3JAMZ

Cryoem structure of 40s-eif1a-eif1 complex from yeast
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
70
structure length
70
Chain Sequence
AKHAVVLDQDKFDRIMKEAPTYRYVSVSVLVDRFKLGGSLARVALRHLENEGIIKPVSKHSKQAIYTRAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational Differences between Open and Closed States of the Eukaryotic Translation Initiation Complex.
pubmed doi rcsb
molecule keywords 18S rRNA
molecule tags Translation
source organism Saccharomyces cerevisiae
total genus 8
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF03297 Ribosomal_S25 S25 ribosomal protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3jamZ00
2WC2A 3QP6A 1XGMA 3VFZA 1BC7C 3JTHA 4U0VA 2KJBA 3ZN1A 1KGSA 2P6SA 5K5RA 3R4KA 2J5OA 2XUBA 1KQ0A 2A3SA 3TO9A 4KYWA 1BC8C 2A61A 2YX4A 1TW3A 4Q4ZF 3I59A 5L3FA 3RKXA 3MAJA 5AIQA 3MZHA 1XDSA 2ZMEA 3I0TA 3WTSC 2CO5A 2DPDA 1IN5A 3L2CA 4WK8F 5D4SA 3HHHA 2L4MA 2UXNA 2F5DA 4AIKA 1Z91A 5LGNA 3K9TA 3RJPA 1SD7A 2O6GE 1F4KA 2ZO4A 2HOEA 2GWRA 1IAWA 4IXAA 2LSOA 2XASA 5D4RA 5E8IA 5E18F 1ZYRF 3S2WA 4ESBA 5J6XA 1B4AA 3RI4A 5LGUA 1R00A 5LHIA 4KNYA 3OOPA 4M73A 2XHKA 2HFHA 4Q5SF 5ICCA 1UFMA 4ENMA 4IRIA 5CVUA 2QVOA 5HS7A 5TRDA 3R61A 2M87A 3T8RA 2HZTA 1DPUA 2JPBA 2VE9A 2BBYA 3V7CA 3GFIA 3K1MA 2P7CB 5HDNA 3ERED 3Q9VA 1QZYA 4L5JA 4RGRA 1GXQA 2ISZA 4NQWA 4Y15A 2B0LA 4E70A 1OKRA 3HTUA 1EV7A 4AD9A 4HF0A 5ILVA 1JGSA 4NB5A 1IF1A 1FBSA 3WGHA 1O57A 2JRTA 2WTEA 5E1XA 4M9XA 3LA7A 2FEZA 3H3ZA 4KIBA 3BZ6A 4FT8A 2EV6A 1KQ8A 1G3WA 5DCFA 1XMKA 1OYIA 2ESNA 2FOKA 1QQIA 5EEGA 2A68F 2KJCA 3K0LA 2CSOA 3GF2A 5L3DA 2DFIA 3JTGA 1H0MA 4UXNA 1YW7A 3Q9SA 2PMHA 1P6RA 1IXSB 3NEUA 3GYHX 3P9IA 1HSJA 1MD0A 4KICA 1YO5C 4I2OA 3HYIA 4JBAA 5FD6A 2QQAA 1FP1D 4IHSA 1IXRC 1O7LA 1OPCA 1YIOA 3D5LA 2GZWA 4WCGA 4IVNA 2FMLA 4LG0B 3KFWX 4ZYHA 4G7HF 2FRHA 2HYGD 4UUVA 4LGWA 1R7JA 2P5LC 4A5NA 4ZYEA 4CO8A 4BHPA 1I27A 3DP7A 2F5FA 5DUIA 3E5XA 1YW8A 2EFPA 4JK1X 4YIIA 3HOSA 5H6RA 4A2UA 5JVTA 2OZUA 2RN7A 3F8MA 1BI2A 3GEZA 1TBXA 4ESJA 5KK1A 2A6HF 4ENNA 3ZMSA 1LB2A 1QPMA 2DBBA 2ZBKA 3SFZA 4Z2YA 3E6MA 4UV8A 1G6NA 4S05A 2D2WA 3HTSB 2ADUA 3HOTA 4N9IA 3HUGA 2ZNYA 5D5WB 5F6FA 3P9CA 1BI1A 1BIBA 2ZNZA 5K5QA 4ETSA 2VBWA 1YQAA 1F5TA 3KP7A 1FZPB 4HV5A 2OQGA 1FYMA 1MJAA 4YFXF 3I58A 2GXGA 3IHUA 1D8KA 4WXDA 2OD5A 4L0ZB 5FLXZ 3QU6A 2STTA 4AIJA 1E2XA 1FSHA 2MBFA 1S6LA 3TDZC 3JW4A 3VEPA 5FLXK 1LNWA 2OU2A 2XROA 1S7AA 5JR3A 3I54A 3DEUA 2M30A 4KA4A 1IN8A 1JHFA 5HDGA 3I59B 1ZH5A 4EJWA 3IKVA 4RGUA 4WF2A 2JT1A 2FXAA 4MEYF 1ZREA 2QQBA 2L54A 1DP7P 2RNJA 3KP5A 1WKMA 2FF4A 1B59A 3IKTA 3FM5A 1XGNA 3O6BB 5DD8A 1FNNA 3KETA 4HBLA 1LJ9A 3W6KB 2HTJA 3CUOA 3IRQA 1ZRDA 4PDKA 3U9GA 4M72A 1W7PA 3GVAA 3U2RA 3B02A 3M1EA 3WGIA 1Z05A 3ZPLA 2HEOA 3ML6A 4UV9A 2H6BA 2R7DA 4BAYA 1MDMA 4YIFA 2IPQX 3R0JA 4KIGA 1TLHB 2FBHA 1FPQA 2CW0F 2LNBA 5LEKA 4P55A 4EQQA 1YLFA 4RS8A 1R1UA 3T8TA 4R1HA 2DPUA 3V8KA 4CXFA 5HVQC 4M6YA 3WU1B 4AWXB 4LG0A 5CLSA 4MHGA 2V6CA 3I64A 2EV5A 1HW5A 1R5HA 2W25A 1HKSA 3ULQB 4RB2C 3EDPA 1H9TA 1KU2A 3HSFA 2ZCWA 1PP7U 3BOQA 4UHTA 4AVPA 1LDKB 3RDIA 3TO7A 4HQMA 5ERIA 2VBXA 3ZN0A 1YS7A 3F3XA 1BOAA 2W84A 3KP6A 4L0YB 3NQOA 2IA2A 1H9GA 3I71A 3J80K 3MWMA 5BQTA 2L01A 4MTDA 5H20A 3G3ZA 1ZAOA 3PQKA 4TV7A 3F6VA 2GQQA 3LQQA 3H92A 2UWMA 4LLNA 2BE5F 3GW2A 5FFXA 2NRAC 5LLQA 2NYXA 1ON2A 1FLIA 2IVMA 2GXBA 4HDUA 4M74A 1ULYA 4I98B 2VOOA 3F22A 3WGGA 1PDNC 1YTYA 1TQIA 4HF2A 5CVJA 3L00A 4IHTA 1BBYA 2M45A 1B1BA 2DK8A 2VN2A 4LB5A 2L3DA 3RIRA 4KN7X 1HQCA 1O7FA 1DDNA 3PFIA 5DEQA 2UZKA 2FMYA 2IRFG 2XGXA 2VOPA 1KYZA 1GVJA 1Z7UA 1T0FA 2O3FA 2OAZA 3BJOA 1Q1HA 4I01A 5D8LB 2HR3A 1UCRA 4HYEA 4G94A 3HRMA 3W6JB 4UVBA 1O3SA 1FYLA 1UHWA 2OA4A 4A12A 1REPC 2VC1A 2KIUA 1OYYA 2BGCA 5BS6A 1U2WA 1XCBA 1XN7A 4EM1A 3ECHA 4RB3C 4IJAA 4HA8A 2MLGA 4U0YA 2L4AA 3SZTA 1B9NA 3WU0A 1K6OA 4GO1A 3KEOA 3ZMVA 4WWCA 4PGGA 2PI0A 4LK1F 4U7DA 5ICGA 1XGSA 3QU3A 2GIVA 3M9AA 3O3KA 1ZG5A 4G7OF 2O61A 4U7BA 2KIFA 2VT2A 3GX4X 1R58A 4O6JA 2E7WA 1TNTA 3V7RA 4FX4A 1FT9A 1RNLA 5FD5A 3SHFA 3RKWA 1BI0A 2DTRA 2DO7A 5BPDA 4B09A 2C6YA 3F8NA 4R79A 3TDUC 4OIOF 2D1VA 1XCVA 4IRHA 1J5YA 3WTWC 1JHHA 3E6CC 3FMRA 2H27A 2EB7A 2XAFA 2VBZA 1E17A 3DPLC 2J5PA 5L3BA 3GXOA 1U5TC 4EVIA 1P4WA 2L02A 1OR7A 3C1DA 3F6OA 3FXQA 3LFKA 5CVIA 2YR2A 3MQ0A 3LQRA 2WV0A 2OQRA 1XB4A 2YX7A 3IWFA 4M9ZA 2XAQA 3GZ5A 1OMIA 1CF7B 4P5OA 2JTVA 1RZ4A 1S8NA 1U5TB 1W7PD 2IA1A 3MEXA 2KIMA 2EK5A 3B73A 2XAGA 1T38A 3KP3A 4CDGA 5BOXA 1S7OA 1I1SA 2AXLA 2GA1A 2OZ6A 5L3GA 2EA2A 4EM0B 3WTZA 1Z9CA 1R5GA 2PBIA 4EM2A 1W7PB 4LFUA 2QQ9A 2YU3A 3HRTA 3HHGA 5TJJA 1SD4A 3QPTA 4QWQA 3K2ZA 3L7WA 1BN5A 1W5TA 3WTYC 1J75A 2DQRA 1J7KA 2E7XA 4L9TA 5F64A 4ZZDA 1MDMB 1KQ9A 1Z6TA 1YYVA 3E5UA 4CYDA 2IA0A 3L09A 2V9VA 1QZZA 2Z9OA 3EETA 1B9MA 3RKYA 3AAFA 3WTXC 3F8BA 4RB1A 2ETHA 5D6EA 4MQ9F 1HKTA 5JHUA 3G73A 2M8EA 1V3FA 3RPQA 4IPAA 1G3TA 4I02A 3KZYA 2VC0A 4G9YA 2NNYA 4JQFA 2JPCA 3FF5A 5D6FA 3WE3A 5CJ9A 5CYVA 4LK0F 3KZZA 3V8JA 4Q47A 3FWEA 3BROA 2K7LA 1G3YA 2QBYB 1JE8A 2MD5A 3C7JA 3QRFF 1BIAA 1IW7F 2E1NA 2VE8A 4AIHA 1YFHA 5IT9Z 4GGGA 4OMZA 4ZZLA 2LDUA 4N0BA 2LKPA 1U78A 2MH9A 3TOBA 1GXPA 3NRVA 3JSPA 2X0LA 1YG2A 5D5VB 1EH8A 2Q2EA 2TDXA 4G7ZF 1K78B 1R23A 3BJAA 1P92A 3IL2A 1YW9A 2JZYA 3R0AA 3EQLF 1FY7A 2O0YA 1SMYF 5HS9A 3D0SA 1O3QA 1T98A 1P2FA 2M5WA 4BHBA 2PMUA 4ENKA 4KIFA 3LA3A 4BQAA 2XKPA 5J8CA 2DLLA 1WI9A 5LHGA 2XIGA 5K5OA 4ASNA 4K2EA 2K02A 1KYWA 2A6EF 2DAOA 1TW2A 1LVAA 3LSTA 1NHAA 2ACJA 1EH6A 3FXRA 2LF8A 3FM3A 3ELKA 3RPUA 3KP2A 2K4BA 4LJZF 3E97A 1UHMA 1XSXA 2CQKA 3ABUA 3GZ6A 3REOA 1SD6A 5E8GA 3E3VA 4B8XA 3ZP5A 4EGYA 1SFUA 1XSVA 1LEBA 3IC7A 1BJAA 3JAMZ 4A6DA 1PP8F 1TNSA 2A5YB 1CF7A 3E6BA 2QYOA 4I09A 5DDGA 2P8TA 1U5TA 4OMYA 1OYWA 4O3MA 2PN6A 1DPRA 2CG4A 3DKWA 1XSDA 3DFGA 1S29A 5ILSA 3TKYA 3HRUA 3CTAA 4HZFA 1FYKA 4HLXA 4Q48A 1QO0D 3K1NA 2K86A 2ZFWA 2ISYA 4HX7A 4L18B 4EJOA 2R3SA 4G8XA 1SFXA 3VOEA 3BWGA 4HDVA 1G4DA 1FBUA 2W57A 3WTVC 2VBYA 4A0XA 3K69A 5HLIA 4GCVA 3BY6A 1ONVA 4HOBA 1WWXA 2ESHA 5DV5A 4ZH4F 1D8JA 2VT3A 1X3UA 2HQRA 4A6EA 3CO7C 4RAYA 2QUFA 3ISPA 3SQNA 3DXJF 2PFBA 4N9HA 1FSEA 5AONA 1Y0UA 1ZHFA 1XGOA 2EA4A 4OU0A 2P4WA 4KT5C 1IN6A 3TO6A 3O2PE 1HBXG 2QBYA 3KLNA 5L3CA 4EGZA 3GLXA 1A04A 1LDDA 5LGTA 3QP5A 2KKOA 3BPVA 3QOPA 2P7VB 5DYMA 2K27A 2UXXA 4BYYA 1F1ZA 1SMTA 4XLNF 2RVCA 2FA5A 4QLCU 4L9NA 3I4PA 5LEJA 1K78A 4DQ2A 4LLGF 2DW4A 3I53A 3M7GA 2H94A 5HLGA 4RGXA 3RTRA 1G3SA 1FWZA 4LD5A 3HSEA 5D5UB 3ZMTA 2DT5A 3EYYA 3HIFA 2RDPA 2O03A 4MTEA 3VODA 5HS8A 3GO5A 2QLZA 3ZMDA 2G9WA 3T5XA 4P9UA 1P4AA 2PEXA 1MJ9A 4ESFA 2Z99A 3LAPA 3ECOA 5DCMB 2MA3A 3KE2A 5IT3A 2W24A 5EEHA 2EV0A 5JFRA 2IP2A 1R1TA 1TQPA 2FU4A 2HTSA 2V79A 2Z3YA 4P96A 3GFJA 3VB2A 4CICA 1R36A 3EUHA 2HQNA 5ICFA 5LRRA 4OIRF 2Q8KA 1IRGA 3TOAA 2QENA 4MNUA 5FO5A 5KVRA 1DUXC 3ZMZA 5FFZA 3J81Z 1RUOA 2DU9A 2K4JA 1S3JA 3DV8A 3GFLA 3FX3A 2PQ8A 4GXOA 3MZYA 3FZVA 3F21A 1UB9A 1BI3A 3J81K 1T6SA 4MGRA 2RQPA 5FB2A 3ZQ7A 1IUYA 4G6DA 1WQ2A 5CVVA 3LAJA 1EH7A 3J7AO 1ZN2A 3ZMUA 2F5CA 2QWWA 4MEXF 4XSZF 4IRGA 5K1YA 1D3YA 2NAZA 1LQ1A 4ZYDA 3M8FA 4MQVA 2ELHA 2RC4A 2XAJA 4DNCA 2MC3A 1O3RA 1XD7A 2XV4S 3SXYA 2IT0A 2Z5UA 4GYGA 5ILUA 4XSXF 1IN4A 5LBQA 2FQ3A 4CHUA 3CO6C 2R7FA 1J2XA 4A5MA 1HSTA 1HW1A 3PQJA 4ON0A 4KFCA 4HLYA 2VODA 2QM3A 4KMFA 5LHHA 2KRFA 3LWFA 3V7SA 1BM9A 1L3LA 1SFEA 1J59A 2Y75A 3F8CA 1RIOH 4GYIA 4O5VA 1J9IA 3FXUA 3Q5FA 2AS5F 1ZARA 2W85A 4EMSA 1P4XA 2G7UA 3CUQC 1KU9A 1U8RA 1ZG3A 1K79A 2HKXA 4L9JA 2Y0MA 2XKOA 2ZKZA 1W5SA 2D1HA 1TTYA 2XAHA 5BMZA 3FHZA 3TGNA 1Z6RA 1SD5A 2QZ8A 1IRFA 1ON1A 4RAZA 3KP4A 2EFWA 1I6XA 5E20A 3CUQB 4F7ZA 1QBJA 3BDDA 3T1BA 2ZXJA 3LA2A 5J8FA 1F9NA 3WTUC 4HQEA 3T0YA 1B6AA 4S04A 3R6SA 4HV6A 4U88A 1T2KA 2HWVA 4KN4X 2XVCA 1RI7A 2BYVE 2E1CA 3SZPA 4CGZA 4EJUA 2HDCA 5A2QZ 3KCCA 5DCMA 3WTTC 1FBQA 2DQLA 2HS5A 3BPXA 2V1UA 1IN7A 5DUKA 2Y48A 3P9KA 5AIPA 2HYFA 3WG9A 5E17F 1ODDA 5A2QK 1HW2A 4LLLA 2FNAA 3C3WA 2LF7A 4LMYA 5BPIA 3ROUA 4I7HA 3GWZA 3DPTA 2DK5A 1MGTA 3BJ6A 2P6TA 1MZBA 3L9FA 4L9VA 1FX7A 4A0YA 1CGPA 5IT9K 1IZ1A 1XDUA 4L5IA 2FNPA 4UVAA 1KA8A 2X4HA 4H0EA 3C18A 3F72A 4OIPF 1ZRFA 1FP2A 2Z33A 3RYPA 2WWYA 1WSUA 4OIQF 1C0WA 3HRSA 4YFKF 3IWZA 4XBFA 2VXZA 4HW0A 2EWNA 2F2EA 3R60A 3WE2A 2RV8A 4Y17A 1STZA 2A69F 1USSA 3I5UA 4Y13A 1TQMA 4A0ZA 4XRFA 6PAXA 1T39A 4BH9A 3H3UA 1YS6A 3EYIA 3QAHA 1J0RA 1QGPA 1I5ZA 1USTA 4D0PA 1AOYA 5LRSA 4HF1A 4HX8A 4RB0A 1KU7A 2PLYA 5HLHA 4WXCA 4P9FA 1Z1DA 2ZJ2A 2COMA 3F8FA 1HXDA 3TQNA 1ZGAA 3OV8A 2GA2A 3MFKA 3N97A 3MCZA 2YPRA 4PCQA 2JSCA 4UNOA 2DI3A 3IRRA 1GHCA 2RKHA 4ENJA 2STWA 1K7AA 3K1PA 4HAMA 3ABTA 2CYYA 2YSRA 2A07F 2H6CA 1AWCA 2Q0OA 4KDPA 1FC3A 1V4RA 2V1XA 3JAMK 2FBIA 4G6QA 4BXUA 2IJLA 2G7HA 2ZMEB 1HKQA 3FMQA 4WXHA 4I0BA 1PUEE 2BEOA 3JSOA 3DF8A 5H6QA 3CLOA 4ZYGA 4KMUX 1LDJA 1VTNC 2PG4A 2F5EA 1FOKA 4FX0A 3CUQA 5HDKA 3FMSA 2MLKA 1KU3A 1ZLKA 3QPHA 1ZGJA 1MKMA 3E5QA 5E1ZB 4PZJA 2BV6A 3P7NA 1LEAA 2OBPA 2O8XA 3RYRA 4YG2F 2HGCA 4KUMA 1R22A 2RGVA 4IF4A 1L0OC 3N4MA 4M9SA 2NNNA 3KEQA 4HX4A 5D5XB 4LB6B 5FGMA 2CWEA 2GAUA 3GFMA 1IXCA 3COAC 1W4MA 1O3TA 4BHCA 4BNCA 5E1WA 1MJBA 2FBKA 5D8KB 4XLPF 1I1GA 2MH2A 3DQVC 1QNTA 1JXSA 4U0WA 2FSWA 4WX9A 2XRNA 4YFNF 5F1RA 2D45A 2VONA 1U3EM 2H09A 1SAXA 3J80Z 2V1DA 5ICEA 2EFNA 3KLOA 5L3EA 4NHJA 1U6GA 3E6DA 2M1BA 3V8LA 2P5KA 4OINF 3V4GA 2FE3A 4UVCA 2CGPA 3HSRA 1ZRCA 2EJRA 2CFXA 3BP8A 4M71A 4FHTA 4R8HA 4EJVA 2P5VA 5ED4A 1XMAA 4EV0A 2IW5A 5HOOA 3GUDA 3M8EA 5DD4A 3CDHA 4M6XA 1ZLJA 4CZZA 1WRJA 1R1VA 4I0AA 3WODF 4RGSA 2PJPA 2NS0A 3U1DA 1ZG1A 1RUNA 5CVRA 5JI6A 2EFQA 4OOIA 4EJTA 2EFOA 3CJNA 2HKOA 3F23A 1D5VA 4PGHA
chains in the Genus database with same CATH superfamily
4HNUA 2WC2A 3QP6A 1XGMA 3VFZA 4YEJA 2LKXA 3JTHA 1BC7C 3AFHA 2KLOA 4U0VA 1D0XA 1RESA 3M8JA 1ETYA 4XRMA 2KJBA 3ZN1A 1KGSA 2F4OB 2P6SA 2E36A 2NS8A 5K5RA 3R4KA 4E7SA 2J5OA 3PM1A 2QA4I 3Q0WA 2XUBA 1KQ0A 2A3SA 1PUFB 3TO9A 1WZ2A 4D1QA 1IRZA 2DYRH 1ORKA 4KYWA 1BC8C 1FJLA 1TP4A 2A61A 2YX4A 2RREA 2TCTA 1TW3A 4BY7J 4Q4ZF 3I59A 2XF7A 3BTCA 3RKXA 5L3FA 2I10A 3GTPJ 1BA5A 3MAJA 5AIQA 3MZHA 1XDSA 2ZMEA 2QEXI 4V2GA 3I0TA 3WTSC 2CO5A 2DJIA 5B1BH 2DPDA 1IN5A 3L2CA 4WK8F 3S2HJ 3CDIA 3QPLA 5D4SA 1QVTA 3HHHA 4BDYA 2L4MA 3MVPA 4D5FA 2UXNA 2QKLB 1YJNI 1Z3XA 2F5DA 3HUGB 2L2OA 4AIKA 1G2HA 1Z91A 1TWCJ 3K9TA 5LGNA 3RJPA 1SD7A 1X1PA 2YS9A 3IH4A 2O6GE 2VL8A 1F4KA 3OYNA 2VJ4A 1HLVA 2ZO4A 2HOEA 4XN3A 2GWRA 1IAWA 4IXAA 2LSOA 1V5EA 1YHQI 2NXNB 2XASA 3PJRA 5D4RA 5E8IA 3MKWB 3CLQA 5E18F 3OS0A 4C9YA 4FTHA 3L2VA 1ZYRF 2LBFB 3S2WA 1H8AC 4ESBA 5J6XA 1B4AA 1KONA 2K40A 3RI4A 2KL4A 3K4BA 5LGUA 1R00A 1ZTRA 5GP9A 5LHIA 1LE8B 5EZGA 4KNYA 3OOPA 2JA8J 3ABMH 4M73A 2LREA 2XHKA 2HFHA 3RCOA 3JRDA 2B9SA 1SVLA 2E2HJ 2BW3A 4Q5SF 3JRGA 1QZEA 5ICCA 3LNQA 1UFMA 4CYCB 2XC7A 1RC9A 2LY1A 2WY8Q 4ENMA 4IRIA 5B5EC 2JA6J 2ZJRF 4LOCA 2R93J 4CCKA 5CVUA 1BR2A 2QVOA 4U87A 2VKHA 3K6GA 1JJ6C 3VYRB 5HS7A 5TRDA 3R61A 1QHHD 2M87A 3K10A 3T8RA 2HZTA 3OIQA 5KCMA 2HQ5A 1DPUA 3ERMA 2JPBA 3RKQA 2VE9A 2OUMA 5EZHA 2BBYA 3V7CA 4PSXA 2X6XA 1HF0A 3GFIA 1X1BA 3K1MA 4W97A 2P7CB 5HDNA 4BUPA 1R4MB 3ERED 1HDDC 3Q9VA 3DTKA 3W3CA 1QZYA 4L5JA 1VFCA 4BEHB 2M4KA 4RGRA 1GXQA 3GTJJ 4G6TB 4XN0A 2ISZA 2BY1A 4NQWA 2PMZN 4UUTA 1FOYA 3S3MA 4Y15A 2B0LA 2JA5J 4E70A 4NNJA 2W4SA 1OKRA 1CQTA 3H9QA 4DYRA 2LC2A 3HTUA 4PJJA 3KYLA 3JRBA 2QSGX 1EV7A 3CQZJ 4A69C 5H2FC 2BY0A 4AD9A 3L1PA 2R4GA 5E3LA 4HF0A 3Q0VA 3CZ6A 5ILVA 5FKOA 5CKTA 1JGSA 4NB5A 1IF1A 4X6AJ 1FBSA 3WGHA 4A3LJ 1O57A 2HYJA 2JRTA 2WTEA 4XLFA 5E1XA 4M9XA 2ZXWH 1MH3A 3LA7A 2FEZA 3H3ZA 1U9NA 4KIBA 4RAFA 1HA8A 5JLWA 3BZ6A 2EINH 4FT8A 3BCAA 2EV6A 3I9V2 3CF5F 4C30A 2DT7B 2KT0A 3OY9A 1KQ8A 1WJAA 1OCCH 1G3WA 1WJEA 1GDTA 5DCFA 1XMKA 1VQPI 1AKHA 1OYIA 2ESNA 2FOKA 1QQIA 3S1MJ 4XKVA 5EEGA 2QCOA 1GUUA 2VQGA 2A68F 2HOAA 4N4OB 2KJCA 5J4YA 1X19A 3K0LA 2CSOA 3GF2A 3DKXA 2EZIA 3HGGA 1TZLA 2R5ZB 5L3DA 2DFIA 4ZC3A 3JTGA 1H0MA 2RAEA 5FRNA 3MN2A 4II3A 1OJLA 2QSFX 4UXNA 1YW7A 3Q9SA 2HNHA 2PMHA 1P6RA 1IXSB 3NEUA 3GYHX 3P9IA 1HSJA 1MD0A 2KZVA 4KICA 1YO5C 2VPLA 2Q1ZB 3H5RA 2G0EA 1Z21A 4I2OA 3HYIA 4JBAA 5FD6A 4PFOA 2QQAA 1J09A 1FP1D 4B47A 5HNHA 4IHSA 1IXRC 1O7LA 1OPCA 1YIOA 2HOTA 3D5LA 1IGNA 2R7XA 2GZWA 4WCGA 3GTKJ 4IVNA 3K2AA 2CUZA 2FMLA 4LG0B 3KFWX 4ZYHA 4G7HF 2DMUA 2FRHA 2HYGD 2X48A 2XDVA 4M6VA 4UUVA 2V9KA 4LGWA 2LMDA 1R7JA 2P5LC 3DTIA 1VQMI 4M3DA 1TT5B 4A5NA 4ZYEA 4CO8A 2JA2A 4BHPA 1I27A 1K61A 3UR3C 4DZPA 1X1AA 3DP7A 2F5FA 1EJ9A 4X0GA 5DUIA 2KRHA 3E5XA 2BY2A 4V2FA 1YW8A 2EFPA 4JK1X 4YIIA 3HOSA 2VLAA 2BVLA 3PO3J 3LSKA 2EZLA 2FUG2 1WPKA 5H6RA 4D9JA 1X2MA 2KDZA 4A2UA 1OCTC 5JVTA 3LSRA 3TW6A 2OZUA 2RN7A 3F8MA 3GCMA 1BI2A 3K70D 3GEZA 1TBXA 4N4NB 4ESJA 5KK1A 2A6HF 2MYSA 4ENNA 2Y0SN 1WJ5A 1R6RA 3PNYA 3ZMSA 3HOVJ 2L9RA 1LB2A 3NWTA 2CS3A 1QPMA 2DBBA 2M2EA 2ZBKA 4Z2YA 3SFZA 2P0WA 3E6MA 2H8WA 1VQ8I 4UV8A 3FKIJ 1AHDP 1G6NA 3HBLA 4S05A 2NVTJ 1YJ9I 1A35A 4Y3OA 2V6EA 2D2WA 3WHBA 3HTSB 1R5ID 2ADUA 3BTJA 3HOTA 2Y9ZA 3I4NJ 3U21A 4IL6C 4N9IA 4IZZA 1F43A 2ZJQF 3HUGA 4BE0A 2HVRA 2ZNYA 5D5WB 5F6FA 3P9CA 3CMEI 1BI1A 5E3OA 1BIBA 2CH0A 2ZNZA 1T0FC 1NG7A 2DYSH 1Y8RB 5K5QA 2JRMA 4ETSA 2VBWA 1YQAA 1F5TA 3BG7A 3KP7A 3OYKA 1FZPB 4HV5A 2OQGA 4ITVA 2KHMA 1GVDA 1MJAA 1JUPA 4XONA 4YFXF 1FYMA 2MFZA 2LBFA 3I58A 2GXGA 3L2UA 2PJRA 3IHUA 1D8KA 4WXDA 2OD5A 3VYSB 1TL8A 4L0ZB 1IV8A 2A5WA 5FLXZ 2ELKA 3QU6A 5HLTA 1U8BA 1LFPA 2STTA 3H9JA 3HOUJ 1MNDA 1VQ7I 3Q0UA 1MBGA 4AIJA 2K3PA 2DOAA 5EDNA 3G1LA 5FROA 1E2XA 1FSHA 2MBFA 5GTIC 1S6LA 1SVMA 1A31A 3S1QJ 3TDZC 1VQ9I 1B72A 3JW4A 2AXTC 3TEDA 1FTZA 3VEPA 5FLXK 1LNWA 3DWLE 4YELA 2OU2A 2XROA 4Y4RA 1S7AA 3QYFA 5JR3A 3I54A 3DEUA 2NVYJ 1LFBA 4BXFA 2E19A 1UMQA 3FXLA 3QQAA 2M30A 2VQLA 2VKEA 3DPUA 2VQHA 3L2RA 4KA4A 1OLTA 2E1OA 3LSJA 1IN8A 4A3EJ 2R7RA 5E3NA 1JHFA 5HDGA 1NK2P 2R7ZJ 1OCOH 1QVUA 3I59B 1ZH5A 1Y56A 3E7LA 4EJWA 3IKVA 4RGUA 4WF2A 2JT1A 2FXAA 1MMSA 4B4CA 4PJ0C 3PO2J 2KDOA 4MFDA 4MEYF 2M7AA 4XLHA 3JRCA 1ZREA 2QQBA 2L54A 2BZTA 1DP7P 2RNJA 3KP5A 5M5YJ 1X1CA 1WKMA 2FF4A 1B59A 3IKTA 3HEFA 2LY9A 3FM5A 1R49A 2LLKA 4D7NA 1XGNA 2MC4A 2EZKA 3H5NA 3O6BB 5DD8A 3JRIA 1FNNA 3KETA 2DOFA 2D5VA 3G1MA 1A6IA 4HBLA 1LJ9A 4PSWA 2E60A 2F48A 3W6KB 3CC4I 2HTJA 4BY1J 2XGEA 3CUOA 1JJ8C 5IYBJ 5GADJ 3DBLB 3IRQA 1ZRDA 4PDKA 3U9GA 4M72A 4H4KC 4BQQA 1W7PA 2AQFA 2XPVA 1LPQA 2Y31A 4MIMA 2VKDA 1DGWY 3TP3A 2W00A 3GVAA 3U2RA 1OR7C 3O8GA 3B02A 4J00A 3M1EA 1ZK8A 3WGIA 3JR9A 3OIOA 1Z05A 3ZPLA 2HEOA 4XKWA 1I3QJ 3ML6A 4UV9A 2H6BA 2BW3B 2R7DA 4BAYA 1MDMA 4C3IJ 2KPMA 1XPXA 1T56A 1Z3YA 4YIFA 4XICA 2IPQX 3DU6A 2M4GA 3R0JA 4KIGA 2IGKA 1TLHB 1WJDA 2FBHA 3PFYA 1FPQA 3ABLH 3CMAI 2CW0F 3B6CA 2L9VA 2LNBA 4IOAF 1W5CC 1K4SA 5LEKA 1LFUP 3ZQIA 5K7HA 4P55A 4EQQA 3CP2A 2GIZA 4CA0A 1YLFA 3GTLJ 4RS8A 1N75A 1R1UA 5GAEJ 2IS6A 3PUBA 3T8TA 3G6EI 4R1HA 2DPUA 2Z16A 1JT6A 4AIDA 3V8KA 4CXFA 1FMWA 1WVRA 2KRCA 5B66C 5HVQC 4MLOA 4M6YA 5KHDA 3WU1B 1E3OC 4AWXB 2M9HA 3TP0A 4LG0A 5CLSA 4MHGA 2V6CA 2CV2A 3GTGJ 3IH3A 3OYFA 1JI8A 3I64A 3BR1A 2EV5A 4A3GJ 2L5QA 1HW5A 3A4CA 1R5HA 2W25A 1Z7LA 4XR6A 4JX4A 1HKSA 2F5VA 3ULQB 5TGTA 4RB2C 3CJQB 3EDPA 4BQOA 1KU2A 1H9TA 1QA6A 3HM5A 2ZCWA 3HSFA 3BOQA 1VQOI 2KZGA 4UHTA 4AVPA 1LDKB 5B1AH 2A05A 1PP7U 3RDIA 3TO7A 3HKZA 4HQMA 5ERIA 2VBXA 3ZN0A 1POGA 1YS7A 3ZOBA 1T8IA 3F3XA 3LMMA 1BOAA 2W84A 3KP6A 2X1EA 4L0YB 4E7HA 3H0GJ 3NQOA 4DYQA 1I39A 2IA2A 1H9GA 3I71A 2O5RA 3J80K 3C2GA 5J1RA 3MWMA 5BQTA 2L01A 4MTDA 4PJNA 3H35A 4XKBA 2DDAA 3FDYA 3G3ZA 5H20A 4FE4A 1ZAOA 4RLFA 3PQKA 2IGNA 1V5GA 1RKTA 1Y0NA 4TV7A 3RZDJ 3J7YJ 3F6VA 2GQQA 2ZSHB 2VQCA 3LOCA 3HC7A 3LQQA 3H92A 3P5JA 2UWMA 2LOOA 4LLNA 2BE5F 3GW2A 2AO9A 5FFXA 3OL4A 2NRAC 5LLQA 3ZQLA 2NYXA 1ON2A 1FLIA 2IVMA 2GXBA 4HDUA 1OCRH 4M74A 2L7ZA 1ULYA 1VQ5I 4I98B 2VOOA 3F22A 3WGGA 1PDNC 2QSHX 4GFBA 2XB5A 1VF9A 1YTYA 1TQIA 4CCLA 4HF2A 5CVJA 3L00A 4IHTA 1X58A 1BBYA 2M45A 1B1BA 4OAZA 2DK8A 2ELJA 2Y69H 1GV2A 4IHVA 2VN2A 1A6QA 4LB5A 2L3DA 1BOBA 5F0FA 4BBRJ 4RA2A 4J19A 4BL0B 3RIRA 2NS7A 2WA0A 4KN7X 3GTMJ 2ZXHA 1HQCA 1O7FA 1SFOJ 1DDNA 1R4NB 3PFIA 5DEQA 2FMYA 2UZKA 2IRFG 1QU3A 2XGXA 2VOPA 5LD2C 1KYZA 2VJIA 1GVJA 4PJLA 1Z7UA 2RQQA 1T0FA 2O3FA 2OAZA 3BJOA 1Q1HA 4I01A 2CQXA 4W1UA 3OYCA 5D8LB 2HR3A 1UCRA 3GMEA 4HYEA 4G94A 4JOMA 3HRMA 4RBOA 1QHGA 3W6JB 3SDGA 3CMMA 4UVBA 4B3XA 1O3SA 2W1OA 2HQAA 1FYLA 1UHWA 2OA4A 4XOPA 4A12A 1REPC 2VC1A 2KIUA 4NC8A 2LH9A 2LFBA 2IEKA 1OYYA 2BGCA 2JQ7A 3W2WA 5BS6A 3WHCA 5GPCA 4B44A 1U2WA 1XCBA 4IOCF 1XN7A 5IYDJ 4EM1A 3ECHA 3A02A 2OCEA 4RB3C 3KZIC 4HA8A 4IJAA 2MLGA 4U0YA 2L4AA 3SZTA 1B9NA 2NVXJ 3WU0A 3KEYA 2CW8A 1K6OA 4GO1A 3KEOA 3ZMVA 2I8DA 4LG3A 2EIJH 2K9QA 4WWCA 4PGGA 1XX5A 2E71A 2PI0A 4LK1F 4U7DA 4PFPA 5ICGA 3PIPF 2DDBA 4XLEA 2LVSA 3OYDA 1JTXA 1XGSA 3QU3A 4JYKA 5EG0A 2GIVA 3M9AA 4LIVA 3AG3H 4A3IJ 3O3KA 1ZG5A 2VJJA 4G7OF 2O61A 4XKCA 3S32A 4U7BA 2KIFA 2VT2A 3GX4X 1R58A 4O6JA 1I6HJ 2CV1A 2E7WA 4LITA 2KQRA 5JLXA 5F27A 2ZSIB 1TNTA 3PL8A 3V7RA 4BS9A 4FX4A 5GAGJ 3OSGA 1FT9A 1RNLA 5FD5A 3SHFA 4JX5A 1OCZH 3RKWA 2PJRB 1BI0A 1JKOC 2DTRA 2DO7A 5BPDA 3DEWA 3LSGA 4B09A 5EEAA 3NWSA 2JVGA 2C6YA 3F8NA 4R79A 3TDUC 2NOGA 1W0UA 4OIOF 1TWGJ 5GTHC 2D1VA 1XCVA 4IRHA 1J5YA 4KITB 3WTWC 1JHHA 5FJ8J 3E6CC 4IX7A 3FMRA 4ZTFA 2H27A 4BE1A 5F0CA 2EB7A 4FCYA 4D5CA 1B72B 2XAFA 2VBZA 1E17A 3DPLC 2J5PA 1PVEA 4AYBA 2OCCH 5L3BA 2EQRA 3GXOA 1U5TC 2KFDA 1YIJI 2XB0X 2TRTA 4EVIA 2KP6A 1P4WA 2L02A 4ZJZA 1OR7A 3C1DA 3F6OA 1X3ZB 4DJAA 3FXQA 1IUFA 3LFKA 3QOEA 5CVIA 4KT6A 2YR2A 3CC7I 3MQ0A 3LQRA 2WV0A 2OQRA 4HEA2 1SAUA 1MMNA 4ANJA 1XB4A 2YX7A 3IWFA 4M9ZA 1V5FA 2GOXB 2XAQA 3GZ5A 1JTYA 1WGXA 2ZXIA 2X6WA 1OMIA 1CF7B 3CCQI 4P5OA 1RR8C 2JTVA 1RZ4A 1S8NA 3M4OJ 2M8GX 2DXIA 3D5RC 1YITI 1U5TB 1W7PD 2XAUA 2IA1A 2B63J 3MEXA 3MMYB 2EIKH 2KIMA 2OTLI 3SFIA 2EK5A 3B73A 2HI3A 2XAGA 1T38A 3KP3A 4CDGA 5BOXA 1S7OA 2BVMA 4RAGA 1I1SA 2JSPA 2AXLA 2GA1A 2OZ6A 3UKGA 3DCFA 5L3GA 2EA2A 4EM0B 1BW5A 2M0MA 3WTZA 1XTAA 1Z9CA 4CUGA 2LTPA 1T33A 1Z0XA 1R5GA 2DMNA 2PBIA 4EM2A 1W7PB 4LFUA 3HL2A 2QQ9A 2WADA 2YU3A 3HRTA 1JKRC 3HHGA 3CDLA 2NOJB 5TJJA 1SD4A 3QPTA 5IP7J 1K6YA 4QWQA 1TT0A 3K2ZA 3L7WA 1BN5A 1W5TA 3WTYC 2L0KA 4BQNA 1J75A 2DQRA 1JKPC 3I56I 2K3FA 4BXXJ 1J7KA 2E7XA 3N05A 4L9TA 5F64A 3F9KA 4RM2A 1U0JA 3C2BA 5IOZA 3AG1H 4ZZDA 1MDMB 2OPTA 3W2VA 1QPIA 4P1WA 2IS1A 3WG7H 3TMOA 1KQ9A 1WJFA 3BZCA 3LSPA 1Z6TA 1R71A 1YYVA 2XF6A 3GTQJ 3E5UA 1KZHA 1N25A 4CYDA 2CW7A 2IA0A 3L09A 5IPAA 2V9VA 1QZZA 2Z9OA 3EETA 1B9MA 2ME0A 3RKYA 3OYJA 3CP8A 4CCOA 3HKZN 3AAFA 5FKMA 2XF5A 3SEQA 3WTXC 3F8BA 1DQUA 4RB1A 2ETHA 1BW6A 1N78A 1FMVA 5D6EA 2X85A 4Z6YA 3S3NA 3BTLA 4FASD 4DGWB 4MQ9F 1HKTA 3TW7A 5JHUA 3G73A 1DP3A 2M8EA 1V3FA 3RPQA 4D7MA 4IPAA 4F92B 1G3TA 3ZGKA 4UY8I 4I02A 3KZYA 2VC0A 4G9YA 1UJ8A 5B3SH 2NNYA 4JQFA 2JPCA 1D1AA 3FF5A 2JA7J 3DU5A 5D6FA 3WE3A 5CJ9A 5CYVA 4LK0F 3KZZA 3V8JA 4Q47A 3FWEA 3BROA 3LL7A 3H3VK 2K7LA 3E1SA 3ZQGA 1G3YA 2QBYB 1JE8A 4UB8C 4JP0A 3AG2H 1JKQC 1Z77A 2MD5A 3C7JA 4JX6A 2HPMA 5F08A 3QRFF 1BIAA 1ETQA 1IW7F 3CESA 2E1NA 2HXOA 3CCMI 2VE8A 4AIHA 1YFHA 5IT9Z 2E35A 4GGGA 5EGOA 1NK3P 4OMZA 1W36C 4ZZLA 4XIDA 2LDUA 4N0BA 1AU7A 2LKPA 1B8IB 3TBIA 4C3JJ 2P81A 2L9NA 1U78A 2MH9A 3TOBA 1GXPA 3NRVA 3JSPA 2X0LA 1YG2A 4CZCA 5D5VB 1EH8A 2Q2EA 2AQEA 2TDXA 4G7ZF 2ME6A 1ITYA 1K78B 3ASNH 1R23A 3BJAA 2HDWA 1W1WE 1P92A 3IL2A 1YW9A 2JZYA 3R0AA 3EQLF 1VZ0A 1FY7A 1MMAA 2O0YA 3S16J 1SMYF 5HS9A 3J7AY 2BOLA 3U1KA 4XL9A 3D0SA 2MW8A 1XC5A 1O3QA 1T98A 5IYCJ 1P2FA 2M5WA 1D5YA 4BHBA 2PMUA 4ENKA 1OQYA 2GOMA 4KIFA 3LA3A 4BQAA 3EUHC 2XKPA 1WH5A 2DN0A 2CQ7A 5J8CA 2DLLA 1WI9A 5LHGA 4QTRA 4HSTA 2XIGA 4G12A 5DM6F 3CCRI 4E6KG 1PJRA 3EUKL 4ASNA 5K5OA 2YUSA 4K2EA 2K02A 1KYWA 1ENHA 2A6EF 2OC6A 3RQIA 2HVSA 2DAOA 4XORA 2ICWG 1S7EA 1BL0A 1TW2A 1LVAA 3LSTA 3F0CA 3OYGA 3ZRGA 1NHAA 2ACJA 1FOXA 1EH6A 3O8HA 3FXRA 3JRAA 3OYBA 2LF8A 1S9HA 3PSFA 2FJ1A 1FTTA 3FM3A 3NAUA 3ELKA 1FEXA 3RPUA 3KP2A 2K4BA 4LJZF 3E97A 3HZJA 1UHMA 1XSXA 2CQKA 2R7SA 3ABUA 3GZ6A 4C2TA 2DODA 3REOA 2JK3A 4ZYAA 1SD6A 2HVQA 4RMNA 1MMGA 5E8GA 3E3VA 3BC8A 4IEJA 4B8XA 2LRDA 2JMWA 3D5SC 3ZP5A 4DIQA 4DZJA 4IQJA 4EGYA 1SFUA 1XSVA 1MMDA 2ZC2A 3D1NI 1LEBA 1VQ4I 3IC7A 1ETKA 4FQGA 1BJAA 3JAMZ 5E79C 4A6DA 1SANA 1TNSA 1PP8F 2A5YB 4NC6A 1CF7A 2HXIA 3E6BA 2QYOA 4I09A 2KMUA 2Z1DA 5DDGA 2P8TA 4IHXA 1U5TA 2XGDA 3FXJA 4OMYA 1YX5A 1OYWA 3BG3A 5EG0B 1RRJA 4O3MA 4Y52J 2PN6A 1DPRA 1WJBA 2WB1A 4BACA 2CG4A 2F6CA 2MGQA 3DKWA 1XSDA 5DS9A 3DFGA 1S29A 5ILSA 3TKYA 3K4LA 3HRUA 3OOUA 4AU7A 2MABA 1OFCX 2IXSA 3IV5A 4I76A 3CTAA 4HZFA 1FYKA 4HLXA 1Y39A 4Q48A 1QO0D 2YU9J 3K1NA 4F55A 2K86A 2ZFWA 2ISYA 3MKLA 4HX7A 4L18B 1IO2A 1BJZA 4EJOA 2R3SA 2K9LA 1YRNB 4QPQA 2R92J 4G8XA 1SFXA 4XRSG 3S1NJ 1MH4A 3VOEA 3BWGA 2FOWA 2EBIA 4A3BJ 3OS2A 4HDVA 1XS9A 1G4DA 1FBUA 2W57A 3WTVC 2VBYA 4A0XA 3K69A 5EYRA 3AL0C 4CCNA 5HLIA 2CRGA 4GCVA 3BY6A 5IP6A 1ONVA 4HOBA 3SJMA 1WWXA 2ESHA 5DV5A 3RZOJ 2EZHA 2R7QA 1XG1A 4ZH4F 3QPSA 4Y33A 1D8JA 2XSJC 2K85A 1MBJA 1WJCA 4CCMA 2VT3A 3I4MJ 1ETOA 1X3UA 4E7IA 3FXOA 2HQRA 4A6EA 3HOXJ 1K4TA 1ZGWA 3FBIB 2DMTA 3CO7C 4AM3A 4RAYA 4A3KJ 2V26A 1VQNI 3CD6I 2DA3A 2IS4A 2QUFA 2XPWA 3ISPA 3SQNA 3AL0B 3FISA 3DXJF 2PFBA 3I55I 1ETXA 4N9HA 1FSEA 5AONA 3BCBA 3RQ4A 4J01A 1Y0UA 1ZHFA 1XGOA 2EA4A 3EUAA 4OU0A 2P4WA 4BKXA 4KT5C 1D0YA 3B6AA 4BU2A 5KAIC 1IN6A 2DA2A 3O2PE 3TO6A 3OYIA 2K9SA 1HBXG 1K83J 2RNGA 2QBYA 3KLNA 2LP0A 5L3CA 2EPFA 4E7JA 3CCYA 2CFOA 1WI3A 4CCJA 2N8GA 4EGZA 3GLXA 1A04A 1LDDA 5LGTA 3DBRB 3QP5A 5GPAA 2KKOA 3BPVA 3OYLA 1XMXA 3H5AA 3QOPA 2P7VB 1B8IA 1YE9A 2JWTA 1VI0A 2E2JJ 5DYMA 2K27A 2UXXA 2DA5A 4B1RA 4BYYA 5EF6A 2L7FP 1F1ZA 1T08B 1SMTA 3BR3A 4XLNF 1D1CA 3G71I 1ERDA 2RVCA 4UB6C 3BZKA 1MSEC 2LY2A 2FA5A 4QLCU 1LUJB 4L9NA 1P9QC 3I4PA 4BGDA 5LEJA 1K78A 4DQ2A 4EEFG 4LLGF 3BG5A 2DW4A 3I53A 3KPHA 2OF7A 4M3GA 2BY3A 1ZELA 2WBMA 2H94A 3M7GA 5HLGA 4RGXA 3RTRA 1H89C 1G3SA 4NUBA 4KJZA 1FWZA 4LD5A 3HSEA 3VYTB 2DFHA 3ZMTA 5D5UB 3OS1A 3VSLA 2DT5A 3EYYA 3HXLA 3HIFA 2QKMB 2RDPA 1EA3A 3BQZA 3SZGA 2L7KA 2O03A 3CCJI 4MTEA 3FK6A 1V55H 3VODA 4YRVA 2UV1A 1P7IA 5HS8A 3GO5A 3MD2A 4S0HB 4DYCA 2F4MB 2QLZA 3CJRB 3VWBA 3ZMDA 1MSFC 3JCUC 3QYEA 2DA7A 2G9WA 2WV1A 3T5XA 1A5JA 2W48A 4P9UA 1P4AA 4C3HJ 4A3MJ 2PEXA 2LG4A 1MJ9A 2VPRA 4CH7A 3CCEI 1RETA 4ESFA 2Z99A 3LAPA 4EATA 2R5YB 3ECOA 2K9NA 5DCMB 1QRYA 2MA3A 3KE2A 5CQGA 2W24A 5EEHA 5IT3A 1FIAA 2EV0A 2IP2A 5CQEA 5JFRA 1R1TA 2JVHA 5F1JA 4I6ZA 1TQPA 2FU4A 1S72I 2HTSA 2V79A 3DLAA 2Z3YA 2LYCA 4P96A 3GFJA 3ZXSA 3VB2A 2VJ5A 2Y0SA 4F91B 4CICA 3JRFA 4IHWA 2CUJA 1R36A 5F0HA 3EUHA 2M0CA 2HQNA 2ZB9A 3QWLA 1MNEA 5ICFA 3FHNA 5LRRA 4OIRF 2Q8KA 3S93A 3BTIA 4ZDPA 1IRGA 3A01A 1EKEA 3TOAA 4BJTA 4UUSB 2QENA 1ACIA 2PX9A 2R7TA 2BHYA 4MNUA 5EGOB 5FO5A 5KVRA 1DUXC 3ZMZA 5BNGA 5FFZA 3WU2C 3J81Z 1RUOA 2DU9A 2K4JA 1S3JA 2WY7Q 3DV8A 1X1DA 1Z67A 3GFLA 3QYBA 1MBKA 1GLNA 3FX3A 3S8PA 2PQ8A 3IAS2 4GXOA 4M3BA 2Q2EB 2WAQA 2QQ8A 3MZYA 3FZVA 1TWAJ 5FLMJ 3F21A 1UB9A 3IH2A 2H1LA 3OYMA 1BI3A 3ASOH 3J81K 1T6SA 4MGRA 2RQPA 3DBHB 5FB2A 2R7WA 2I5UA 2ID6A 1F36A 3ZQ7A 1IUYA 4G6DA 1WQ2A 2A6TA 4OWRB 5CVVA 1EH7A 2LKSA 3LAJA 1ZN2A 3J7AO 3ZMUA 2F5CA 2QWWA 2OJED 5IP9J 4A3JJ 3GTOJ 4MEXF 3HGYA 3OWTA 3G4SI 5GAHJ 4XSZF 4IRGA 3H1CA 3ZQQA 4HRIA 5K1YA 3BR2A 1D3YA 1RKWA 3ZQFA 2NAZA 3FIWA 1LQ1A 4GRIA 3Q3SA 4M3FA 4ZDLA 1IC8A 1DU0A 4ZYDA 3RPUD 3M8FA 4MQVA 2ELHA 2Y2ZA 4E7ZA 2RC4A 2XAJA 4DNCA 2MC3A 1O3RA 3V42A 3BG6A 2Y9YA 4YIRX 1XD7A 3CCVI 1YRNA 4F52A 3MZ8A 2XV4S 3ONQA 3SXYA 5M3MJ 2R7VA 5C44J 2IT0A 4I99C 3JREA 1UELB 2Z5UA 4GYGA 1APLC 3LSIA 5ILUA 3BT9A 5E3MA 4XSXF 2Z2SB 5HODA 1IN4A 4XRSA 5LBQA 2FQ3A 2ZFUA 4CHUA 1G8XA 2WB1N 2H1KA 2H8RA 3CO6C 1TWHJ 2R7FA 4QSHA 1J2XA 2X6OA 3BG9A 4A5MA 5M5XJ 4GDFA 1HSTA 1HW1A 3PQJA 4ON0A 4KFCA 2OTJI 4II2A 4HLYA 3ZQCA 2VODA 2QM3A 5FLVA 4KMFA 3IAM2 5LHHA 2KRFA 2GBYA 3BR6A 3LWFA 3V7SA 1BM9A 1L3LA 1SFEA 3FXKA 1J59A 1X4OA 2M34A 2Y75A 3F8CA 3S14J 1RIOH 1IRXA 1OCPA 2R7OA 1IDYA 4GYIA 2DMQA 4O5VA 1J9IA 3FXUA 3Q5FA 5FRMA 2X9DA 1TWFJ 2AS5F 4L5EA 5FKNA 1ZARA 2E1MC 2W85A 1DGRM 1SEUA 4CSWA 4EMSA 1P4XA 2EILH 2G7UA 3CUQC 1KU9A 3LSMA 1ZG3A 4FISA 5JVGF 1U8RA 1K79A 2HKXA 2BXZA 1E3HA 3VDXA 2DMPA 3K4NA 2Y0MA 4L9JA 2XKOA 5J47A 4PK4A 4PUSA 1SC7A 3OR1C 2CJJA 2ZKZA 1W5SA 2D1HA 2XPUA 1X2NA 1TTYA 2XAHA 1BR1A 5BMZA 2MSYA 3FHZA 3TGNA 1ETWA 1Z6RA 3GBGA 4DOZA 3GLLA 3HG9A 2DT6A 3K4CA 1SD5A 2QZ8A 4BJ5C 1O4XA 4DBQA 2GLOA 4HG2A 1IRFA 1ON1A 5M5WJ 4RAZA 2E1MB 3KP4A 3DEEA 2EFWA 1H88C 3EPZA 1I6XA 1RPWA 5E20A 4IHYA 1D1BA 3CUQB 4F7ZA 1QBJA 2AHQA 3BDDA 3T1BA 1FIPA 3QODA 2ZXJA 1G59A 1YX3A 2V7FA 2M7BA 5FKKA 3OYEA 3LA2A 1NG6A 5J8FA 4E7LA 2IGOA 4A3FJ 4X1EA 3KX2A 5J1YA 5DTDA 1F9NA 1R9TJ 2BXYA 1YOVB 4B3AA 3WTUC 4HQEA 4E4HA 3A03A 3T0YA 1B6AA 4S04A 3HOYJ 3R6SA 2E5ZA 2R0QC 4HV6A 2VIXA 4U88A 1T2KA 2HWVA 3H0DA 4KN4X 2XVCA 1RI7A 5K7ZA 2BYVE 2CU7A 2E1CA 4PJMA 3SZPA 3UNGC 4CGZA 4AUXA 2VI6A 4EJUA 2CV0A 2HDCA 2XSDC 2R5YA 5A2QZ 1UHSA 3KCCA 3FBNB 5DCMA 1ZKGA 3WTTC 1WH7A 2ID3A 4F93B 1FBQA 2DQLA 1WCMJ 2HS5A 3K4KA 2VB6A 1DU6A 1UG2A 3BPXA 2V1UA 1IN7A 2DTZA 5DUKA 3OIPA 1VQKI 2Y48A 1JGGA 5KAFC 3BR0A 3S3OA 3P9KA 2JUGA 3HPGA 5AIPA 2HYFA 3WG9A 4HPQA 5E17F 3HOZJ 5CPRB 5LFAA 1ODDA 5A2QK 1HW2A 4LLLA 1W0TA 2DA4A 3ZCOA 3KYCB 2FNAA 4UUSA 3C3WA 4RLQA 3HOWJ 5J1UA 5IOYA 2LF7A 2E5NA 4LMYA 5BPIA 3ROUA 1ZR2A 4ZDOA 4I7HA 3PUFA 3GWZA 3DPTA 2DK5A 1MGTA 3MKZA 3ESWB 2V1NA 1W36D 3BJ6A 2EH3A 2P6TA 3SDBA 3K70C 1MZBA 3L9FA 4L9VA 1FX7A 2XRLA 3IUOA 4XK4A 2M3AA 4A0YA 1CGPA 1PUFA 5IT9K 4HNTA 3OL3A 1IZ1A 1XDUA 3G2BA 4Y7NJ 1N77A 4L5IA 2COBA 4XM3A 2FNPA 1NH3A 4HSRA 4UVAA 1RR7A 1KA8A 2X4HA 4M3EA 2MD0A 3C18A 4H0EA 3KYDB 3F72A 3AG4H 4XLCA 2X1CA 4OIPF 1ZRFA 4NDLA 1FP2A 2Z33A 1IDZA 2KIQA 3M07A 3RYPA 2DFFA 2WWYA 4XNFA 3OSFA 4BJ6C 1WSUA 4OIQF 1C0WA 3HRSA 3SYTA 4YFKF 1S5LC 2OV7A 3IWZA 2VXZA 4XBFA 4BBSJ 2IS2A 2HOSA 1HDPA 4HW0A 4ABZA 3E0JB 2EWNA 2F2EA 2VKVA 3R60A 2NVQJ 3WE2A 2RV8A 4Y17A 4AVZA 4IO9F 1U9OA 2V4JC 1STZA 2QF7A 2VXDA 1EF4A 4XQFA 1I50J 2A69F 4RM3A 1USSA 3IP4B 3I5UA 3LSHA 4Y13A 1TQMA 4A0ZA 2L7MP 4XRFA 3X2QH 6PAXA 2K9MA 1T39A 4BH9A 5J4VA 2IBDA 4B48A 3H3UA 1X4PA 5F04A 3VPRA 2W7NA 2WAQN 1YS6A 3EYIA 1PYVA 3QAHA 1YI2I 4AC0A 1J0RA 1QGPA 2ECCA 1I5ZA 1UG0A 1USTA 3CCLI 3H36A 4D0PA 3PSIA 2V9PA 4DBRA 1AOYA 5J40A 3OMYA 2LK2A 5LRSA 4HF1A 4HX8A 2DCEA 5J3LA 1V54H 1LE8A 2HDDA 4RB0A 1KU7A 3A01B 5HLHA 2PLYA 4WXCA 4P9FA 1Z1DA 3S17J 4MFEA 3BR5A 4A93J 2K5CA 1P7JA 4CYCA 2ZJ2A 4E7KA 1GV5A 2COMA 3F8FA 2CQQA 1HXDA 2JN6A 3TQNA 1D0ZA 3JRHA 1ZGAA 1TC3C 3OV8A 3S1RJ 1ETVA 2ZMEC 2O7OA 2GA2A 3A1YA 3MFKA 1LVKA 2X51A 3TL4X 3N97A 3MCZA 2YPRA 4PCQA 2JSCA 3W2AA 4UNOA 2DI3A 3IRRA 3VYUB 3K7AJ 1GHCA 1MBHA 4LIUA 2RKHA 2EIMH 2WAFA 4ENJA 2STWA 3I3LA 2MG4A 3HB9A 1OISA 1K7AA 1Y1WJ 3K1PA 4HAMA 3PNTA 3H9GA 5C4JJ 3ABTA 5K7FA 2FD5A 1I3AA 3S2DJ 2CYYA 2YSRA 2A07F 3A0HC 2H6CA 3FKJA 1AWCA 1MNMC 1Q1VA 2Q0OA 4KDPA 1FC3A 1V4RA 1MBFA 2V1XA 4BEHA 4HNVA 3JAMK 2FBIA 4NBQA 4G6QA 4BXUA 4RDUA 4AYBN 2CQNA 2IJLA 2G7HA 2ZMEB 3M1CA 1E0EA 1HKQA 3FMQA 4WXHA 1X3WB 2ZJPF 1M1EB 4FE7A 3ABKH 4FETA 1YJWI 2IAIA 5IY5H 2O8KA 4I0BA 1PUEE 4BDZA 2BEOA 3S15J 1Y1VJ 3JSOA 3DF8A 5H6QA 3CLOA 4XLAA 3PIOF 4ZYGA 2ECBA 2IGMA 3PNVA 2GM4A 5DM7F 2DFEA 2HU9A 4KMUX 1LDJA 1VTNC 2PG4A 2F5EA 1T95A 2L9SA 4FX0A 1FOKA 1MBEA 3CUQA 5HDKA 3FMSA 2MLKA 1KU3A 5C3EJ 3OYAA 1ZLKA 3QPHA 4XOTA 1ZGJA 2HPIA 1MKMA 2Y30A 2O9LA 1AA7A 3CJTB 3E5QA 5E1ZB 3KIOA 4PZJA 3HPHA 3RSNA 2BV6A 3P7NA 1LEAA 3NARA 2OBPA 2PMZA 3GZNB 2O8XA 3RYRA 3LFUA 3A2KA 4YG2F 2HGCA 4F3QA 4KUMA 1R22A 2B7EA 2RGVA 4IF4A 1L0OC 1MW7A 1VNDA 4IQ4A 1FOWA 2R5ZA 3N4MA 3K4JA 4M9SA 2NNNA 3KEQA 2QGUA 4HX4A 1Y8QB 5D5XB 4LB6B 1ZQ3P 5FGMA 2CWEA 1HOMA 9ANTA 3SEZA 3CCSI 3FK7A 4MO7A 2GAUA 1WHUA 3GFMA 3VSKA 2XGCA 1IXCA 2R7UA 3COAC 1W4MA 4BE2A 1O3TA 4BHCA 1IV6A 4BNCA 1IJWC 5E1WA 1MJBA 2DJNA 3J7ZI 2FBKA 4ZTJA 2DA1A 5D8KB 4XLPF 1I1GA 1BR4A 1Y6IA 2MH2A 3DQVC 1QNTA 1JXSA 1UZCA 2JUCA 1E3PA 1MIJA 2DA6A 3M3YJ 2CUFA 5M3FJ 4NQWB 3BLYA 2KISA 3L2QA 4A3CJ 5JHFA 4A3DJ 1A36A 4U0WA 2FSWA 4WX9A 2XRNA 3CMYA 4YFNF 1HCRA 5F1RA 2X6YA 3C2HA 2D45A 1IG7A 5FKLA 4DW6A 3ZQHA 1U3EM 5HNFA 2VONA 2X1DA 1SVOA 2H09A 1NTCA 1SAXA 4XMYA 3ZR8X 3J80Z 4C2UA 1VQ6I 2V1DA 5ICEA 2EFNA 1JUSA 3KLOA 5L3EA 3L2WA 2DOEA 4NHJA 1U6GA 3E6DA 2LD5A 4NC7A 2FX0A 2M1BA 5TISC 3V8LA 2P5KA 4OINF 3V4GA 1UAAA 2FE3A 4UVCA 2CGPA 3HSRA 1JT0A 1ZRCA 2EJRA 2CFXA 2VUMJ 3BQYA 3BP8A 4QIWN 4M71A 2VASA 3FXMA 2UUZA 4FHTA 4R8HA 1AKHB 4EJVA 2LR8A 2P5VA 2E2IJ 3MKYB 5ED4A 3OYHA 1XMAA 4EV0A 2F4IA 2IW5A 2GXAA 5HOOA 3GUDA 3AKZA 2WAEA 3M8EA 1GT0C 4KISA 4IKFA 5DD4A 3A0BC 3W6VA 3CDHA 4M6XA 4OAYA 2HZDA 1ZLJA 2CMPA 3DLLF 5C4XJ 4CZZA 2W82A 3DKYA 1HC8A 3G1OA 1WRJA 3CC2I 1R1VA 4I0AA 3WODF 2JJ7A 4RGSA 3HDDA 2PJPA 4V19K 1SFKA 2NS0A 3U1DA 3K4MA 1ZG1A 1ZR4A 2NVUB 1RUNA 4QPOA 5CVRA 5JI6A 4C2MJ 2BHZA 1VQLI 3OR2C 2EFQA 4OOIA 4EJTA 4B43A 2EFOA 2FQ4A 3CJNA 2HKOA 1LKXA 3DTEA 3F23A 3CF2A 3CCUI 1JUMA 2CUEA 2E34A 3HJEA 5EJCA 1D5VA 1WFXA 4PGHA 5KNLA
chains in the Genus database with same CATH topology
2WC2A 3QP6A 1XGMA 3VFZA 1BC7C 3JTHA 4U0VA 2KJBA 3ZN1A 1KGSA 2P6SA 5K5RA 3R4KA 2J5OA 2XUBA 1KQ0A 2A3SA 3TO9A 4KYWA 1BC8C 2A61A 2YX4A 1TW3A 4Q4ZF 3I59A 5L3FA 3RKXA 3MAJA 5AIQA 3MZHA 1XDSA 2ZMEA 3I0TA 3WTSC 2CO5A 2DPDA 1IN5A 3L2CA 4WK8F 5D4SA 3HHHA 2L4MA 2UXNA 2F5DA 4AIKA 1Z91A 5LGNA 3K9TA 3RJPA 1SD7A 2O6GE 1F4KA 2ZO4A 2HOEA 2GWRA 1IAWA 4IXAA 2LSOA 2XASA 5D4RA 5E8IA 5E18F 1ZYRF 3S2WA 4ESBA 5J6XA 1B4AA 3RI4A 5LGUA 1R00A 5LHIA 4KNYA 3OOPA 4M73A 2XHKA 2HFHA 4Q5SF 5ICCA 1UFMA 4ENMA 4IRIA 5CVUA 2QVOA 5HS7A 5TRDA 3R61A 2M87A 3T8RA 2HZTA 1DPUA 2JPBA 2VE9A 2BBYA 3V7CA 3GFIA 3K1MA 2P7CB 5HDNA 3ERED 3Q9VA 1QZYA 4L5JA 4RGRA 1GXQA 2ISZA 4NQWA 4Y15A 2B0LA 4E70A 1OKRA 3HTUA 1EV7A 4AD9A 4HF0A 5ILVA 1JGSA 4NB5A 1IF1A 1FBSA 3WGHA 1O57A 2JRTA 2WTEA 5E1XA 4M9XA 3LA7A 2FEZA 3H3ZA 4KIBA 3BZ6A 4FT8A 2EV6A 1KQ8A 1G3WA 5DCFA 1XMKA 1OYIA 2ESNA 2FOKA 1QQIA 5EEGA 2A68F 2KJCA 3K0LA 2CSOA 3GF2A 5L3DA 2DFIA 3JTGA 1H0MA 4UXNA 1YW7A 3Q9SA 2PMHA 1P6RA 1IXSB 3NEUA 3GYHX 3P9IA 1HSJA 1MD0A 4KICA 1YO5C 4I2OA 3HYIA 4JBAA 5FD6A 2QQAA 1FP1D 4IHSA 1IXRC 1O7LA 1OPCA 1YIOA 3D5LA 2GZWA 4WCGA 4IVNA 2FMLA 4LG0B 3KFWX 4ZYHA 4G7HF 2FRHA 2HYGD 4UUVA 4LGWA 1R7JA 2P5LC 4A5NA 4ZYEA 4CO8A 4BHPA 1I27A 3DP7A 2F5FA 5DUIA 3E5XA 1YW8A 2EFPA 4JK1X 4YIIA 3HOSA 5H6RA 4A2UA 5JVTA 2OZUA 2RN7A 3F8MA 1BI2A 3GEZA 1TBXA 4ESJA 5KK1A 2A6HF 4ENNA 3ZMSA 1LB2A 1QPMA 2DBBA 2ZBKA 3SFZA 4Z2YA 3E6MA 4UV8A 1G6NA 4S05A 2D2WA 3HTSB 2ADUA 3HOTA 4N9IA 3HUGA 2ZNYA 5D5WB 5F6FA 3P9CA 1BI1A 1BIBA 2ZNZA 5K5QA 4ETSA 2VBWA 1YQAA 1F5TA 3KP7A 1FZPB 4HV5A 2OQGA 1FYMA 1MJAA 4YFXF 3I58A 2GXGA 3IHUA 1D8KA 4WXDA 2OD5A 4L0ZB 5FLXZ 3QU6A 2STTA 4AIJA 1E2XA 1FSHA 2MBFA 1S6LA 3TDZC 3JW4A 3VEPA 5FLXK 1LNWA 2OU2A 2XROA 1S7AA 5JR3A 3I54A 3DEUA 2M30A 4KA4A 1IN8A 1JHFA 5HDGA 3I59B 1ZH5A 4EJWA 3IKVA 4RGUA 4WF2A 2JT1A 2FXAA 4MEYF 1ZREA 2QQBA 2L54A 1DP7P 2RNJA 3KP5A 1WKMA 2FF4A 1B59A 3IKTA 3FM5A 1XGNA 3O6BB 5DD8A 1FNNA 3KETA 4HBLA 1LJ9A 3W6KB 2HTJA 3CUOA 3IRQA 1ZRDA 4PDKA 3U9GA 4M72A 1W7PA 3GVAA 3U2RA 3B02A 3M1EA 3WGIA 1Z05A 3ZPLA 2HEOA 3ML6A 4UV9A 2H6BA 2R7DA 4BAYA 1MDMA 4YIFA 2IPQX 3R0JA 4KIGA 1TLHB 2FBHA 1FPQA 2CW0F 2LNBA 5LEKA 4P55A 4EQQA 1YLFA 4RS8A 1R1UA 3T8TA 4R1HA 2DPUA 3V8KA 4CXFA 5HVQC 4M6YA 3WU1B 4AWXB 4LG0A 5CLSA 4MHGA 2V6CA 3I64A 2EV5A 1HW5A 1R5HA 2W25A 1HKSA 3ULQB 4RB2C 3EDPA 1H9TA 1KU2A 3HSFA 2ZCWA 1PP7U 3BOQA 4UHTA 4AVPA 1LDKB 3RDIA 3TO7A 4HQMA 5ERIA 2VBXA 3ZN0A 1YS7A 3F3XA 1BOAA 2W84A 3KP6A 4L0YB 3NQOA 2IA2A 1H9GA 3I71A 3J80K 3MWMA 5BQTA 2L01A 4MTDA 5H20A 3G3ZA 1ZAOA 3PQKA 4TV7A 3F6VA 2GQQA 3LQQA 3H92A 2UWMA 4LLNA 2BE5F 3GW2A 5FFXA 2NRAC 5LLQA 2NYXA 1ON2A 1FLIA 2IVMA 2GXBA 4HDUA 4M74A 1ULYA 4I98B 2VOOA 3F22A 3WGGA 1PDNC 1YTYA 1TQIA 4HF2A 5CVJA 3L00A 4IHTA 1BBYA 2M45A 1B1BA 2DK8A 2VN2A 4LB5A 2L3DA 3RIRA 4KN7X 1HQCA 1O7FA 1DDNA 3PFIA 5DEQA 2UZKA 2FMYA 2IRFG 2XGXA 2VOPA 1KYZA 1GVJA 1Z7UA 1T0FA 2O3FA 2OAZA 3BJOA 1Q1HA 4I01A 5D8LB 2HR3A 1UCRA 4HYEA 4G94A 3HRMA 3W6JB 4UVBA 1O3SA 1FYLA 1UHWA 2OA4A 4A12A 1REPC 2VC1A 2KIUA 1OYYA 2BGCA 5BS6A 1U2WA 1XCBA 1XN7A 4EM1A 3ECHA 4RB3C 4IJAA 4HA8A 2MLGA 4U0YA 2L4AA 3SZTA 1B9NA 3WU0A 1K6OA 4GO1A 3KEOA 3ZMVA 4WWCA 4PGGA 2PI0A 4LK1F 4U7DA 5ICGA 1XGSA 3QU3A 2GIVA 3M9AA 3O3KA 1ZG5A 4G7OF 2O61A 4U7BA 2KIFA 2VT2A 3GX4X 1R58A 4O6JA 2E7WA 1TNTA 3V7RA 4FX4A 1FT9A 1RNLA 5FD5A 3SHFA 3RKWA 1BI0A 2DTRA 2DO7A 5BPDA 4B09A 2C6YA 3F8NA 4R79A 3TDUC 4OIOF 2D1VA 1XCVA 4IRHA 1J5YA 3WTWC 1JHHA 3E6CC 3FMRA 2H27A 2EB7A 2XAFA 2VBZA 1E17A 3DPLC 2J5PA 5L3BA 3GXOA 1U5TC 4EVIA 1P4WA 2L02A 1OR7A 3C1DA 3F6OA 3FXQA 3LFKA 5CVIA 2YR2A 3MQ0A 3LQRA 2WV0A 2OQRA 1XB4A 2YX7A 3IWFA 4M9ZA 2XAQA 3GZ5A 1OMIA 1CF7B 4P5OA 2JTVA 1RZ4A 1S8NA 1U5TB 1W7PD 2IA1A 3MEXA 2KIMA 2EK5A 3B73A 2XAGA 1T38A 3KP3A 4CDGA 5BOXA 1S7OA 1I1SA 2AXLA 2GA1A 2OZ6A 5L3GA 2EA2A 4EM0B 3WTZA 1Z9CA 1R5GA 2PBIA 4EM2A 1W7PB 4LFUA 2QQ9A 2YU3A 3HRTA 3HHGA 5TJJA 1SD4A 3QPTA 4QWQA 3K2ZA 3L7WA 1BN5A 1W5TA 3WTYC 1J75A 2DQRA 1J7KA 2E7XA 4L9TA 5F64A 4ZZDA 1MDMB 1KQ9A 1Z6TA 1YYVA 3E5UA 4CYDA 2IA0A 3L09A 2V9VA 1QZZA 2Z9OA 3EETA 1B9MA 3RKYA 3AAFA 3WTXC 3F8BA 4RB1A 2ETHA 5D6EA 4MQ9F 1HKTA 5JHUA 3G73A 2M8EA 1V3FA 3RPQA 4IPAA 1G3TA 4I02A 3KZYA 2VC0A 4G9YA 2NNYA 4JQFA 2JPCA 3FF5A 5D6FA 3WE3A 5CJ9A 5CYVA 4LK0F 3KZZA 3V8JA 4Q47A 3FWEA 3BROA 2K7LA 1G3YA 2QBYB 1JE8A 2MD5A 3C7JA 3QRFF 1BIAA 1IW7F 2E1NA 2VE8A 4AIHA 1YFHA 5IT9Z 4GGGA 4OMZA 4ZZLA 2LDUA 4N0BA 2LKPA 1U78A 2MH9A 3TOBA 1GXPA 3NRVA 3JSPA 2X0LA 1YG2A 5D5VB 1EH8A 2Q2EA 2TDXA 4G7ZF 1K78B 1R23A 3BJAA 1P92A 3IL2A 1YW9A 2JZYA 3R0AA 3EQLF 1FY7A 2O0YA 1SMYF 5HS9A 3D0SA 1O3QA 1T98A 1P2FA 2M5WA 4BHBA 2PMUA 4ENKA 4KIFA 3LA3A 4BQAA 2XKPA 5J8CA 2DLLA 1WI9A 5LHGA 2XIGA 5K5OA 4ASNA 4K2EA 2K02A 1KYWA 2A6EF 2DAOA 1TW2A 1LVAA 3LSTA 1NHAA 2ACJA 1EH6A 3FXRA 2LF8A 3FM3A 3ELKA 3RPUA 3KP2A 2K4BA 4LJZF 3E97A 1UHMA 1XSXA 2CQKA 3ABUA 3GZ6A 3REOA 1SD6A 5E8GA 3E3VA 4B8XA 3ZP5A 4EGYA 1SFUA 1XSVA 1LEBA 3IC7A 1BJAA 3JAMZ 4A6DA 1PP8F 1TNSA 2A5YB 1CF7A 3E6BA 2QYOA 4I09A 5DDGA 2P8TA 1U5TA 4OMYA 1OYWA 4O3MA 2PN6A 1DPRA 2CG4A 3DKWA 1XSDA 3DFGA 1S29A 5ILSA 3TKYA 3HRUA 3CTAA 4HZFA 1FYKA 4HLXA 4Q48A 1QO0D 3K1NA 2K86A 2ZFWA 2ISYA 4HX7A 4L18B 4EJOA 2R3SA 4G8XA 1SFXA 3VOEA 3BWGA 4HDVA 1G4DA 1FBUA 2W57A 3WTVC 2VBYA 4A0XA 3K69A 5HLIA 4GCVA 3BY6A 1ONVA 4HOBA 1WWXA 2ESHA 5DV5A 4ZH4F 1D8JA 2VT3A 1X3UA 2HQRA 4A6EA 3CO7C 4RAYA 2QUFA 3ISPA 3SQNA 3DXJF 2PFBA 4N9HA 1FSEA 5AONA 1Y0UA 1ZHFA 1XGOA 2EA4A 4OU0A 2P4WA 4KT5C 1IN6A 3TO6A 3O2PE 1HBXG 2QBYA 3KLNA 5L3CA 4EGZA 3GLXA 1A04A 1LDDA 5LGTA 3QP5A 2KKOA 3BPVA 3QOPA 2P7VB 5DYMA 2K27A 2UXXA 4BYYA 1F1ZA 1SMTA 4XLNF 2RVCA 2FA5A 4QLCU 4L9NA 3I4PA 5LEJA 1K78A 4DQ2A 4LLGF 2DW4A 3I53A 3M7GA 2H94A 5HLGA 4RGXA 3RTRA 1G3SA 1FWZA 4LD5A 3HSEA 5D5UB 3ZMTA 2DT5A 3EYYA 3HIFA 2RDPA 2O03A 4MTEA 3VODA 5HS8A 3GO5A 2QLZA 3ZMDA 2G9WA 3T5XA 4P9UA 1P4AA 2PEXA 1MJ9A 4ESFA 2Z99A 3LAPA 3ECOA 5DCMB 2MA3A 3KE2A 5IT3A 2W24A 5EEHA 2EV0A 5JFRA 2IP2A 1R1TA 1TQPA 2FU4A 2HTSA 2V79A 2Z3YA 4P96A 3GFJA 3VB2A 4CICA 1R36A 3EUHA 2HQNA 5ICFA 5LRRA 4OIRF 2Q8KA 1IRGA 3TOAA 2QENA 4MNUA 5FO5A 5KVRA 1DUXC 3ZMZA 5FFZA 3J81Z 1RUOA 2DU9A 2K4JA 1S3JA 3DV8A 3GFLA 3FX3A 2PQ8A 4GXOA 3MZYA 3FZVA 3F21A 1UB9A 1BI3A 3J81K 1T6SA 4MGRA 2RQPA 5FB2A 3ZQ7A 1IUYA 4G6DA 1WQ2A 5CVVA 3LAJA 1EH7A 3J7AO 1ZN2A 3ZMUA 2F5CA 2QWWA 4MEXF 4XSZF 4IRGA 5K1YA 1D3YA 2NAZA 1LQ1A 4ZYDA 3M8FA 4MQVA 2ELHA 2RC4A 2XAJA 4DNCA 2MC3A 1O3RA 1XD7A 2XV4S 3SXYA 2IT0A 2Z5UA 4GYGA 5ILUA 4XSXF 1IN4A 5LBQA 2FQ3A 4CHUA 3CO6C 2R7FA 1J2XA 4A5MA 1HSTA 1HW1A 3PQJA 4ON0A 4KFCA 4HLYA 2VODA 2QM3A 4KMFA 5LHHA 2KRFA 3LWFA 3V7SA 1BM9A 1L3LA 1SFEA 1J59A 2Y75A 3F8CA 1RIOH 4GYIA 4O5VA 1J9IA 3FXUA 3Q5FA 2AS5F 1ZARA 2W85A 4EMSA 1P4XA 2G7UA 3CUQC 1KU9A 1U8RA 1ZG3A 1K79A 2HKXA 4L9JA 2Y0MA 2XKOA 2ZKZA 1W5SA 2D1HA 1TTYA 2XAHA 5BMZA 3FHZA 3TGNA 1Z6RA 1SD5A 2QZ8A 1IRFA 1ON1A 4RAZA 3KP4A 2EFWA 1I6XA 5E20A 3CUQB 4F7ZA 1QBJA 3BDDA 3T1BA 2ZXJA 3LA2A 5J8FA 1F9NA 3WTUC 4HQEA 3T0YA 1B6AA 4S04A 3R6SA 4HV6A 4U88A 1T2KA 2HWVA 4KN4X 2XVCA 1RI7A 2BYVE 2E1CA 3SZPA 4CGZA 4EJUA 2HDCA 5A2QZ 3KCCA 5DCMA 3WTTC 1FBQA 2DQLA 2HS5A 3BPXA 2V1UA 1IN7A 5DUKA 2Y48A 3P9KA 5AIPA 2HYFA 3WG9A 5E17F 1ODDA 5A2QK 1HW2A 4LLLA 2FNAA 3C3WA 2LF7A 4LMYA 5BPIA 3ROUA 4I7HA 3GWZA 3DPTA 2DK5A 1MGTA 3BJ6A 2P6TA 1MZBA 3L9FA 4L9VA 1FX7A 4A0YA 1CGPA 5IT9K 1IZ1A 1XDUA 4L5IA 2FNPA 4UVAA 1KA8A 2X4HA 4H0EA 3C18A 3F72A 4OIPF 1ZRFA 1FP2A 2Z33A 3RYPA 2WWYA 1WSUA 4OIQF 1C0WA 3HRSA 4YFKF 3IWZA 4XBFA 2VXZA 4HW0A 2EWNA 2F2EA 3R60A 3WE2A 2RV8A 4Y17A 1STZA 2A69F 1USSA 3I5UA 4Y13A 1TQMA 4A0ZA 4XRFA 6PAXA 1T39A 4BH9A 3H3UA 1YS6A 3EYIA 3QAHA 1J0RA 1QGPA 1I5ZA 1USTA 4D0PA 1AOYA 5LRSA 4HF1A 4HX8A 4RB0A 1KU7A 2PLYA 5HLHA 4WXCA 4P9FA 1Z1DA 2ZJ2A 2COMA 3F8FA 1HXDA 3TQNA 1ZGAA 3OV8A 2GA2A 3MFKA 3N97A 3MCZA 2YPRA 4PCQA 2JSCA 4UNOA 2DI3A 3IRRA 1GHCA 2RKHA 4ENJA 2STWA 1K7AA 3K1PA 4HAMA 3ABTA 2CYYA 2YSRA 2A07F 2H6CA 1AWCA 2Q0OA 4KDPA 1FC3A 1V4RA 2V1XA 3JAMK 2FBIA 4G6QA 4BXUA 2IJLA 2G7HA 2ZMEB 1HKQA 3FMQA 4WXHA 4I0BA 1PUEE 2BEOA 3JSOA 3DF8A 5H6QA 3CLOA 4ZYGA 4KMUX 1LDJA 1VTNC 2PG4A 2F5EA 1FOKA 4FX0A 3CUQA 5HDKA 3FMSA 2MLKA 1KU3A 1ZLKA 3QPHA 1ZGJA 1MKMA 3E5QA 5E1ZB 4PZJA 2BV6A 3P7NA 1LEAA 2OBPA 2O8XA 3RYRA 4YG2F 2HGCA 4KUMA 1R22A 2RGVA 4IF4A 1L0OC 3N4MA 4M9SA 2NNNA 3KEQA 4HX4A 5D5XB 4LB6B 5FGMA 2CWEA 2GAUA 3GFMA 1IXCA 3COAC 1W4MA 1O3TA 4BHCA 4BNCA 5E1WA 1MJBA 2FBKA 5D8KB 4XLPF 1I1GA 2MH2A 3DQVC 1QNTA 1JXSA 4U0WA 2FSWA 4WX9A 2XRNA 4YFNF 5F1RA 2D45A 2VONA 1U3EM 2H09A 1SAXA 3J80Z 2V1DA 5ICEA 2EFNA 3KLOA 5L3EA 4NHJA 1U6GA 3E6DA 2M1BA 3V8LA 2P5KA 4OINF 3V4GA 2FE3A 4UVCA 2CGPA 3HSRA 1ZRCA 2EJRA 2CFXA 3BP8A 4M71A 4FHTA 4R8HA 4EJVA 2P5VA 5ED4A 1XMAA 4EV0A 2IW5A 5HOOA 3GUDA 3M8EA 5DD4A 3CDHA 4M6XA 1ZLJA 4CZZA 1WRJA 1R1VA 4I0AA 3WODF 4RGSA 2PJPA 2NS0A 3U1DA 1ZG1A 1RUNA 5CVRA 5JI6A 2EFQA 4OOIA 4EJTA 2EFOA 3CJNA 2HKOA 3F23A 1D5VA 4PGHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WC2 A;  3QP6 A;  1XGM A;  3VFZ A;  1BC7 C;  3JTH A;  4U0V A;  2KJB A;  3ZN1 A;  1KGS A;  2P6S A;  5K5R A;  3R4K A;  2J5O A;  2XUB A;  1KQ0 A;  2A3S A;  3TO9 A;  4KYW A;  1BC8 C;  2A61 A;  2YX4 A;  1TW3 A;  4Q4Z F;  3I59 A;  5L3F A;  3RKX A;  3MAJ A;  5AIQ A;  3MZH A;  1XDS A;  2ZME A;  3I0T A;  3WTS C;  2CO5 A;  2DPD A;  1IN5 A;  3L2C A;  4WK8 F;  5D4S A;  3HHH A;  2L4M A;  2UXN A;  2F5D A;  4AIK A;  1Z91 A;  5LGN A;  3K9T A;  3RJP A;  1SD7 A;  2O6G E;  1F4K A;  2ZO4 A;  2HOE A;  2GWR A;  1IAW A;  4IXA A;  2LSO A;  2XAS A;  5D4R A;  5E8I A;  5E18 F;  1ZYR F;  3S2W A;  4ESB A;  5J6X A;  1B4A A;  3RI4 A;  5LGU A;  1R00 A;  5LHI A;  4KNY A;  3OOP A;  4M73 A;  2XHK A;  2HFH A;  4Q5S F;  5ICC A;  1UFM A;  4ENM A;  4IRI A;  5CVU A;  2QVO A;  5HS7 A;  5TRD A;  3R61 A;  2M87 A;  3T8R A;  2HZT A;  1DPU A;  2JPB A;  2VE9 A;  2BBY A;  3V7C A;  3GFI A;  3K1M A;  2P7C B;  5HDN A;  3ERE D;  3Q9V A;  1QZY A;  4L5J A;  4RGR A;  1GXQ A;  2ISZ A;  4NQW A;  4Y15 A;  2B0L A;  4E70 A;  1OKR A;  3HTU A;  1EV7 A;  4AD9 A;  4HF0 A;  5ILV A;  1JGS A;  4NB5 A;  1IF1 A;  1FBS A;  3WGH A;  1O57 A;  2JRT A;  2WTE A;  5E1X A;  4M9X A;  3LA7 A;  2FEZ A;  3H3Z A;  4KIB A;  3BZ6 A;  4FT8 A;  2EV6 A;  1KQ8 A;  1G3W A;  5DCF A;  1XMK A;  1OYI A;  2ESN A;  2FOK A;  1QQI A;  5EEG A;  2A68 F;  2KJC A;  3K0L A;  2CSO A;  3GF2 A;  5L3D A;  2DFI A;  3JTG A;  1H0M A;  4UXN A;  1YW7 A;  3Q9S A;  2PMH A;  1P6R A;  1IXS B;  3NEU A;  3GYH X;  3P9I A;  1HSJ A;  1MD0 A;  4KIC A;  1YO5 C;  4I2O A;  3HYI A;  4JBA A;  5FD6 A;  2QQA A;  1FP1 D;  4IHS A;  1IXR C;  1O7L A;  1OPC A;  1YIO A;  3D5L A;  2GZW A;  4WCG A;  4IVN A;  2FML A;  4LG0 B;  3KFW X;  4ZYH A;  4G7H F;  2FRH A;  2HYG D;  4UUV A;  4LGW A;  1R7J A;  2P5L C;  4A5N A;  4ZYE A;  4CO8 A;  4BHP A;  1I27 A;  3DP7 A;  2F5F A;  5DUI A;  3E5X A;  1YW8 A;  2EFP A;  4JK1 X;  4YII A;  3HOS A;  5H6R A;  4A2U A;  5JVT A;  2OZU A;  2RN7 A;  3F8M A;  1BI2 A;  3GEZ A;  1TBX A;  4ESJ A;  5KK1 A;  2A6H F;  4ENN A;  3ZMS A;  1LB2 A;  1QPM A;  2DBB A;  2ZBK A;  3SFZ A;  4Z2Y A;  3E6M A;  4UV8 A;  1G6N A;  4S05 A;  2D2W A;  3HTS B;  2ADU A;  3HOT A;  4N9I A;  3HUG A;  2ZNY A;  5D5W B;  5F6F A;  3P9C A;  1BI1 A;  1BIB A;  2ZNZ A;  5K5Q A;  4ETS A;  2VBW A;  1YQA A;  1F5T A;  3KP7 A;  1FZP B;  4HV5 A;  2OQG A;  1FYM A;  1MJA A;  4YFX F;  3I58 A;  2GXG A;  3IHU A;  1D8K A;  4WXD A;  2OD5 A;  4L0Z B;  5FLX Z;  3QU6 A;  2STT A;  4AIJ A;  1E2X A;  1FSH A;  2MBF A;  1S6L A;  3TDZ C;  3JW4 A;  3VEP A;  5FLX K;  1LNW A;  2OU2 A;  2XRO A;  1S7A A;  5JR3 A;  3I54 A;  3DEU A;  2M30 A;  4KA4 A;  1IN8 A;  1JHF A;  5HDG A;  3I59 B;  1ZH5 A;  4EJW A;  3IKV A;  4RGU A;  4WF2 A;  2JT1 A;  2FXA A;  4MEY F;  1ZRE A;  2QQB A;  2L54 A;  1DP7 P;  2RNJ A;  3KP5 A;  1WKM A;  2FF4 A;  1B59 A;  3IKT A;  3FM5 A;  1XGN A;  3O6B B;  5DD8 A;  1FNN A;  3KET A;  4HBL A;  1LJ9 A;  3W6K B;  2HTJ A;  3CUO A;  3IRQ A;  1ZRD A;  4PDK A;  3U9G A;  4M72 A;  1W7P A;  3GVA A;  3U2R A;  3B02 A;  3M1E A;  3WGI A;  1Z05 A;  3ZPL A;  2HEO A;  3ML6 A;  4UV9 A;  2H6B A;  2R7D A;  4BAY A;  1MDM A;  4YIF A;  2IPQ X;  3R0J A;  4KIG A;  1TLH B;  2FBH A;  1FPQ A;  2CW0 F;  2LNB A;  5LEK A;  4P55 A;  4EQQ A;  1YLF A;  4RS8 A;  1R1U A;  3T8T A;  4R1H A;  2DPU A;  3V8K A;  4CXF A;  5HVQ C;  4M6Y A;  3WU1 B;  4AWX B;  4LG0 A;  5CLS A;  4MHG A;  2V6C A;  3I64 A;  2EV5 A;  1HW5 A;  1R5H A;  2W25 A;  1HKS A;  3ULQ B;  4RB2 C;  3EDP A;  1H9T A;  1KU2 A;  3HSF A;  2ZCW A;  1PP7 U;  3BOQ A;  4UHT A;  4AVP A;  1LDK B;  3RDI A;  3TO7 A;  4HQM A;  5ERI A;  2VBX A;  3ZN0 A;  1YS7 A;  3F3X A;  1BOA A;  2W84 A;  3KP6 A;  4L0Y B;  3NQO A;  2IA2 A;  1H9G A;  3I71 A;  3J80 K;  3MWM A;  5BQT A;  2L01 A;  4MTD A;  5H20 A;  3G3Z A;  1ZAO A;  3PQK A;  4TV7 A;  3F6V A;  2GQQ A;  3LQQ A;  3H92 A;  2UWM A;  4LLN A;  2BE5 F;  3GW2 A;  5FFX A;  2NRA C;  5LLQ A;  2NYX A;  1ON2 A;  1FLI A;  2IVM A;  2GXB A;  4HDU A;  4M74 A;  1ULY A;  4I98 B;  2VOO A;  3F22 A;  3WGG A;  1PDN C;  1YTY A;  1TQI A;  4HF2 A;  5CVJ A;  3L00 A;  4IHT A;  1BBY A;  2M45 A;  1B1B A;  2DK8 A;  2VN2 A;  4LB5 A;  2L3D A;  3RIR A;  4KN7 X;  1HQC A;  1O7F A;  1DDN A;  3PFI A;  5DEQ A;  2UZK A;  2FMY A;  2IRF G;  2XGX A;  2VOP A;  1KYZ A;  1GVJ A;  1Z7U A;  1T0F A;  2O3F A;  2OAZ A;  3BJO A;  1Q1H A;  4I01 A;  5D8L B;  2HR3 A;  1UCR A;  4HYE A;  4G94 A;  3HRM A;  3W6J B;  4UVB A;  1O3S A;  1FYL A;  1UHW A;  2OA4 A;  4A12 A;  1REP C;  2VC1 A;  2KIU A;  1OYY A;  2BGC A;  5BS6 A;  1U2W A;  1XCB A;  1XN7 A;  4EM1 A;  3ECH A;  4RB3 C;  4IJA A;  4HA8 A;  2MLG A;  4U0Y A;  2L4A A;  3SZT A;  1B9N A;  3WU0 A;  1K6O A;  4GO1 A;  3KEO A;  3ZMV A;  4WWC A;  4PGG A;  2PI0 A;  4LK1 F;  4U7D A;  5ICG A;  1XGS A;  3QU3 A;  2GIV A;  3M9A A;  3O3K A;  1ZG5 A;  4G7O F;  2O61 A;  4U7B A;  2KIF A;  2VT2 A;  3GX4 X;  1R58 A;  4O6J A;  2E7W A;  1TNT A;  3V7R A;  4FX4 A;  1FT9 A;  1RNL A;  5FD5 A;  3SHF A;  3RKW A;  1BI0 A;  2DTR A;  2DO7 A;  5BPD A;  4B09 A;  2C6Y A;  3F8N A;  4R79 A;  3TDU C;  4OIO F;  2D1V A;  1XCV A;  4IRH A;  1J5Y A;  3WTW C;  1JHH A;  3E6C C;  3FMR A;  2H27 A;  2EB7 A;  2XAF A;  2VBZ A;  1E17 A;  3DPL C;  2J5P A;  5L3B A;  3GXO A;  1U5T C;  4EVI A;  1P4W A;  2L02 A;  1OR7 A;  3C1D A;  3F6O A;  3FXQ A;  3LFK A;  5CVI A;  2YR2 A;  3MQ0 A;  3LQR A;  2WV0 A;  2OQR A;  1XB4 A;  2YX7 A;  3IWF A;  4M9Z A;  2XAQ A;  3GZ5 A;  1OMI A;  1CF7 B;  4P5O A;  2JTV A;  1RZ4 A;  1S8N A;  1U5T B;  1W7P D;  2IA1 A;  3MEX A;  2KIM A;  2EK5 A;  3B73 A;  2XAG A;  1T38 A;  3KP3 A;  4CDG A;  5BOX A;  1S7O A;  1I1S A;  2AXL A;  2GA1 A;  2OZ6 A;  5L3G A;  2EA2 A;  4EM0 B;  3WTZ A;  1Z9C A;  1R5G A;  2PBI A;  4EM2 A;  1W7P B;  4LFU A;  2QQ9 A;  2YU3 A;  3HRT A;  3HHG A;  5TJJ A;  1SD4 A;  3QPT A;  4QWQ A;  3K2Z A;  3L7W A;  1BN5 A;  1W5T A;  3WTY C;  1J75 A;  2DQR A;  1J7K A;  2E7X A;  4L9T A;  5F64 A;  4ZZD A;  1MDM B;  1KQ9 A;  1Z6T A;  1YYV A;  3E5U A;  4CYD A;  2IA0 A;  3L09 A;  2V9V A;  1QZZ A;  2Z9O A;  3EET A;  1B9M A;  3RKY A;  3AAF A;  3WTX C;  3F8B A;  4RB1 A;  2ETH A;  5D6E A;  4MQ9 F;  1HKT A;  5JHU A;  3G73 A;  2M8E A;  1V3F A;  3RPQ A;  4IPA A;  1G3T A;  4I02 A;  3KZY A;  2VC0 A;  4G9Y A;  2NNY A;  4JQF A;  2JPC A;  3FF5 A;  5D6F A;  3WE3 A;  5CJ9 A;  5CYV A;  4LK0 F;  3KZZ A;  3V8J A;  4Q47 A;  3FWE A;  3BRO A;  2K7L A;  1G3Y A;  2QBY B;  1JE8 A;  2MD5 A;  3C7J A;  3QRF F;  1BIA A;  1IW7 F;  2E1N A;  2VE8 A;  4AIH A;  1YFH A;  5IT9 Z;  4GGG A;  4OMZ A;  4ZZL A;  2LDU A;  4N0B A;  2LKP A;  1U78 A;  2MH9 A;  3TOB A;  1GXP A;  3NRV A;  3JSP A;  2X0L A;  1YG2 A;  5D5V B;  1EH8 A;  2Q2E A;  2TDX A;  4G7Z F;  1K78 B;  1R23 A;  3BJA A;  1P92 A;  3IL2 A;  1YW9 A;  2JZY A;  3R0A A;  3EQL F;  1FY7 A;  2O0Y A;  1SMY F;  5HS9 A;  3D0S A;  1O3Q A;  1T98 A;  1P2F A;  2M5W A;  4BHB A;  2PMU A;  4ENK A;  4KIF A;  3LA3 A;  4BQA A;  2XKP A;  5J8C A;  2DLL A;  1WI9 A;  5LHG A;  2XIG A;  5K5O A;  4ASN A;  4K2E A;  2K02 A;  1KYW A;  2A6E F;  2DAO A;  1TW2 A;  1LVA A;  3LST A;  1NHA A;  2ACJ A;  1EH6 A;  3FXR A;  2LF8 A;  3FM3 A;  3ELK A;  3RPU A;  3KP2 A;  2K4B A;  4LJZ F;  3E97 A;  1UHM A;  1XSX A;  2CQK A;  3ABU A;  3GZ6 A;  3REO A;  1SD6 A;  5E8G A;  3E3V A;  4B8X A;  3ZP5 A;  4EGY A;  1SFU A;  1XSV A;  1LEB A;  3IC7 A;  1BJA A;  3JAM Z;  4A6D A;  1PP8 F;  1TNS A;  2A5Y B;  1CF7 A;  3E6B A;  2QYO A;  4I09 A;  5DDG A;  2P8T A;  1U5T A;  4OMY A;  1OYW A;  4O3M A;  2PN6 A;  1DPR A;  2CG4 A;  3DKW A;  1XSD A;  3DFG A;  1S29 A;  5ILS A;  3TKY A;  3HRU A;  3CTA A;  4HZF A;  1FYK A;  4HLX A;  4Q48 A;  1QO0 D;  3K1N A;  2K86 A;  2ZFW A;  2ISY A;  4HX7 A;  4L18 B;  4EJO A;  2R3S A;  4G8X A;  1SFX A;  3VOE A;  3BWG A;  4HDV A;  1G4D A;  1FBU A;  2W57 A;  3WTV C;  2VBY A;  4A0X A;  3K69 A;  5HLI A;  4GCV A;  3BY6 A;  1ONV A;  4HOB A;  1WWX A;  2ESH A;  5DV5 A;  4ZH4 F;  1D8J A;  2VT3 A;  1X3U A;  2HQR A;  4A6E A;  3CO7 C;  4RAY A;  2QUF A;  3ISP A;  3SQN A;  3DXJ F;  2PFB A;  4N9H A;  1FSE A;  5AON A;  1Y0U A;  1ZHF A;  1XGO A;  2EA4 A;  4OU0 A;  2P4W A;  4KT5 C;  1IN6 A;  3TO6 A;  3O2P E;  1HBX G;  2QBY A;  3KLN A;  5L3C A;  4EGZ A;  3GLX A;  1A04 A;  1LDD A;  5LGT A;  3QP5 A;  2KKO A;  3BPV A;  3QOP A;  2P7V B;  5DYM A;  2K27 A;  2UXX A;  4BYY A;  1F1Z A;  1SMT A;  4XLN F;  2RVC A;  2FA5 A;  4QLC U;  4L9N A;  3I4P A;  5LEJ A;  1K78 A;  4DQ2 A;  4LLG F;  2DW4 A;  3I53 A;  3M7G A;  2H94 A;  5HLG A;  4RGX A;  3RTR A;  1G3S A;  1FWZ A;  4LD5 A;  3HSE A;  5D5U B;  3ZMT A;  2DT5 A;  3EYY A;  3HIF A;  2RDP A;  2O03 A;  4MTE A;  3VOD A;  5HS8 A;  3GO5 A;  2QLZ A;  3ZMD A;  2G9W A;  3T5X A;  4P9U A;  1P4A A;  2PEX A;  1MJ9 A;  4ESF A;  2Z99 A;  3LAP A;  3ECO A;  5DCM B;  2MA3 A;  3KE2 A;  5IT3 A;  2W24 A;  5EEH A;  2EV0 A;  5JFR A;  2IP2 A;  1R1T A;  1TQP A;  2FU4 A;  2HTS A;  2V79 A;  2Z3Y A;  4P96 A;  3GFJ A;  3VB2 A;  4CIC A;  1R36 A;  3EUH A;  2HQN A;  5ICF A;  5LRR A;  4OIR F;  2Q8K A;  1IRG A;  3TOA A;  2QEN A;  4MNU A;  5FO5 A;  5KVR A;  1DUX C;  3ZMZ A;  5FFZ A;  3J81 Z;  1RUO A;  2DU9 A;  2K4J A;  1S3J A;  3DV8 A;  3GFL A;  3FX3 A;  2PQ8 A;  4GXO A;  3MZY A;  3FZV A;  3F21 A;  1UB9 A;  1BI3 A;  3J81 K;  1T6S A;  4MGR A;  2RQP A;  5FB2 A;  3ZQ7 A;  1IUY A;  4G6D A;  1WQ2 A;  5CVV A;  3LAJ A;  1EH7 A;  3J7A O;  1ZN2 A;  3ZMU A;  2F5C A;  2QWW A;  4MEX F;  4XSZ F;  4IRG A;  5K1Y A;  1D3Y A;  2NAZ A;  1LQ1 A;  4ZYD A;  3M8F A;  4MQV A;  2ELH A;  2RC4 A;  2XAJ A;  4DNC A;  2MC3 A;  1O3R A;  1XD7 A;  2XV4 S;  3SXY A;  2IT0 A;  2Z5U A;  4GYG A;  5ILU A;  4XSX F;  1IN4 A;  5LBQ A;  2FQ3 A;  4CHU A;  3CO6 C;  2R7F A;  1J2X A;  4A5M A;  1HST A;  1HW1 A;  3PQJ A;  4ON0 A;  4KFC A;  4HLY A;  2VOD A;  2QM3 A;  4KMF A;  5LHH A;  2KRF A;  3LWF A;  3V7S A;  1BM9 A;  1L3L A;  1SFE A;  1J59 A;  2Y75 A;  3F8C A;  1RIO H;  4GYI A;  4O5V A;  1J9I A;  3FXU A;  3Q5F A;  2AS5 F;  1ZAR A;  2W85 A;  4EMS A;  1P4X A;  2G7U A;  3CUQ C;  1KU9 A;  1U8R A;  1ZG3 A;  1K79 A;  2HKX A;  4L9J A;  2Y0M A;  2XKO A;  2ZKZ A;  1W5S A;  2D1H A;  1TTY A;  2XAH A;  5BMZ A;  3FHZ A;  3TGN A;  1Z6R A;  1SD5 A;  2QZ8 A;  1IRF A;  1ON1 A;  4RAZ A;  3KP4 A;  2EFW A;  1I6X A;  5E20 A;  3CUQ B;  4F7Z A;  1QBJ A;  3BDD A;  3T1B A;  2ZXJ A;  3LA2 A;  5J8F A;  1F9N A;  3WTU C;  4HQE A;  3T0Y A;  1B6A A;  4S04 A;  3R6S A;  4HV6 A;  4U88 A;  1T2K A;  2HWV A;  4KN4 X;  2XVC A;  1RI7 A;  2BYV E;  2E1C A;  3SZP A;  4CGZ A;  4EJU A;  2HDC A;  5A2Q Z;  3KCC A;  5DCM A;  3WTT C;  1FBQ A;  2DQL A;  2HS5 A;  3BPX A;  2V1U A;  1IN7 A;  5DUK A;  2Y48 A;  3P9K A;  5AIP A;  2HYF A;  3WG9 A;  5E17 F;  1ODD A;  5A2Q K;  1HW2 A;  4LLL A;  2FNA A;  3C3W A;  2LF7 A;  4LMY A;  5BPI A;  3ROU A;  4I7H A;  3GWZ A;  3DPT A;  2DK5 A;  1MGT A;  3BJ6 A;  2P6T A;  1MZB A;  3L9F A;  4L9V A;  1FX7 A;  4A0Y A;  1CGP A;  5IT9 K;  1IZ1 A;  1XDU A;  4L5I A;  2FNP A;  4UVA A;  1KA8 A;  2X4H A;  4H0E A;  3C18 A;  3F72 A;  4OIP F;  1ZRF A;  1FP2 A;  2Z33 A;  3RYP A;  2WWY A;  1WSU A;  4OIQ F;  1C0W A;  3HRS A;  4YFK F;  3IWZ A;  4XBF A;  2VXZ A;  4HW0 A;  2EWN A;  2F2E A;  3R60 A;  3WE2 A;  2RV8 A;  4Y17 A;  1STZ A;  2A69 F;  1USS A;  3I5U A;  4Y13 A;  1TQM A;  4A0Z A;  4XRF A;  6PAX A;  1T39 A;  4BH9 A;  3H3U A;  1YS6 A;  3EYI A;  3QAH A;  1J0R A;  1QGP A;  1I5Z A;  1UST A;  4D0P A;  1AOY A;  5LRS A;  4HF1 A;  4HX8 A;  4RB0 A;  1KU7 A;  2PLY A;  5HLH A;  4WXC A;  4P9F A;  1Z1D A;  2ZJ2 A;  2COM A;  3F8F A;  1HXD A;  3TQN A;  1ZGA A;  3OV8 A;  2GA2 A;  3MFK A;  3N97 A;  3MCZ A;  2YPR A;  4PCQ A;  2JSC A;  4UNO A;  2DI3 A;  3IRR A;  1GHC A;  2RKH A;  4ENJ A;  2STW A;  1K7A A;  3K1P A;  4HAM A;  3ABT A;  2CYY A;  2YSR A;  2A07 F;  2H6C A;  1AWC A;  2Q0O A;  4KDP A;  1FC3 A;  1V4R A;  2V1X A;  3JAM K;  2FBI A;  4G6Q A;  4BXU A;  2IJL A;  2G7H A;  2ZME B;  1HKQ A;  3FMQ A;  4WXH A;  4I0B A;  1PUE E;  2BEO A;  3JSO A;  3DF8 A;  5H6Q A;  3CLO A;  4ZYG A;  4KMU X;  1LDJ A;  1VTN C;  2PG4 A;  2F5E A;  1FOK A;  4FX0 A;  3CUQ A;  5HDK A;  3FMS A;  2MLK A;  1KU3 A;  1ZLK A;  3QPH A;  1ZGJ A;  1MKM A;  3E5Q A;  5E1Z B;  4PZJ A;  2BV6 A;  3P7N A;  1LEA A;  2OBP A;  2O8X A;  3RYR A;  4YG2 F;  2HGC A;  4KUM A;  1R22 A;  2RGV A;  4IF4 A;  1L0O C;  3N4M A;  4M9S A;  2NNN A;  3KEQ A;  4HX4 A;  5D5X B;  4LB6 B;  5FGM A;  2CWE A;  2GAU A;  3GFM A;  1IXC A;  3COA C;  1W4M A;  1O3T A;  4BHC A;  4BNC A;  5E1W A;  1MJB A;  2FBK A;  5D8K B;  4XLP F;  1I1G A;  2MH2 A;  3DQV C;  1QNT A;  1JXS A;  4U0W A;  2FSW A;  4WX9 A;  2XRN A;  4YFN F;  5F1R A;  2D45 A;  2VON A;  1U3E M;  2H09 A;  1SAX A;  3J80 Z;  2V1D A;  5ICE A;  2EFN A;  3KLO A;  5L3E A;  4NHJ A;  1U6G A;  3E6D A;  2M1B A;  3V8L A;  2P5K A;  4OIN F;  3V4G A;  2FE3 A;  4UVC A;  2CGP A;  3HSR A;  1ZRC A;  2EJR A;  2CFX A;  3BP8 A;  4M71 A;  4FHT A;  4R8H A;  4EJV A;  2P5V A;  5ED4 A;  1XMA A;  4EV0 A;  2IW5 A;  5HOO A;  3GUD A;  3M8E A;  5DD4 A;  3CDH A;  4M6X A;  1ZLJ A;  4CZZ A;  1WRJ A;  1R1V A;  4I0A A;  3WOD F;  4RGS A;  2PJP A;  2NS0 A;  3U1D A;  1ZG1 A;  1RUN A;  5CVR A;  5JI6 A;  2EFQ A;  4OOI A;  4EJT A;  2EFO A;  3CJN A;  2HKO A;  3F23 A;  1D5V A;  4PGH A; 
#chains in the Genus database with same CATH topology
 4HNU A;  2WC2 A;  3QP6 A;  1XGM A;  3VFZ A;  4YEJ A;  2LKX A;  3JTH A;  1BC7 C;  3AFH A;  2KLO A;  4U0V A;  1D0X A;  1RES A;  3M8J A;  1ETY A;  4XRM A;  2KJB A;  3ZN1 A;  1KGS A;  2F4O B;  2P6S A;  2E36 A;  2NS8 A;  5K5R A;  3R4K A;  4E7S A;  2J5O A;  3PM1 A;  2QA4 I;  3Q0W A;  2XUB A;  1KQ0 A;  2A3S A;  1PUF B;  3TO9 A;  1WZ2 A;  4D1Q A;  1IRZ A;  2DYR H;  1ORK A;  4KYW A;  1BC8 C;  1FJL A;  1TP4 A;  2A61 A;  2YX4 A;  2RRE A;  2TCT A;  1TW3 A;  4BY7 J;  4Q4Z F;  3I59 A;  2XF7 A;  3BTC A;  3RKX A;  5L3F A;  2I10 A;  3GTP J;  1BA5 A;  3MAJ A;  5AIQ A;  3MZH A;  1XDS A;  2ZME A;  2QEX I;  4V2G A;  3I0T A;  3WTS C;  2CO5 A;  2DJI A;  5B1B H;  2DPD A;  1IN5 A;  3L2C A;  4WK8 F;  3S2H J;  3CDI A;  3QPL A;  5D4S A;  1QVT A;  3HHH A;  4BDY A;  2L4M A;  3MVP A;  4D5F A;  2UXN A;  2QKL B;  1YJN I;  1Z3X A;  2F5D A;  3HUG B;  2L2O A;  4AIK A;  1G2H A;  1Z91 A;  1TWC J;  3K9T A;  5LGN A;  3RJP A;  1SD7 A;  1X1P A;  2YS9 A;  3IH4 A;  2O6G E;  2VL8 A;  1F4K A;  3OYN A;  2VJ4 A;  1HLV A;  2ZO4 A;  2HOE A;  4XN3 A;  2GWR A;  1IAW A;  4IXA A;  2LSO A;  1V5E A;  1YHQ I;  2NXN B;  2XAS A;  3PJR A;  5D4R A;  5E8I A;  3MKW B;  3CLQ A;  5E18 F;  3OS0 A;  4C9Y A;  4FTH A;  3L2V A;  1ZYR F;  2LBF B;  3S2W A;  1H8A C;  4ESB A;  5J6X A;  1B4A A;  1KON A;  2K40 A;  3RI4 A;  2KL4 A;  3K4B A;  5LGU A;  1R00 A;  1ZTR A;  5GP9 A;  5LHI A;  1LE8 B;  5EZG A;  4KNY A;  3OOP A;  2JA8 J;  3ABM H;  4M73 A;  2LRE A;  2XHK A;  2HFH A;  3RCO A;  3JRD A;  2B9S A;  1SVL A;  2E2H J;  2BW3 A;  4Q5S F;  3JRG A;  1QZE A;  5ICC A;  3LNQ A;  1UFM A;  4CYC B;  2XC7 A;  1RC9 A;  2LY1 A;  2WY8 Q;  4ENM A;  4IRI A;  5B5E C;  2JA6 J;  2ZJR F;  4LOC A;  2R93 J;  4CCK A;  5CVU A;  1BR2 A;  2QVO A;  4U87 A;  2VKH A;  3K6G A;  1JJ6 C;  3VYR B;  5HS7 A;  5TRD A;  3R61 A;  1QHH D;  2M87 A;  3K10 A;  3T8R A;  2HZT A;  3OIQ A;  5KCM A;  2HQ5 A;  1DPU A;  3ERM A;  2JPB A;  3RKQ A;  2VE9 A;  2OUM A;  5EZH A;  2BBY A;  3V7C A;  4PSX A;  2X6X A;  1HF0 A;  3GFI A;  1X1B A;  3K1M A;  4W97 A;  2P7C B;  5HDN A;  4BUP A;  1R4M B;  3ERE D;  1HDD C;  3Q9V A;  3DTK A;  3W3C A;  1QZY A;  4L5J A;  1VFC A;  4BEH B;  2M4K A;  4RGR A;  1GXQ A;  3GTJ J;  4G6T B;  4XN0 A;  2ISZ A;  2BY1 A;  4NQW A;  2PMZ N;  4UUT A;  1FOY A;  3S3M A;  4Y15 A;  2B0L A;  2JA5 J;  4E70 A;  4NNJ A;  2W4S A;  1OKR A;  1CQT A;  3H9Q A;  4DYR A;  2LC2 A;  3HTU A;  4PJJ A;  3KYL A;  3JRB A;  2QSG X;  1EV7 A;  3CQZ J;  4A69 C;  5H2F C;  2BY0 A;  4AD9 A;  3L1P A;  2R4G A;  5E3L A;  4HF0 A;  3Q0V A;  3CZ6 A;  5ILV A;  5FKO A;  5CKT A;  1JGS A;  4NB5 A;  1IF1 A;  4X6A J;  1FBS A;  3WGH A;  4A3L J;  1O57 A;  2HYJ A;  2JRT A;  2WTE A;  4XLF A;  5E1X A;  4M9X A;  2ZXW H;  1MH3 A;  3LA7 A;  2FEZ A;  3H3Z A;  1U9N A;  4KIB A;  4RAF A;  1HA8 A;  5JLW A;  3BZ6 A;  2EIN H;  4FT8 A;  3BCA A;  2EV6 A;  3I9V 2;  3CF5 F;  4C30 A;  2DT7 B;  2KT0 A;  3OY9 A;  1KQ8 A;  1WJA A;  1OCC H;  1G3W A;  1WJE A;  1GDT A;  5DCF A;  1XMK A;  1VQP I;  1AKH A;  1OYI A;  2ESN A;  2FOK A;  1QQI A;  3S1M J;  4XKV A;  5EEG A;  2QCO A;  1GUU A;  2VQG A;  2A68 F;  2HOA A;  4N4O B;  2KJC A;  5J4Y A;  1X19 A;  3K0L A;  2CSO A;  3GF2 A;  3DKX A;  2EZI A;  3HGG A;  1TZL A;  2R5Z B;  5L3D A;  2DFI A;  4ZC3 A;  3JTG A;  1H0M A;  2RAE A;  5FRN A;  3MN2 A;  4II3 A;  1OJL A;  2QSF X;  4UXN A;  1YW7 A;  3Q9S A;  2HNH A;  2PMH A;  1P6R A;  1IXS B;  3NEU A;  3GYH X;  3P9I A;  1HSJ A;  1MD0 A;  2KZV A;  4KIC A;  1YO5 C;  2VPL A;  2Q1Z B;  3H5R A;  2G0E A;  1Z21 A;  4I2O A;  3HYI A;  4JBA A;  5FD6 A;  4PFO A;  2QQA A;  1J09 A;  1FP1 D;  4B47 A;  5HNH A;  4IHS A;  1IXR C;  1O7L A;  1OPC A;  1YIO A;  2HOT A;  3D5L A;  1IGN A;  2R7X A;  2GZW A;  4WCG A;  3GTK J;  4IVN A;  3K2A A;  2CUZ A;  2FML A;  4LG0 B;  3KFW X;  4ZYH A;  4G7H F;  2DMU A;  2FRH A;  2HYG D;  2X48 A;  2XDV A;  4M6V A;  4UUV A;  2V9K A;  4LGW A;  2LMD A;  1R7J A;  2P5L C;  3DTI A;  1VQM I;  4M3D A;  1TT5 B;  4A5N A;  4ZYE A;  4CO8 A;  2JA2 A;  4BHP A;  1I27 A;  1K61 A;  3UR3 C;  4DZP A;  1X1A A;  3DP7 A;  2F5F A;  1EJ9 A;  4X0G A;  5DUI A;  2KRH A;  3E5X A;  2BY2 A;  4V2F A;  1YW8 A;  2EFP A;  4JK1 X;  4YII A;  3HOS A;  2VLA A;  2BVL A;  3PO3 J;  3LSK A;  2EZL A;  2FUG 2;  1WPK A;  5H6R A;  4D9J A;  1X2M A;  2KDZ A;  4A2U A;  1OCT C;  5JVT A;  3LSR A;  3TW6 A;  2OZU A;  2RN7 A;  3F8M A;  3GCM A;  1BI2 A;  3K70 D;  3GEZ A;  1TBX A;  4N4N B;  4ESJ A;  5KK1 A;  2A6H F;  2MYS A;  4ENN A;  2Y0S N;  1WJ5 A;  1R6R A;  3PNY A;  3ZMS A;  3HOV J;  2L9R A;  1LB2 A;  3NWT A;  2CS3 A;  1QPM A;  2DBB A;  2M2E A;  2ZBK A;  4Z2Y A;  3SFZ A;  2P0W A;  3E6M A;  2H8W A;  1VQ8 I;  4UV8 A;  3FKI J;  1AHD P;  1G6N A;  3HBL A;  4S05 A;  2NVT J;  1YJ9 I;  1A35 A;  4Y3O A;  2V6E A;  2D2W A;  3WHB A;  3HTS B;  1R5I D;  2ADU A;  3BTJ A;  3HOT A;  2Y9Z A;  3I4N J;  3U21 A;  4IL6 C;  4N9I A;  4IZZ A;  1F43 A;  2ZJQ F;  3HUG A;  4BE0 A;  2HVR A;  2ZNY A;  5D5W B;  5F6F A;  3P9C A;  3CME I;  1BI1 A;  5E3O A;  1BIB A;  2CH0 A;  2ZNZ A;  1T0F C;  1NG7 A;  2DYS H;  1Y8R B;  5K5Q A;  2JRM A;  4ETS A;  2VBW A;  1YQA A;  1F5T A;  3BG7 A;  3KP7 A;  3OYK A;  1FZP B;  4HV5 A;  2OQG A;  4ITV A;  2KHM A;  1GVD A;  1MJA A;  1JUP A;  4XON A;  4YFX F;  1FYM A;  2MFZ A;  2LBF A;  3I58 A;  2GXG A;  3L2U A;  2PJR A;  3IHU A;  1D8K A;  4WXD A;  2OD5 A;  3VYS B;  1TL8 A;  4L0Z B;  1IV8 A;  2A5W A;  5FLX Z;  2ELK A;  3QU6 A;  5HLT A;  1U8B A;  1LFP A;  2STT A;  3H9J A;  3HOU J;  1MND A;  1VQ7 I;  3Q0U A;  1MBG A;  4AIJ A;  2K3P A;  2DOA A;  5EDN A;  3G1L A;  5FRO A;  1E2X A;  1FSH A;  2MBF A;  5GTI C;  1S6L A;  1SVM A;  1A31 A;  3S1Q J;  3TDZ C;  1VQ9 I;  1B72 A;  3JW4 A;  2AXT C;  3TED A;  1FTZ A;  3VEP A;  5FLX K;  1LNW A;  3DWL E;  4YEL A;  2OU2 A;  2XRO A;  4Y4R A;  1S7A A;  3QYF A;  5JR3 A;  3I54 A;  3DEU A;  2NVY J;  1LFB A;  4BXF A;  2E19 A;  1UMQ A;  3FXL A;  3QQA A;  2M30 A;  2VQL A;  2VKE A;  3DPU A;  2VQH A;  3L2R A;  4KA4 A;  1OLT A;  2E1O A;  3LSJ A;  1IN8 A;  4A3E J;  2R7R A;  5E3N A;  1JHF A;  5HDG A;  1NK2 P;  2R7Z J;  1OCO H;  1QVU A;  3I59 B;  1ZH5 A;  1Y56 A;  3E7L A;  4EJW A;  3IKV A;  4RGU A;  4WF2 A;  2JT1 A;  2FXA A;  1MMS A;  4B4C A;  4PJ0 C;  3PO2 J;  2KDO A;  4MFD A;  4MEY F;  2M7A A;  4XLH A;  3JRC A;  1ZRE A;  2QQB A;  2L54 A;  2BZT A;  1DP7 P;  2RNJ A;  3KP5 A;  5M5Y J;  1X1C A;  1WKM A;  2FF4 A;  1B59 A;  3IKT A;  3HEF A;  2LY9 A;  3FM5 A;  1R49 A;  2LLK A;  4D7N A;  1XGN A;  2MC4 A;  2EZK A;  3H5N A;  3O6B B;  5DD8 A;  3JRI A;  1FNN A;  3KET A;  2DOF A;  2D5V A;  3G1M A;  1A6I A;  4HBL A;  1LJ9 A;  4PSW A;  2E60 A;  2F48 A;  3W6K B;  3CC4 I;  2HTJ A;  4BY1 J;  2XGE A;  3CUO A;  1JJ8 C;  5IYB J;  5GAD J;  3DBL B;  3IRQ A;  1ZRD A;  4PDK A;  3U9G A;  4M72 A;  4H4K C;  4BQQ A;  1W7P A;  2AQF A;  2XPV A;  1LPQ A;  2Y31 A;  4MIM A;  2VKD A;  1DGW Y;  3TP3 A;  2W00 A;  3GVA A;  3U2R A;  1OR7 C;  3O8G A;  3B02 A;  4J00 A;  3M1E A;  1ZK8 A;  3WGI A;  3JR9 A;  3OIO A;  1Z05 A;  3ZPL A;  2HEO A;  4XKW A;  1I3Q J;  3ML6 A;  4UV9 A;  2H6B A;  2BW3 B;  2R7D A;  4BAY A;  1MDM A;  4C3I J;  2KPM A;  1XPX A;  1T56 A;  1Z3Y A;  4YIF A;  4XIC A;  2IPQ X;  3DU6 A;  2M4G A;  3R0J A;  4KIG A;  2IGK A;  1TLH B;  1WJD A;  2FBH A;  3PFY A;  1FPQ A;  3ABL H;  3CMA I;  2CW0 F;  3B6C A;  2L9V A;  2LNB A;  4IOA F;  1W5C C;  1K4S A;  5LEK A;  1LFU P;  3ZQI A;  5K7H A;  4P55 A;  4EQQ A;  3CP2 A;  2GIZ A;  4CA0 A;  1YLF A;  3GTL J;  4RS8 A;  1N75 A;  1R1U A;  5GAE J;  2IS6 A;  3PUB A;  3T8T A;  3G6E I;  4R1H A;  2DPU A;  2Z16 A;  1JT6 A;  4AID A;  3V8K A;  4CXF A;  1FMW A;  1WVR A;  2KRC A;  5B66 C;  5HVQ C;  4MLO A;  4M6Y A;  5KHD A;  3WU1 B;  1E3O C;  4AWX B;  2M9H A;  3TP0 A;  4LG0 A;  5CLS A;  4MHG A;  2V6C A;  2CV2 A;  3GTG J;  3IH3 A;  3OYF A;  1JI8 A;  3I64 A;  3BR1 A;  2EV5 A;  4A3G J;  2L5Q A;  1HW5 A;  3A4C A;  1R5H A;  2W25 A;  1Z7L A;  4XR6 A;  4JX4 A;  1HKS A;  2F5V A;  3ULQ B;  5TGT A;  4RB2 C;  3CJQ B;  3EDP A;  4BQO A;  1KU2 A;  1H9T A;  1QA6 A;  3HM5 A;  2ZCW A;  3HSF A;  3BOQ A;  1VQO I;  2KZG A;  4UHT A;  4AVP A;  1LDK B;  5B1A H;  2A05 A;  1PP7 U;  3RDI A;  3TO7 A;  3HKZ A;  4HQM A;  5ERI A;  2VBX A;  3ZN0 A;  1POG A;  1YS7 A;  3ZOB A;  1T8I A;  3F3X A;  3LMM A;  1BOA A;  2W84 A;  3KP6 A;  2X1E A;  4L0Y B;  4E7H A;  3H0G J;  3NQO A;  4DYQ A;  1I39 A;  2IA2 A;  1H9G A;  3I71 A;  2O5R A;  3J80 K;  3C2G A;  5J1R A;  3MWM A;  5BQT A;  2L01 A;  4MTD A;  4PJN A;  3H35 A;  4XKB A;  2DDA A;  3FDY A;  3G3Z A;  5H20 A;  4FE4 A;  1ZAO A;  4RLF A;  3PQK A;  2IGN A;  1V5G A;  1RKT A;  1Y0N A;  4TV7 A;  3RZD J;  3J7Y J;  3F6V A;  2GQQ A;  2ZSH B;  2VQC A;  3LOC A;  3HC7 A;  3LQQ A;  3H92 A;  3P5J A;  2UWM A;  2LOO A;  4LLN A;  2BE5 F;  3GW2 A;  2AO9 A;  5FFX A;  3OL4 A;  2NRA C;  5LLQ A;  3ZQL A;  2NYX A;  1ON2 A;  1FLI A;  2IVM A;  2GXB A;  4HDU A;  1OCR H;  4M74 A;  2L7Z A;  1ULY A;  1VQ5 I;  4I98 B;  2VOO A;  3F22 A;  3WGG A;  1PDN C;  2QSH X;  4GFB A;  2XB5 A;  1VF9 A;  1YTY A;  1TQI A;  4CCL A;  4HF2 A;  5CVJ A;  3L00 A;  4IHT A;  1X58 A;  1BBY A;  2M45 A;  1B1B A;  4OAZ A;  2DK8 A;  2ELJ A;  2Y69 H;  1GV2 A;  4IHV A;  2VN2 A;  1A6Q A;  4LB5 A;  2L3D A;  1BOB A;  5F0F A;  4BBR J;  4RA2 A;  4J19 A;  4BL0 B;  3RIR A;  2NS7 A;  2WA0 A;  4KN7 X;  3GTM J;  2ZXH A;  1HQC A;  1O7F A;  1SFO J;  1DDN A;  1R4N B;  3PFI A;  5DEQ A;  2FMY A;  2UZK A;  2IRF G;  1QU3 A;  2XGX A;  2VOP A;  5LD2 C;  1KYZ A;  2VJI A;  1GVJ A;  4PJL A;  1Z7U A;  2RQQ A;  1T0F A;  2O3F A;  2OAZ A;  3BJO A;  1Q1H A;  4I01 A;  2CQX A;  4W1U A;  3OYC A;  5D8L B;  2HR3 A;  1UCR A;  3GME A;  4HYE A;  4G94 A;  4JOM A;  3HRM A;  4RBO A;  1QHG A;  3W6J B;  3SDG A;  3CMM A;  4UVB A;  4B3X A;  1O3S A;  2W1O A;  2HQA A;  1FYL A;  1UHW A;  2OA4 A;  4XOP A;  4A12 A;  1REP C;  2VC1 A;  2KIU A;  4NC8 A;  2LH9 A;  2LFB A;  2IEK A;  1OYY A;  2BGC A;  2JQ7 A;  3W2W A;  5BS6 A;  3WHC A;  5GPC A;  4B44 A;  1U2W A;  1XCB A;  4IOC F;  1XN7 A;  5IYD J;  4EM1 A;  3ECH A;  3A02 A;  2OCE A;  4RB3 C;  3KZI C;  4HA8 A;  4IJA A;  2MLG A;  4U0Y A;  2L4A A;  3SZT A;  1B9N A;  2NVX J;  3WU0 A;  3KEY A;  2CW8 A;  1K6O A;  4GO1 A;  3KEO A;  3ZMV A;  2I8D A;  4LG3 A;  2EIJ H;  2K9Q A;  4WWC A;  4PGG A;  1XX5 A;  2E71 A;  2PI0 A;  4LK1 F;  4U7D A;  4PFP A;  5ICG A;  3PIP F;  2DDB A;  4XLE A;  2LVS A;  3OYD A;  1JTX A;  1XGS A;  3QU3 A;  4JYK A;  5EG0 A;  2GIV A;  3M9A A;  4LIV A;  3AG3 H;  4A3I J;  3O3K A;  1ZG5 A;  2VJJ A;  4G7O F;  2O61 A;  4XKC A;  3S32 A;  4U7B A;  2KIF A;  2VT2 A;  3GX4 X;  1R58 A;  4O6J A;  1I6H J;  2CV1 A;  2E7W A;  4LIT A;  2KQR A;  5JLX A;  5F27 A;  2ZSI B;  1TNT A;  3PL8 A;  3V7R A;  4BS9 A;  4FX4 A;  5GAG J;  3OSG A;  1FT9 A;  1RNL A;  5FD5 A;  3SHF A;  4JX5 A;  1OCZ H;  3RKW A;  2PJR B;  1BI0 A;  1JKO C;  2DTR A;  2DO7 A;  5BPD A;  3DEW A;  3LSG A;  4B09 A;  5EEA A;  3NWS A;  2JVG A;  2C6Y A;  3F8N A;  4R79 A;  3TDU C;  2NOG A;  1W0U A;  4OIO F;  1TWG J;  5GTH C;  2D1V A;  1XCV A;  4IRH A;  1J5Y A;  4KIT B;  3WTW C;  1JHH A;  5FJ8 J;  3E6C C;  4IX7 A;  3FMR A;  4ZTF A;  2H27 A;  4BE1 A;  5F0C A;  2EB7 A;  4FCY A;  4D5C A;  1B72 B;  2XAF A;  2VBZ A;  1E17 A;  3DPL C;  2J5P A;  1PVE A;  4AYB A;  2OCC H;  5L3B A;  2EQR A;  3GXO A;  1U5T C;  2KFD A;  1YIJ I;  2XB0 X;  2TRT A;  4EVI A;  2KP6 A;  1P4W A;  2L02 A;  4ZJZ A;  1OR7 A;  3C1D A;  3F6O A;  1X3Z B;  4DJA A;  3FXQ A;  1IUF A;  3LFK A;  3QOE A;  5CVI A;  4KT6 A;  2YR2 A;  3CC7 I;  3MQ0 A;  3LQR A;  2WV0 A;  2OQR A;  4HEA 2;  1SAU A;  1MMN A;  4ANJ A;  1XB4 A;  2YX7 A;  3IWF A;  4M9Z A;  1V5F A;  2GOX B;  2XAQ A;  3GZ5 A;  1JTY A;  1WGX A;  2ZXI A;  2X6W A;  1OMI A;  1CF7 B;  3CCQ I;  4P5O A;  1RR8 C;  2JTV A;  1RZ4 A;  1S8N A;  3M4O J;  2M8G X;  2DXI A;  3D5R C;  1YIT I;  1U5T B;  1W7P D;  2XAU A;  2IA1 A;  2B63 J;  3MEX A;  3MMY B;  2EIK H;  2KIM A;  2OTL I;  3SFI A;  2EK5 A;  3B73 A;  2HI3 A;  2XAG A;  1T38 A;  3KP3 A;  4CDG A;  5BOX A;  1S7O A;  2BVM A;  4RAG A;  1I1S A;  2JSP A;  2AXL A;  2GA1 A;  2OZ6 A;  3UKG A;  3DCF A;  5L3G A;  2EA2 A;  4EM0 B;  1BW5 A;  2M0M A;  3WTZ A;  1XTA A;  1Z9C A;  4CUG A;  2LTP A;  1T33 A;  1Z0X A;  1R5G A;  2DMN A;  2PBI A;  4EM2 A;  1W7P B;  4LFU A;  3HL2 A;  2QQ9 A;  2WAD A;  2YU3 A;  3HRT A;  1JKR C;  3HHG A;  3CDL A;  2NOJ B;  5TJJ A;  1SD4 A;  3QPT A;  5IP7 J;  1K6Y A;  4QWQ A;  1TT0 A;  3K2Z A;  3L7W A;  1BN5 A;  1W5T A;  3WTY C;  2L0K A;  4BQN A;  1J75 A;  2DQR A;  1JKP C;  3I56 I;  2K3F A;  4BXX J;  1J7K A;  2E7X A;  3N05 A;  4L9T A;  5F64 A;  3F9K A;  4RM2 A;  1U0J A;  3C2B A;  5IOZ A;  3AG1 H;  4ZZD A;  1MDM B;  2OPT A;  3W2V A;  1QPI A;  4P1W A;  2IS1 A;  3WG7 H;  3TMO A;  1KQ9 A;  1WJF A;  3BZC A;  3LSP A;  1Z6T A;  1R71 A;  1YYV A;  2XF6 A;  3GTQ J;  3E5U A;  1KZH A;  1N25 A;  4CYD A;  2CW7 A;  2IA0 A;  3L09 A;  5IPA A;  2V9V A;  1QZZ A;  2Z9O A;  3EET A;  1B9M A;  2ME0 A;  3RKY A;  3OYJ A;  3CP8 A;  4CCO A;  3HKZ N;  3AAF A;  5FKM A;  2XF5 A;  3SEQ A;  3WTX C;  3F8B A;  1DQU A;  4RB1 A;  2ETH A;  1BW6 A;  1N78 A;  1FMV A;  5D6E A;  2X85 A;  4Z6Y A;  3S3N A;  3BTL A;  4FAS D;  4DGW B;  4MQ9 F;  1HKT A;  3TW7 A;  5JHU A;  3G73 A;  1DP3 A;  2M8E A;  1V3F A;  3RPQ A;  4D7M A;  4IPA A;  4F92 B;  1G3T A;  3ZGK A;  4UY8 I;  4I02 A;  3KZY A;  2VC0 A;  4G9Y A;  1UJ8 A;  5B3S H;  2NNY A;  4JQF A;  2JPC A;  1D1A A;  3FF5 A;  2JA7 J;  3DU5 A;  5D6F A;  3WE3 A;  5CJ9 A;  5CYV A;  4LK0 F;  3KZZ A;  3V8J A;  4Q47 A;  3FWE A;  3BRO A;  3LL7 A;  3H3V K;  2K7L A;  3E1S A;  3ZQG A;  1G3Y A;  2QBY B;  1JE8 A;  4UB8 C;  4JP0 A;  3AG2 H;  1JKQ C;  1Z77 A;  2MD5 A;  3C7J A;  4JX6 A;  2HPM A;  5F08 A;  3QRF F;  1BIA A;  1ETQ A;  1IW7 F;  3CES A;  2E1N A;  2HXO A;  3CCM I;  2VE8 A;  4AIH A;  1YFH A;  5IT9 Z;  2E35 A;  4GGG A;  5EGO A;  1NK3 P;  4OMZ A;  1W36 C;  4ZZL A;  4XID A;  2LDU A;  4N0B A;  1AU7 A;  2LKP A;  1B8I B;  3TBI A;  4C3J J;  2P81 A;  2L9N A;  1U78 A;  2MH9 A;  3TOB A;  1GXP A;  3NRV A;  3JSP A;  2X0L A;  1YG2 A;  4CZC A;  5D5V B;  1EH8 A;  2Q2E A;  2AQE A;  2TDX A;  4G7Z F;  2ME6 A;  1ITY A;  1K78 B;  3ASN H;  1R23 A;  3BJA A;  2HDW A;  1W1W E;  1P92 A;  3IL2 A;  1YW9 A;  2JZY A;  3R0A A;  3EQL F;  1VZ0 A;  1FY7 A;  1MMA A;  2O0Y A;  3S16 J;  1SMY F;  5HS9 A;  3J7A Y;  2BOL A;  3U1K A;  4XL9 A;  3D0S A;  2MW8 A;  1XC5 A;  1O3Q A;  1T98 A;  5IYC J;  1P2F A;  2M5W A;  1D5Y A;  4BHB A;  2PMU A;  4ENK A;  1OQY A;  2GOM A;  4KIF A;  3LA3 A;  4BQA A;  3EUH C;  2XKP A;  1WH5 A;  2DN0 A;  2CQ7 A;  5J8C A;  2DLL A;  1WI9 A;  5LHG A;  4QTR A;  4HST A;  2XIG A;  4G12 A;  5DM6 F;  3CCR I;  4E6K G;  1PJR A;  3EUK L;  4ASN A;  5K5O A;  2YUS A;  4K2E A;  2K02 A;  1KYW A;  1ENH A;  2A6E F;  2OC6 A;  3RQI A;  2HVS A;  2DAO A;  4XOR A;  2ICW G;  1S7E A;  1BL0 A;  1TW2 A;  1LVA A;  3LST A;  3F0C A;  3OYG A;  3ZRG A;  1NHA A;  2ACJ A;  1FOX A;  1EH6 A;  3O8H A;  3FXR A;  3JRA A;  3OYB A;  2LF8 A;  1S9H A;  3PSF A;  2FJ1 A;  1FTT A;  3FM3 A;  3NAU A;  3ELK A;  1FEX A;  3RPU A;  3KP2 A;  2K4B A;  4LJZ F;  3E97 A;  3HZJ A;  1UHM A;  1XSX A;  2CQK A;  2R7S A;  3ABU A;  3GZ6 A;  4C2T A;  2DOD A;  3REO A;  2JK3 A;  4ZYA A;  1SD6 A;  2HVQ A;  4RMN A;  1MMG A;  5E8G A;  3E3V A;  3BC8 A;  4IEJ A;  4B8X A;  2LRD A;  2JMW A;  3D5S C;  3ZP5 A;  4DIQ A;  4DZJ A;  4IQJ A;  4EGY A;  1SFU A;  1XSV A;  1MMD A;  2ZC2 A;  3D1N I;  1LEB A;  1VQ4 I;  3IC7 A;  1ETK A;  4FQG A;  1BJA A;  3JAM Z;  5E79 C;  4A6D A;  1SAN A;  1TNS A;  1PP8 F;  2A5Y B;  4NC6 A;  1CF7 A;  2HXI A;  3E6B A;  2QYO A;  4I09 A;  2KMU A;  2Z1D A;  5DDG A;  2P8T A;  4IHX A;  1U5T A;  2XGD A;  3FXJ A;  4OMY A;  1YX5 A;  1OYW A;  3BG3 A;  5EG0 B;  1RRJ A;  4O3M A;  4Y52 J;  2PN6 A;  1DPR A;  1WJB A;  2WB1 A;  4BAC A;  2CG4 A;  2F6C A;  2MGQ A;  3DKW A;  1XSD A;  5DS9 A;  3DFG A;  1S29 A;  5ILS A;  3TKY A;  3K4L A;  3HRU A;  3OOU A;  4AU7 A;  2MAB A;  1OFC X;  2IXS A;  3IV5 A;  4I76 A;  3CTA A;  4HZF A;  1FYK A;  4HLX A;  1Y39 A;  4Q48 A;  1QO0 D;  2YU9 J;  3K1N A;  4F55 A;  2K86 A;  2ZFW A;  2ISY A;  3MKL A;  4HX7 A;  4L18 B;  1IO2 A;  1BJZ A;  4EJO A;  2R3S A;  2K9L A;  1YRN B;  4QPQ A;  2R92 J;  4G8X A;  1SFX A;  4XRS G;  3S1N J;  1MH4 A;  3VOE A;  3BWG A;  2FOW A;  2EBI A;  4A3B J;  3OS2 A;  4HDV A;  1XS9 A;  1G4D A;  1FBU A;  2W57 A;  3WTV C;  2VBY A;  4A0X A;  3K69 A;  5EYR A;  3AL0 C;  4CCN A;  5HLI A;  2CRG A;  4GCV A;  3BY6 A;  5IP6 A;  1ONV A;  4HOB A;  3SJM A;  1WWX A;  2ESH A;  5DV5 A;  3RZO J;  2EZH A;  2R7Q A;  1XG1 A;  4ZH4 F;  3QPS A;  4Y33 A;  1D8J A;  2XSJ C;  2K85 A;  1MBJ A;  1WJC A;  4CCM A;  2VT3 A;  3I4M J;  1ETO A;  1X3U A;  4E7I A;  3FXO A;  2HQR A;  4A6E A;  3HOX J;  1K4T A;  1ZGW A;  3FBI B;  2DMT A;  3CO7 C;  4AM3 A;  4RAY A;  4A3K J;  2V26 A;  1VQN I;  3CD6 I;  2DA3 A;  2IS4 A;  2QUF A;  2XPW A;  3ISP A;  3SQN A;  3AL0 B;  3FIS A;  3DXJ F;  2PFB A;  3I55 I;  1ETX A;  4N9H A;  1FSE A;  5AON A;  3BCB A;  3RQ4 A;  4J01 A;  1Y0U A;  1ZHF A;  1XGO A;  2EA4 A;  3EUA A;  4OU0 A;  2P4W A;  4BKX A;  4KT5 C;  1D0Y A;  3B6A A;  4BU2 A;  5KAI C;  1IN6 A;  2DA2 A;  3O2P E;  3TO6 A;  3OYI A;  2K9S A;  1HBX G;  1K83 J;  2RNG A;  2QBY A;  3KLN A;  2LP0 A;  5L3C A;  2EPF A;  4E7J A;  3CCY A;  2CFO A;  1WI3 A;  4CCJ A;  2N8G A;  4EGZ A;  3GLX A;  1A04 A;  1LDD A;  5LGT A;  3DBR B;  3QP5 A;  5GPA A;  2KKO A;  3BPV A;  3OYL A;  1XMX A;  3H5A A;  3QOP A;  2P7V B;  1B8I A;  1YE9 A;  2JWT A;  1VI0 A;  2E2J J;  5DYM A;  2K27 A;  2UXX A;  2DA5 A;  4B1R A;  4BYY A;  5EF6 A;  2L7F P;  1F1Z A;  1T08 B;  1SMT A;  3BR3 A;  4XLN F;  1D1C A;  3G71 I;  1ERD A;  2RVC A;  4UB6 C;  3BZK A;  1MSE C;  2LY2 A;  2FA5 A;  4QLC U;  1LUJ B;  4L9N A;  1P9Q C;  3I4P A;  4BGD A;  5LEJ A;  1K78 A;  4DQ2 A;  4EEF G;  4LLG F;  3BG5 A;  2DW4 A;  3I53 A;  3KPH A;  2OF7 A;  4M3G A;  2BY3 A;  1ZEL A;  2WBM A;  2H94 A;  3M7G A;  5HLG A;  4RGX A;  3RTR A;  1H89 C;  1G3S A;  4NUB A;  4KJZ A;  1FWZ A;  4LD5 A;  3HSE A;  3VYT B;  2DFH A;  3ZMT A;  5D5U B;  3OS1 A;  3VSL A;  2DT5 A;  3EYY A;  3HXL A;  3HIF A;  2QKM B;  2RDP A;  1EA3 A;  3BQZ A;  3SZG A;  2L7K A;  2O03 A;  3CCJ I;  4MTE A;  3FK6 A;  1V55 H;  3VOD A;  4YRV A;  2UV1 A;  1P7I A;  5HS8 A;  3GO5 A;  3MD2 A;  4S0H B;  4DYC A;  2F4M B;  2QLZ A;  3CJR B;  3VWB A;  3ZMD A;  1MSF C;  3JCU C;  3QYE A;  2DA7 A;  2G9W A;  2WV1 A;  3T5X A;  1A5J A;  2W48 A;  4P9U A;  1P4A A;  4C3H J;  4A3M J;  2PEX A;  2LG4 A;  1MJ9 A;  2VPR A;  4CH7 A;  3CCE I;  1RET A;  4ESF A;  2Z99 A;  3LAP A;  4EAT A;  2R5Y B;  3ECO A;  2K9N A;  5DCM B;  1QRY A;  2MA3 A;  3KE2 A;  5CQG A;  2W24 A;  5EEH A;  5IT3 A;  1FIA A;  2EV0 A;  2IP2 A;  5CQE A;  5JFR A;  1R1T A;  2JVH A;  5F1J A;  4I6Z A;  1TQP A;  2FU4 A;  1S72 I;  2HTS A;  2V79 A;  3DLA A;  2Z3Y A;  2LYC A;  4P96 A;  3GFJ A;  3ZXS A;  3VB2 A;  2VJ5 A;  2Y0S A;  4F91 B;  4CIC A;  3JRF A;  4IHW A;  2CUJ A;  1R36 A;  5F0H A;  3EUH A;  2M0C A;  2HQN A;  2ZB9 A;  3QWL A;  1MNE A;  5ICF A;  3FHN A;  5LRR A;  4OIR F;  2Q8K A;  3S93 A;  3BTI A;  4ZDP A;  1IRG A;  3A01 A;  1EKE A;  3TOA A;  4BJT A;  4UUS B;  2QEN A;  1ACI A;  2PX9 A;  2R7T A;  2BHY A;  4MNU A;  5EGO B;  5FO5 A;  5KVR A;  1DUX C;  3ZMZ A;  5BNG A;  5FFZ A;  3WU2 C;  3J81 Z;  1RUO A;  2DU9 A;  2K4J A;  1S3J A;  2WY7 Q;  3DV8 A;  1X1D A;  1Z67 A;  3GFL A;  3QYB A;  1MBK A;  1GLN A;  3FX3 A;  3S8P A;  2PQ8 A;  3IAS 2;  4GXO A;  4M3B A;  2Q2E B;  2WAQ A;  2QQ8 A;  3MZY A;  3FZV A;  1TWA J;  5FLM J;  3F21 A;  1UB9 A;  3IH2 A;  2H1L A;  3OYM A;  1BI3 A;  3ASO H;  3J81 K;  1T6S A;  4MGR A;  2RQP A;  3DBH B;  5FB2 A;  2R7W A;  2I5U A;  2ID6 A;  1F36 A;  3ZQ7 A;  1IUY A;  4G6D A;  1WQ2 A;  2A6T A;  4OWR B;  5CVV A;  1EH7 A;  2LKS A;  3LAJ A;  1ZN2 A;  3J7A O;  3ZMU A;  2F5C A;  2QWW A;  2OJE D;  5IP9 J;  4A3J J;  3GTO J;  4MEX F;  3HGY A;  3OWT A;  3G4S I;  5GAH J;  4XSZ F;  4IRG A;  3H1C A;  3ZQQ A;  4HRI A;  5K1Y A;  3BR2 A;  1D3Y A;  1RKW A;  3ZQF A;  2NAZ A;  3FIW A;  1LQ1 A;  4GRI A;  3Q3S A;  4M3F A;  4ZDL A;  1IC8 A;  1DU0 A;  4ZYD A;  3RPU D;  3M8F A;  4MQV A;  2ELH A;  2Y2Z A;  4E7Z A;  2RC4 A;  2XAJ A;  4DNC A;  2MC3 A;  1O3R A;  3V42 A;  3BG6 A;  2Y9Y A;  4YIR X;  1XD7 A;  3CCV I;  1YRN A;  4F52 A;  3MZ8 A;  2XV4 S;  3ONQ A;  3SXY A;  5M3M J;  2R7V A;  5C44 J;  2IT0 A;  4I99 C;  3JRE A;  1UEL B;  2Z5U A;  4GYG A;  1APL C;  3LSI A;  5ILU A;  3BT9 A;  5E3M A;  4XSX F;  2Z2S B;  5HOD A;  1IN4 A;  4XRS A;  5LBQ A;  2FQ3 A;  2ZFU A;  4CHU A;  1G8X A;  2WB1 N;  2H1K A;  2H8R A;  3CO6 C;  1TWH J;  2R7F A;  4QSH A;  1J2X A;  2X6O A;  3BG9 A;  4A5M A;  5M5X J;  4GDF A;  1HST A;  1HW1 A;  3PQJ A;  4ON0 A;  4KFC A;  2OTJ I;  4II2 A;  4HLY A;  3ZQC A;  2VOD A;  2QM3 A;  5FLV A;  4KMF A;  3IAM 2;  5LHH A;  2KRF A;  2GBY A;  3BR6 A;  3LWF A;  3V7S A;  1BM9 A;  1L3L A;  1SFE A;  3FXK A;  1J59 A;  1X4O A;  2M34 A;  2Y75 A;  3F8C A;  3S14 J;  1RIO H;  1IRX A;  1OCP A;  2R7O A;  1IDY A;  4GYI A;  2DMQ A;  4O5V A;  1J9I A;  3FXU A;  3Q5F A;  5FRM A;  2X9D A;  1TWF J;  2AS5 F;  4L5E A;  5FKN A;  1ZAR A;  2E1M C;  2W85 A;  1DGR M;  1SEU A;  4CSW A;  4EMS A;  1P4X A;  2EIL H;  2G7U A;  3CUQ C;  1KU9 A;  3LSM A;  1ZG3 A;  4FIS A;  5JVG F;  1U8R A;  1K79 A;  2HKX A;  2BXZ A;  1E3H A;  3VDX A;  2DMP A;  3K4N A;  2Y0M A;  4L9J A;  2XKO A;  5J47 A;  4PK4 A;  4PUS A;  1SC7 A;  3OR1 C;  2CJJ A;  2ZKZ A;  1W5S A;  2D1H A;  2XPU A;  1X2N A;  1TTY A;  2XAH A;  1BR1 A;  5BMZ A;  2MSY A;  3FHZ A;  3TGN A;  1ETW A;  1Z6R A;  3GBG A;  4DOZ A;  3GLL A;  3HG9 A;  2DT6 A;  3K4C A;  1SD5 A;  2QZ8 A;  4BJ5 C;  1O4X A;  4DBQ A;  2GLO A;  4HG2 A;  1IRF A;  1ON1 A;  5M5W J;  4RAZ A;  2E1M B;  3KP4 A;  3DEE A;  2EFW A;  1H88 C;  3EPZ A;  1I6X A;  1RPW A;  5E20 A;  4IHY A;  1D1B A;  3CUQ B;  4F7Z A;  1QBJ A;  2AHQ A;  3BDD A;  3T1B A;  1FIP A;  3QOD A;  2ZXJ A;  1G59 A;  1YX3 A;  2V7F A;  2M7B A;  5FKK A;  3OYE A;  3LA2 A;  1NG6 A;  5J8F A;  4E7L A;  2IGO A;  4A3F J;  4X1E A;  3KX2 A;  5J1Y A;  5DTD A;  1F9N A;  1R9T J;  2BXY A;  1YOV B;  4B3A A;  3WTU C;  4HQE A;  4E4H A;  3A03 A;  3T0Y A;  1B6A A;  4S04 A;  3HOY J;  3R6S A;  2E5Z A;  2R0Q C;  4HV6 A;  2VIX A;  4U88 A;  1T2K A;  2HWV A;  3H0D A;  4KN4 X;  2XVC A;  1RI7 A;  5K7Z A;  2BYV E;  2CU7 A;  2E1C A;  4PJM A;  3SZP A;  3UNG C;  4CGZ A;  4AUX A;  2VI6 A;  4EJU A;  2CV0 A;  2HDC A;  2XSD C;  2R5Y A;  5A2Q Z;  1UHS A;  3KCC A;  3FBN B;  5DCM A;  1ZKG A;  3WTT C;  1WH7 A;  2ID3 A;  4F93 B;  1FBQ A;  2DQL A;  1WCM J;  2HS5 A;  3K4K A;  2VB6 A;  1DU6 A;  1UG2 A;  3BPX A;  2V1U A;  1IN7 A;  2DTZ A;  5DUK A;  3OIP A;  1VQK I;  2Y48 A;  1JGG A;  5KAF C;  3BR0 A;  3S3O A;  3P9K A;  2JUG A;  3HPG A;  5AIP A;  2HYF A;  3WG9 A;  4HPQ A;  5E17 F;  3HOZ J;  5CPR B;  5LFA A;  1ODD A;  5A2Q K;  1HW2 A;  4LLL A;  1W0T A;  2DA4 A;  3ZCO A;  3KYC B;  2FNA A;  4UUS A;  3C3W A;  4RLQ A;  3HOW J;  5J1U A;  5IOY A;  2LF7 A;  2E5N A;  4LMY A;  5BPI A;  3ROU A;  1ZR2 A;  4ZDO A;  4I7H A;  3PUF A;  3GWZ A;  3DPT A;  2DK5 A;  1MGT A;  3MKZ A;  3ESW B;  2V1N A;  1W36 D;  3BJ6 A;  2EH3 A;  2P6T A;  3SDB A;  3K70 C;  1MZB A;  3L9F A;  4L9V A;  1FX7 A;  2XRL A;  3IUO A;  4XK4 A;  2M3A A;  4A0Y A;  1CGP A;  1PUF A;  5IT9 K;  4HNT A;  3OL3 A;  1IZ1 A;  1XDU A;  3G2B A;  4Y7N J;  1N77 A;  4L5I A;  2COB A;  4XM3 A;  2FNP A;  1NH3 A;  4HSR A;  4UVA A;  1RR7 A;  1KA8 A;  2X4H A;  4M3E A;  2MD0 A;  3C18 A;  4H0E A;  3KYD B;  3F72 A;  3AG4 H;  4XLC A;  2X1C A;  4OIP F;  1ZRF A;  4NDL A;  1FP2 A;  2Z33 A;  1IDZ A;  2KIQ A;  3M07 A;  3RYP A;  2DFF A;  2WWY A;  4XNF A;  3OSF A;  4BJ6 C;  1WSU A;  4OIQ F;  1C0W A;  3HRS A;  3SYT A;  4YFK F;  1S5L C;  2OV7 A;  3IWZ A;  2VXZ A;  4XBF A;  4BBS J;  2IS2 A;  2HOS A;  1HDP A;  4HW0 A;  4ABZ A;  3E0J B;  2EWN A;  2F2E A;  2VKV A;  3R60 A;  2NVQ J;  3WE2 A;  2RV8 A;  4Y17 A;  4AVZ A;  4IO9 F;  1U9O A;  2V4J C;  1STZ A;  2QF7 A;  2VXD A;  1EF4 A;  4XQF A;  1I50 J;  2A69 F;  4RM3 A;  1USS A;  3IP4 B;  3I5U A;  3LSH A;  4Y13 A;  1TQM A;  4A0Z A;  2L7M P;  4XRF A;  3X2Q H;  6PAX A;  2K9M A;  1T39 A;  4BH9 A;  5J4V A;  2IBD A;  4B48 A;  3H3U A;  1X4P A;  5F04 A;  3VPR A;  2W7N A;  2WAQ N;  1YS6 A;  3EYI A;  1PYV A;  3QAH A;  1YI2 I;  4AC0 A;  1J0R A;  1QGP A;  2ECC A;  1I5Z A;  1UG0 A;  1UST A;  3CCL I;  3H36 A;  4D0P A;  3PSI A;  2V9P A;  4DBR A;  1AOY A;  5J40 A;  3OMY A;  2LK2 A;  5LRS A;  4HF1 A;  4HX8 A;  2DCE A;  5J3L A;  1V54 H;  1LE8 A;  2HDD A;  4RB0 A;  1KU7 A;  3A01 B;  5HLH A;  2PLY A;  4WXC A;  4P9F A;  1Z1D A;  3S17 J;  4MFE A;  3BR5 A;  4A93 J;  2K5C A;  1P7J A;  4CYC A;  2ZJ2 A;  4E7K A;  1GV5 A;  2COM A;  3F8F A;  2CQQ A;  1HXD A;  2JN6 A;  3TQN A;  1D0Z A;  3JRH A;  1ZGA A;  1TC3 C;  3OV8 A;  3S1R J;  1ETV A;  2ZME C;  2O7O A;  2GA2 A;  3A1Y A;  3MFK A;  1LVK A;  2X51 A;  3TL4 X;  3N97 A;  3MCZ A;  2YPR A;  4PCQ A;  2JSC A;  3W2A A;  4UNO A;  2DI3 A;  3IRR A;  3VYU B;  3K7A J;  1GHC A;  1MBH A;  4LIU A;  2RKH A;  2EIM H;  2WAF A;  4ENJ A;  2STW A;  3I3L A;  2MG4 A;  3HB9 A;  1OIS A;  1K7A A;  1Y1W J;  3K1P A;  4HAM A;  3PNT A;  3H9G A;  5C4J J;  3ABT A;  5K7F A;  2FD5 A;  1I3A A;  3S2D J;  2CYY A;  2YSR A;  2A07 F;  3A0H C;  2H6C A;  3FKJ A;  1AWC A;  1MNM C;  1Q1V A;  2Q0O A;  4KDP A;  1FC3 A;  1V4R A;  1MBF A;  2V1X A;  4BEH A;  4HNV A;  3JAM K;  2FBI A;  4NBQ A;  4G6Q A;  4BXU A;  4RDU A;  4AYB N;  2CQN A;  2IJL A;  2G7H A;  2ZME B;  3M1C A;  1E0E A;  1HKQ A;  3FMQ A;  4WXH A;  1X3W B;  2ZJP F;  1M1E B;  4FE7 A;  3ABK H;  4FET A;  1YJW I;  2IAI A;  5IY5 H;  2O8K A;  4I0B A;  1PUE E;  4BDZ A;  2BEO A;  3S15 J;  1Y1V J;  3JSO A;  3DF8 A;  5H6Q A;  3CLO A;  4XLA A;  3PIO F;  4ZYG A;  2ECB A;  2IGM A;  3PNV A;  2GM4 A;  5DM7 F;  2DFE A;  2HU9 A;  4KMU X;  1LDJ A;  1VTN C;  2PG4 A;  2F5E A;  1T95 A;  2L9S A;  4FX0 A;  1FOK A;  1MBE A;  3CUQ A;  5HDK A;  3FMS A;  2MLK A;  1KU3 A;  5C3E J;  3OYA A;  1ZLK A;  3QPH A;  4XOT A;  1ZGJ A;  2HPI A;  1MKM A;  2Y30 A;  2O9L A;  1AA7 A;  3CJT B;  3E5Q A;  5E1Z B;  3KIO A;  4PZJ A;  3HPH A;  3RSN A;  2BV6 A;  3P7N A;  1LEA A;  3NAR A;  2OBP A;  2PMZ A;  3GZN B;  2O8X A;  3RYR A;  3LFU A;  3A2K A;  4YG2 F;  2HGC A;  4F3Q A;  4KUM A;  1R22 A;  2B7E A;  2RGV A;  4IF4 A;  1L0O C;  1MW7 A;  1VND A;  4IQ4 A;  1FOW A;  2R5Z A;  3N4M A;  3K4J A;  4M9S A;  2NNN A;  3KEQ A;  2QGU A;  4HX4 A;  1Y8Q B;  5D5X B;  4LB6 B;  1ZQ3 P;  5FGM A;  2CWE A;  1HOM A;  9ANT A;  3SEZ A;  3CCS I;  3FK7 A;  4MO7 A;  2GAU A;  1WHU A;  3GFM A;  3VSK A;  2XGC A;  1IXC A;  2R7U A;  3COA C;  1W4M A;  4BE2 A;  1O3T A;  4BHC A;  1IV6 A;  4BNC A;  1IJW C;  5E1W A;  1MJB A;  2DJN A;  3J7Z I;  2FBK A;  4ZTJ A;  2DA1 A;  5D8K B;  4XLP F;  1I1G A;  1BR4 A;  1Y6I A;  2MH2 A;  3DQV C;  1QNT A;  1JXS A;  1UZC A;  2JUC A;  1E3P A;  1MIJ A;  2DA6 A;  3M3Y J;  2CUF A;  5M3F J;  4NQW B;  3BLY A;  2KIS A;  3L2Q A;  4A3C J;  5JHF A;  4A3D J;  1A36 A;  4U0W A;  2FSW A;  4WX9 A;  2XRN A;  3CMY A;  4YFN F;  1HCR A;  5F1R A;  2X6Y A;  3C2H A;  2D45 A;  1IG7 A;  5FKL A;  4DW6 A;  3ZQH A;  1U3E M;  5HNF A;  2VON A;  2X1D A;  1SVO A;  2H09 A;  1NTC A;  1SAX A;  4XMY A;  3ZR8 X;  3J80 Z;  4C2U A;  1VQ6 I;  2V1D A;  5ICE A;  2EFN A;  1JUS A;  3KLO A;  5L3E A;  3L2W A;  2DOE A;  4NHJ A;  1U6G A;  3E6D A;  2LD5 A;  4NC7 A;  2FX0 A;  2M1B A;  5TIS C;  3V8L A;  2P5K A;  4OIN F;  3V4G A;  1UAA A;  2FE3 A;  4UVC A;  2CGP A;  3HSR A;  1JT0 A;  1ZRC A;  2EJR A;  2CFX A;  2VUM J;  3BQY A;  3BP8 A;  4QIW N;  4M71 A;  2VAS A;  3FXM A;  2UUZ A;  4FHT A;  4R8H A;  1AKH B;  4EJV A;  2LR8 A;  2P5V A;  2E2I J;  3MKY B;  5ED4 A;  3OYH A;  1XMA A;  4EV0 A;  2F4I A;  2IW5 A;  2GXA A;  5HOO A;  3GUD A;  3AKZ A;  2WAE A;  3M8E A;  1GT0 C;  4KIS A;  4IKF A;  5DD4 A;  3A0B C;  3W6V A;  3CDH A;  4M6X A;  4OAY A;  2HZD A;  1ZLJ A;  2CMP A;  3DLL F;  5C4X J;  4CZZ A;  2W82 A;  3DKY A;  1HC8 A;  3G1O A;  1WRJ A;  3CC2 I;  1R1V A;  4I0A A;  3WOD F;  2JJ7 A;  4RGS A;  3HDD A;  2PJP A;  4V19 K;  1SFK A;  2NS0 A;  3U1D A;  3K4M A;  1ZG1 A;  1ZR4 A;  2NVU B;  1RUN A;  4QPO A;  5CVR A;  5JI6 A;  4C2M J;  2BHZ A;  1VQL I;  3OR2 C;  2EFQ A;  4OOI A;  4EJT A;  4B43 A;  2EFO A;  2FQ4 A;  3CJN A;  2HKO A;  1LKX A;  3DTE A;  3F23 A;  3CF2 A;  3CCU I;  1JUM A;  2CUE A;  2E34 A;  3HJE A;  5EJC A;  1D5V A;  1WFX A;  4PGH A;  5KNL A; 
#chains in the Genus database with same CATH homology
 2WC2 A;  3QP6 A;  1XGM A;  3VFZ A;  1BC7 C;  3JTH A;  4U0V A;  2KJB A;  3ZN1 A;  1KGS A;  2P6S A;  5K5R A;  3R4K A;  2J5O A;  2XUB A;  1KQ0 A;  2A3S A;  3TO9 A;  4KYW A;  1BC8 C;  2A61 A;  2YX4 A;  1TW3 A;  4Q4Z F;  3I59 A;  5L3F A;  3RKX A;  3MAJ A;  5AIQ A;  3MZH A;  1XDS A;  2ZME A;  3I0T A;  3WTS C;  2CO5 A;  2DPD A;  1IN5 A;  3L2C A;  4WK8 F;  5D4S A;  3HHH A;  2L4M A;  2UXN A;  2F5D A;  4AIK A;  1Z91 A;  5LGN A;  3K9T A;  3RJP A;  1SD7 A;  2O6G E;  1F4K A;  2ZO4 A;  2HOE A;  2GWR A;  1IAW A;  4IXA A;  2LSO A;  2XAS A;  5D4R A;  5E8I A;  5E18 F;  1ZYR F;  3S2W A;  4ESB A;  5J6X A;  1B4A A;  3RI4 A;  5LGU A;  1R00 A;  5LHI A;  4KNY A;  3OOP A;  4M73 A;  2XHK A;  2HFH A;  4Q5S F;  5ICC A;  1UFM A;  4ENM A;  4IRI A;  5CVU A;  2QVO A;  5HS7 A;  5TRD A;  3R61 A;  2M87 A;  3T8R A;  2HZT A;  1DPU A;  2JPB A;  2VE9 A;  2BBY A;  3V7C A;  3GFI A;  3K1M A;  2P7C B;  5HDN A;  3ERE D;  3Q9V A;  1QZY A;  4L5J A;  4RGR A;  1GXQ A;  2ISZ A;  4NQW A;  4Y15 A;  2B0L A;  4E70 A;  1OKR A;  3HTU A;  1EV7 A;  4AD9 A;  4HF0 A;  5ILV A;  1JGS A;  4NB5 A;  1IF1 A;  1FBS A;  3WGH A;  1O57 A;  2JRT A;  2WTE A;  5E1X A;  4M9X A;  3LA7 A;  2FEZ A;  3H3Z A;  4KIB A;  3BZ6 A;  4FT8 A;  2EV6 A;  1KQ8 A;  1G3W A;  5DCF A;  1XMK A;  1OYI A;  2ESN A;  2FOK A;  1QQI A;  5EEG A;  2A68 F;  2KJC A;  3K0L A;  2CSO A;  3GF2 A;  5L3D A;  2DFI A;  3JTG A;  1H0M A;  4UXN A;  1YW7 A;  3Q9S A;  2PMH A;  1P6R A;  1IXS B;  3NEU A;  3GYH X;  3P9I A;  1HSJ A;  1MD0 A;  4KIC A;  1YO5 C;  4I2O A;  3HYI A;  4JBA A;  5FD6 A;  2QQA A;  1FP1 D;  4IHS A;  1IXR C;  1O7L A;  1OPC A;  1YIO A;  3D5L A;  2GZW A;  4WCG A;  4IVN A;  2FML A;  4LG0 B;  3KFW X;  4ZYH A;  4G7H F;  2FRH A;  2HYG D;  4UUV A;  4LGW A;  1R7J A;  2P5L C;  4A5N A;  4ZYE A;  4CO8 A;  4BHP A;  1I27 A;  3DP7 A;  2F5F A;  5DUI A;  3E5X A;  1YW8 A;  2EFP A;  4JK1 X;  4YII A;  3HOS A;  5H6R A;  4A2U A;  5JVT A;  2OZU A;  2RN7 A;  3F8M A;  1BI2 A;  3GEZ A;  1TBX A;  4ESJ A;  5KK1 A;  2A6H F;  4ENN A;  3ZMS A;  1LB2 A;  1QPM A;  2DBB A;  2ZBK A;  3SFZ A;  4Z2Y A;  3E6M A;  4UV8 A;  1G6N A;  4S05 A;  2D2W A;  3HTS B;  2ADU A;  3HOT A;  4N9I A;  3HUG A;  2ZNY A;  5D5W B;  5F6F A;  3P9C A;  1BI1 A;  1BIB A;  2ZNZ A;  5K5Q A;  4ETS A;  2VBW A;  1YQA A;  1F5T A;  3KP7 A;  1FZP B;  4HV5 A;  2OQG A;  1FYM A;  1MJA A;  4YFX F;  3I58 A;  2GXG A;  3IHU A;  1D8K A;  4WXD A;  2OD5 A;  4L0Z B;  5FLX Z;  3QU6 A;  2STT A;  4AIJ A;  1E2X A;  1FSH A;  2MBF A;  1S6L A;  3TDZ C;  3JW4 A;  3VEP A;  5FLX K;  1LNW A;  2OU2 A;  2XRO A;  1S7A A;  5JR3 A;  3I54 A;  3DEU A;  2M30 A;  4KA4 A;  1IN8 A;  1JHF A;  5HDG A;  3I59 B;  1ZH5 A;  4EJW A;  3IKV A;  4RGU A;  4WF2 A;  2JT1 A;  2FXA A;  4MEY F;  1ZRE A;  2QQB A;  2L54 A;  1DP7 P;  2RNJ A;  3KP5 A;  1WKM A;  2FF4 A;  1B59 A;  3IKT A;  3FM5 A;  1XGN A;  3O6B B;  5DD8 A;  1FNN A;  3KET A;  4HBL A;  1LJ9 A;  3W6K B;  2HTJ A;  3CUO A;  3IRQ A;  1ZRD A;  4PDK A;  3U9G A;  4M72 A;  1W7P A;  3GVA A;  3U2R A;  3B02 A;  3M1E A;  3WGI A;  1Z05 A;  3ZPL A;  2HEO A;  3ML6 A;  4UV9 A;  2H6B A;  2R7D A;  4BAY A;  1MDM A;  4YIF A;  2IPQ X;  3R0J A;  4KIG A;  1TLH B;  2FBH A;  1FPQ A;  2CW0 F;  2LNB A;  5LEK A;  4P55 A;  4EQQ A;  1YLF A;  4RS8 A;  1R1U A;  3T8T A;  4R1H A;  2DPU A;  3V8K A;  4CXF A;  5HVQ C;  4M6Y A;  3WU1 B;  4AWX B;  4LG0 A;  5CLS A;  4MHG A;  2V6C A;  3I64 A;  2EV5 A;  1HW5 A;  1R5H A;  2W25 A;  1HKS A;  3ULQ B;  4RB2 C;  3EDP A;  1H9T A;  1KU2 A;  3HSF A;  2ZCW A;  1PP7 U;  3BOQ A;  4UHT A;  4AVP A;  1LDK B;  3RDI A;  3TO7 A;  4HQM A;  5ERI A;  2VBX A;  3ZN0 A;  1YS7 A;  3F3X A;  1BOA A;  2W84 A;  3KP6 A;  4L0Y B;  3NQO A;  2IA2 A;  1H9G A;  3I71 A;  3J80 K;  3MWM A;  5BQT A;  2L01 A;  4MTD A;  5H20 A;  3G3Z A;  1ZAO A;  3PQK A;  4TV7 A;  3F6V A;  2GQQ A;  3LQQ A;  3H92 A;  2UWM A;  4LLN A;  2BE5 F;  3GW2 A;  5FFX A;  2NRA C;  5LLQ A;  2NYX A;  1ON2 A;  1FLI A;  2IVM A;  2GXB A;  4HDU A;  4M74 A;  1ULY A;  4I98 B;  2VOO A;  3F22 A;  3WGG A;  1PDN C;  1YTY A;  1TQI A;  4HF2 A;  5CVJ A;  3L00 A;  4IHT A;  1BBY A;  2M45 A;  1B1B A;  2DK8 A;  2VN2 A;  4LB5 A;  2L3D A;  3RIR A;  4KN7 X;  1HQC A;  1O7F A;  1DDN A;  3PFI A;  5DEQ A;  2UZK A;  2FMY A;  2IRF G;  2XGX A;  2VOP A;  1KYZ A;  1GVJ A;  1Z7U A;  1T0F A;  2O3F A;  2OAZ A;  3BJO A;  1Q1H A;  4I01 A;  5D8L B;  2HR3 A;  1UCR A;  4HYE A;  4G94 A;  3HRM A;  3W6J B;  4UVB A;  1O3S A;  1FYL A;  1UHW A;  2OA4 A;  4A12 A;  1REP C;  2VC1 A;  2KIU A;  1OYY A;  2BGC A;  5BS6 A;  1U2W A;  1XCB A;  1XN7 A;  4EM1 A;  3ECH A;  4RB3 C;  4IJA A;  4HA8 A;  2MLG A;  4U0Y A;  2L4A A;  3SZT A;  1B9N A;  3WU0 A;  1K6O A;  4GO1 A;  3KEO A;  3ZMV A;  4WWC A;  4PGG A;  2PI0 A;  4LK1 F;  4U7D A;  5ICG A;  1XGS A;  3QU3 A;  2GIV A;  3M9A A;  3O3K A;  1ZG5 A;  4G7O F;  2O61 A;  4U7B A;  2KIF A;  2VT2 A;  3GX4 X;  1R58 A;  4O6J A;  2E7W A;  1TNT A;  3V7R A;  4FX4 A;  1FT9 A;  1RNL A;  5FD5 A;  3SHF A;  3RKW A;  1BI0 A;  2DTR A;  2DO7 A;  5BPD A;  4B09 A;  2C6Y A;  3F8N A;  4R79 A;  3TDU C;  4OIO F;  2D1V A;  1XCV A;  4IRH A;  1J5Y A;  3WTW C;  1JHH A;  3E6C C;  3FMR A;  2H27 A;  2EB7 A;  2XAF A;  2VBZ A;  1E17 A;  3DPL C;  2J5P A;  5L3B A;  3GXO A;  1U5T C;  4EVI A;  1P4W A;  2L02 A;  1OR7 A;  3C1D A;  3F6O A;  3FXQ A;  3LFK A;  5CVI A;  2YR2 A;  3MQ0 A;  3LQR A;  2WV0 A;  2OQR A;  1XB4 A;  2YX7 A;  3IWF A;  4M9Z A;  2XAQ A;  3GZ5 A;  1OMI A;  1CF7 B;  4P5O A;  2JTV A;  1RZ4 A;  1S8N A;  1U5T B;  1W7P D;  2IA1 A;  3MEX A;  2KIM A;  2EK5 A;  3B73 A;  2XAG A;  1T38 A;  3KP3 A;  4CDG A;  5BOX A;  1S7O A;  1I1S A;  2AXL A;  2GA1 A;  2OZ6 A;  5L3G A;  2EA2 A;  4EM0 B;  3WTZ A;  1Z9C A;  1R5G A;  2PBI A;  4EM2 A;  1W7P B;  4LFU A;  2QQ9 A;  2YU3 A;  3HRT A;  3HHG A;  5TJJ A;  1SD4 A;  3QPT A;  4QWQ A;  3K2Z A;  3L7W A;  1BN5 A;  1W5T A;  3WTY C;  1J75 A;  2DQR A;  1J7K A;  2E7X A;  4L9T A;  5F64 A;  4ZZD A;  1MDM B;  1KQ9 A;  1Z6T A;  1YYV A;  3E5U A;  4CYD A;  2IA0 A;  3L09 A;  2V9V A;  1QZZ A;  2Z9O A;  3EET A;  1B9M A;  3RKY A;  3AAF A;  3WTX C;  3F8B A;  4RB1 A;  2ETH A;  5D6E A;  4MQ9 F;  1HKT A;  5JHU A;  3G73 A;  2M8E A;  1V3F A;  3RPQ A;  4IPA A;  1G3T A;  4I02 A;  3KZY A;  2VC0 A;  4G9Y A;  2NNY A;  4JQF A;  2JPC A;  3FF5 A;  5D6F A;  3WE3 A;  5CJ9 A;  5CYV A;  4LK0 F;  3KZZ A;  3V8J A;  4Q47 A;  3FWE A;  3BRO A;  2K7L A;  1G3Y A;  2QBY B;  1JE8 A;  2MD5 A;  3C7J A;  3QRF F;  1BIA A;  1IW7 F;  2E1N A;  2VE8 A;  4AIH A;  1YFH A;  5IT9 Z;  4GGG A;  4OMZ A;  4ZZL A;  2LDU A;  4N0B A;  2LKP A;  1U78 A;  2MH9 A;  3TOB A;  1GXP A;  3NRV A;  3JSP A;  2X0L A;  1YG2 A;  5D5V B;  1EH8 A;  2Q2E A;  2TDX A;  4G7Z F;  1K78 B;  1R23 A;  3BJA A;  1P92 A;  3IL2 A;  1YW9 A;  2JZY A;  3R0A A;  3EQL F;  1FY7 A;  2O0Y A;  1SMY F;  5HS9 A;  3D0S A;  1O3Q A;  1T98 A;  1P2F A;  2M5W A;  4BHB A;  2PMU A;  4ENK A;  4KIF A;  3LA3 A;  4BQA A;  2XKP A;  5J8C A;  2DLL A;  1WI9 A;  5LHG A;  2XIG A;  5K5O A;  4ASN A;  4K2E A;  2K02 A;  1KYW A;  2A6E F;  2DAO A;  1TW2 A;  1LVA A;  3LST A;  1NHA A;  2ACJ A;  1EH6 A;  3FXR A;  2LF8 A;  3FM3 A;  3ELK A;  3RPU A;  3KP2 A;  2K4B A;  4LJZ F;  3E97 A;  1UHM A;  1XSX A;  2CQK A;  3ABU A;  3GZ6 A;  3REO A;  1SD6 A;  5E8G A;  3E3V A;  4B8X A;  3ZP5 A;  4EGY A;  1SFU A;  1XSV A;  1LEB A;  3IC7 A;  1BJA A;  3JAM Z;  4A6D A;  1PP8 F;  1TNS A;  2A5Y B;  1CF7 A;  3E6B A;  2QYO A;  4I09 A;  5DDG A;  2P8T A;  1U5T A;  4OMY A;  1OYW A;  4O3M A;  2PN6 A;  1DPR A;  2CG4 A;  3DKW A;  1XSD A;  3DFG A;  1S29 A;  5ILS A;  3TKY A;  3HRU A;  3CTA A;  4HZF A;  1FYK A;  4HLX A;  4Q48 A;  1QO0 D;  3K1N A;  2K86 A;  2ZFW A;  2ISY A;  4HX7 A;  4L18 B;  4EJO A;  2R3S A;  4G8X A;  1SFX A;  3VOE A;  3BWG A;  4HDV A;  1G4D A;  1FBU A;  2W57 A;  3WTV C;  2VBY A;  4A0X A;  3K69 A;  5HLI A;  4GCV A;  3BY6 A;  1ONV A;  4HOB A;  1WWX A;  2ESH A;  5DV5 A;  4ZH4 F;  1D8J A;  2VT3 A;  1X3U A;  2HQR A;  4A6E A;  3CO7 C;  4RAY A;  2QUF A;  3ISP A;  3SQN A;  3DXJ F;  2PFB A;  4N9H A;  1FSE A;  5AON A;  1Y0U A;  1ZHF A;  1XGO A;  2EA4 A;  4OU0 A;  2P4W A;  4KT5 C;  1IN6 A;  3TO6 A;  3O2P E;  1HBX G;  2QBY A;  3KLN A;  5L3C A;  4EGZ A;  3GLX A;  1A04 A;  1LDD A;  5LGT A;  3QP5 A;  2KKO A;  3BPV A;  3QOP A;  2P7V B;  5DYM A;  2K27 A;  2UXX A;  4BYY A;  1F1Z A;  1SMT A;  4XLN F;  2RVC A;  2FA5 A;  4QLC U;  4L9N A;  3I4P A;  5LEJ A;  1K78 A;  4DQ2 A;  4LLG F;  2DW4 A;  3I53 A;  3M7G A;  2H94 A;  5HLG A;  4RGX A;  3RTR A;  1G3S A;  1FWZ A;  4LD5 A;  3HSE A;  5D5U B;  3ZMT A;  2DT5 A;  3EYY A;  3HIF A;  2RDP A;  2O03 A;  4MTE A;  3VOD A;  5HS8 A;  3GO5 A;  2QLZ A;  3ZMD A;  2G9W A;  3T5X A;  4P9U A;  1P4A A;  2PEX A;  1MJ9 A;  4ESF A;  2Z99 A;  3LAP A;  3ECO A;  5DCM B;  2MA3 A;  3KE2 A;  5IT3 A;  2W24 A;  5EEH A;  2EV0 A;  5JFR A;  2IP2 A;  1R1T A;  1TQP A;  2FU4 A;  2HTS A;  2V79 A;  2Z3Y A;  4P96 A;  3GFJ A;  3VB2 A;  4CIC A;  1R36 A;  3EUH A;  2HQN A;  5ICF A;  5LRR A;  4OIR F;  2Q8K A;  1IRG A;  3TOA A;  2QEN A;  4MNU A;  5FO5 A;  5KVR A;  1DUX C;  3ZMZ A;  5FFZ A;  3J81 Z;  1RUO A;  2DU9 A;  2K4J A;  1S3J A;  3DV8 A;  3GFL A;  3FX3 A;  2PQ8 A;  4GXO A;  3MZY A;  3FZV A;  3F21 A;  1UB9 A;  1BI3 A;  3J81 K;  1T6S A;  4MGR A;  2RQP A;  5FB2 A;  3ZQ7 A;  1IUY A;  4G6D A;  1WQ2 A;  5CVV A;  3LAJ A;  1EH7 A;  3J7A O;  1ZN2 A;  3ZMU A;  2F5C A;  2QWW A;  4MEX F;  4XSZ F;  4IRG A;  5K1Y A;  1D3Y A;  2NAZ A;  1LQ1 A;  4ZYD A;  3M8F A;  4MQV A;  2ELH A;  2RC4 A;  2XAJ A;  4DNC A;  2MC3 A;  1O3R A;  1XD7 A;  2XV4 S;  3SXY A;  2IT0 A;  2Z5U A;  4GYG A;  5ILU A;  4XSX F;  1IN4 A;  5LBQ A;  2FQ3 A;  4CHU A;  3CO6 C;  2R7F A;  1J2X A;  4A5M A;  1HST A;  1HW1 A;  3PQJ A;  4ON0 A;  4KFC A;  4HLY A;  2VOD A;  2QM3 A;  4KMF A;  5LHH A;  2KRF A;  3LWF A;  3V7S A;  1BM9 A;  1L3L A;  1SFE A;  1J59 A;  2Y75 A;  3F8C A;  1RIO H;  4GYI A;  4O5V A;  1J9I A;  3FXU A;  3Q5F A;  2AS5 F;  1ZAR A;  2W85 A;  4EMS A;  1P4X A;  2G7U A;  3CUQ C;  1KU9 A;  1U8R A;  1ZG3 A;  1K79 A;  2HKX A;  4L9J A;  2Y0M A;  2XKO A;  2ZKZ A;  1W5S A;  2D1H A;  1TTY A;  2XAH A;  5BMZ A;  3FHZ A;  3TGN A;  1Z6R A;  1SD5 A;  2QZ8 A;  1IRF A;  1ON1 A;  4RAZ A;  3KP4 A;  2EFW A;  1I6X A;  5E20 A;  3CUQ B;  4F7Z A;  1QBJ A;  3BDD A;  3T1B A;  2ZXJ A;  3LA2 A;  5J8F A;  1F9N A;  3WTU C;  4HQE A;  3T0Y A;  1B6A A;  4S04 A;  3R6S A;  4HV6 A;  4U88 A;  1T2K A;  2HWV A;  4KN4 X;  2XVC A;  1RI7 A;  2BYV E;  2E1C A;  3SZP A;  4CGZ A;  4EJU A;  2HDC A;  5A2Q Z;  3KCC A;  5DCM A;  3WTT C;  1FBQ A;  2DQL A;  2HS5 A;  3BPX A;  2V1U A;  1IN7 A;  5DUK A;  2Y48 A;  3P9K A;  5AIP A;  2HYF A;  3WG9 A;  5E17 F;  1ODD A;  5A2Q K;  1HW2 A;  4LLL A;  2FNA A;  3C3W A;  2LF7 A;  4LMY A;  5BPI A;  3ROU A;  4I7H A;  3GWZ A;  3DPT A;  2DK5 A;  1MGT A;  3BJ6 A;  2P6T A;  1MZB A;  3L9F A;  4L9V A;  1FX7 A;  4A0Y A;  1CGP A;  5IT9 K;  1IZ1 A;  1XDU A;  4L5I A;  2FNP A;  4UVA A;  1KA8 A;  2X4H A;  4H0E A;  3C18 A;  3F72 A;  4OIP F;  1ZRF A;  1FP2 A;  2Z33 A;  3RYP A;  2WWY A;  1WSU A;  4OIQ F;  1C0W A;  3HRS A;  4YFK F;  3IWZ A;  4XBF A;  2VXZ A;  4HW0 A;  2EWN A;  2F2E A;  3R60 A;  3WE2 A;  2RV8 A;  4Y17 A;  1STZ A;  2A69 F;  1USS A;  3I5U A;  4Y13 A;  1TQM A;  4A0Z A;  4XRF A;  6PAX A;  1T39 A;  4BH9 A;  3H3U A;  1YS6 A;  3EYI A;  3QAH A;  1J0R A;  1QGP A;  1I5Z A;  1UST A;  4D0P A;  1AOY A;  5LRS A;  4HF1 A;  4HX8 A;  4RB0 A;  1KU7 A;  2PLY A;  5HLH A;  4WXC A;  4P9F A;  1Z1D A;  2ZJ2 A;  2COM A;  3F8F A;  1HXD A;  3TQN A;  1ZGA A;  3OV8 A;  2GA2 A;  3MFK A;  3N97 A;  3MCZ A;  2YPR A;  4PCQ A;  2JSC A;  4UNO A;  2DI3 A;  3IRR A;  1GHC A;  2RKH A;  4ENJ A;  2STW A;  1K7A A;  3K1P A;  4HAM A;  3ABT A;  2CYY A;  2YSR A;  2A07 F;  2H6C A;  1AWC A;  2Q0O A;  4KDP A;  1FC3 A;  1V4R A;  2V1X A;  3JAM K;  2FBI A;  4G6Q A;  4BXU A;  2IJL A;  2G7H A;  2ZME B;  1HKQ A;  3FMQ A;  4WXH A;  4I0B A;  1PUE E;  2BEO A;  3JSO A;  3DF8 A;  5H6Q A;  3CLO A;  4ZYG A;  4KMU X;  1LDJ A;  1VTN C;  2PG4 A;  2F5E A;  1FOK A;  4FX0 A;  3CUQ A;  5HDK A;  3FMS A;  2MLK A;  1KU3 A;  1ZLK A;  3QPH A;  1ZGJ A;  1MKM A;  3E5Q A;  5E1Z B;  4PZJ A;  2BV6 A;  3P7N A;  1LEA A;  2OBP A;  2O8X A;  3RYR A;  4YG2 F;  2HGC A;  4KUM A;  1R22 A;  2RGV A;  4IF4 A;  1L0O C;  3N4M A;  4M9S A;  2NNN A;  3KEQ A;  4HX4 A;  5D5X B;  4LB6 B;  5FGM A;  2CWE A;  2GAU A;  3GFM A;  1IXC A;  3COA C;  1W4M A;  1O3T A;  4BHC A;  4BNC A;  5E1W A;  1MJB A;  2FBK A;  5D8K B;  4XLP F;  1I1G A;  2MH2 A;  3DQV C;  1QNT A;  1JXS A;  4U0W A;  2FSW A;  4WX9 A;  2XRN A;  4YFN F;  5F1R A;  2D45 A;  2VON A;  1U3E M;  2H09 A;  1SAX A;  3J80 Z;  2V1D A;  5ICE A;  2EFN A;  3KLO A;  5L3E A;  4NHJ A;  1U6G A;  3E6D A;  2M1B A;  3V8L A;  2P5K A;  4OIN F;  3V4G A;  2FE3 A;  4UVC A;  2CGP A;  3HSR A;  1ZRC A;  2EJR A;  2CFX A;  3BP8 A;  4M71 A;  4FHT A;  4R8H A;  4EJV A;  2P5V A;  5ED4 A;  1XMA A;  4EV0 A;  2IW5 A;  5HOO A;  3GUD A;  3M8E A;  5DD4 A;  3CDH A;  4M6X A;  1ZLJ A;  4CZZ A;  1WRJ A;  1R1V A;  4I0A A;  3WOD F;  4RGS A;  2PJP A;  2NS0 A;  3U1D A;  1ZG1 A;  1RUN A;  5CVR A;  5JI6 A;  2EFQ A;  4OOI A;  4EJT A;  2EFO A;  3CJN A;  2HKO A;  3F23 A;  1D5V A;  4PGH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...