH9 A;  2NXN B;  1ZHF A;  4KA4 A;  1Y0U A;  2IA2 A;  1FX7 A;  3OYM A;  2KRF A;  3NAR A;  1YW9 A;  5ILV A;  3H3Z A;  3KZZ A;  2HKO A;  2CS3 A;  1R49 A;  2KRC A;  4PJN A;  3SFI A;  4BJ6 C;  1T39 A;  2BW3 B;  3ONQ A;  3L7W A;  5AON A;  4UVC A;  3M9A A;  4BS9 A;  1Y39 A;  1YQA A;  4GRI A;  1R22 A;  3IKV A;  3ZOB A;  4C2M J;  5J8C A;  2MLG A;  1KQ9 A;  4HX7 A;  4PJ0 C;  2P7C B;  1KYW A;  4ENK A;  2FF4 A;  1WI9 A;  2JPC A;  2M4K A;  1AHD P;  1A04 A;  3LA2 A;  5FRO A;  1IXR C;  3P5J A;  1U0J A;  4FX4 A;  4ZTJ A;  3FXK A;  3ELK A;  5J4V A;  4GGG A;  5IT9 K;  1OIS A;  3J81 K;  3CDL A;  3MZY A;  2KRH A;  3OIO A;  2L5Q A;  4ZZL A;  3G1O A;  1TBX A;  1DPR A;  2DTZ A;  4E6K G;  3B73 A;  5D4S A;  1F36 A;  2HFH A;  4L0Y B;  4KFC A;  3D5R C;  2X0L A;  1U9O A;  1FC3 A;  4L9V A;  1K78 A;  2FSW A;  2BZT A;  4OAZ A;  3LSK A;  2YUS A;  3LQR A;  4IEJ A;  1W1W E;  3EUH C;  2ETH A;  3FHZ A;  2CUJ A;  4CGZ A;  4N4N B;  5D5U B;  2EZI A;  2CV0 A;  1IDZ A;  4FCY A;  1A6I A;  1NK2 P;  2WV1 A;  1RR7 A;  2NNN A;  3L1P A;  4BBR J;  2ZJP F;  4HQM A;  3QWL A;  3EUA A;  1K83 J;  2JVG A;  2LYC A;  1JI8 A;  3HUG A;  2VQH A;  2EIJ H;  1YLF A;  2R5Y B;  3DPT A;  1SFU A;  5JFR A;  3CDI A;  5ED4 A;  2N8G A;  2EFQ A;  3SZG A;  2LC2 A;  3LST A;  3T8R A;  2OF7 A;  2NAZ A;  2VBX A;  5FRN A;  4F3Q A;  2DMU A;  1T33 A;  1KQ8 A;  4HV5 A;  4YRV A;  3HSE A;  1X1A A;  2MC3 A;  1A35 A;  2QCO A;  3FMR A;  4RAF A;  5DEQ A;  4XLP F;  4UV8 A;  2X6Y A;  1W5S A;  2K9N A;  3ASO H;  3MZH A;  5E3O A;  1FJL A;  4CXF A;  2HI3 A;  2R7T A;  4UXN A;  1XCV A;  5CQG A;  5FD5 A;  2BGC A;  1R7J A;  3QQA A;  2STW A;  2P5K A;  4UUS A;  2V26 A;  4HDV A;  4YFX F;  2HDD A;  2R92 J;  3MWM A;  4OMZ A;  1ZAO A;  4HST A;  2ZC2 A;  2HTS A;  3MD2 A;  5D8L B;  5LRS A;  5FGM A;  4Q4Z F;  2CV2 A; 
#chains in the Genus database with same CATH homology
 3OOP A;  2HZT A;  2XUB A;  1XSV A;  1XCB A;  4M6X A;  3JW4 A;  3KLO A;  1U5T B;  2FBH A;  2K02 A;  2WV0 A;  4CIC A;  3COA C;  5ICC A;  2FQ3 A;  4G7O F;  4IJA A;  2DO7 A;  3T5X A;  4YFN F;  4P96 A;  4RGS A;  3T8T A;  3ZN1 A;  4KN7 X;  1Q1H A;  2OQG A;  2XRN A;  3I54 A;  2IPQ X;  3HIF A;  1LEB A;  3ROU A;  1C0W A;  2XAF A;  2OAZ A;  1U8R A;  3TO7 A;  4HV6 A;  4LLG F;  3R4K A;  1XN7 A;  2EV0 A;  2XAQ A;  2H6B A;  2EB7 A;  4M71 A;  3ZMZ A;  2GIV A;  4CZZ A;  5E1Z B;  2E1C A;  2HWV A;  2V6C A;  5FB2 A;  1T0F A;  2XRO A;  2V1D A;  1RNL A;  1MJ9 A;  2GAU A;  2R7F A;  4KIF A;  4M73 A;  1ZLJ A;  2MBF A;  4HBL A;  1ZGA A;  2RGV A;  2H09 A;  4O3M A;  4HOB A;  2XAH A;  1AWC A;  1ZLK A;  4N9I A;  2NRA C;  2F2E A;  1REP C;  4L9T A;  3KEO A;  4ENN A;  5CJ9 A;  1LDD A;  1GVJ A;  1P92 A;  4AIH A;  3CUQ A;  4LG0 B;  3C18 A;  2GXB A;  3RPQ A;  5E1W A;  3ABT A;  1BI3 A;  5BS6 A;  4U7D A;  5DD8 A;  5HS8 A;  3IRQ A;  4ZYH A;  4H0E A;  4IXA A;  2OU2 A;  4M9S A;  3Q9V A;  1JGS A;  2ZNZ A;  3DKW A;  5HLH A;  2MH9 A;  3RKY A;  1BIB A;  2CG4 A;  2UWM A;  2IA1 A;  3DQV C;  3WTU C;  3VB2 A;  2VC0 A;  3FF5 A;  2COM A;  3EUH A;  2DT5 A;  1SFX A;  3KLN A;  4MHG A;  5FO5 A;  4HX4 A;  4UUV A;  3IC7 A;  2P6S A;  4F7Z A;  3WE2 A;  4KMF A;  3P9C A;  3GFJ A;  4ON0 A;  2VBY A;  2L01 A;  2CGP A;  3B02 A;  3E97 A;  3F22 A;  3GXO A;  4OIP F;  1WRJ A;  1DP7 P;  1RI7 A;  3AAF A;  1SD6 A;  4EJT A;  1HKS A;  3F6O A;  3I5U A;  3WGH A;  1LVA A;  3O2P E;  5D4R A;  4RAZ A;  2EJR A;  5D8K B;  1P4W A;  4UHT A;  1QQI A;  5HS7 A;  5LGN A;  4CHU A;  4MTE A;  2XHK A;  4I0A A;  1ULY A;  2F5C A;  2DK5 A;  3K0L A;  3JTH A;  3E3V A;  1D3Y A;  3FM3 A;  2GXG A;  4KN4 X;  2DFI A;  2V1X A;  1PUE E;  2KIM A;  2O0Y A;  4GO1 A;  2GA2 A;  4YIF A;  2KKO A;  4JBA A;  4FHT A;  1R1U A;  2HDC A;  1SD4 A;  3K69 A;  5L3F A;  4UV9 A;  5L3G A;  3IWZ A;  4EM1 A;  1STZ A;  4G6D A;  1FYK A;  4KMU X;  2ACJ A;  4EMS A;  3KET A;  1ZRD A;  2IP2 A;  1GXQ A;  1B9M A;  5HVQ C;  2QBY B;  5DUK A;  1U5T A;  4M74 A;  1ZG3 A;  4MEX F;  4A6D A;  1ODD A;  5BQT A;  2QZ8 A;  3SQN A;  5LGT A;  4P9F A;  1LNW A;  2J5O A;  4BAY A;  3RKW A;  2ZJ2 A;  1ZRC A;  4BHB A;  1ON2 A;  2F5D A;  4G94 A;  1OYW A;  2Z3Y A;  4HX8 A;  2HEO A;  1SAX A;  1FBS A;  3BPV A;  1RUO A;  5IT3 A;  3QRF F;  3KP3 A;  5KVR A;  5H20 A;  3O6B B;  4U0Y A;  5DV5 A;  2DQL A;  2NNY A;  1IAW A;  1LB2 A;  2NS0 A;  3KE2 A;  3BJO A;  3HOS A;  1B59 A;  3I58 A;  4IHS A;  3DV8 A;  4IRI A;  3WU1 B;  3HOT A;  2JZY A;  3CUQ B;  4LG0 A;  4AD9 A;  4KUM A;  1IW7 F;  2LSO A;  1CGP A;  3CDH A;  3QOP A;  1ZYR F;  4OIR F;  1JE8 A;  1B1B A;  2PQ8 A;  2IJL A;  1B6A A;  2ZXJ A;  2CFX A;  4S05 A;  1D8J A;  4CO8 A;  2CQK A;  3M1E A;  4Q48 A;  4BHC A;  4EVI A;  3TOA A;  3K9T A;  2QBY A;  1QPM A;  3LAJ A;  1EH7 A;  5HOO A;  1LJ9 A;  3VFZ A;  2A5Y B;  3DEU A;  3GWZ A;  1F5T A;  4I01 A;  2V1U A;  1J0R A;  4Y15 A;  5E8G A;  1XB4 A;  2BE5 F;  3ZMS A;  1KU7 A;  2P5V A;  1IUY A;  2KIU A;  3I64 A;  2XAJ A;  2A69 F;  2ESH A;  2KIF A;  1U78 A;  2DU9 A;  1LDJ A;  1QZZ A;  2FMY A;  2FNP A;  4A6E A;  2EFP A;  4WXH A;  2O3F A;  1Z9C A;  2VE9 A;  4KIC A;  2H94 A;  4LMY A;  2HR3 A;  3KP5 A;  1J5Y A;  3F23 A;  3KP2 A;  4M72 A;  5E8I A;  4EM2 A;  3FM5 A;  3QP5 A;  1MZB A;  2RDP A;  3RDI A;  3K2Z A;  1UB9 A;  3I4P A;  3W6K B;  3U9G A;  4EM0 B;  4A0X A;  1K7A A;  2VOO A;  4KDP A;  3TOB A;  5HLG A;  3WOD F;  3HRU A;  3F8C A;  3CO6 C;  2EK5 A;  3FMQ A;  5LGU A;  2A68 F;  2TDX A;  2ADU A;  1HW2 A;  5J6X A;  1MDM A;  2DAO A;  4NB5 A;  2FRH A;  1GHC A;  1BIA A;  3VEP A;  5CVU A;  4YII A;  3ABU A;  2VBW A;  1TW3 A;  2JPB A;  5FFX A;  2FBK A;  2P4W A;  3K1N A;  2ZME A;  3SZP A;  4HF2 A;  5DCM B;  2LF7 A;  1IN6 A;  4Q47 A;  1S7A A;  2VE8 A;  1H9G A;  4IRG A;  1F4K A;  4QLC U;  2A6H F;  5J8F A;  3HYI A;  2PBI A;  3SHF A;  4AVP A;  2W25 A;  3Q5F A;  5ICF A;  2CSO A;  1YW7 A;  3LFK A;  2DTR A;  1IN5 A;  2CW0 F;  2D1V A;  5L3D A;  1S6L A;  5K5R A;  3QPT A;  1Z7U A;  2RV8 A;  3WTZ A;  1YFH A;  2VBZ A;  2PN6 A;  4EJO A;  1G6N A;  4Y13 A;  3PFI A;  2E7X A;  2L3D A;  3GZ5 A;  4CYD A;  1IRF A;  1G3T A;  3EDP A;  4HA8 A;  4WWC A;  2M5W A;  1G3W A;  3DPL C;  5KK1 A;  2L02 A;  3K1M A;  3H3U A;  2HTJ A;  2V9V A;  1B4A A;  1HQC A;  1QZY A;  5A2Q K;  2R3S A;  4HYE A;  3M8F A;  2HQR A;  5TRD A;  4N9H A;  2FNA A;  1RZ4 A;  2MLK A;  3BP8 A;  3RPU A;  4LLN A;  3U1D A;  4A5M A;  2ZNY A;  1UCR A;  5EEH A;  5ILS A;  2XVC A;  4U7B A;  4BHP A;  1TW2 A;  4AIK A;  2VON A;  1IXS B;  2Q2E A;  3LWF A;  1U6G A;  1G3Y A;  2QVO A;  1BBY A;  1HSJ A;  3HSF A;  3V8J A;  3F3X A;  1XGS A;  1IN4 A;  4MGR A;  3J81 Z;  3I71 A;  4KYW A;  3IHU A;  4U0W A;  4I98 B;  2QUF A;  1TQI A;  5EEG A;  4RB2 C;  5BPI A;  2G7H A;  3EYI A;  3GEZ A;  3ZMT A;  4EJU A;  1YYV A;  3M8E A;  1Z6T A;  3BY6 A;  1J59 A;  2Y75 A;  3FX3 A;  2K86 A;  2X4H A;  3GFM A;  4KIB A;  3SFZ A;  2HGC A;  5CVR A;  3V7R A;  3JSO A;  2PJP A;  3FXU A;  2EFW A;  2G9W A;  4BQA A;  2RQP A;  3N4M A;  3WGG A;  2HKX A;  4WK8 F;  4I02 A;  4DNC A;  2VXZ A;  4FX0 A;  1HBX G;  1XMK A;  4I7H A;  1ZG1 A;  1OYI A;  2YX7 A;  4HQE A;  1QGP A;  1UHW A;  2OZU A;  4M9Z A;  3RYR A;  5FD6 A;  4UVA A;  3L2C A;  2EA2 A;  2EV6 A;  4K2E A;  1YIO A;  3REO A;  2QWW A;  3PQJ A;  2BV6 A;  5F6F A;  3WTY C;  5DCF A;  3CUO A;  3R0J A;  2B0L A;  3WTX C;  3VOD A;  3ZMD A;  4GXO A;  4PCQ A;  4LFU A;  1ON1 A;  2PMU A;  1P4X A;  1KU9 A;  4I0B A;  2ISZ A;  1SFE A;  4MNU A;  1FWZ A;  4U0V A;  2AS5 F;  3I53 A;  2K27 A;  1ZH5 A;  2LNB A;  2XAG A;  4AWX B;  4HLX A;  4BYY A;  1R36 A;  5LHG A;  2IA0 A;  1FP2 A;  2H27 A;  2M30 A;  1WSU A;  3DFG A;  1I6X A;  4D0P A;  2JT1 A;  4LD5 A;  3HTU A;  2QQA A;  3GX4 X;  1W5T A;  3WU0 A;  1BI2 A;  4GCV A;  3D0S A;  5HDK A;  1HKQ A;  2CYY A;  3HHH A;  4IRH A;  2XIG A;  1U5T C;  2UXN A;  4ESF A;  1BM9 A;  1L0O C;  3RYP A;  3V8K A;  1O3Q A;  3D5L A;  5LEK A;  2FBI A;  1KU3 A;  3DF8 A;  2EA4 A;  4RB3 C;  2STT A;  4IF4 A;  2YSR A;  1FBU A;  4L18 B;  3R60 A;  5A2Q Z;  3KCC A;  3F8N A;  5LLQ A;  2MD5 A;  1QO0 D;  2XKP A;  1GXP A;  1W7P D;  1E2X A;  1J75 A;  1FT9 A;  3EET A;  4OMY A;  2YPR A;  1U3E M;  1EH6 A;  4U88 A;  4MQV A;  1D8K A;  2G7U A;  1IZ1 A;  2FEZ A;  1E17 A;  4ZZD A;  1K79 A;  1TNT A;  1FPQ A;  3TKY A;  2J5P A;  4YFK F;  3QPH A;  5FFZ A;  2W57 A;  3HSR A;  4KNY A;  4OU0 A;  5E20 A;  4PZJ A;  2M87 A;  3TGN A;  3TO9 A;  2OA4 A;  3JSP A;  3GYH X;  4I2O A;  5FLX K;  1KYZ A;  2GWR A;  1SMT A;  5CVJ A;  2XAS A;  4G9Y A;  2A6E F;  5E1X A;  2ZFW A;  5H6Q A;  1T38 A;  4EV0 A;  3ECO A;  3QP6 A;  2FML A;  2CWE A;  4QWQ A;  2EFN A;  1R58 A;  5ICG A;  1TQP A;  2VOD A;  1BOA A;  1WQ2 A;  3ZQ7 A;  3V4G A;  4EQQ A;  3W6J B;  3HRM A;  4LGW A;  2KJC A;  3RI4 A;  2BYV E;  1XGM A;  3GUD A;  5LHH A;  1BI0 A;  3R0A A;  3CJN A;  5L3E A;  3RKX A;  2W24 A;  4OIN F;  4MTD A;  2W85 A;  3V7S A;  1OR7 A;  3F8M A;  4NHJ A;  1J7K A;  2VN2 A;  1VTN C;  4BXU A;  1G4D A;  2VOP A;  1P2F A;  1ZN2 A;  1QNT A;  4OIQ F;  2ESN A;  4ESB A;  1KGS A;  4HF0 A;  4EJW A;  1USS A;  4ZYG A;  4S04 A;  3KFW X;  3WTS C;  3ZMU A;  2Y0M A;  4NQW A;  1HW1 A;  2IT0 A;  3F6V A;  2PMH A;  5K5Q A;  4RGR A;  3ISP A;  1YTY A;  2DW4 A;  4ENM A;  1TQM A;  1YS6 A;  1ONV A;  1S3J A;  3BWG A;  2YR2 A;  1JHH A;  3FWE A;  4R79 A;  2ZCW A;  3M7G A;  1WWX A;  3I59 B;  3P9K A;  4UNO A;  3KP4 A;  5L3C A;  3L00 A;  4PDK A;  4ZH4 F;  1TTY A;  1BC7 C;  2GZW A;  1AOY A;  1YS7 A;  2LDU A;  4WX9 A;  1O7F A;  4UVB A;  5AIP A;  3BPX A;  4XRF A;  3FZV A;  2QLZ A;  3MEX A;  1UST A;  4P55 A;  2P6T A;  2OBP A;  2Z9O A;  2O6G E;  1R1V A;  3HRS A;  2CO5 A;  3HTS B;  1IF1 A;  3E5Q A;  1SD5 A;  4G8X A;  3FXR A;  1FYL A;  1DPU A;  3CLO A;  4HLY A;  3L09 A;  4JK1 X;  2BEO A;  5TJJ A;  1FSE A;  1G3S A;  3JTG A;  3OV8 A;  6PAX A;  3BZ6 A;  1F1Z A;  3ZPL A;  3G3Z A;  1XDS A;  1O3T A;  3GO5 A;  4LB5 A;  2VT2 A;  4ETS A;  2DK8 A;  1XSD A;  2JSC A;  4HW0 A;  4YG2 F;  3HHG A;  4A0Z A;  1IN8 A;  2RVC A;  1R00 A;  4L9J A;  3EYY A;  4HF1 A;  1IXC A;  4ZYE A;  1FBQ A;  2QQB A;  4ESJ A;  2Q8K A;  2R7D A;  3BRO A;  3IWF A;  4OIO F;  5IT9 Z;  1YG2 A;  4R8H A;  5ILU A;  4RB1 A;  5JVT A;  3NQO A;  3C1D A;  2M1B A;  3GLX A;  3Q9S A;  5DYM A;  1IN7 A;  2PI0 A;  1T2K A;  4CDG A;  1NHA A;  4IHT A;  3V7C A;  5LHI A;  2OZ6 A;  3P7N A;  1SMY F;  2Z5U A;  3QU6 A;  5CLS A;  5BPD A;  2RN7 A;  4KT5 C;  4WXC A;  1O7L A;  2MH2 A;  4R1H A;  4TV7 A;  3F8B A;  4DQ2 A;  1YW8 A;  5BOX A;  1ZG5 A;  2QEN A;  4RS8 A;  2O03 A;  3KEQ A;  1ZRE A;  3GFL A;  2A3S A;  4AIJ A;  3ML6 A;  4BNC A;  3E6C C;  3GZ6 A;  4IVN A;  2DQR A;  4RGX A;  3E6M A;  3DP7 A;  2JTV A;  3QAH A;  2NYX A;  3SZT A;  2O8X A;  4GYG A;  4XBF A;  1BI1 A;  1YO5 C;  1CF7 A;  4GYI A;  2RC4 A;  1JXS A;  1F9N A;  4L0Z B;  4LB6 B;  2HQN A;  2GA1 A;  1FLI A;  1R5H A;  2O61 A;  1HKT A;  3L9F A;  3MAJ A;  5LRR A;  1S8N A;  3N97 A;  3BJ6 A;  1H9T A;  3TDU C;  1R23 A;  3E5U A;  4G7Z F;  2D45 A;  4A5N A;  2Y48 A;  5HDN A;  2FXA A;  1RIO H;  3MCZ A;  2JRT A;  1I1G A;  3PQK A;  5AIQ A;  3K1P A;  4P9U A;  3ERE D;  2OQR A;  5ERI A;  2LKP A;  2XV4 S;  2KJB A;  5HLI A;  5DUI A;  2UZK A;  4EGY A;  1IRG A;  1L3L A;  3F21 A;  1W7P B;  2QM3 A;  2P5L C;  1Z91 A;  3ZN0 A;  5DD4 A;  2K7L A;  5CVI A;  2ZBK A;  4OOI A;  3CO7 C;  1UHM A;  3R61 A;  1Z05 A;  4ENJ A;  2LF8 A;  5JHU A;  5D6E A;  3F8F A;  5H6R A;  4KIG A;  3LA3 A;  3WE3 A;  5E17 F;  2D2W A;  1ZGJ A;  4B09 A;  2WC2 A;  5HDG A;  3HRT A;  3F72 A;  2YX4 A;  1JHF A;  4MEY F;  1V3F A;  5K5O A;  4I09 A;  1BN5 A;  2C6Y A;  2F5E A;  1OMI A;  3TO6 A;  5D6F A;  5HS9 A;  2ZME B;  2WWY A;  1J9I A;  2ZO4 A;  2OD5 A;  3T1B A;  5L3B A;  2F5F A;  1MDM B;  2IRF G;  3IL2 A;  3QU3 A;  1PDN C;  2A61 A;  1H0M A;  2HS5 A;  3NEU A;  1V4R A;  3IKT A;  1DUX C;  2DBB A;  1FP1 D;  1W4M A;  2HOE A;  4PGH A;  3TDZ C;  4A2U A;  4EGZ A;  3LAP A;  1XD7 A;  1Z1D A;  4LJZ F;  2M45 A;  3E6B A;  1XSX A;  2FOK A;  1T6S A;  3C3W A;  4G7H F;  3MQ0 A;  3R6S A;  3CTA A;  2QYO A;  3RTR A;  2MA3 A;  4XSZ F;  3LQQ A;  1P4A A;  3ECH A;  3IRR A;  5F64 A;  4L5I A;  2EWN A;  3DXJ F;  5LEJ A;  3GVA A;  2P7V B;  1FNN A;  3BJA A;  2EV5 A;  4WF2 A;  3RJP A;  5DDG A;  1O57 A;  3WTV C;  1KA8 A;  4Z2Y A;  4LLL A;  3O3K A;  3CUQ C;  1T98 A;  3ZMV A;  2IVM A;  1Z6R A;  1I27 A;  4WXD A;  1XDU A;  4RGU A;  3WGI A;  4XLN F;  3WTW C;  3MFK A;  2IW5 A;  2BBY A;  3NRV A;  1EH8 A;  4HZF A;  5D5V B;  4L5J A;  4HDU A;  5F1R A;  2FA5 A;  5JI6 A;  2D1H A;  3J80 K;  2ELH A;  2K4J A;  3I0T A;  1HW5 A;  4G6Q A;  1X3U A;  5JR3 A;  1WKM A;  2DI3 A;  4A0Y A;  4FT8 A;  1K6O A;  2YU3 A;  2VC1 A;  1BJA A;  1FZP B;  2E1N A;  2HYG D;  1R1T A;  2A07 F;  2L4A A;  3EQL F;  5D5X B;  1TNS A;  2FU4 A;  2PG4 A;  4O5V A;  3KZY A;  4O6J A;  1TLH B;  3WTT C;  4XSX F;  1FYM A;  1S7O A;  3SXY A;  1OYY A;  2VT3 A;  2EFO A;  3ULQ B;  3E5X A;  1MKM A;  1FY7 A;  3GFI A;  3BDD A;  4IPA A;  2XGX A;  1BC8 C;  1R5G A;  2GQQ A;  1UFM A;  1LQ1 A;  1K78 B;  4PGG A;  1I5Z A;  1HST A;  1MGT A;  1HXD A;  4N0B A;  1ZRF A;  1B9N A;  2L4M A;  3JAM K;  3E6D A;  2DPU A;  2V79 A;  5LBQ A;  3J80 Z;  2RKH A;  1EV7 A;  5DCM A;  1MJA A;  3ZP5 A;  2XKO A;  5CVV A;  2M8E A;  1FSH A;  4L9N A;  3I59 A;  4LK1 F;  2Q0O A;  2UXX A;  2WTE A;  1RUN A;  3RIR A;  1CF7 B;  5FLX Z;  3GW2 A;  2AXL A;  2E7W A;  2P8T A;  2ZKZ A;  2W84 A;  1OKR A;  1SD7 A;  1KU2 A;  4EJV A;  1ZAR A;  2FE3 A;  1FOK A;  2DLL A;  3LA7 A;  3V8L A;  3WG9 A;  4WCG A;  3H92 A;  3FXQ A;  5ICE A;  1O3S A;  1P6R A;  3VOE A;  1D5V A;  3U2R A;  2QQ9 A;  2PEX A;  3S2W A;  1J2X A;  3G73 A;  1U2W A;  1XGN A;  3TQN A;  4E70 A;  1LDK B;  5E18 F;  4M9X A;  4Q5S F;  4B8X A;  3BOQ A;  4LK0 F;  1PP7 U;  4A12 A;  3GF2 A;  4ASN A;  3C7J A;  1LEA A;  3JAM Z;  2L54 A;  2H6C A;  1MJB A;  5BMZ A;  1DDN A;  2DPD A;  2K4B A;  4Y17 A;  2HYF A;  1PP8 F;  1W7P A;  2PFB A;  3FMS A;  4RB0 A;  2ISY A;  5K1Y A;  1S29 A;  1QBJ A;  4HAM A;  3J7A O;  1MD0 A;  4ZYD A;  1O3R A;  3T0Y A;  4P5O A;  4JQF A;  3P9I A;  1I1S A;  1XMA A;  4M6Y A;  4MQ9 F;  3KP6 A;  1KQ0 A;  4RAY A;  5CYV A;  2PLY A;  5D5W B;  3KP7 A;  2Z33 A;  1XGO A;  2Z99 A;  1OPC A;  2RNJ A;  4BH9 A;  1ZHF A;  4KA4 A;  1Y0U A;  2IA2 A;  1FX7 A;  2KRF A;  1YW9 A;  5ILV A;  3H3Z A;  3KZZ A;  2HKO A;  1T39 A;  3L7W A;  5AON A;  4UVC A;  3M9A A;  1YQA A;  1R22 A;  3IKV A;  5J8C A;  2MLG A;  1KQ9 A;  4HX7 A;  2P7C B;  1KYW A;  4ENK A;  2FF4 A;  1WI9 A;  2JPC A;  1A04 A;  3LA2 A;  1IXR C;  4FX4 A;  3ELK A;  4GGG A;  5IT9 K;  3J81 K;  3MZY A;  4ZZL A;  1TBX A;  1DPR A;  3B73 A;  5D4S A;  2HFH A;  4L0Y B;  4KFC A;  2X0L A;  1FC3 A;  4L9V A;  1K78 A;  2FSW A;  3LQR A;  3FHZ A;  2ETH A;  4CGZ A;  5D5U B;  2NNN A;  4HQM A;  3HUG A;  1YLF A;  3DPT A;  1SFU A;  5JFR A;  5ED4 A;  2EFQ A;  3LST A;  3T8R A;  2NAZ A;  2VBX A;  1KQ8 A;  4HV5 A;  3HSE A;  2MC3 A;  5DEQ A;  3FMR A;  4XLP F;  4UV8 A;  1W5S A;  3MZH A;  4CXF A;  4UXN A;  1XCV A;  5FD5 A;  2BGC A;  1R7J A;  2STW A;  2P5K A;  4HDV A;  4YFX F;  3MWM A;  4OMZ A;  1ZAO A;  5D8L B;  2HTS A;  5LRS A;  5FGM A;  4Q4Z F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...