3JAMi

Cryoem structure of 40s-eif1a-eif1 complex from yeast
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
96
structure length
96
Chain Sequence
PKRELIYKEEGQEYAQITKMLGNGRVEASCFDGNKRMAHIRGKLRKKVWMGQGDIILVSLRDFQDDQCDVVHKYNLDEARTLKNQGELPENAKINE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 18S rRNA
publication title Conformational Differences between Open and Closed States of the Eukaryotic Translation Initiation Complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Translation
total genus 16
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
i PF01176 eIF-1a Translation initiation factor 1A / IF-1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3jami00
4LFAL 1JMCA 3FHWA 4JI2Q 4DK3C 2E5LL 2UUAQ 5ELNA 1KRTA 4DPGA 3AYHB 1YJ9A 2XTIA 4R4QA 1VQ6A 3TS2A 3PCOB 1W2BA 2CCZA 3GTOH 4KI0A 4C3JH 5AJ3L 2QA4A 4OX9L 3I4MG 3I2ZA 1PYSB 1TWFH 1Q46A 2R7DA 4P73A 1KIXA 1N33L 1RL2A 4RMFA 5H1SE 3KJPA 5M3FH 1IBKL 3H15A 4JI5Q 2R6GA 5LMNW 2JA9A 3OTOL 1LYLA 4BY1H 4HJ9A 1QVFA 2JA5H 3A5ZB 1KRSA 3KDFA 4A3DH 4QL5A 4B3ML 4C3IH 4AIMA 3H3VI 4JI0L 3EN2A 2E2IH 1X56A 3UDXA 4UP7A 3CCMA 5HGQA 3ULPA 2N3SA 3J80c 2QEXA 3K7UC 4LUOA 1WCMG 3PGZA 5BR8L 3PUYA 1RIPA 4B3RL 2B3GA 4HJAA 3PUWA 4JOIC 4GNXC 3T1HQ 4NPSA 4A3LG 1D8LA 3Q8DA 5LMUL 4JI7L 3JC66 4X64Q 4DR5Q 3F8TA 1XNRQ 1NMFA 4K0KL 4IFDG 4YHHL 2BH2A 4DV0L 5IYDH 1CSPA 2H5XA 4A3GH 2K50A 4GN5A 4MNOA 1N36Q 4GN4B 4BBRH 4DR4L 3U4VA 2I5LX 3HOZG 3AEVA 4NXNQ 1Q7YC 4GKJQ 4JC0A 2ATWA 4A3MH 3M85A 4X65Q 1WOCA 2ZTCA 1VQOA 3GTLH 5IP7H 4KHZA 5IP9H 3PO3G 1IBLQ 3F1ZA 2Z6KC 3I4OA 4JBKA 1A8VA 1YIJA 1QVCA 2EQSA 1G51A 1L2FA 3TREA 2WB1E 1I50H 4A3BH 2JEAI 1EOVA 1VQDA 4KHPL 1NE3A 1XPRA 2UXDL 1M90C 1EQRA 4B3TQ 1XMQQ 4X6AH 4GKKQ 4UP8A 5C4JH 4YY3L 4GLXA 2Z6KA 4J15A 1ASZA 1PH9A 3PUZA 1E24A 2ZJPA 3DM3A 4A75A 1ASYA 4LF9Q 3CPFA 1NY4A 2PI2E 4C2MH 3K8AA 3E0EA 1OXUA 2HHHQ 5IT9c 2BA1A 5C3EG 4POFA 4YWMA 1JJCB 3J80i 1YITA 3I4NH 4KLKA 4OO1I 3CC7A 4BBSG 2NVQH 3RNUA 3PO2G 4X62Q 3M9BA 1N9WA 1H95A 1YEZA 3S16H 5C4XH 4UP9A 4JV5L 1NJIC 1Y1WG 4BXXH 1X65A 1W3SA 5C44G 4A3EG 3HOWG 1HNXQ 3ICEA 4R4IA 3HKSA 1VQEA 4JYAL 1CUKA 2I0QA 1B70B 2CFMA 3KF6A 4IPCA 1UWVA 3I55A 4LF4L 2L15A 3PUVA 4WJ4A 4LF7L 2KHJA 4DR2Q 2R92H 1Z47A 1S40A 3CC2A 4B3SQ 4A3FG 3HKZE 2GVBA 4C3HH 1L0WA 5IYCH 1VQCA 3TS0A 1HR0L 2Y0SG 1CKMA 2NZOA 4OWTB 4A3IH 4DV4L 1IBMQ 1N32Q 3S14H 3H0GH 2AMCB 4JI8L 2B63G 5JJKA 5FLXc 2HQLA 5JEAG 4AYBG 4AQYL 3KYHC 2UU9L 3M4OH 1HNZL 2N49A 3S1MH 3U4ZA 2NN6I 1K73C 1VCIA 4R4TA 2C35B 3BJUA 2VL6A 2D0PA 2N8NA 1I3QH 1LUZA 2JE6I 2WAQE 4PZ8A 5M5YH 2MQHA 1PH3A 5FLMG 4LF5L 2MO0A 4DV1L 1S72A 2JA8H 2ZM6Q 1V43A 3ZJYC 2Q2TA 1HH2P 2PNHA 1TWHH 5IWAQ 1I5FA 4DUYL 3CF5A 1U0LA 5LMNL 1VQMA 4QGUA 2XGTA 1J5EL 4NXMQ 3PF5A 1Y1VG 5IYBH 3CCJA 3DLLA 4P71A 3CCEA 1D7QA 2OWOA 4OX9Q 3GTMH 1YBYA 1FJGL 1HJPA 2MFIA 3EBEA 3UDIA 2N78A 4HJ5A 1C7YA 1N33Q 3RZOH 2GN5A 4QY7A 4IOAA 5M5XH 2VQFL 3J7A5 3TQYA 2VW9A 3HOVG 1VQBA 3IRBA 1PYBA 4H02A 4A4IA 5C0XJ 3OTOQ 3RN5A 1CKOA 2JA7H 1XPUA 4IOCA 3MEFA 4A93G 1JJGA 2ID0A 1O7IA 2Z0SA 2KBNA 2ZTEA 3HOXH 4JI0Q 4A3CG 1R9TH 3G48A 4LF8L 1X3GA 3PIPA 1KXLA 5FJ8H 2VUMG 5BR8Q 1E22A 2D62A 3BZCA 4DV2L 4B3RQ 3FKIH 2ZJRA 4GOPB 1Q12A 3K80C 1SR3A 4OWWB 2B63H 4IJHA 3LGJA 4TVAB 4GNXB 2LXJA 4GOPC 4LFBL 5LMUQ 1PH5A 2K52A 1VQ5A 4BA1I 1MIUA 4Y7NH 1L1OB 2IHEA 4A3JH 1EYGA 4YHHQ 2JQOA 3I56A 4DV0Q 4OO1G 4LFCQ 2VZAA 1G291 1L1OC 2EIFA 2LXKA 1QVGA 1V9PA 4QIWE 4DV7Q 2RF4A 1UEBA 4DR4Q 4QQBX 3UDGA 4JI1L 3I7FA 1JJ2A 4JG2A 4GOPA 1PH6A 1T9HA 1Z9FA 1MKHA 2RHQB 1CKNB 3WWVA 4OWXB 3CCUA 4Y52H 1B7YB 4DAMA 4JOIA 1DGSA 1TWGH 1X3FA 4GNXA 3A0JA 4IJLA 2UXCL 1YI2A 3UE1A 1HNWL 4DR7L 2HT1A 2ALYB 1L1OA 4JI4Q 4P75A 3CMEA 1VQ4A 1WJJA 1NBWA 1JB7A 2ASBA 4A76A 1Q86C 1HZ9A 4A3KG 3HKZG 2UXDQ 3I4MH 2F4VQ 3T1HL 4BY7G 3CC4A 1Q1EA 4JBWA 3W1BA 2WFWA 5J3BA 2VQEL 4X64L 1XNRL 3HOYG 1VS0A 2KENA 4YY3Q 1CKNA 2K5HA 2NN6G 2MO1A 4JI6L 2OTLA 4IPDA 1SROA 1VQNA 2K4KA 2OCEA 3J81c 4DUZQ 1PFSA 1SFOH 2JA6G 4R4CA 3CCQA 1SMXA 3CQZH 4LF6Q 2OQ0A 1N36L 3B6YA 1HZCA 5HY6A 2R93G 2NZHA 4NXNL 2V1CC 3PSIA 4DR6Q 2YTXA 1VQJA 1WCMH 2Q2IA 2UUBQ 3S17H 4X66Q 5GADC 3CAMA 4DAYB 3UDFA 4A3LH 1XJVA 1IBLL 2R7ZG 3HOUG 1PH4A 4DV6Q 3GTQH 2QGQA 1PH2A 3U58A 4R1JA 1XMOL 3RZDH 1YHBA 2YU9H 1J6QA 4JI3Q 4UY8C 4LF4Q 3CCSA 3CPWA 1FL0A 1WFQA 2PI2A 3BU2A 3S1RH 1KQSA 4DR1L 4B3TL 3G4SA 3HOZH 1IYJB 1KC8C 1HR0Q 4XIGS 1SE8A 1UE1A 1SRUA 4BA2I 2ES2A 2WP8J 1YZ6A 2BA0A 3E9IA 4DK6C 1A0IA 1PH7A 2EXDA 4TQUS 1X54A 3VDYA 4MTNA 2GVAA 1Q8KA 1YHAA 1IXRA 2HHHL 3PO3H 4AQYQ 3GD7A 1HNZQ 2YTYA 1G6PA 4RG1A 3ERSX 4L5TA 1OXTA 4A3KH 1PVOA 2FXQA 2AHOB 1EQQA 1Q82C 3JAMc 3GO5A 4IFDJ 4DV3L 1S3OA 1FVIA 5JJIA 3ULLA 3J81j 5ELOA 2UXBQ 4DV1Q 5M3FG 4POGA 1XPOA 3GTPH 1PHJA 3RLNA 1JT8A 1N34L 1XNQL 1AE3A 3UE0A 2KHIA 3A74A 2IX0A 4QJFA 4BY1G 1X55A 3S1QH 2JA5G 1J5EQ 4A3DG 2OTJA 3PIOA 5LMNQ 4LFAQ 3J81i 4GS3A 4DR3L 3MXNB 5GAEC 3AFQA 2E5LQ 2AKWB 1VQAA 4DR2L 2NVTH 1BBWA 1FJGQ 3OYYA 5E7NA 5C3EH 4DV5L 1NMGA 1A63A 3G6EA 5AJ3Q 4BBSH 3PO2H 2IT1A 5IY0A 3CXCA 1CSQA 3U50C 1K8GA 1N32L 2F52A 3F2CA 1VQHA 1IBKQ 5C0XI 1Y1WH 4LF6L 2K5VA 3HOWH 4A3EH 5C44H 3EIVA 1HR0W 3RR5A 1WI5A 5IYDG 3F2DA 1I94L 1BBUA 2BH8A 4B3MQ 4A3GG 2K75A 4YWLA 4EQ5A 1TWAH 2WB1G 4OXPA 4BBRG 5M3MG 2UUCL 2R7ZH 1GKHA 1GD7A 4A3FH 2ZM6L 3H3VH 2MNAA 3RLOA 1VQ9A 4HJ8A 2R7FA 4GLAC 4JCVE 3TEHB 4A3MG 4EX5A 3T1YL 1QZGA 5IWAL 4JBMA 1VQPA 2RHSB 5IP9G 5IP7G 4HIDA 4NXML 2I5MX 3AQQA 2UUAL 4JI2L 4JI7Q 1I6HH 3L7ZC 3L0OA 1TWCH 4L5SA 4PMWA 4K0KQ 3S15H 3S2DH 3M3YH 2CWPA 3KJOA 2LSSA 3S1NH 4A3BG 4JI1Q 2VS1A 2IHFA 1QZHA 3M4QA 1LTLA 2ZTDA 1PH1A 3JAMi 3RN2A 3STBD 4YWKA 1GVPA 1TXYA 3NEMA 4JBJA 2VNUD 1QUQB 2Y0SE 5FLMH 1LM0A 4JI5L 3CCRA 4P72A 1VQ8A 2PQAB 4WJ3M 1GM5A 3D31A 1P8LA 2UXCQ 1HNWQ 4DR7Q 1K0RA 4YCUA 4LWCA 3CCVA 1UE5A 1VQGA 2F3IA 1GO3E 4AYBE 1OTCA 1P16A 3PV0A 1KAWA 2YV5A 1Y1VH 2I5HA 1OXXK 1JE5A 1K8AC 1KD1C 3I4NG 2CQOA 2KCMA 3CMAA 5JEAJ 1E3PA 4IO9A 2VQEQ 4KHPQ 3HOVH 1QUQA 5DLQE 5C4XG 5JJLA 3CD6A 4JI6Q 4A93H 2PQAA 4LFCL 4FDBA 2K5NA 4NB3A 2CWAA 1FGUA 2K14A 1N8RC 4DR5L 4BXXG 1OXSC 4ME3A 3KLWA 3GTGH 1E7ZA 4A3CH 4R4OA 4DV7L 3NELA 3FP9A 4APVA 5M3MH 1SN8A 3K7AH 2E8GA 2JEBI 2VUMH 1Q81C 3HFZB 4GLVB 1KL9A 5IE8A 4DKAC 5M5WH 4HIMA 2R92G 1BKBA 2WAQG 5IYCG 1A62A 1MJEA 4GKJL 5GROA 5GAHC 1K83H 1VQFA 4A3IG 3H0GG 4X65L 4GN3B 1X9NA 3CCLA 4JI4L 4JV5Q 1XMOQ 3L2PA 3GTJH 1HZBA 3S24A 4L5RC 3PUXA 3PF4A 2D0OA 4L5QA 3CP0A 1YNXA 2F4VL 1VQKA 1K3RA 4XTCS 5C0XG 4DR1Q 2A8VA 4JYAQ 4P74A 4HIKA 3K0XA 2IX1A 4ALPA 1SLJA 1AH9A 1Q1BA 4LF7Q 1U5KA 1B8AA 1VQIA 3G71A 2JA8G 2A19A 3CW2C 5GQOA 1M1KC 4DUZL 1PH8A 1PV4A 1XMQL 1IL2A 1YVCA 1NTGA 2JJQA 3ER0A 3KF6B 1OXVA 3M4PA 4GKKL 1HZAA 4LUVA 1UE7A 5K36G 1EWIA 4DV4Q 4JI8Q 4PZ7A 4LF9L 5IYBG 2KCTA 2DUDA 4DR6L 3GTKH 3KOJA 3KFUA 4PG3A 2UUBL 2UU9Q 4DV3Q 4O0AA 4X66L 1IZ6A 4IPHA 5GAGC 4IFDI 2PMZE 1YHQA 1EIYB 4O2DA 2Q2HA 2E2JH 2ZJQA 4BY7H 3NENA 3GDEA 1YJNA 1N34Q 1XNQQ 3S2HH 1KHIA 4X62L 1E1TA 2OQKA 4DV6L 2E2HH 3HOYH 4LW1A 4HIOA 2JA7G 1EIFA 4LF5Q 1WYDA 4OONA 3D0FA 3HOXG 2JA6H 4JI3L 1X3EA 4DR3Q 1VQLA 1HNXL 2IY5B 3K81C 1YJWA 2NVYH 3OW2A 4MZ9A 4DUYQ 2R93H 5FJ8G 4DV5Q 1X6OA 1V1QA 1Y14B 3FKIG 1C9OA 1EFWA 3RLFA 1XTDA 4IPGA 3AFPA 2B29A 3SGIA 3ULJA 4B3SL 2JK8A 3M7NA 1MJCA 2DGYA 2HIVA 2VQFQ 2HIXA 3J7ZC 1E1OA 2A1AA 2RCNA 3BZKA 5EAYA 1UE6A 4LUZA 2CKZB 3STBC 4AH6A 4A3JG 1IBML 1PA6A 3W5OA 3HOUH 1C0AA 2YYZA 2Q2UA 1AE2A 1I94Q 4UPAA 4DNIA 4PZ6A 4YCWA 1EUJA 3KF8B 2VY3A 3TRZA 1BVSA 3NBHB 4LF8Q 3A5UA 2NVXH 1K9MC 3W1GA 2UUCQ 4LNQA 2UXBL 3E9HA 4HJ7A 4YCVA 2AWNA 4DV2Q 2YTVA 3T1YQ 3F2BA 2AWOA 3KDFB 1VQ7A 4LFBQ
chains in the Genus database with same CATH superfamily
3D3RA 2E5LL 1SXTA 3HOWB 5C44B 1LV9A 3PCOB 1CHQD 1FNUA 1TWAB 4C3JH 3NBHA 3I72A 3I2ZA 2R7DA 2LS01 1IBKL 4FVMA 3ND9A 2R6GA 3D8GA 3FKIB 3T13A 1EY8A 2JA9A 5LMNW 3H3VC 4BY1H 1QVFA 1Q3LA 3E0JA 4KD3A 5CV7A 1Y8PB 3S2DB 5HGQA 4U673 1JOKA 3J80c 3K7UC 4CBVA 2B8FA 3PUYA 4X3SA 2B3GA 4RA8A 4GNXC 1LTSD 4JOIC 4HAEA 4A3LG 1D8LA 5EBCA 3E3XA 3JC66 4K0KL 3BDOA 1CSPA 1TVXA 3AB9A 4GN4B 1SNPA 2I5LX 3HOZG 3I70A 3SK5A 1H9SA 3HOVB 4JC0A 2ATWA 4X65Q 1TT2A 4KHZA 5IP9H 1RDPD 4M1UB 4OL7A 3F1ZA 1GUNA 1TR5A 4UHVA 1QVCA 3EQLC 1YNJD 2F0IA 3A7LA 1JOQA 1PRTF 2EY1A 3RUZA 2L55A 4DNRB 2BDNA 3SK4A 4DAVA 2A68D 5DNFA 3MXPA 3DM3A 2HHHQ 3K0YA 5IT9c 1PFBA 5C3EG 4POFA 1HPCA 3I4NH 3CC7A 2B2VA 4BBSG 1G8ZD 3FPPA 3H94A 3HZXA 4X62Q 3RNUA 4FF2A 1RTNA 1RD9D 4JV5L 1K8OA 1X65A 4A3EG 3MVVA 4QUCA 2WV6D 2EYFA 1CUKA 4K2KA 3I55A 4LF4L 2L15A 1RF2D 2B2WA 2R92H 4X3TA 5BN4A 1K28A 5CC4A 4A3FG 4BY7B 3S2HB 4ZCKA 2GVBA 4ZKCB 5CMDA 1HR0L 1S5BD 2Y0SG 1G2TA 4DV4L 1IBMQ 2B63G 4HEDA 2JA6B 5JEAG 3DEOA 3KLSA 4AYBG 4AQYL 2UU9L 1FR3A 1GHKA 5TSSA 3U4ZA 1K73C 5C0XH 4IALA 4R4TA 2FJ2A 1QOHA 1II3A 3IFTA 2MQHA 5FLMG 4DV1L 2G9DA 2ZM6Q 3ZJYC 2HDLA 3PO2B 2R7ZB 4F87A 4XYOA 1DM0B 1I5FA 2E76C 5IWAQ 1VQMA 2F0LA 2M9VA 3FVQA 3DLLA 1IL8A 2IL8A 2OWOA 3MA2B 3UDIA 2IJ0A 3NWSA 4IOAA 4ULLA 3MEHA 5ISRA 1PRTD 4H02A 4A4IA 1HRJA 1XPUA 2Z0SA 2ZTEA 3BYYB 3BS1A 2A6EC 1EY6A 3HP3A 3GTOB 2Z4HA 5FJ8H 1TWCB 3EA6A 1SBBB 4DV2L 4HCEA 3J80E 4K5WA 1C48A 1Q12A 3K80C 5M3FB 4OWWB 4XDXA 2K52A 1T5XD 1EYGA 3K57A 3JAML 3U9SA 4LFCQ 2VZAA 3T4AC 4HR7B 2E2IB 2EIFA 2XIWA 3SK6A 3NXWA 3MWYW 4B9WA 4RKLA 5C4ZA 2PNRC 3WWVA 1Z9FA 1MKHA 2K5WA 4OWXB 1B7YB 3BZDB 4GNXA 2KVMA 1DGSA 4JOIA 1X3FA 4JVZA 3A0JA 3BVZA 4IJLA 3DXJC 1FNVA 4JI4Q 3CMEA 1WJJA 2WB1B 4BBRB 3I4LA 1WTWA 2A73B 1F9PA 3T1HL 1Q1EA 4JBWA 2WFWA 5J3BA 2VQEL 4X64L 2B2YA 3GTLB 1CKNA 2MO1A 2OTLA 1VQNA 3J81c 2B2UA 1SE4A 3CQZH 5IGGA 1I50B 1E2VA 4ZAIA 4NXNL 3PSIA 3LNNA 3VYUA 2X6GA 4ZLTF 3EFXD 5IT9E 2UUBQ 1HA5A 3IKJA 5CV4A 3WOEA 5GADC 4CJ0B 3CAMA 4DAYB 2AQ3B 1XJVA 5C4JB 1PH4A 4DV6Q 1I4GA 1HA6A 4IFDH 1W6KA 1H9MA 5K5PA 2YU9H 1J6QA 3D4DA 4LF4Q 5NUCA 3CCSA 1R4QB 3VA5A 1KQSA 3D4RA 3P75A 5KNBA 4U68A 1MGSA 1HR0Q 1CA6A 1QG7A 3HKZB 4DK6C 1A0IA 2QILA 3VDYA 4AQYQ 3GD7A 4CKCA 4A3KH 2O5JC 4GZYC 2RDGA 1FVIA 4DV1Q 3GTPH 1N34L 4CKEA 4RKBA 3P7JA 1SE3A 3S1QH 2JA5G 1STNA 4A3DG 2XRQD 3PIOA 2L4NA 4LFAQ 3A8JE 3H6MA 2NVTH 5E7NA 3EROA 4DV5L 1EZ6A 3G6EA 1PTOD 5IY0A 2EPBA 1K8GA 2CW0D 2JA8B 4WORA 1B4OA 1TWHB 1Y1WH 3TZUA 2GA4B 3HOWH 5C44H 4KKTA 4CGYB 1HR0W 3F2DA 5IYDG 1JWSD 2BH8A 4A3GG 3SHLA 3MXNA 1TWAH 1BNZA 3GTMB 3X3MA 1DONA 2UUCL 5D65A 4IURA 4C3JB 1HFNA 4GLAC 3TP7A 3KLSX 3T1YL 1YNJC 1VQPA 1EYDA 5IP7G 4NXML 3HOXB 4JI2L 4K5XA 1R9TB 2BOSA 4ID6A 4BY1B 3S2DH 2LSSA 1EWCA 4A3BG 2OF1A 3M4QA 2A68C 3JAMi 1ZXTA 4G7OC 4HMJA 4QMGA 1F2ZA 1ZYRD 3NEMA 4K14A 2L0CA 3BVMA 1VQ8A 1YNND 2WINB 1GM5A 4Y7NB 4YCUA 1STYA 2F0QA 4C1NI 5KIXA 2R61A 1ILPA 1EYCA 3G6JB 2CQOA 2KCMA 4QUFA 2VQEQ 4KHPQ 4PMCA 1AN8A 4F8MA 3HOVH 3HG9A 4DXFA 4DA2A 1N8RC 4DR5L 3KLWA 3IAYA 4R4OA 1B3QA 3FP9A 3NELA 3J81E 2K05A 2E8GA 3J7YW 1WTOA 1Q81C 3SEBA 4GLVB 1KL9A 5IE8A 3NBIA 5M5WH 4HIMA 1F9RA 3LWUA 4HSPA 3A55A 5I9PA 1IKMA 1BKBA 2WAQG 4C3HG 2EYMA 5IYCG 1MJEA 4GKJL 3DM1A 4A3IG 1VQFA 1DOLA 3H0GG 3VR3A 4OO1H 3L2PA 3GTJH 2F0PA 2ICEC 2D0OA 3CHBD 2NB0A 1SYCA 1RHPA 1JWMD 2Z1CA 2AQ2B 4PMBA 4HIKA 1RODA 1WCMB 1JWUD 1SLJA 1U5KA 1B8AA 1DZ1A 1IL2A 3ER0A 3GTQB 4GKKL 1HZAA 1XWEA 1IHZA 3RZDB 4JI8Q 5KYIA 3MXUA 5IYBG 3KFUA 4PG3A 1IZ6A 2ZXRA 1MD2D 4BY7H 3NENA 1N34Q 3S2HH 1GUSA 1MHWC 2G9HD 3OOCA 1E1TA 2OQKA 1WVLA 4XQNA 1MSGA 2JA7G 4OGQC 2BCOA 3FRPB 2JA6H 1ICWA 4JI3L 1X3EA 1NSNS 1VQLA 2IY5B 5KGUA 3OW2A 1HXYD 3OSOA 4DUYQ 1SYEA 4C3IG 4DV5Q 3FKIG 1C9OA 2FINB 5T1IA 1B1ZA 1LTTD 2B29A 2JK8A 1Z6HA 2HIVA 1V8QA 2F0KA 4R8IA 2A1AA 2R7ZH 4WJWA 4LUZA 2D9UA 1PA6A 2YYZA 4P2CB 4NP5A 3KF8B 2VY3A 3TRZA 4NDXA 1BVSA 3E6ZX 1BO0A 2UUCQ 4LNQA 1C4QA 1LABA 1ZEQX 4F88A 3ERQA 2AWNA 4KD4A 3I73A 3T51B 3T1YQ 3MFYA 3MZ5A 3FPUB 2QKIC 1F9QA 4JI2Q 4DK3C 4N9TA 1KRTA 2F0JA 3TS2A 1W2BA 3GTOH 4EQPA 1S5DD 4IZ8A 5AJ3L 1UAPA 4OX9L 3I4MG 5H1SE 3KJPA 5M3FH 5ELFA 2XWBB 3OTOL 5EPJA 4S3SA 3O13A 1G2SA 4B3ML 4HN7A 3EN2A 2E2IH 4UP7A 1BBXC 3CCMA 3BG3A 4K2LA 3K5NA 3PGZA 4B3RL 1ENFA 2HCIA 5FLXL 4NPSA 1DCZA 2BE5C 1EY7A 3Q8DA 4JI7L 1XNRQ 4DR5Q 2L5TA 4YHHL 1Y1VB 4ZYSA 2ENBA 2I46A 3CKIB 4GN5A 3DWQA 1N36Q 4BBRH 4H44C 4GKJQ 1EEFD 1SAPA 4ILWA 3KUPA 4A93B 2ZTCA 3GTLH 2TSSA 3NK9A 1EU3A 1G51A 4IUTA 3NTIA 4QF4A 2WB1E 1I50H 1QILA 2JEAI 3K6OA 1STBA 3CQZB 2VUMB 1VQDA 3N52A 4PNYA 2RQXA 1V1OA 1XPRA 4FYDA 1E2WA 1K83B 2WACA 4GKKQ 4UP8A 5C4JH 4GLXA 2DNCA 2Z6KA 4OIKA 3PUZA 1PTOC 2PI2E 1OXUA 2EY5A 2CW0C 2BA1A 2E75C 1UUPA 3I90A 3GQBA 2K5QA 2B2WC 4J8QA 3PO2G 4DN4M 5C4XH 4UP9A 4WRDA 5C3WA 1SE2A 1BUVT 5KNCA 4BXXH 1W3SA 5LHY1 2NBFA 2SNSA 2F4IA 1LTGD 5FK9C 3GTKB 4IPCA 1SMYC 4A3KB 4WJ4A 5A2QE 4DR2Q 1Z47A 3CC2A 4V0BA 4CDDC 3Q22A 3HKZE 1CQFA 5IIFA 3TS0A 1VQCA 1CKMA 4OWTB 1GUOA 2J4XA 3GTPB 2HQLA 3S1QB 4NKLA 1HNZL 1ZYRC 2N49A 2NN6I 2VL6A 4KTAA 2N8NA 5FO7B 2BDOA 2L1BA 4LF5L 2EJMA 2JA8H 1V43A 2PNHA 1TWHH 3HOUB 5ELDA 5K36H 3CF5A 2KECA 3CCJA 3CCEA 1D7QA 4OX9Q 1NUCA 3GTMH 1VDZA 1C7YA 2N78A 4HJ5A 3RZOH 3GV6A 4QY7A 1F77A 2VQFL 2VW9A 3IRBA 3OTOQ 3RN5A 5C0XJ 4IOCA 1JJGA 2ID0A 1O7IA 4KV6A 3HOXH 4DXGA 1R9TH 4X3KA 1X3GA 2QDLA 4LJZC 3BZCA 1A2UA 4B3RQ 1TWFB 1ESFA 2NVQB 4YIJA 4IUUA 1TY2A 2B63H 4LFBL 4BA1I 1MIUA 4FF4A 4Y7NH 2CHBD 4YHHQ 3HGBA 1PZKD 3I8ZA 1QVGA 2KJXA 5IGFA 4DV7Q 3UDGA 1O78A 3I7FA 1IKLA 1STGA 2SOBA 4GOPA 2RHQB 3DMUA 5KRUA 1JQYD 4DAMA 2B2YC 2UXCL 3UE1A 4DR7L 5ELEA 3C3LA 2ALYB 1L1OA 4KKSA 4P75A 2WIIB 2B2UC 1VQ4A 1JB7A 1NBWA 2O2LD 4F7XA 1Z7TA 1LT3D 4KK7A 1Q86C 1HZ9A 3HKZG 2K04A 2LMCB 2F4VQ 1BQQT 1LTID 2D5DA 3W1BA 1EU4A 5M5WB 3Q0AA 4A3MB 1VS0A 3HOYG 2NN6G 3QIAA 4R9WA 4JI6L 4DUZQ 3NPPA 1PFMA 1UEAB 3CCQA 1SMXA 2VB2X 2OEOA 2QCPX 5HY6A 3M4YA 3GTJB 2R93G 2NZHA 2V1CC 2KEDA 1WCMH 2Q2IA 3S17H 4X66Q 2V4DA 1WTHA 1IYVA 1TS4A 1IBLL 3GTQH 1EOTA 3A8IE 1U9RA 3RZDH 4C2MB 1I4PA 4UY8C 3FEWX 4KMUC 1FL0A 1WFQA 1GUGA 3BU2A 4B3TL 1CM9A 1KC8C 4C1NK 4XIGS 1SE8A 1UE1A 2PCFB 2WP8J 1U4RA 3QJYA 2AQ1B 1PH7A 4JW0A 3PO3H 1IXRA 3E5SA 3Q6SA 4R8NA 1HNZQ 2YTYA 3TP6A 3SR1A 4RG1A 4L5TA 1LT5D 1PVOA 4KJOA 1EQQA 2PO4A 4C3JG 3GO5A 4TRDA 4IFDJ 1S3OA 2PW7A 5JJIA 3J81j 4O1NA 5ELOA 1K8MA 4L8JA 1PHJA 1STHA 3UE0A 3A74A 5HGTA 2LY7A 4BY1G 1X55A 2RBMA 1SYFA 4KN4C 1IW7D 1BCPC 3M7GA 2E5LQ 3AFQA 3M4OB 3S1MB 2RDHA 5I6YA 3P20A 1NMGA 1LACA 2F0DA 4HTHA 1CSQA 1N32L 4JPBW 1IBKQ 5C0XI 1L0YB 1VMPA 3GV3A 3TDQA 2K5DA 5T1GA 3SVMA 2KA7A 1I94L 1A2TA 2B2TC 5M3MG 1SNOA 5JVH3 1GD7A 1M4VA 4LMQD 5M5XB 3H3VH 3RLOA 4HJ8A 2R7FA 4JCVE 1X3PA 1QZGA 4RFBA 2RHSB 5IP9G 3DHQA 3L7ZC 3L0OA 4L5SA 4KKUA 4PMWA 4K0KQ 3M3YH 3KJOA 4HSVA 1BDOA 4QIWB 2ZTDA 2Q8TA 1TXYA 4JI5L 3BVGA 4P72A 2PQAB 3D31A 4ZUIA 2UXCQ 4DR7Q 1K0RA 4K6DA 4A3JB 3S9WA 1UE5A 1P16A 2F3WA 3PV0A 1Y1VH 2JN4A 3URYA 2X69A 3I4NG 3CMAA 1JOOA 4TKOB 3UI2A 1PTOF 3IL8A 1E3PA 2Q8RE 1QUQA 5JJLA 3CD6A 4JI6Q 4A93H 4FDBA 1FGUA 2K14A 4A3CH 1LTRD 2G5DA 4APVA 1SN8A 4IUQA 3W2DA 1EQVA 2JEBI 4DGZA 2VUMH 3HFZB 2R92G 1JE4A 2DNEA 4FXDA 5GROA 5AFWA 1K83H 3OW7A 4XYQA 2KUMA 1HFGA 2MGSA 4JV5Q 1EYAA 3S24A 4EQNA 3PUXA 1SDFA 3CP0A 1VQKA 1K3RA 2F0VA 5C0XG 2BE5D 5E3FA 2IX1A 4ALPA 5C5MA 5GQOA 2EYHA 2EJFC 5JPMC 4N8FA 1XMQL 2JJQA 1JC7A 3J80L 4DV4Q 5C4XB 3TP5A 1PRTB 3V2TA 5C5LA 4DR6L 2KCTA 2DUDA 3GTKH 1GOZA 2UU9Q 3S1RB 1AZPA 3G7LA 1X3QA 4IFDI 3HOZB 1YHQA 2E2JH 4FNFA 1I4QA 4OONA 3TN2A 1D5XC 3NTKA 4QB4A 5E4WC 3K81C 2XWJB 4DU9A 5FJ8G 1X6OA 3A8KE 3RMHA 2F1MA 3AFPA 3M7NA 2RCNA 3HOUH 5A35A 1AE2A 1I94Q 2F0FA 1EY0A 1EUJA 4K8JA 3NBHB 2IW3A 2RDFA 5C3EB 2UXBL 1K9MC 3W1GA 1XYIA 3E9HA 1QE6A 4BBSB 4YCVA 1JR0D 4NW2A 4DV2Q 2HCCA 1VF7A 5JJZA 3RZOB 2AWOA 3MTSA 1PYWD 1JMCA 1SMYD 3TZDA 5IT9L 5ELNA 4A3EB 2F0MA 1YJ9A 1VQ6A 4R4QA 4DF7A 1PYSB 1TWFH 1KIXA 4P73A 4A3FB 2B2TA 1N33L 1RL2A 4RMFA 4JI5Q 4ODGA 2NVQH 1O80A 2Y0SB 2CH4A 1LYLA 4IN3A 4DK1A 2B63B 1KRSA 3HS0C 3KDFA 3MHBA 2K7VA 1L0XB 2D2CC 4C3IH 4AIMA 4AYBB 2H1EA 1X56A 3UDXA 1EEID 3SDZA 4LK1C 3WOFA 2NWGA 4XT3B 5DAUA 2J7ZA 3ULPA 3S1NB 2N3SA 3I91A 4DK0A 1FD7D 2QF7A 3DEPA 5CV6A 5BR8L 1RIPA 1X32A 1H9SB 2MPMA 4BS9A 3AU7A 3PUWA 3T1HQ 5LMUL 2R3ZA 4X64Q 1Y69U 4IFDG 2BH2A 1TQOA 2K50A 4MNOA 3VYTA 1FGBD 4NXNQ 4XXEA 4A3MH 4CHTB 1SSOA 3M85A 1VQOA 4KY7A 2EYLA 3OIPA 2Z6KC 4MHEA 2ICIA 1GXDC 1Q8IA 3TREA 3R93A 3VYSA 1BF4A 2P5ZX 1EOVA 2KOLA 1NE3A 5COYA 1M90C 1IW7C 2EXZA 4J6HA 1HCZA 4EGVA 1XMQQ 4I7AA 1BOSA 3S17B 2XRSD 4YY3L 1PTOB 1EY4A 3W3AA 5G3LF 1ILQA 1JICA 1ASZA 1K0SA 2ZJPA 2B39A 4A75A 1TIID 4C2MH 2KCNA 3E0EA 3OPOA 3DUZA 4OELB 2FFKB 1BCPF 1JJCB 1NCVA 4YWMA 3J80i 2DY8A 4OO1I 2PMZB 3K58A 4PV1C 2SNMA 1YEZA 1RJTA 1Y1WG 3HOWG 4G57A 5C44G 3HKSA 4JYAL 1XTCD 5EPKA 3KF6A 3PO3B 1O7LA 3EJIA 5CV9A 4LF7L 1RCVD 2KHJA 4EQOA 1SNMA 1L0WA 2HUGA 2K33A 1B9MA 3KYHC 1KDCA 3SE0A 3M4OH 2KQ3A 3S1MH 4Q5VA 2AUKA 3Q23A 1VCIA 3BJUA 2H4OA 1IYUA 1I3QH 4PZ8A 3C1EA 3J81L 2MO0A 2RSNA 1HH2P 1TY0A 2WKDA 4ME5A 1U0LA 5LMNL 4NXMQ 2XGTA 3PF5A 5I2YA 1O7ZA 2B8GA 1YBYA 1N33Q 2GN5A 1CA5A 5M5XH 3TQYA 1DOMA 3HOVG 1VQBA 2EYJA 5EBDA 4OEMB 1GJXA 4ZK9B 2IPKD 1M8AA 1D5MC 3G48A 3KBGA 4LF8L 3VR6A 5G3LD 2A6HD 2PW5A 1TKWB 5BR8Q 1E22A 2D62A 3M3YB 2HD3A 3OMGA 4IUPA 1HUNA 1ZKOA 4XQJA 4IJHA 4TVAB 4GNXB 1BCPD 2RCFA 4GOPC 3SXHA 5LMUQ 3C2PA 4A3JH 2IHEA 2EJGC 4OO1G 5IGDA 1L1OC 4RH6A 4QIWE 1UEBA 3K5OA 2EOTA 4FP5D 4IQZA 4RCNA 2O4XA 4JG2A 1PH6A 1T9HA 4Y52H 1CKNB 2EY2A 5IGBA 4O42A 1KDAA 1KTKA 1T5EA 1HNWL 2HT1A 3I3CA 1WD1A 2VXWA 2NTSA 4A3GB 3NE5B 1H9KA 3C46A 4J1MA 4BY7G 3CC4A 2PZWA 5C3XA 2KENA 1QB5D 3PMFA 4YY3Q 2K5HA 5EQ0A 2JA6G 2EYOA 4H13C 2K03A 2OQ0A 2X6LA 4RGMA 1HZCA 1D5ZC 1DD2A 1G91A 5J22A 1QCBD 2YTXA 1LO5D 1EIGA 1O7YA 3OHXC 3UDFA 4A3LH 2R7ZG 1NAPA 2QGQA 1PH2A 4R1JA 1YHBA 5DM63 3Q24A 4JI3Q 2QDBA 2Z8LA 5FOBB 3NQTA 2PI2A 3CPWA 3S1RH 3KBXA 1ICFB 4DR1L 2PYKA 3G4SA 5CBEE 3HOZH 2L11A 1IYJB 4BA2I 1SRUA 3E9IA 1S5FD 2JSOA 1SNCA 4DAYA 3S16B 4Z9CB 2E2JB 1X54A 1NR4A 2K28A 4IUVA 1Q8KA 1EIHA 2HHHL 1G6PA 1LLRD 1OXTA 5I6WA 1I4RA 1Q82C 3JAMc 4DV3L 5C4HA 4OIJA 4HCSA 5M3FG 2WAQB 4N9PA 3RLNA 3VR2A 4C3HB 1WD0A 1AE3A 1CT1D 4ZQ3A 4TSSA 3S14B 3H0GB 2ZT9C 5CR3A 2OTJA 1MSHA 5LMNQ 2Z6BA 3J81i 4GS3A 4DR3L 3MXNB 5GAEC 3CU7A 1BBWA 2A69D 1B50A 3OYYA 5C3EH 4EVOA 5AJ3Q 4BBSH 2OXPA 3U50C 3CRKC 1WTXA 3F2CA 1J9OA 4LF6L 5LL6X 2K5VA 4A3EH 3EIVA 3RR5A 1WI5A 1BBUA 4B3MQ 3MXGA 4EQ5A 1F2LA 2WB1G 4OXPA 4BBRG 3D4WA 1GKHA 2F0TA 2C9OA 4A3FH 2ZM6L 2MNAA 1VQ9A 2JA7B 5IWAL 3T56B 2I5MX 2I07B 2UUAL 4JI7Q 1I6HH 1AEXA 5JEAH 2MUYA 3VR5A 5DEHA 2F0HA 3NP8A 1VF5C 4MN3A 3S1NH 4C3IB 3R2TA 1QZHA 1LTLA 1PH1A 3RN2A 4K8IA 4JBJA 3NQIA 2Y0SE 5FLMH 3CCRA 4ABNA 5M9OA 1STAA 1HNWQ 5A2QL 3PIP3 3CCVA 1A3TA 1VQGA 4AYBE 1OTCA 2NZ1D 5DM73 3R2IA 2IWHA 1JE5A 5ELBA 3OIQA 2XSCA 3QOLA 4FO2A 4IO9A 2QEJC 5C4XG 1EQTA 1TWGB 2Z4IA 1A6XA 4LFCL 1KAAA 2CWAA 4BXXG 4K5VA 4ME3A 3GTGH 2L12A 1JCKB 1RKNA 2EYPA 5M3MH 4H7BA 3I4MB 3ONAB 4RHRA 1U4LA 2F0EA 2FMCA 5F2DA 4JI4L 1PTOH 1SFOB 1HZBA 3PF4A 4L5QA 3A54A 1YNXA 5J39A 1PMRA 4XTCS 4DR1Q 2SEBD 2KHSA 1SJHD 1FYCA 2ZXOA 3R3OA 2JA8G 2A19A 1PH8A 1YVCA 1NTGA 3KF6B 3M4PA 1OXVA 5EKLA 3MFGA 3OWEB 5K36G 4LF9L 1SYGA 3F2UA 3KOJA 2QW7A 2UUBL 4DV3Q 4O0AA 4IPHA 5GAGC 2PMZE 3JAME 1MI2A 3GDEA 1KHIA 4DV6L 2F3VA 4LF5Q 1WYDA 2A6HC 5D3DA 1AZQA 3D0FA 1S4ZA 4KN7C 3HOXG 4DR3Q 1D2BA 1HNXL 5E4XA 1YJWA 2NVYH 4MZ9A 1QNKA 1SYDA 5EKIA 1Q90A 1Y14B 1LT4D 3N6RA 3RLFA 1XTDA 4IPGA 4UDUC 4B3SL 1MJCA 4G4KA 5JVG3 2NUCA 2VQFQ 1I3QB 2HIXA 3BZKA 5EAYA 4AH6A 3STBC 3J7ZC 4LF6Q 4IUNA 3R8BA 4UPAA 4DNIA 4PZ6A 1W6JA 2XNAC 2K01A 2NYZD 2RA4A 2A74C 2F0UA 3A5UA 1GHJA 1TU2B 1ONLA 4DAPA 4KY6A 2YTVA 3F2BA 5KYLA 1NR2A 1DXMA 1VQ7A 4LFBQ 4LFAL 3FHWA 2UUAQ 4G7HC 1CQVA 4DPGA 3AYHB 2XTIA 3NSWA 1B44D 4XQQA 2CCZA 2O5IC 2RKSA 3KF8A 3NWTA 3QB3A 4KI0A 1FNWA 1QWYA 4CJ2C 2QA4A 2Q8IB 4RGNA 5IGEA 1Q46A 1KLGD 3QR8A 4UAIA 5I9OA 3H15A 1D6EC 4HJ9A 2JA5H 3A5ZB 4A3DH 4QL5A 1F2MA 3H3VI 2SDFA 4JI0L 4ZRZA 3S15B 1SYBA 1ET9A 4DFAA 2KEEA 1QJOA 5EGTA 5CBAE 2QEXA 1ESRA 1DYQA 4LUOA 1WCMG 2K6AA 1K3BC 4HJAA 4NMZA 5EPLA 3F8TA 1LT6D 1DOKA 1NMFA 1CK1A 1LTBD 4L6TB 1KNEA 3WDNA 4DV0L 5IYDH 2H5XA 4A3GH 4DR4L 1U4MA 3U4VA 4ZUJA 3AEVA 1Q7YC 2F0WA 3MC0B 1WOCA 3VR4A 1HQRD 5IP7H 3FMCA 3PO3G 1IBLQ 4JBKA 3I4OA 5D14A 1A8VA 1YIJA 2EQSA 1L2FA 1NNXA 5FO8B 3K7AB 3H91A 4A3BH 5HURA 2F0NA 4KHPL 1I4XA 2UXDL 1S5ED 3H09A 1EQRA 2AUJD 4B3TQ 1A3VA 3PQIA 2HDMA 3AMUA 4X6AH 2A69C 4J15A 3K5MA 1PH9A 1H9RA 3L9AX 4L63B 4MIUA 1E24A 1ASYA 4LF9Q 3CPFA 1NY4A 4RAUC 3K8AA 1V1PA 4C56C 3QG1A 1DJRD 3J7AV 1YITA 4KLKA 2FHTA 1EFID 3M9BA 1N9WA 1H95A 3QOJA 5KNDA 3S16H 3NUCA 1NJIC 5IOCA 3ICEA 1HNXQ 4R4IA 1VQEA 3C1FA 1BR9A 1ENCA 2I0QA 1B70B 2CFMA 1JORA 5D3IB 1UWVA 3PUVA 5FKAC 1S40A 4B3SQ 3L3OC 4C3HH 5IYCH 2E2HB 3HOYB 2NZOA 4A3IH 3TBIB 1E2ZA 4DNTB 1N32Q 3S14H 3H0GH 2AMCB 4JI8L 4CDCC 1MBYA 2K32A 1HQMC 2JYOA 2Z9HA 5C6AA 5JJKA 5FLXc 4KJNA 3VYRA 2JXMB 2N88A 5KEEA 1F2YA 4H0LC 2R93B 2C35B 1ENAA 2EDGA 4KHVA 2D0PA 1LUZA 2JE6I 2WAQE 2IX3A 1SEBD 2PQEA 5M5YH 1PH3A 1D1KA 1D1IA 1CHPD 1S72A 2F0SA 2Q2TA 1EZ8A 4FXKC 1U4PA 1PLFA 1TS5A 4DUYL 1KLUD 1WTVA 1J5EL 4FF1A 3IFDA 4QGUA 1Y1VG 4MTKA 5IYBH 5I2XA 4P71A 3V96A 2EVBA 2NVXB 1R4PB 1BXTA 1FJGL 1HJPA 2MFIA 3EBEA 3J7A5 1PYBA 1EWHA 1VMCA 4A93G 1CKOA 2JA7H 5IODA 3MEFA 2KBNA 4A3CG 4JI0Q 2MHVA 1XX8A 4E6IA 1PDQA 1Y8OB 5EKKA 3PIPA 1I6HB 1H9JA 1KXLA 2VUMG 3FDTA 3FKIH 2ZJRA 4GOPB 2EE1A 1SR3A 4RGTA 3LGJA 2LXJA 2CQAA 1PH5A 4QCLA 1VQ5A 3DWAA 1L1OB 2F03A 2JQOA 3I56A 4DV0Q 4RHSA 1SNQA 2M2LA 1G291 2LXKA 2ZXPA 1V9PA 2RF4A 2DN8A 2NTTA 3P1HA 4DR4Q 1AP0A 4QQBX 4JI1L 2XVSA 2M00A 1JJ2A 5CGKA 3CCUA 1TWGH 3VA7A 5CV5A 1YI2A 1CZGA 4JK1C 2ASBA 1B2TA 3GTGB 4A76A 4M8AA 2L9HA 1CI3M 4A3KG 5M3MB 2UXDQ 3BDCA 3I4MH 4BWGB 1EY9A 3TSSA 1XNRL 1I4HA 4IPDA 1SROA 4V190 2K4KA 2OCEA 1SFOH 1PFSA 1C8CA 4R4CA 3KLRA 4RGOS 4HMIA 3TP8A 1N36L 2E74C 3B6YA 3ZYYX 2A5HA 3OMCA 4DR6Q 3A56A 1HTLD 1VQJA 2PZUA 3A7AB 3TMEA 3X3NA 5EJWA 4FXGC 3BDLA 2E2DC 3HOUG 5CYUA 3U58A 1STEA 1XMOL 3QWNA 4ZKBB 1EL0A 2OT2A 1B3AA 3I4NB 4I7ZC 4B08A 3MAQA 2ES2A 1YZ6A 2BA0A 2EY6A 2EXDA 4TQUS 3V05A 4MTNA 2GVAA 5CV8A 1YHAA 3OWFA 1PRTC 1SJED 4KY5A 4G7ZC 3ERSX 5FLXE 2FXQA 2AHOB 3K5LA 2NVYB 2R92B 3ULLA 2UXBQ 4POGA 3KK7A 1XPOA 1JT8A 1XNQL 2KHIA 3ITPA 3J7AF 2IX0A 3QO2A 4QJFA 5JAVA 2J0TD 1J5EQ 1E0BA 2FMMA 2AKWB 1WTPA 1VQAA 4DR2L 5BN3A 1FJGQ 3HRZC 1A63A 2C5CA 1ET6A 2WKCA 3NTHA 3PO2H 2IT1A 3LX0A 5JOBA 1TS2A 3CXCA 2F52A 2PZTA 1VQHA 1XXGA 3ND8A 2K1BA 4CKBA 2K75A 4YWLA 1G6ZA 1Y8NB 4LAAA 4PQXA 4RCOA 2DJFC 2VB3X 3HEJA 3TEHB 4A3MG 4FF3A 4EX5A 4JBMA 4HIDA 2DJGC 3AQQA 2XN9C 1TWCH 2JA5B 1B9NA 3S15H 2CWPA 4I65A 4A3DB 1CZWA 4K6LA 4JI1Q 2VS1A 2IHFA 1PXUA 5JPNC 3STBD 4YWKA 5E1FA 1GVPA 2VNUD 1QUQB 3T53B 1LM0A 4WJ3M 1OO9B 2KCCA 1P8LA 4LWCA 2F3IA 1GO3E 3EVQA 1KAWA 2TMPA 2YV5A 2I5HA 3RD4A 1OXXK 4B9XA 5CORA 1K8AC 3U9OA 1KD1C 2RSOA 3K59A 1QNUA 3BYTB 5JEAJ 4XT1B 1KABA 4CDEC 1I6VC 1SNDA 5DLQE 4X3UA 2PQAA 2MP1A 2K5NA 4NB3A 5J1ZA 1OXSC 1E7ZA 1WTRA 4DV7L 4CDFC 1GUTA 3D6WA 4WFN3 3K7AH 3CRLC 4DKAC 1B53A 3DWPA 2A6ED 4A3BB 1KDBA 1A62A 5GAHC 2HQEA 1V1PB 4X65L 1PZID 4GN3B 1UNSA 1X9NA 3CCLA 1A15A 1XMOQ 4L5RC 1RTOA 5FO9B 2F4VL 4JYAQ 1GUWA 1TS3A 2B2VC 2A8VA 4P74A 1J8IA 3K0XA 1A3UA 1AH9A 1Q1BA 4LF7Q 1VQIA 3G71A 2F0OA 3CW2C 1M1KC 4DUZL 1PV4A 4LUVA 1UE7A 4Q0FA 1EWIA 2EZVA 1EY5A 1F9SA 4PZ7A 5LL6S 2YU9B 1HUMA 5ELCA 4X66L 2F0GA 3GP7A 3SK8A 5IGCA 1EIYB 2ZJQA 4O2DA 2Q2HA 1XNQQ 1YJNA 4X62L 2E2HH 3HOYH 1KNAA 2CH4W 2DY7A 1EIFA 1HTPA 4LW1A 4HIOA 2NN6H 1LTAD 4CJ1B 1WTQA 1AFPA 4A3IB 3LWEA 1BCPB 4N8X1 5I4DA 2PPBC 2R93H 1CTMA 1PFNA 1V1QA 2JP1A 2N55A 1PZJD 1EFWA 1ML0D 3SGIA 1S5CD 3ULJA 2DGYA 4OHJA 1CFMA 4RWSC 1E1OA 5M5YB 1UE6A 2CKZB 4A3JG 1IBML 1C0AA 3W5OA 2CVRA 5BN5A 2Q2UA 2LKVA 1YNNC 1HHVA 4YCWA 3NHHA 1JB3A 2LFNA 2NVTB 4LF8Q 2NVXH 4HJ7A 1AW7A 3T16A 2RVLA 2MJ8A 3PIO3 3D6CA 5L37A 3KDFB 1Y1WB
chains in the Genus database with same CATH topology
4LFAL 1JMCA 3FHWA 4JI2Q 4DK3C 2E5LL 2UUAQ 5ELNA 1KRTA 4DPGA 3AYHB 1YJ9A 2XTIA 4R4QA 1VQ6A 3TS2A 3PCOB 1W2BA 2CCZA 3GTOH 4KI0A 4C3JH 5AJ3L 2QA4A 4OX9L 3I4MG 3I2ZA 1PYSB 1TWFH 1Q46A 2R7DA 4P73A 1KIXA 1N33L 1RL2A 4RMFA 5H1SE 3KJPA 5M3FH 1IBKL 3H15A 4JI5Q 2R6GA 5LMNW 2JA9A 3OTOL 1LYLA 4BY1H 4HJ9A 1QVFA 2JA5H 3A5ZB 1KRSA 3KDFA 4A3DH 4QL5A 4B3ML 4C3IH 4AIMA 3H3VI 4JI0L 3EN2A 2E2IH 1X56A 3UDXA 4UP7A 3CCMA 5HGQA 3ULPA 2N3SA 3J80c 2QEXA 3K7UC 4LUOA 1WCMG 3PGZA 5BR8L 3PUYA 1RIPA 4B3RL 2B3GA 4HJAA 3PUWA 4JOIC 4GNXC 3T1HQ 4NPSA 4A3LG 1D8LA 3Q8DA 5LMUL 4JI7L 3JC66 4X64Q 4DR5Q 3F8TA 1XNRQ 1NMFA 4K0KL 4IFDG 4YHHL 2BH2A 4DV0L 5IYDH 1CSPA 2H5XA 4A3GH 2K50A 4GN5A 4MNOA 1N36Q 4GN4B 4BBRH 4DR4L 3U4VA 2I5LX 3HOZG 3AEVA 4NXNQ 1Q7YC 4GKJQ 4JC0A 2ATWA 4A3MH 3M85A 4X65Q 1WOCA 2ZTCA 1VQOA 3GTLH 5IP7H 4KHZA 5IP9H 3PO3G 1IBLQ 3F1ZA 2Z6KC 3I4OA 4JBKA 1A8VA 1YIJA 1QVCA 2EQSA 1G51A 1L2FA 3TREA 2WB1E 1I50H 4A3BH 2JEAI 1EOVA 1VQDA 4KHPL 1NE3A 1XPRA 2UXDL 1M90C 1EQRA 4B3TQ 1XMQQ 4X6AH 4GKKQ 4UP8A 5C4JH 4YY3L 4GLXA 2Z6KA 4J15A 1ASZA 1PH9A 3PUZA 1E24A 2ZJPA 3DM3A 4A75A 1ASYA 4LF9Q 3CPFA 1NY4A 2PI2E 4C2MH 3K8AA 3E0EA 1OXUA 2HHHQ 5IT9c 2BA1A 5C3EG 4POFA 4YWMA 1JJCB 3J80i 1YITA 3I4NH 4KLKA 4OO1I 3CC7A 4BBSG 2NVQH 3RNUA 3PO2G 4X62Q 3M9BA 1N9WA 1H95A 1YEZA 3S16H 5C4XH 4UP9A 4JV5L 1NJIC 1Y1WG 4BXXH 1X65A 1W3SA 5C44G 4A3EG 3HOWG 1HNXQ 3ICEA 4R4IA 3HKSA 1VQEA 4JYAL 1CUKA 2I0QA 1B70B 2CFMA 3KF6A 4IPCA 1UWVA 3I55A 4LF4L 2L15A 3PUVA 4WJ4A 4LF7L 2KHJA 4DR2Q 2R92H 1Z47A 1S40A 3CC2A 4B3SQ 4A3FG 3HKZE 2GVBA 4C3HH 1L0WA 5IYCH 1VQCA 3TS0A 1HR0L 2Y0SG 1CKMA 2NZOA 4OWTB 4A3IH 4DV4L 1IBMQ 1N32Q 3S14H 3H0GH 2AMCB 4JI8L 2B63G 5JJKA 5FLXc 2HQLA 5JEAG 4AYBG 4AQYL 3KYHC 2UU9L 3M4OH 1HNZL 2N49A 3S1MH 3U4ZA 2NN6I 1K73C 1VCIA 4R4TA 2C35B 3BJUA 2VL6A 2D0PA 2N8NA 1I3QH 1LUZA 2JE6I 2WAQE 4PZ8A 5M5YH 2MQHA 1PH3A 5FLMG 4LF5L 2MO0A 4DV1L 1S72A 2JA8H 2ZM6Q 1V43A 3ZJYC 2Q2TA 1HH2P 2PNHA 1TWHH 5IWAQ 1I5FA 4DUYL 3CF5A 1U0LA 5LMNL 1VQMA 4QGUA 2XGTA 1J5EL 4NXMQ 3PF5A 1Y1VG 5IYBH 3CCJA 3DLLA 4P71A 3CCEA 1D7QA 2OWOA 4OX9Q 3GTMH 1YBYA 1FJGL 1HJPA 2MFIA 3EBEA 3UDIA 2N78A 4HJ5A 1C7YA 1N33Q 3RZOH 2GN5A 4QY7A 4IOAA 5M5XH 2VQFL 3J7A5 3TQYA 2VW9A 3HOVG 1VQBA 3IRBA 1PYBA 4H02A 4A4IA 5C0XJ 3OTOQ 3RN5A 1CKOA 2JA7H 1XPUA 4IOCA 3MEFA 4A93G 1JJGA 2ID0A 1O7IA 2Z0SA 2KBNA 2ZTEA 3HOXH 4JI0Q 4A3CG 1R9TH 3G48A 4LF8L 1X3GA 3PIPA 1KXLA 5FJ8H 2VUMG 5BR8Q 1E22A 2D62A 3BZCA 4DV2L 4B3RQ 3FKIH 2ZJRA 4GOPB 1Q12A 3K80C 1SR3A 4OWWB 2B63H 4IJHA 3LGJA 4TVAB 4GNXB 2LXJA 4GOPC 4LFBL 5LMUQ 1PH5A 2K52A 1VQ5A 4BA1I 1MIUA 4Y7NH 1L1OB 2IHEA 4A3JH 1EYGA 4YHHQ 2JQOA 3I56A 4DV0Q 4OO1G 4LFCQ 2VZAA 1G291 1L1OC 2EIFA 2LXKA 1QVGA 1V9PA 4QIWE 4DV7Q 2RF4A 1UEBA 4DR4Q 4QQBX 3UDGA 4JI1L 3I7FA 1JJ2A 4JG2A 4GOPA 1PH6A 1T9HA 1Z9FA 1MKHA 2RHQB 1CKNB 3WWVA 4OWXB 3CCUA 4Y52H 1B7YB 4DAMA 4JOIA 1DGSA 1TWGH 1X3FA 4GNXA 3A0JA 4IJLA 2UXCL 1YI2A 3UE1A 1HNWL 4DR7L 2HT1A 2ALYB 1L1OA 4JI4Q 4P75A 3CMEA 1VQ4A 1WJJA 1NBWA 1JB7A 2ASBA 4A76A 1Q86C 1HZ9A 4A3KG 3HKZG 2UXDQ 3I4MH 2F4VQ 3T1HL 4BY7G 3CC4A 1Q1EA 4JBWA 3W1BA 2WFWA 5J3BA 2VQEL 4X64L 1XNRL 3HOYG 1VS0A 2KENA 4YY3Q 1CKNA 2K5HA 2NN6G 2MO1A 4JI6L 2OTLA 4IPDA 1SROA 1VQNA 2K4KA 2OCEA 3J81c 4DUZQ 1PFSA 1SFOH 2JA6G 4R4CA 3CCQA 1SMXA 3CQZH 4LF6Q 2OQ0A 1N36L 3B6YA 1HZCA 5HY6A 2R93G 2NZHA 4NXNL 2V1CC 3PSIA 4DR6Q 2YTXA 1VQJA 1WCMH 2Q2IA 2UUBQ 3S17H 4X66Q 5GADC 3CAMA 4DAYB 3UDFA 4A3LH 1XJVA 1IBLL 2R7ZG 3HOUG 1PH4A 4DV6Q 3GTQH 2QGQA 1PH2A 3U58A 4R1JA 1XMOL 3RZDH 1YHBA 2YU9H 1J6QA 4JI3Q 4UY8C 4LF4Q 3CCSA 3CPWA 1FL0A 1WFQA 2PI2A 3BU2A 3S1RH 1KQSA 4DR1L 4B3TL 3G4SA 3HOZH 1IYJB 1KC8C 1HR0Q 4XIGS 1SE8A 1UE1A 1SRUA 4BA2I 2ES2A 2WP8J 1YZ6A 2BA0A 3E9IA 4DK6C 1A0IA 1PH7A 2EXDA 4TQUS 1X54A 3VDYA 4MTNA 2GVAA 1Q8KA 1YHAA 1IXRA 2HHHL 3PO3H 4AQYQ 3GD7A 1HNZQ 2YTYA 1G6PA 4RG1A 3ERSX 4L5TA 1OXTA 4A3KH 1PVOA 2FXQA 2AHOB 1EQQA 1Q82C 3JAMc 3GO5A 4IFDJ 4DV3L 1S3OA 1FVIA 5JJIA 3ULLA 3J81j 5ELOA 2UXBQ 4DV1Q 5M3FG 4POGA 1XPOA 3GTPH 1PHJA 3RLNA 1JT8A 1N34L 1XNQL 1AE3A 3UE0A 2KHIA 3A74A 2IX0A 4QJFA 4BY1G 1X55A 3S1QH 2JA5G 1J5EQ 4A3DG 2OTJA 3PIOA 5LMNQ 4LFAQ 3J81i 4GS3A 4DR3L 3MXNB 5GAEC 3AFQA 2E5LQ 2AKWB 1VQAA 4DR2L 2NVTH 1BBWA 1FJGQ 3OYYA 5E7NA 5C3EH 4DV5L 1NMGA 1A63A 3G6EA 5AJ3Q 4BBSH 3PO2H 2IT1A 5IY0A 3CXCA 1CSQA 3U50C 1K8GA 1N32L 2F52A 3F2CA 1VQHA 1IBKQ 5C0XI 1Y1WH 4LF6L 2K5VA 3HOWH 4A3EH 5C44H 3EIVA 1HR0W 3RR5A 1WI5A 5IYDG 3F2DA 1I94L 1BBUA 2BH8A 4B3MQ 4A3GG 2K75A 4YWLA 4EQ5A 1TWAH 2WB1G 4OXPA 4BBRG 5M3MG 2UUCL 2R7ZH 1GKHA 1GD7A 4A3FH 2ZM6L 3H3VH 2MNAA 3RLOA 1VQ9A 4HJ8A 2R7FA 4GLAC 4JCVE 3TEHB 4A3MG 4EX5A 3T1YL 1QZGA 5IWAL 4JBMA 1VQPA 2RHSB 5IP9G 5IP7G 4HIDA 4NXML 2I5MX 3AQQA 2UUAL 4JI2L 4JI7Q 1I6HH 3L7ZC 3L0OA 1TWCH 4L5SA 4PMWA 4K0KQ 3S15H 3S2DH 3M3YH 2CWPA 3KJOA 2LSSA 3S1NH 4A3BG 4JI1Q 2VS1A 2IHFA 1QZHA 3M4QA 1LTLA 2ZTDA 1PH1A 3JAMi 3RN2A 3STBD 4YWKA 1GVPA 1TXYA 3NEMA 4JBJA 2VNUD 1QUQB 2Y0SE 5FLMH 1LM0A 4JI5L 3CCRA 4P72A 1VQ8A 2PQAB 4WJ3M 1GM5A 3D31A 1P8LA 2UXCQ 1HNWQ 4DR7Q 1K0RA 4YCUA 4LWCA 3CCVA 1UE5A 1VQGA 2F3IA 1GO3E 4AYBE 1OTCA 1P16A 3PV0A 1KAWA 2YV5A 1Y1VH 2I5HA 1OXXK 1JE5A 1K8AC 1KD1C 3I4NG 2CQOA 2KCMA 3CMAA 5JEAJ 1E3PA 4IO9A 2VQEQ 4KHPQ 3HOVH 1QUQA 5DLQE 5C4XG 5JJLA 3CD6A 4JI6Q 4A93H 2PQAA 4LFCL 4FDBA 2K5NA 4NB3A 2CWAA 1FGUA 2K14A 1N8RC 4DR5L 4BXXG 1OXSC 4ME3A 3KLWA 3GTGH 1E7ZA 4A3CH 4R4OA 4DV7L 3NELA 3FP9A 4APVA 5M3MH 1SN8A 3K7AH 2E8GA 2JEBI 2VUMH 1Q81C 3HFZB 4GLVB 1KL9A 5IE8A 4DKAC 5M5WH 4HIMA 2R92G 1BKBA 2WAQG 5IYCG 1A62A 1MJEA 4GKJL 5GROA 5GAHC 1K83H 1VQFA 4A3IG 3H0GG 4X65L 4GN3B 1X9NA 3CCLA 4JI4L 4JV5Q 1XMOQ 3L2PA 3GTJH 1HZBA 3S24A 4L5RC 3PUXA 3PF4A 2D0OA 4L5QA 3CP0A 1YNXA 2F4VL 1VQKA 1K3RA 4XTCS 5C0XG 4DR1Q 2A8VA 4JYAQ 4P74A 4HIKA 3K0XA 2IX1A 4ALPA 1SLJA 1AH9A 1Q1BA 4LF7Q 1U5KA 1B8AA 1VQIA 3G71A 2JA8G 2A19A 3CW2C 5GQOA 1M1KC 4DUZL 1PH8A 1PV4A 1XMQL 1IL2A 1YVCA 1NTGA 2JJQA 3ER0A 3KF6B 1OXVA 3M4PA 4GKKL 1HZAA 4LUVA 1UE7A 5K36G 1EWIA 4DV4Q 4JI8Q 4PZ7A 4LF9L 5IYBG 2KCTA 2DUDA 4DR6L 3GTKH 3KOJA 3KFUA 4PG3A 2UUBL 2UU9Q 4DV3Q 4O0AA 4X66L 1IZ6A 4IPHA 5GAGC 4IFDI 2PMZE 1YHQA 1EIYB 4O2DA 2Q2HA 2E2JH 2ZJQA 4BY7H 3NENA 3GDEA 1YJNA 1N34Q 1XNQQ 3S2HH 1KHIA 4X62L 1E1TA 2OQKA 4DV6L 2E2HH 3HOYH 4LW1A 4HIOA 2JA7G 1EIFA 4LF5Q 1WYDA 4OONA 3D0FA 3HOXG 2JA6H 4JI3L 1X3EA 4DR3Q 1VQLA 1HNXL 2IY5B 3K81C 1YJWA 2NVYH 3OW2A 4MZ9A 4DUYQ 2R93H 5FJ8G 4DV5Q 1X6OA 1V1QA 1Y14B 3FKIG 1C9OA 1EFWA 3RLFA 1XTDA 4IPGA 3AFPA 2B29A 3SGIA 3ULJA 4B3SL 2JK8A 3M7NA 1MJCA 2DGYA 2HIVA 2VQFQ 2HIXA 3J7ZC 1E1OA 2A1AA 2RCNA 3BZKA 5EAYA 1UE6A 4LUZA 2CKZB 3STBC 4AH6A 4A3JG 1IBML 1PA6A 3W5OA 3HOUH 1C0AA 2YYZA 2Q2UA 1AE2A 1I94Q 4UPAA 4DNIA 4PZ6A 4YCWA 1EUJA 3KF8B 2VY3A 3TRZA 1BVSA 3NBHB 4LF8Q 3A5UA 2NVXH 1K9MC 3W1GA 2UUCQ 4LNQA 2UXBL 3E9HA 4HJ7A 4YCVA 2AWNA 4DV2Q 2YTVA 3T1YQ 3F2BA 2AWOA 3KDFB 1VQ7A 4LFBQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LFA L;  1JMC A;  3FHW A;  4JI2 Q;  4DK3 C;  2E5L L;  2UUA Q;  5ELN A;  1KRT A;  4DPG A;  3AYH B;  1YJ9 A;  2XTI A;  4R4Q A;  1VQ6 A;  3TS2 A;  3PCO B;  1W2B A;  2CCZ A;  3GTO H;  4KI0 A;  4C3J H;  5AJ3 L;  2QA4 A;  4OX9 L;  3I4M G;  3I2Z A;  1PYS B;  1TWF H;  1Q46 A;  2R7D A;  4P73 A;  1KIX A;  1N33 L;  1RL2 A;  4RMF A;  5H1S E;  3KJP A;  5M3F H;  1IBK L;  3H15 A;  4JI5 Q;  2R6G A;  5LMN W;  2JA9 A;  3OTO L;  1LYL A;  4BY1 H;  4HJ9 A;  1QVF A;  2JA5 H;  3A5Z B;  1KRS A;  3KDF A;  4A3D H;  4QL5 A;  4B3M L;  4C3I H;  4AIM A;  3H3V I;  4JI0 L;  3EN2 A;  2E2I H;  1X56 A;  3UDX A;  4UP7 A;  3CCM A;  5HGQ A;  3ULP A;  2N3S A;  3J80 c;  2QEX A;  3K7U C;  4LUO A;  1WCM G;  3PGZ A;  5BR8 L;  3PUY A;  1RIP A;  4B3R L;  2B3G A;  4HJA A;  3PUW A;  4JOI C;  4GNX C;  3T1H Q;  4NPS A;  4A3L G;  1D8L A;  3Q8D A;  5LMU L;  4JI7 L;  3JC6 6;  4X64 Q;  4DR5 Q;  3F8T A;  1XNR Q;  1NMF A;  4K0K L;  4IFD G;  4YHH L;  2BH2 A;  4DV0 L;  5IYD H;  1CSP A;  2H5X A;  4A3G H;  2K50 A;  4GN5 A;  4MNO A;  1N36 Q;  4GN4 B;  4BBR H;  4DR4 L;  3U4V A;  2I5L X;  3HOZ G;  3AEV A;  4NXN Q;  1Q7Y C;  4GKJ Q;  4JC0 A;  2ATW A;  4A3M H;  3M85 A;  4X65 Q;  1WOC A;  2ZTC A;  1VQO A;  3GTL H;  5IP7 H;  4KHZ A;  5IP9 H;  3PO3 G;  1IBL Q;  3F1Z A;  2Z6K C;  3I4O A;  4JBK A;  1A8V A;  1YIJ A;  1QVC A;  2EQS A;  1G51 A;  1L2F A;  3TRE A;  2WB1 E;  1I50 H;  4A3B H;  2JEA I;  1EOV A;  1VQD A;  4KHP L;  1NE3 A;  1XPR A;  2UXD L;  1M90 C;  1EQR A;  4B3T Q;  1XMQ Q;  4X6A H;  4GKK Q;  4UP8 A;  5C4J H;  4YY3 L;  4GLX A;  2Z6K A;  4J15 A;  1ASZ A;  1PH9 A;  3PUZ A;  1E24 A;  2ZJP A;  3DM3 A;  4A75 A;  1ASY A;  4LF9 Q;  3CPF A;  1NY4 A;  2PI2 E;  4C2M H;  3K8A A;  3E0E A;  1OXU A;  2HHH Q;  5IT9 c;  2BA1 A;  5C3E G;  4POF A;  4YWM A;  1JJC B;  3J80 i;  1YIT A;  3I4N H;  4KLK A;  4OO1 I;  3CC7 A;  4BBS G;  2NVQ H;  3RNU A;  3PO2 G;  4X62 Q;  3M9B A;  1N9W A;  1H95 A;  1YEZ A;  3S16 H;  5C4X H;  4UP9 A;  4JV5 L;  1NJI C;  1Y1W G;  4BXX H;  1X65 A;  1W3S A;  5C44 G;  4A3E G;  3HOW G;  1HNX Q;  3ICE A;  4R4I A;  3HKS A;  1VQE A;  4JYA L;  1CUK A;  2I0Q A;  1B70 B;  2CFM A;  3KF6 A;  4IPC A;  1UWV A;  3I55 A;  4LF4 L;  2L15 A;  3PUV A;  4WJ4 A;  4LF7 L;  2KHJ A;  4DR2 Q;  2R92 H;  1Z47 A;  1S40 A;  3CC2 A;  4B3S Q;  4A3F G;  3HKZ E;  2GVB A;  4C3H H;  1L0W A;  5IYC H;  1VQC A;  3TS0 A;  1HR0 L;  2Y0S G;  1CKM A;  2NZO A;  4OWT B;  4A3I H;  4DV4 L;  1IBM Q;  1N32 Q;  3S14 H;  3H0G H;  2AMC B;  4JI8 L;  2B63 G;  5JJK A;  5FLX c;  2HQL A;  5JEA G;  4AYB G;  4AQY L;  3KYH C;  2UU9 L;  3M4O H;  1HNZ L;  2N49 A;  3S1M H;  3U4Z A;  2NN6 I;  1K73 C;  1VCI A;  4R4T A;  2C35 B;  3BJU A;  2VL6 A;  2D0P A;  2N8N A;  1I3Q H;  1LUZ A;  2JE6 I;  2WAQ E;  4PZ8 A;  5M5Y H;  2MQH A;  1PH3 A;  5FLM G;  4LF5 L;  2MO0 A;  4DV1 L;  1S72 A;  2JA8 H;  2ZM6 Q;  1V43 A;  3ZJY C;  2Q2T A;  1HH2 P;  2PNH A;  1TWH H;  5IWA Q;  1I5F A;  4DUY L;  3CF5 A;  1U0L A;  5LMN L;  1VQM A;  4QGU A;  2XGT A;  1J5E L;  4NXM Q;  3PF5 A;  1Y1V G;  5IYB H;  3CCJ A;  3DLL A;  4P71 A;  3CCE A;  1D7Q A;  2OWO A;  4OX9 Q;  3GTM H;  1YBY A;  1FJG L;  1HJP A;  2MFI A;  3EBE A;  3UDI A;  2N78 A;  4HJ5 A;  1C7Y A;  1N33 Q;  3RZO H;  2GN5 A;  4QY7 A;  4IOA A;  5M5X H;  2VQF L;  3J7A 5;  3TQY A;  2VW9 A;  3HOV G;  1VQB A;  3IRB A;  1PYB A;  4H02 A;  4A4I A;  5C0X J;  3OTO Q;  3RN5 A;  1CKO A;  2JA7 H;  1XPU A;  4IOC A;  3MEF A;  4A93 G;  1JJG A;  2ID0 A;  1O7I A;  2Z0S A;  2KBN A;  2ZTE A;  3HOX H;  4JI0 Q;  4A3C G;  1R9T H;  3G48 A;  4LF8 L;  1X3G A;  3PIP A;  1KXL A;  5FJ8 H;  2VUM G;  5BR8 Q;  1E22 A;  2D62 A;  3BZC A;  4DV2 L;  4B3R Q;  3FKI H;  2ZJR A;  4GOP B;  1Q12 A;  3K80 C;  1SR3 A;  4OWW B;  2B63 H;  4IJH A;  3LGJ A;  4TVA B;  4GNX B;  2LXJ A;  4GOP C;  4LFB L;  5LMU Q;  1PH5 A;  2K52 A;  1VQ5 A;  4BA1 I;  1MIU A;  4Y7N H;  1L1O B;  2IHE A;  4A3J H;  1EYG A;  4YHH Q;  2JQO A;  3I56 A;  4DV0 Q;  4OO1 G;  4LFC Q;  2VZA A;  1G29 1;  1L1O C;  2EIF A;  2LXK A;  1QVG A;  1V9P A;  4QIW E;  4DV7 Q;  2RF4 A;  1UEB A;  4DR4 Q;  4QQB X;  3UDG A;  4JI1 L;  3I7F A;  1JJ2 A;  4JG2 A;  4GOP A;  1PH6 A;  1T9H A;  1Z9F A;  1MKH A;  2RHQ B;  1CKN B;  3WWV A;  4OWX B;  3CCU A;  4Y52 H;  1B7Y B;  4DAM A;  4JOI A;  1DGS A;  1TWG H;  1X3F A;  4GNX A;  3A0J A;  4IJL A;  2UXC L;  1YI2 A;  3UE1 A;  1HNW L;  4DR7 L;  2HT1 A;  2ALY B;  1L1O A;  4JI4 Q;  4P75 A;  3CME A;  1VQ4 A;  1WJJ A;  1NBW A;  1JB7 A;  2ASB A;  4A76 A;  1Q86 C;  1HZ9 A;  4A3K G;  3HKZ G;  2UXD Q;  3I4M H;  2F4V Q;  3T1H L;  4BY7 G;  3CC4 A;  1Q1E A;  4JBW A;  3W1B A;  2WFW A;  5J3B A;  2VQE L;  4X64 L;  1XNR L;  3HOY G;  1VS0 A;  2KEN A;  4YY3 Q;  1CKN A;  2K5H A;  2NN6 G;  2MO1 A;  4JI6 L;  2OTL A;  4IPD A;  1SRO A;  1VQN A;  2K4K A;  2OCE A;  3J81 c;  4DUZ Q;  1PFS A;  1SFO H;  2JA6 G;  4R4C A;  3CCQ A;  1SMX A;  3CQZ H;  4LF6 Q;  2OQ0 A;  1N36 L;  3B6Y A;  1HZC A;  5HY6 A;  2R93 G;  2NZH A;  4NXN L;  2V1C C;  3PSI A;  4DR6 Q;  2YTX A;  1VQJ A;  1WCM H;  2Q2I A;  2UUB Q;  3S17 H;  4X66 Q;  5GAD C;  3CAM A;  4DAY B;  3UDF A;  4A3L H;  1XJV A;  1IBL L;  2R7Z G;  3HOU G;  1PH4 A;  4DV6 Q;  3GTQ H;  2QGQ A;  1PH2 A;  3U58 A;  4R1J A;  1XMO L;  3RZD H;  1YHB A;  2YU9 H;  1J6Q A;  4JI3 Q;  4UY8 C;  4LF4 Q;  3CCS A;  3CPW A;  1FL0 A;  1WFQ A;  2PI2 A;  3BU2 A;  3S1R H;  1KQS A;  4DR1 L;  4B3T L;  3G4S A;  3HOZ H;  1IYJ B;  1KC8 C;  1HR0 Q;  4XIG S;  1SE8 A;  1UE1 A;  1SRU A;  4BA2 I;  2ES2 A;  2WP8 J;  1YZ6 A;  2BA0 A;  3E9I A;  4DK6 C;  1A0I A;  1PH7 A;  2EXD A;  4TQU S;  1X54 A;  3VDY A;  4MTN A;  2GVA A;  1Q8K A;  1YHA A;  1IXR A;  2HHH L;  3PO3 H;  4AQY Q;  3GD7 A;  1HNZ Q;  2YTY A;  1G6P A;  4RG1 A;  3ERS X;  4L5T A;  1OXT A;  4A3K H;  1PVO A;  2FXQ A;  2AHO B;  1EQQ A;  1Q82 C;  3JAM c;  3GO5 A;  4IFD J;  4DV3 L;  1S3O A;  1FVI A;  5JJI A;  3ULL A;  3J81 j;  5ELO A;  2UXB Q;  4DV1 Q;  5M3F G;  4POG A;  1XPO A;  3GTP H;  1PHJ A;  3RLN A;  1JT8 A;  1N34 L;  1XNQ L;  1AE3 A;  3UE0 A;  2KHI A;  3A74 A;  2IX0 A;  4QJF A;  4BY1 G;  1X55 A;  3S1Q H;  2JA5 G;  1J5E Q;  4A3D G;  2OTJ A;  3PIO A;  5LMN Q;  4LFA Q;  3J81 i;  4GS3 A;  4DR3 L;  3MXN B;  5GAE C;  3AFQ A;  2E5L Q;  2AKW B;  1VQA A;  4DR2 L;  2NVT H;  1BBW A;  1FJG Q;  3OYY A;  5E7N A;  5C3E H;  4DV5 L;  1NMG A;  1A63 A;  3G6E A;  5AJ3 Q;  4BBS H;  3PO2 H;  2IT1 A;  5IY0 A;  3CXC A;  1CSQ A;  3U50 C;  1K8G A;  1N32 L;  2F52 A;  3F2C A;  1VQH A;  1IBK Q;  5C0X I;  1Y1W H;  4LF6 L;  2K5V A;  3HOW H;  4A3E H;  5C44 H;  3EIV A;  1HR0 W;  3RR5 A;  1WI5 A;  5IYD G;  3F2D A;  1I94 L;  1BBU A;  2BH8 A;  4B3M Q;  4A3G G;  2K75 A;  4YWL A;  4EQ5 A;  1TWA H;  2WB1 G;  4OXP A;  4BBR G;  5M3M G;  2UUC L;  2R7Z H;  1GKH A;  1GD7 A;  4A3F H;  2ZM6 L;  3H3V H;  2MNA A;  3RLO A;  1VQ9 A;  4HJ8 A;  2R7F A;  4GLA C;  4JCV E;  3TEH B;  4A3M G;  4EX5 A;  3T1Y L;  1QZG A;  5IWA L;  4JBM A;  1VQP A;  2RHS B;  5IP9 G;  5IP7 G;  4HID A;  4NXM L;  2I5M X;  3AQQ A;  2UUA L;  4JI2 L;  4JI7 Q;  1I6H H;  3L7Z C;  3L0O A;  1TWC H;  4L5S A;  4PMW A;  4K0K Q;  3S15 H;  3S2D H;  3M3Y H;  2CWP A;  3KJO A;  2LSS A;  3S1N H;  4A3B G;  4JI1 Q;  2VS1 A;  2IHF A;  1QZH A;  3M4Q A;  1LTL A;  2ZTD A;  1PH1 A;  3JAM i;  3RN2 A;  3STB D;  4YWK A;  1GVP A;  1TXY A;  3NEM A;  4JBJ A;  2VNU D;  1QUQ B;  2Y0S E;  5FLM H;  1LM0 A;  4JI5 L;  3CCR A;  4P72 A;  1VQ8 A;  2PQA B;  4WJ3 M;  1GM5 A;  3D31 A;  1P8L A;  2UXC Q;  1HNW Q;  4DR7 Q;  1K0R A;  4YCU A;  4LWC A;  3CCV A;  1UE5 A;  1VQG A;  2F3I A;  1GO3 E;  4AYB E;  1OTC A;  1P16 A;  3PV0 A;  1KAW A;  2YV5 A;  1Y1V H;  2I5H A;  1OXX K;  1JE5 A;  1K8A C;  1KD1 C;  3I4N G;  2CQO A;  2KCM A;  3CMA A;  5JEA J;  1E3P A;  4IO9 A;  2VQE Q;  4KHP Q;  3HOV H;  1QUQ A;  5DLQ E;  5C4X G;  5JJL A;  3CD6 A;  4JI6 Q;  4A93 H;  2PQA A;  4LFC L;  4FDB A;  2K5N A;  4NB3 A;  2CWA A;  1FGU A;  2K14 A;  1N8R C;  4DR5 L;  4BXX G;  1OXS C;  4ME3 A;  3KLW A;  3GTG H;  1E7Z A;  4A3C H;  4R4O A;  4DV7 L;  3NEL A;  3FP9 A;  4APV A;  5M3M H;  1SN8 A;  3K7A H;  2E8G A;  2JEB I;  2VUM H;  1Q81 C;  3HFZ B;  4GLV B;  1KL9 A;  5IE8 A;  4DKA C;  5M5W H;  4HIM A;  2R92 G;  1BKB A;  2WAQ G;  5IYC G;  1A62 A;  1MJE A;  4GKJ L;  5GRO A;  5GAH C;  1K83 H;  1VQF A;  4A3I G;  3H0G G;  4X65 L;  4GN3 B;  1X9N A;  3CCL A;  4JI4 L;  4JV5 Q;  1XMO Q;  3L2P A;  3GTJ H;  1HZB A;  3S24 A;  4L5R C;  3PUX A;  3PF4 A;  2D0O A;  4L5Q A;  3CP0 A;  1YNX A;  2F4V L;  1VQK A;  1K3R A;  4XTC S;  5C0X G;  4DR1 Q;  2A8V A;  4JYA Q;  4P74 A;  4HIK A;  3K0X A;  2IX1 A;  4ALP A;  1SLJ A;  1AH9 A;  1Q1B A;  4LF7 Q;  1U5K A;  1B8A A;  1VQI A;  3G71 A;  2JA8 G;  2A19 A;  3CW2 C;  5GQO A;  1M1K C;  4DUZ L;  1PH8 A;  1PV4 A;  1XMQ L;  1IL2 A;  1YVC A;  1NTG A;  2JJQ A;  3ER0 A;  3KF6 B;  1OXV A;  3M4P A;  4GKK L;  1HZA A;  4LUV A;  1UE7 A;  5K36 G;  1EWI A;  4DV4 Q;  4JI8 Q;  4PZ7 A;  4LF9 L;  5IYB G;  2KCT A;  2DUD A;  4DR6 L;  3GTK H;  3KOJ A;  3KFU A;  4PG3 A;  2UUB L;  2UU9 Q;  4DV3 Q;  4O0A A;  4X66 L;  1IZ6 A;  4IPH A;  5GAG C;  4IFD I;  2PMZ E;  1YHQ A;  1EIY B;  4O2D A;  2Q2H A;  2E2J H;  2ZJQ A;  4BY7 H;  3NEN A;  3GDE A;  1YJN A;  1N34 Q;  1XNQ Q;  3S2H H;  1KHI A;  4X62 L;  1E1T A;  2OQK A;  4DV6 L;  2E2H H;  3HOY H;  4LW1 A;  4HIO A;  2JA7 G;  1EIF A;  4LF5 Q;  1WYD A;  4OON A;  3D0F A;  3HOX G;  2JA6 H;  4JI3 L;  1X3E A;  4DR3 Q;  1VQL A;  1HNX L;  2IY5 B;  3K81 C;  1YJW A;  2NVY H;  3OW2 A;  4MZ9 A;  4DUY Q;  2R93 H;  5FJ8 G;  4DV5 Q;  1X6O A;  1V1Q A;  1Y14 B;  3FKI G;  1C9O A;  1EFW A;  3RLF A;  1XTD A;  4IPG A;  3AFP A;  2B29 A;  3SGI A;  3ULJ A;  4B3S L;  2JK8 A;  3M7N A;  1MJC A;  2DGY A;  2HIV A;  2VQF Q;  2HIX A;  3J7Z C;  1E1O A;  2A1A A;  2RCN A;  3BZK A;  5EAY A;  1UE6 A;  4LUZ A;  2CKZ B;  3STB C;  4AH6 A;  4A3J G;  1IBM L;  1PA6 A;  3W5O A;  3HOU H;  1C0A A;  2YYZ A;  2Q2U A;  1AE2 A;  1I94 Q;  4UPA A;  4DNI A;  4PZ6 A;  4YCW A;  1EUJ A;  3KF8 B;  2VY3 A;  3TRZ A;  1BVS A;  3NBH B;  4LF8 Q;  3A5U A;  2NVX H;  1K9M C;  3W1G A;  2UUC Q;  4LNQ A;  2UXB L;  3E9H A;  4HJ7 A;  4YCV A;  2AWN A;  4DV2 Q;  2YTV A;  3T1Y Q;  3F2B A;  2AWO A;  3KDF B;  1VQ7 A;  4LFB Q; 
#chains in the Genus database with same CATH topology
 3D3R A;  2E5L L;  1SXT A;  3HOW B;  5C44 B;  1LV9 A;  3PCO B;  1CHQ D;  1FNU A;  1TWA B;  4C3J H;  3NBH A;  3I72 A;  3I2Z A;  2R7D A;  2LS0 1;  1IBK L;  4FVM A;  3ND9 A;  2R6G A;  3D8G A;  3FKI B;  3T13 A;  1EY8 A;  2JA9 A;  5LMN W;  3H3V C;  4BY1 H;  1QVF A;  1Q3L A;  3E0J A;  4KD3 A;  5CV7 A;  1Y8P B;  3S2D B;  5HGQ A;  4U67 3;  1JOK A;  3J80 c;  3K7U C;  4CBV A;  2B8F A;  3PUY A;  4X3S A;  2B3G A;  4RA8 A;  4GNX C;  1LTS D;  4JOI C;  4HAE A;  4A3L G;  1D8L A;  5EBC A;  3E3X A;  3JC6 6;  4K0K L;  3BDO A;  1CSP A;  1TVX A;  3AB9 A;  4GN4 B;  1SNP A;  2I5L X;  3HOZ G;  3I70 A;  3SK5 A;  1H9S A;  3HOV B;  4JC0 A;  2ATW A;  4X65 Q;  1TT2 A;  4KHZ A;  5IP9 H;  1RDP D;  4M1U B;  4OL7 A;  3F1Z A;  1GUN A;  1TR5 A;  4UHV A;  1QVC A;  3EQL C;  1YNJ D;  2F0I A;  3A7L A;  1JOQ A;  1PRT F;  2EY1 A;  3RUZ A;  2L55 A;  4DNR B;  2BDN A;  3SK4 A;  4DAV A;  2A68 D;  5DNF A;  3MXP A;  3DM3 A;  2HHH Q;  3K0Y A;  5IT9 c;  1PFB A;  5C3E G;  4POF A;  1HPC A;  3I4N H;  3CC7 A;  2B2V A;  4BBS G;  1G8Z D;  3FPP A;  3H94 A;  3HZX A;  4X62 Q;  3RNU A;  4FF2 A;  1RTN A;  1RD9 D;  4JV5 L;  1K8O A;  1X65 A;  4A3E G;  3MVV A;  4QUC A;  2WV6 D;  2EYF A;  1CUK A;  4K2K A;  3I55 A;  4LF4 L;  2L15 A;  1RF2 D;  2B2W A;  2R92 H;  4X3T A;  5BN4 A;  1K28 A;  5CC4 A;  4A3F G;  4BY7 B;  3S2H B;  4ZCK A;  2GVB A;  4ZKC B;  5CMD A;  1HR0 L;  1S5B D;  2Y0S G;  1G2T A;  4DV4 L;  1IBM Q;  2B63 G;  4HED A;  2JA6 B;  5JEA G;  3DEO A;  3KLS A;  4AYB G;  4AQY L;  2UU9 L;  1FR3 A;  1GHK A;  5TSS A;  3U4Z A;  1K73 C;  5C0X H;  4IAL A;  4R4T A;  2FJ2 A;  1QOH A;  1II3 A;  3IFT A;  2MQH A;  5FLM G;  4DV1 L;  2G9D A;  2ZM6 Q;  3ZJY C;  2HDL A;  3PO2 B;  2R7Z B;  4F87 A;  4XYO A;  1DM0 B;  1I5F A;  2E76 C;  5IWA Q;  1VQM A;  2F0L A;  2M9V A;  3FVQ A;  3DLL A;  1IL8 A;  2IL8 A;  2OWO A;  3MA2 B;  3UDI A;  2IJ0 A;  3NWS A;  4IOA A;  4ULL A;  3MEH A;  5ISR A;  1PRT D;  4H02 A;  4A4I A;  1HRJ A;  1XPU A;  2Z0S A;  2ZTE A;  3BYY B;  3BS1 A;  2A6E C;  1EY6 A;  3HP3 A;  3GTO B;  2Z4H A;  5FJ8 H;  1TWC B;  3EA6 A;  1SBB B;  4DV2 L;  4HCE A;  3J80 E;  4K5W A;  1C48 A;  1Q12 A;  3K80 C;  5M3F B;  4OWW B;  4XDX A;  2K52 A;  1T5X D;  1EYG A;  3K57 A;  3JAM L;  3U9S A;  4LFC Q;  2VZA A;  3T4A C;  4HR7 B;  2E2I B;  2EIF A;  2XIW A;  3SK6 A;  3NXW A;  3MWY W;  4B9W A;  4RKL A;  5C4Z A;  2PNR C;  3WWV A;  1Z9F A;  1MKH A;  2K5W A;  4OWX B;  1B7Y B;  3BZD B;  4GNX A;  2KVM A;  1DGS A;  4JOI A;  1X3F A;  4JVZ A;  3A0J A;  3BVZ A;  4IJL A;  3DXJ C;  1FNV A;  4JI4 Q;  3CME A;  1WJJ A;  2WB1 B;  4BBR B;  3I4L A;  1WTW A;  2A73 B;  1F9P A;  3T1H L;  1Q1E A;  4JBW A;  2WFW A;  5J3B A;  2VQE L;  4X64 L;  2B2Y A;  3GTL B;  1CKN A;  2MO1 A;  2OTL A;  1VQN A;  3J81 c;  2B2U A;  1SE4 A;  3CQZ H;  5IGG A;  1I50 B;  1E2V A;  4ZAI A;  4NXN L;  3PSI A;  3LNN A;  3VYU A;  2X6G A;  4ZLT F;  3EFX D;  5IT9 E;  2UUB Q;  1HA5 A;  3IKJ A;  5CV4 A;  3WOE A;  5GAD C;  4CJ0 B;  3CAM A;  4DAY B;  2AQ3 B;  1XJV A;  5C4J B;  1PH4 A;  4DV6 Q;  1I4G A;  1HA6 A;  4IFD H;  1W6K A;  1H9M A;  5K5P A;  2YU9 H;  1J6Q A;  3D4D A;  4LF4 Q;  5NUC A;  3CCS A;  1R4Q B;  3VA5 A;  1KQS A;  3D4R A;  3P75 A;  5KNB A;  4U68 A;  1MGS A;  1HR0 Q;  1CA6 A;  1QG7 A;  3HKZ B;  4DK6 C;  1A0I A;  2QIL A;  3VDY A;  4AQY Q;  3GD7 A;  4CKC A;  4A3K H;  2O5J C;  4GZY C;  2RDG A;  1FVI A;  4DV1 Q;  3GTP H;  1N34 L;  4CKE A;  4RKB A;  3P7J A;  1SE3 A;  3S1Q H;  2JA5 G;  1STN A;  4A3D G;  2XRQ D;  3PIO A;  2L4N A;  4LFA Q;  3A8J E;  3H6M A;  2NVT H;  5E7N A;  3ERO A;  4DV5 L;  1EZ6 A;  3G6E A;  1PTO D;  5IY0 A;  2EPB A;  1K8G A;  2CW0 D;  2JA8 B;  4WOR A;  1B4O A;  1TWH B;  1Y1W H;  3TZU A;  2GA4 B;  3HOW H;  5C44 H;  4KKT A;  4CGY B;  1HR0 W;  3F2D A;  5IYD G;  1JWS D;  2BH8 A;  4A3G G;  3SHL A;  3MXN A;  1TWA H;  1BNZ A;  3GTM B;  3X3M A;  1DON A;  2UUC L;  5D65 A;  4IUR A;  4C3J B;  1HFN A;  4GLA C;  3TP7 A;  3KLS X;  3T1Y L;  1YNJ C;  1VQP A;  1EYD A;  5IP7 G;  4NXM L;  3HOX B;  4JI2 L;  4K5X A;  1R9T B;  2BOS A;  4ID6 A;  4BY1 B;  3S2D H;  2LSS A;  1EWC A;  4A3B G;  2OF1 A;  3M4Q A;  2A68 C;  3JAM i;  1ZXT A;  4G7O C;  4HMJ A;  4QMG A;  1F2Z A;  1ZYR D;  3NEM A;  4K14 A;  2L0C A;  3BVM A;  1VQ8 A;  1YNN D;  2WIN B;  1GM5 A;  4Y7N B;  4YCU A;  1STY A;  2F0Q A;  4C1N I;  5KIX A;  2R61 A;  1ILP A;  1EYC A;  3G6J B;  2CQO A;  2KCM A;  4QUF A;  2VQE Q;  4KHP Q;  4PMC A;  1AN8 A;  4F8M A;  3HOV H;  3HG9 A;  4DXF A;  4DA2 A;  1N8R C;  4DR5 L;  3KLW A;  3IAY A;  4R4O A;  1B3Q A;  3FP9 A;  3NEL A;  3J81 E;  2K05 A;  2E8G A;  3J7Y W;  1WTO A;  1Q81 C;  3SEB A;  4GLV B;  1KL9 A;  5IE8 A;  3NBI A;  5M5W H;  4HIM A;  1F9R A;  3LWU A;  4HSP A;  3A55 A;  5I9P A;  1IKM A;  1BKB A;  2WAQ G;  4C3H G;  2EYM A;  5IYC G;  1MJE A;  4GKJ L;  3DM1 A;  4A3I G;  1VQF A;  1DOL A;  3H0G G;  3VR3 A;  4OO1 H;  3L2P A;  3GTJ H;  2F0P A;  2ICE C;  2D0O A;  3CHB D;  2NB0 A;  1SYC A;  1RHP A;  1JWM D;  2Z1C A;  2AQ2 B;  4PMB A;  4HIK A;  1ROD A;  1WCM B;  1JWU D;  1SLJ A;  1U5K A;  1B8A A;  1DZ1 A;  1IL2 A;  3ER0 A;  3GTQ B;  4GKK L;  1HZA A;  1XWE A;  1IHZ A;  3RZD B;  4JI8 Q;  5KYI A;  3MXU A;  5IYB G;  3KFU A;  4PG3 A;  1IZ6 A;  2ZXR A;  1MD2 D;  4BY7 H;  3NEN A;  1N34 Q;  3S2H H;  1GUS A;  1MHW C;  2G9H D;  3OOC A;  1E1T A;  2OQK A;  1WVL A;  4XQN A;  1MSG A;  2JA7 G;  4OGQ C;  2BCO A;  3FRP B;  2JA6 H;  1ICW A;  4JI3 L;  1X3E A;  1NSN S;  1VQL A;  2IY5 B;  5KGU A;  3OW2 A;  1HXY D;  3OSO A;  4DUY Q;  1SYE A;  4C3I G;  4DV5 Q;  3FKI G;  1C9O A;  2FIN B;  5T1I A;  1B1Z A;  1LTT D;  2B29 A;  2JK8 A;  1Z6H A;  2HIV A;  1V8Q A;  2F0K A;  4R8I A;  2A1A A;  2R7Z H;  4WJW A;  4LUZ A;  2D9U A;  1PA6 A;  2YYZ A;  4P2C B;  4NP5 A;  3KF8 B;  2VY3 A;  3TRZ A;  4NDX A;  1BVS A;  3E6Z X;  1BO0 A;  2UUC Q;  4LNQ A;  1C4Q A;  1LAB A;  1ZEQ X;  4F88 A;  3ERQ A;  2AWN A;  4KD4 A;  3I73 A;  3T51 B;  3T1Y Q;  3MFY A;  3MZ5 A;  3FPU B;  2QKI C;  1F9Q A;  4JI2 Q;  4DK3 C;  4N9T A;  1KRT A;  2F0J A;  3TS2 A;  1W2B A;  3GTO H;  4EQP A;  1S5D D;  4IZ8 A;  5AJ3 L;  1UAP A;  4OX9 L;  3I4M G;  5H1S E;  3KJP A;  5M3F H;  5ELF A;  2XWB B;  3OTO L;  5EPJ A;  4S3S A;  3O13 A;  1G2S A;  4B3M L;  4HN7 A;  3EN2 A;  2E2I H;  4UP7 A;  1BBX C;  3CCM A;  3BG3 A;  4K2L A;  3K5N A;  3PGZ A;  4B3R L;  1ENF A;  2HCI A;  5FLX L;  4NPS A;  1DCZ A;  2BE5 C;  1EY7 A;  3Q8D A;  4JI7 L;  1XNR Q;  4DR5 Q;  2L5T A;  4YHH L;  1Y1V B;  4ZYS A;  2ENB A;  2I46 A;  3CKI B;  4GN5 A;  3DWQ A;  1N36 Q;  4BBR H;  4H44 C;  4GKJ Q;  1EEF D;  1SAP A;  4ILW A;  3KUP A;  4A93 B;  2ZTC A;  3GTL H;  2TSS A;  3NK9 A;  1EU3 A;  1G51 A;  4IUT A;  3NTI A;  4QF4 A;  2WB1 E;  1I50 H;  1QIL A;  2JEA I;  3K6O A;  1STB A;  3CQZ B;  2VUM B;  1VQD A;  3N52 A;  4PNY A;  2RQX A;  1V1O A;  1XPR A;  4FYD A;  1E2W A;  1K83 B;  2WAC A;  4GKK Q;  4UP8 A;  5C4J H;  4GLX A;  2DNC A;  2Z6K A;  4OIK A;  3PUZ A;  1PTO C;  2PI2 E;  1OXU A;  2EY5 A;  2CW0 C;  2BA1 A;  2E75 C;  1UUP A;  3I90 A;  3GQB A;  2K5Q A;  2B2W C;  4J8Q A;  3PO2 G;  4DN4 M;  5C4X H;  4UP9 A;  4WRD A;  5C3W A;  1SE2 A;  1BUV T;  5KNC A;  4BXX H;  1W3S A;  5LHY 1;  2NBF A;  2SNS A;  2F4I A;  1LTG D;  5FK9 C;  3GTK B;  4IPC A;  1SMY C;  4A3K B;  4WJ4 A;  5A2Q E;  4DR2 Q;  1Z47 A;  3CC2 A;  4V0B A;  4CDD C;  3Q22 A;  3HKZ E;  1CQF A;  5IIF A;  3TS0 A;  1VQC A;  1CKM A;  4OWT B;  1GUO A;  2J4X A;  3GTP B;  2HQL A;  3S1Q B;  4NKL A;  1HNZ L;  1ZYR C;  2N49 A;  2NN6 I;  2VL6 A;  4KTA A;  2N8N A;  5FO7 B;  2BDO A;  2L1B A;  4LF5 L;  2EJM A;  2JA8 H;  1V43 A;  2PNH A;  1TWH H;  3HOU B;  5ELD A;  5K36 H;  3CF5 A;  2KEC A;  3CCJ A;  3CCE A;  1D7Q A;  4OX9 Q;  1NUC A;  3GTM H;  1VDZ A;  1C7Y A;  2N78 A;  4HJ5 A;  3RZO H;  3GV6 A;  4QY7 A;  1F77 A;  2VQF L;  2VW9 A;  3IRB A;  3OTO Q;  3RN5 A;  5C0X J;  4IOC A;  1JJG A;  2ID0 A;  1O7I A;  4KV6 A;  3HOX H;  4DXG A;  1R9T H;  4X3K A;  1X3G A;  2QDL A;  4LJZ C;  3BZC A;  1A2U A;  4B3R Q;  1TWF B;  1ESF A;  2NVQ B;  4YIJ A;  4IUU A;  1TY2 A;  2B63 H;  4LFB L;  4BA1 I;  1MIU A;  4FF4 A;  4Y7N H;  2CHB D;  4YHH Q;  3HGB A;  1PZK D;  3I8Z A;  1QVG A;  2KJX A;  5IGF A;  4DV7 Q;  3UDG A;  1O78 A;  3I7F A;  1IKL A;  1STG A;  2SOB A;  4GOP A;  2RHQ B;  3DMU A;  5KRU A;  1JQY D;  4DAM A;  2B2Y C;  2UXC L;  3UE1 A;  4DR7 L;  5ELE A;  3C3L A;  2ALY B;  1L1O A;  4KKS A;  4P75 A;  2WII B;  2B2U C;  1VQ4 A;  1JB7 A;  1NBW A;  2O2L D;  4F7X A;  1Z7T A;  1LT3 D;  4KK7 A;  1Q86 C;  1HZ9 A;  3HKZ G;  2K04 A;  2LMC B;  2F4V Q;  1BQQ T;  1LTI D;  2D5D A;  3W1B A;  1EU4 A;  5M5W B;  3Q0A A;  4A3M B;  1VS0 A;  3HOY G;  2NN6 G;  3QIA A;  4R9W A;  4JI6 L;  4DUZ Q;  3NPP A;  1PFM A;  1UEA B;  3CCQ A;  1SMX A;  2VB2 X;  2OEO A;  2QCP X;  5HY6 A;  3M4Y A;  3GTJ B;  2R93 G;  2NZH A;  2V1C C;  2KED A;  1WCM H;  2Q2I A;  3S17 H;  4X66 Q;  2V4D A;  1WTH A;  1IYV A;  1TS4 A;  1IBL L;  3GTQ H;  1EOT A;  3A8I E;  1U9R A;  3RZD H;  4C2M B;  1I4P A;  4UY8 C;  3FEW X;  4KMU C;  1FL0 A;  1WFQ A;  1GUG A;  3BU2 A;  4B3T L;  1CM9 A;  1KC8 C;  4C1N K;  4XIG S;  1SE8 A;  1UE1 A;  2PCF B;  2WP8 J;  1U4R A;  3QJY A;  2AQ1 B;  1PH7 A;  4JW0 A;  3PO3 H;  1IXR A;  3E5S A;  3Q6S A;  4R8N A;  1HNZ Q;  2YTY A;  3TP6 A;  3SR1 A;  4RG1 A;  4L5T A;  1LT5 D;  1PVO A;  4KJO A;  1EQQ A;  2PO4 A;  4C3J G;  3GO5 A;  4TRD A;  4IFD J;  1S3O A;  2PW7 A;  5JJI A;  3J81 j;  4O1N A;  5ELO A;  1K8M A;  4L8J A;  1PHJ A;  1STH A;  3UE0 A;  3A74 A;  5HGT A;  2LY7 A;  4BY1 G;  1X55 A;  2RBM A;  1SYF A;  4KN4 C;  1IW7 D;  1BCP C;  3M7G A;  2E5L Q;  3AFQ A;  3M4O B;  3S1M B;  2RDH A;  5I6Y A;  3P20 A;  1NMG A;  1LAC A;  2F0D A;  4HTH A;  1CSQ A;  1N32 L;  4JPB W;  1IBK Q;  5C0X I;  1L0Y B;  1VMP A;  3GV3 A;  3TDQ A;  2K5D A;  5T1G A;  3SVM A;  2KA7 A;  1I94 L;  1A2T A;  2B2T C;  5M3M G;  1SNO A;  5JVH 3;  1GD7 A;  1M4V A;  4LMQ D;  5M5X B;  3H3V H;  3RLO A;  4HJ8 A;  2R7F A;  4JCV E;  1X3P A;  1QZG A;  4RFB A;  2RHS B;  5IP9 G;  3DHQ A;  3L7Z C;  3L0O A;  4L5S A;  4KKU A;  4PMW A;  4K0K Q;  3M3Y H;  3KJO A;  4HSV A;  1BDO A;  4QIW B;  2ZTD A;  2Q8T A;  1TXY A;  4JI5 L;  3BVG A;  4P72 A;  2PQA B;  3D31 A;  4ZUI A;  2UXC Q;  4DR7 Q;  1K0R A;  4K6D A;  4A3J B;  3S9W A;  1UE5 A;  1P16 A;  2F3W A;  3PV0 A;  1Y1V H;  2JN4 A;  3URY A;  2X69 A;  3I4N G;  3CMA A;  1JOO A;  4TKO B;  3UI2 A;  1PTO F;  3IL8 A;  1E3P A;  2Q8R E;  1QUQ A;  5JJL A;  3CD6 A;  4JI6 Q;  4A93 H;  4FDB A;  1FGU A;  2K14 A;  4A3C H;  1LTR D;  2G5D A;  4APV A;  1SN8 A;  4IUQ A;  3W2D A;  1EQV A;  2JEB I;  4DGZ A;  2VUM H;  3HFZ B;  2R92 G;  1JE4 A;  2DNE A;  4FXD A;  5GRO A;  5AFW A;  1K83 H;  3OW7 A;  4XYQ A;  2KUM A;  1HFG A;  2MGS A;  4JV5 Q;  1EYA A;  3S24 A;  4EQN A;  3PUX A;  1SDF A;  3CP0 A;  1VQK A;  1K3R A;  2F0V A;  5C0X G;  2BE5 D;  5E3F A;  2IX1 A;  4ALP A;  5C5M A;  5GQO A;  2EYH A;  2EJF C;  5JPM C;  4N8F A;  1XMQ L;  2JJQ A;  1JC7 A;  3J80 L;  4DV4 Q;  5C4X B;  3TP5 A;  1PRT B;  3V2T A;  5C5L A;  4DR6 L;  2KCT A;  2DUD A;  3GTK H;  1GOZ A;  2UU9 Q;  3S1R B;  1AZP A;  3G7L A;  1X3Q A;  4IFD I;  3HOZ B;  1YHQ A;  2E2J H;  4FNF A;  1I4Q A;  4OON A;  3TN2 A;  1D5X C;  3NTK A;  4QB4 A;  5E4W C;  3K81 C;  2XWJ B;  4DU9 A;  5FJ8 G;  1X6O A;  3A8K E;  3RMH A;  2F1M A;  3AFP A;  3M7N A;  2RCN A;  3HOU H;  5A35 A;  1AE2 A;  1I94 Q;  2F0F A;  1EY0 A;  1EUJ A;  4K8J A;  3NBH B;  2IW3 A;  2RDF A;  5C3E B;  2UXB L;  1K9M C;  3W1G A;  1XYI A;  3E9H A;  1QE6 A;  4BBS B;  4YCV A;  1JR0 D;  4NW2 A;  4DV2 Q;  2HCC A;  1VF7 A;  5JJZ A;  3RZO B;  2AWO A;  3MTS A;  1PYW D;  1JMC A;  1SMY D;  3TZD A;  5IT9 L;  5ELN A;  4A3E B;  2F0M A;  1YJ9 A;  1VQ6 A;  4R4Q A;  4DF7 A;  1PYS B;  1TWF H;  1KIX A;  4P73 A;  4A3F B;  2B2T A;  1N33 L;  1RL2 A;  4RMF A;  4JI5 Q;  4ODG A;  2NVQ H;  1O80 A;  2Y0S B;  2CH4 A;  1LYL A;  4IN3 A;  4DK1 A;  2B63 B;  1KRS A;  3HS0 C;  3KDF A;  3MHB A;  2K7V A;  1L0X B;  2D2C C;  4C3I H;  4AIM A;  4AYB B;  2H1E A;  1X56 A;  3UDX A;  1EEI D;  3SDZ A;  4LK1 C;  3WOF A;  2NWG A;  4XT3 B;  5DAU A;  2J7Z A;  3ULP A;  3S1N B;  2N3S A;  3I91 A;  4DK0 A;  1FD7 D;  2QF7 A;  3DEP A;  5CV6 A;  5BR8 L;  1RIP A;  1X32 A;  1H9S B;  2MPM A;  4BS9 A;  3AU7 A;  3PUW A;  3T1H Q;  5LMU L;  2R3Z A;  4X64 Q;  1Y69 U;  4IFD G;  2BH2 A;  1TQO A;  2K50 A;  4MNO A;  3VYT A;  1FGB D;  4NXN Q;  4XXE A;  4A3M H;  4CHT B;  1SSO A;  3M85 A;  1VQO A;  4KY7 A;  2EYL A;  3OIP A;  2Z6K C;  4MHE A;  2ICI A;  1GXD C;  1Q8I A;  3TRE A;  3R93 A;  3VYS A;  1BF4 A;  2P5Z X;  1EOV A;  2KOL A;  1NE3 A;  5COY A;  1M90 C;  1IW7 C;  2EXZ A;  4J6H A;  1HCZ A;  4EGV A;  1XMQ Q;  4I7A A;  1BOS A;  3S17 B;  2XRS D;  4YY3 L;  1PTO B;  1EY4 A;  3W3A A;  5G3L F;  1ILQ A;  1JIC A;  1ASZ A;  1K0S A;  2ZJP A;  2B39 A;  4A75 A;  1TII D;  4C2M H;  2KCN A;  3E0E A;  3OPO A;  3DUZ A;  4OEL B;  2FFK B;  1BCP F;  1JJC B;  1NCV A;  4YWM A;  3J80 i;  2DY8 A;  4OO1 I;  2PMZ B;  3K58 A;  4PV1 C;  2SNM A;  1YEZ A;  1RJT A;  1Y1W G;  3HOW G;  4G57 A;  5C44 G;  3HKS A;  4JYA L;  1XTC D;  5EPK A;  3KF6 A;  3PO3 B;  1O7L A;  3EJI A;  5CV9 A;  4LF7 L;  1RCV D;  2KHJ A;  4EQO A;  1SNM A;  1L0W A;  2HUG A;  2K33 A;  1B9M A;  3KYH C;  1KDC A;  3SE0 A;  3M4O H;  2KQ3 A;  3S1M H;  4Q5V A;  2AUK A;  3Q23 A;  1VCI A;  3BJU A;  2H4O A;  1IYU A;  1I3Q H;  4PZ8 A;  3C1E A;  3J81 L;  2MO0 A;  2RSN A;  1HH2 P;  1TY0 A;  2WKD A;  4ME5 A;  1U0L A;  5LMN L;  4NXM Q;  2XGT A;  3PF5 A;  5I2Y A;  1O7Z A;  2B8G A;  1YBY A;  1N33 Q;  2GN5 A;  1CA5 A;  5M5X H;  3TQY A;  1DOM A;  3HOV G;  1VQB A;  2EYJ A;  5EBD A;  4OEM B;  1GJX A;  4ZK9 B;  2IPK D;  1M8A A;  1D5M C;  3G48 A;  3KBG A;  4LF8 L;  3VR6 A;  5G3L D;  2A6H D;  2PW5 A;  1TKW B;  5BR8 Q;  1E22 A;  2D62 A;  3M3Y B;  2HD3 A;  3OMG A;  4IUP A;  1HUN A;  1ZKO A;  4XQJ A;  4IJH A;  4TVA B;  4GNX B;  1BCP D;  2RCF A;  4GOP C;  3SXH A;  5LMU Q;  3C2P A;  4A3J H;  2IHE A;  2EJG C;  4OO1 G;  5IGD A;  1L1O C;  4RH6 A;  4QIW E;  1UEB A;  3K5O A;  2EOT A;  4FP5 D;  4IQZ A;  4RCN A;  2O4X A;  4JG2 A;  1PH6 A;  1T9H A;  4Y52 H;  1CKN B;  2EY2 A;  5IGB A;  4O42 A;  1KDA A;  1KTK A;  1T5E A;  1HNW L;  2HT1 A;  3I3C A;  1WD1 A;  2VXW A;  2NTS A;  4A3G B;  3NE5 B;  1H9K A;  3C46 A;  4J1M A;  4BY7 G;  3CC4 A;  2PZW A;  5C3X A;  2KEN A;  1QB5 D;  3PMF A;  4YY3 Q;  2K5H A;  5EQ0 A;  2JA6 G;  2EYO A;  4H13 C;  2K03 A;  2OQ0 A;  2X6L A;  4RGM A;  1HZC A;  1D5Z C;  1DD2 A;  1G91 A;  5J22 A;  1QCB D;  2YTX A;  1LO5 D;  1EIG A;  1O7Y A;  3OHX C;  3UDF A;  4A3L H;  2R7Z G;  1NAP A;  2QGQ A;  1PH2 A;  4R1J A;  1YHB A;  5DM6 3;  3Q24 A;  4JI3 Q;  2QDB A;  2Z8L A;  5FOB B;  3NQT A;  2PI2 A;  3CPW A;  3S1R H;  3KBX A;  1ICF B;  4DR1 L;  2PYK A;  3G4S A;  5CBE E;  3HOZ H;  2L11 A;  1IYJ B;  4BA2 I;  1SRU A;  3E9I A;  1S5F D;  2JSO A;  1SNC A;  4DAY A;  3S16 B;  4Z9C B;  2E2J B;  1X54 A;  1NR4 A;  2K28 A;  4IUV A;  1Q8K A;  1EIH A;  2HHH L;  1G6P A;  1LLR D;  1OXT A;  5I6W A;  1I4R A;  1Q82 C;  3JAM c;  4DV3 L;  5C4H A;  4OIJ A;  4HCS A;  5M3F G;  2WAQ B;  4N9P A;  3RLN A;  3VR2 A;  4C3H B;  1WD0 A;  1AE3 A;  1CT1 D;  4ZQ3 A;  4TSS A;  3S14 B;  3H0G B;  2ZT9 C;  5CR3 A;  2OTJ A;  1MSH A;  5LMN Q;  2Z6B A;  3J81 i;  4GS3 A;  4DR3 L;  3MXN B;  5GAE C;  3CU7 A;  1BBW A;  2A69 D;  1B50 A;  3OYY A;  5C3E H;  4EVO A;  5AJ3 Q;  4BBS H;  2OXP A;  3U50 C;  3CRK C;  1WTX A;  3F2C A;  1J9O A;  4LF6 L;  5LL6 X;  2K5V A;  4A3E H;  3EIV A;  3RR5 A;  1WI5 A;  1BBU A;  4B3M Q;  3MXG A;  4EQ5 A;  1F2L A;  2WB1 G;  4OXP A;  4BBR G;  3D4W A;  1GKH A;  2F0T A;  2C9O A;  4A3F H;  2ZM6 L;  2MNA A;  1VQ9 A;  2JA7 B;  5IWA L;  3T56 B;  2I5M X;  2I07 B;  2UUA L;  4JI7 Q;  1I6H H;  1AEX A;  5JEA H;  2MUY A;  3VR5 A;  5DEH A;  2F0H A;  3NP8 A;  1VF5 C;  4MN3 A;  3S1N H;  4C3I B;  3R2T A;  1QZH A;  1LTL A;  1PH1 A;  3RN2 A;  4K8I A;  4JBJ A;  3NQI A;  2Y0S E;  5FLM H;  3CCR A;  4ABN A;  5M9O A;  1STA A;  1HNW Q;  5A2Q L;  3PIP 3;  3CCV A;  1A3T A;  1VQG A;  4AYB E;  1OTC A;  2NZ1 D;  5DM7 3;  3R2I A;  2IWH A;  1JE5 A;  5ELB A;  3OIQ A;  2XSC A;  3QOL A;  4FO2 A;  4IO9 A;  2QEJ C;  5C4X G;  1EQT A;  1TWG B;  2Z4I A;  1A6X A;  4LFC L;  1KAA A;  2CWA A;  4BXX G;  4K5V A;  4ME3 A;  3GTG H;  2L12 A;  1JCK B;  1RKN A;  2EYP A;  5M3M H;  4H7B A;  3I4M B;  3ONA B;  4RHR A;  1U4L A;  2F0E A;  2FMC A;  5F2D A;  4JI4 L;  1PTO H;  1SFO B;  1HZB A;  3PF4 A;  4L5Q A;  3A54 A;  1YNX A;  5J39 A;  1PMR A;  4XTC S;  4DR1 Q;  2SEB D;  2KHS A;  1SJH D;  1FYC A;  2ZXO A;  3R3O A;  2JA8 G;  2A19 A;  1PH8 A;  1YVC A;  1NTG A;  3KF6 B;  3M4P A;  1OXV A;  5EKL A;  3MFG A;  3OWE B;  5K36 G;  4LF9 L;  1SYG A;  3F2U A;  3KOJ A;  2QW7 A;  2UUB L;  4DV3 Q;  4O0A A;  4IPH A;  5GAG C;  2PMZ E;  3JAM E;  1MI2 A;  3GDE A;  1KHI A;  4DV6 L;  2F3V A;  4LF5 Q;  1WYD A;  2A6H C;  5D3D A;  1AZQ A;  3D0F A;  1S4Z A;  4KN7 C;  3HOX G;  4DR3 Q;  1D2B A;  1HNX L;  5E4X A;  1YJW A;  2NVY H;  4MZ9 A;  1QNK A;  1SYD A;  5EKI A;  1Q90 A;  1Y14 B;  1LT4 D;  3N6R A;  3RLF A;  1XTD A;  4IPG A;  4UDU C;  4B3S L;  1MJC A;  4G4K A;  5JVG 3;  2NUC A;  2VQF Q;  1I3Q B;  2HIX A;  3BZK A;  5EAY A;  4AH6 A;  3STB C;  3J7Z C;  4LF6 Q;  4IUN A;  3R8B A;  4UPA A;  4DNI A;  4PZ6 A;  1W6J A;  2XNA C;  2K01 A;  2NYZ D;  2RA4 A;  2A74 C;  2F0U A;  3A5U A;  1GHJ A;  1TU2 B;  1ONL A;  4DAP A;  4KY6 A;  2YTV A;  3F2B A;  5KYL A;  1NR2 A;  1DXM A;  1VQ7 A;  4LFB Q;  4LFA L;  3FHW A;  2UUA Q;  4G7H C;  1CQV A;  4DPG A;  3AYH B;  2XTI A;  3NSW A;  1B44 D;  4XQQ A;  2CCZ A;  2O5I C;  2RKS A;  3KF8 A;  3NWT A;  3QB3 A;  4KI0 A;  1FNW A;  1QWY A;  4CJ2 C;  2QA4 A;  2Q8I B;  4RGN A;  5IGE A;  1Q46 A;  1KLG D;  3QR8 A;  4UAI A;  5I9O A;  3H15 A;  1D6E C;  4HJ9 A;  2JA5 H;  3A5Z B;  4A3D H;  4QL5 A;  1F2M A;  3H3V I;  2SDF A;  4JI0 L;  4ZRZ A;  3S15 B;  1SYB A;  1ET9 A;  4DFA A;  2KEE A;  1QJO A;  5EGT A;  5CBA E;  2QEX A;  1ESR A;  1DYQ A;  4LUO A;  1WCM G;  2K6A A;  1K3B C;  4HJA A;  4NMZ A;  5EPL A;  3F8T A;  1LT6 D;  1DOK A;  1NMF A;  1CK1 A;  1LTB D;  4L6T B;  1KNE A;  3WDN A;  4DV0 L;  5IYD H;  2H5X A;  4A3G H;  4DR4 L;  1U4M A;  3U4V A;  4ZUJ A;  3AEV A;  1Q7Y C;  2F0W A;  3MC0 B;  1WOC A;  3VR4 A;  1HQR D;  5IP7 H;  3FMC A;  3PO3 G;  1IBL Q;  4JBK A;  3I4O A;  5D14 A;  1A8V A;  1YIJ A;  2EQS A;  1L2F A;  1NNX A;  5FO8 B;  3K7A B;  3H91 A;  4A3B H;  5HUR A;  2F0N A;  4KHP L;  1I4X A;  2UXD L;  1S5E D;  3H09 A;  1EQR A;  2AUJ D;  4B3T Q;  1A3V A;  3PQI A;  2HDM A;  3AMU A;  4X6A H;  2A69 C;  4J15 A;  3K5M A;  1PH9 A;  1H9R A;  3L9A X;  4L63 B;  4MIU A;  1E24 A;  1ASY A;  4LF9 Q;  3CPF A;  1NY4 A;  4RAU C;  3K8A A;  1V1P A;  4C56 C;  3QG1 A;  1DJR D;  3J7A V;  1YIT A;  4KLK A;  2FHT A;  1EFI D;  3M9B A;  1N9W A;  1H95 A;  3QOJ A;  5KND A;  3S16 H;  3NUC A;  1NJI C;  5IOC A;  3ICE A;  1HNX Q;  4R4I A;  1VQE A;  3C1F A;  1BR9 A;  1ENC A;  2I0Q A;  1B70 B;  2CFM A;  1JOR A;  5D3I B;  1UWV A;  3PUV A;  5FKA C;  1S40 A;  4B3S Q;  3L3O C;  4C3H H;  5IYC H;  2E2H B;  3HOY B;  2NZO A;  4A3I H;  3TBI B;  1E2Z A;  4DNT B;  1N32 Q;  3S14 H;  3H0G H;  2AMC B;  4JI8 L;  4CDC C;  1MBY A;  2K32 A;  1HQM C;  2JYO A;  2Z9H A;  5C6A A;  5JJK A;  5FLX c;  4KJN A;  3VYR A;  2JXM B;  2N88 A;  5KEE A;  1F2Y A;  4H0L C;  2R93 B;  2C35 B;  1ENA A;  2EDG A;  4KHV A;  2D0P A;  1LUZ A;  2JE6 I;  2WAQ E;  2IX3 A;  1SEB D;  2PQE A;  5M5Y H;  1PH3 A;  1D1K A;  1D1I A;  1CHP D;  1S72 A;  2F0S A;  2Q2T A;  1EZ8 A;  4FXK C;  1U4P A;  1PLF A;  1TS5 A;  4DUY L;  1KLU D;  1WTV A;  1J5E L;  4FF1 A;  3IFD A;  4QGU A;  1Y1V G;  4MTK A;  5IYB H;  5I2X A;  4P71 A;  3V96 A;  2EVB A;  2NVX B;  1R4P B;  1BXT A;  1FJG L;  1HJP A;  2MFI A;  3EBE A;  3J7A 5;  1PYB A;  1EWH A;  1VMC A;  4A93 G;  1CKO A;  2JA7 H;  5IOD A;  3MEF A;  2KBN A;  4A3C G;  4JI0 Q;  2MHV A;  1XX8 A;  4E6I A;  1PDQ A;  1Y8O B;  5EKK A;  3PIP A;  1I6H B;  1H9J A;  1KXL A;  2VUM G;  3FDT A;  3FKI H;  2ZJR A;  4GOP B;  2EE1 A;  1SR3 A;  4RGT A;  3LGJ A;  2LXJ A;  2CQA A;  1PH5 A;  4QCL A;  1VQ5 A;  3DWA A;  1L1O B;  2F03 A;  2JQO A;  3I56 A;  4DV0 Q;  4RHS A;  1SNQ A;  2M2L A;  1G29 1;  2LXK A;  2ZXP A;  1V9P A;  2RF4 A;  2DN8 A;  2NTT A;  3P1H A;  4DR4 Q;  1AP0 A;  4QQB X;  4JI1 L;  2XVS A;  2M00 A;  1JJ2 A;  5CGK A;  3CCU A;  1TWG H;  3VA7 A;  5CV5 A;  1YI2 A;  1CZG A;  4JK1 C;  2ASB A;  1B2T A;  3GTG B;  4A76 A;  4M8A A;  2L9H A;  1CI3 M;  4A3K G;  5M3M B;  2UXD Q;  3BDC A;  3I4M H;  4BWG B;  1EY9 A;  3TSS A;  1XNR L;  1I4H A;  4IPD A;  1SRO A;  4V19 0;  2K4K A;  2OCE A;  1SFO H;  1PFS A;  1C8C A;  4R4C A;  3KLR A;  4RGO S;  4HMI A;  3TP8 A;  1N36 L;  2E74 C;  3B6Y A;  3ZYY X;  2A5H A;  3OMC A;  4DR6 Q;  3A56 A;  1HTL D;  1VQJ A;  2PZU A;  3A7A B;  3TME A;  3X3N A;  5EJW A;  4FXG C;  3BDL A;  2E2D C;  3HOU G;  5CYU A;  3U58 A;  1STE A;  1XMO L;  3QWN A;  4ZKB B;  1EL0 A;  2OT2 A;  1B3A A;  3I4N B;  4I7Z C;  4B08 A;  3MAQ A;  2ES2 A;  1YZ6 A;  2BA0 A;  2EY6 A;  2EXD A;  4TQU S;  3V05 A;  4MTN A;  2GVA A;  5CV8 A;  1YHA A;  3OWF A;  1PRT C;  1SJE D;  4KY5 A;  4G7Z C;  3ERS X;  5FLX E;  2FXQ A;  2AHO B;  3K5L A;  2NVY B;  2R92 B;  3ULL A;  2UXB Q;  4POG A;  3KK7 A;  1XPO A;  1JT8 A;  1XNQ L;  2KHI A;  3ITP A;  3J7A F;  2IX0 A;  3QO2 A;  4QJF A;  5JAV A;  2J0T D;  1J5E Q;  1E0B A;  2FMM A;  2AKW B;  1WTP A;  1VQA A;  4DR2 L;  5BN3 A;  1FJG Q;  3HRZ C;  1A63 A;  2C5C A;  1ET6 A;  2WKC A;  3NTH A;  3PO2 H;  2IT1 A;  3LX0 A;  5JOB A;  1TS2 A;  3CXC A;  2F52 A;  2PZT A;  1VQH A;  1XXG A;  3ND8 A;  2K1B A;  4CKB A;  2K75 A;  4YWL A;  1G6Z A;  1Y8N B;  4LAA A;  4PQX A;  4RCO A;  2DJF C;  2VB3 X;  3HEJ A;  3TEH B;  4A3M G;  4FF3 A;  4EX5 A;  4JBM A;  4HID A;  2DJG C;  3AQQ A;  2XN9 C;  1TWC H;  2JA5 B;  1B9N A;  3S15 H;  2CWP A;  4I65 A;  4A3D B;  1CZW A;  4K6L A;  4JI1 Q;  2VS1 A;  2IHF A;  1PXU A;  5JPN C;  3STB D;  4YWK A;  5E1F A;  1GVP A;  2VNU D;  1QUQ B;  3T53 B;  1LM0 A;  4WJ3 M;  1OO9 B;  2KCC A;  1P8L A;  4LWC A;  2F3I A;  1GO3 E;  3EVQ A;  1KAW A;  2TMP A;  2YV5 A;  2I5H A;  3RD4 A;  1OXX K;  4B9X A;  5COR A;  1K8A C;  3U9O A;  1KD1 C;  2RSO A;  3K59 A;  1QNU A;  3BYT B;  5JEA J;  4XT1 B;  1KAB A;  4CDE C;  1I6V C;  1SND A;  5DLQ E;  4X3U A;  2PQA A;  2MP1 A;  2K5N A;  4NB3 A;  5J1Z A;  1OXS C;  1E7Z A;  1WTR A;  4DV7 L;  4CDF C;  1GUT A;  3D6W A;  4WFN 3;  3K7A H;  3CRL C;  4DKA C;  1B53 A;  3DWP A;  2A6E D;  4A3B B;  1KDB A;  1A62 A;  5GAH C;  2HQE A;  1V1P B;  4X65 L;  1PZI D;  4GN3 B;  1UNS A;  1X9N A;  3CCL A;  1A15 A;  1XMO Q;  4L5R C;  1RTO A;  5FO9 B;  2F4V L;  4JYA Q;  1GUW A;  1TS3 A;  2B2V C;  2A8V A;  4P74 A;  1J8I A;  3K0X A;  1A3U A;  1AH9 A;  1Q1B A;  4LF7 Q;  1VQI A;  3G71 A;  2F0O A;  3CW2 C;  1M1K C;  4DUZ L;  1PV4 A;  4LUV A;  1UE7 A;  4Q0F A;  1EWI A;  2EZV A;  1EY5 A;  1F9S A;  4PZ7 A;  5LL6 S;  2YU9 B;  1HUM A;  5ELC A;  4X66 L;  2F0G A;  3GP7 A;  3SK8 A;  5IGC A;  1EIY B;  2ZJQ A;  4O2D A;  2Q2H A;  1XNQ Q;  1YJN A;  4X62 L;  2E2H H;  3HOY H;  1KNA A;  2CH4 W;  2DY7 A;  1EIF A;  1HTP A;  4LW1 A;  4HIO A;  2NN6 H;  1LTA D;  4CJ1 B;  1WTQ A;  1AFP A;  4A3I B;  3LWE A;  1BCP B;  4N8X 1;  5I4D A;  2PPB C;  2R93 H;  1CTM A;  1PFN A;  1V1Q A;  2JP1 A;  2N55 A;  1PZJ D;  1EFW A;  1ML0 D;  3SGI A;  1S5C D;  3ULJ A;  2DGY A;  4OHJ A;  1CFM A;  4RWS C;  1E1O A;  5M5Y B;  1UE6 A;  2CKZ B;  4A3J G;  1IBM L;  1C0A A;  3W5O A;  2CVR A;  5BN5 A;  2Q2U A;  2LKV A;  1YNN C;  1HHV A;  4YCW A;  3NHH A;  1JB3 A;  2LFN A;  2NVT B;  4LF8 Q;  2NVX H;  4HJ7 A;  1AW7 A;  3T16 A;  2RVL A;  2MJ8 A;  3PIO 3;  3D6C A;  5L37 A;  3KDF B;  1Y1W B; 
#chains in the Genus database with same CATH homology
 4LFA L;  1JMC A;  3FHW A;  4JI2 Q;  4DK3 C;  2E5L L;  2UUA Q;  5ELN A;  1KRT A;  4DPG A;  3AYH B;  1YJ9 A;  2XTI A;  4R4Q A;  1VQ6 A;  3TS2 A;  3PCO B;  1W2B A;  2CCZ A;  3GTO H;  4KI0 A;  4C3J H;  5AJ3 L;  2QA4 A;  4OX9 L;  3I4M G;  3I2Z A;  1PYS B;  1TWF H;  1Q46 A;  2R7D A;  4P73 A;  1KIX A;  1N33 L;  1RL2 A;  4RMF A;  5H1S E;  3KJP A;  5M3F H;  1IBK L;  3H15 A;  4JI5 Q;  2R6G A;  5LMN W;  2JA9 A;  3OTO L;  1LYL A;  4BY1 H;  4HJ9 A;  1QVF A;  2JA5 H;  3A5Z B;  1KRS A;  3KDF A;  4A3D H;  4QL5 A;  4B3M L;  4C3I H;  4AIM A;  3H3V I;  4JI0 L;  3EN2 A;  2E2I H;  1X56 A;  3UDX A;  4UP7 A;  3CCM A;  5HGQ A;  3ULP A;  2N3S A;  3J80 c;  2QEX A;  3K7U C;  4LUO A;  1WCM G;  3PGZ A;  5BR8 L;  3PUY A;  1RIP A;  4B3R L;  2B3G A;  4HJA A;  3PUW A;  4JOI C;  4GNX C;  3T1H Q;  4NPS A;  4A3L G;  1D8L A;  3Q8D A;  5LMU L;  4JI7 L;  3JC6 6;  4X64 Q;  4DR5 Q;  3F8T A;  1XNR Q;  1NMF A;  4K0K L;  4IFD G;  4YHH L;  2BH2 A;  4DV0 L;  5IYD H;  1CSP A;  2H5X A;  4A3G H;  2K50 A;  4GN5 A;  4MNO A;  1N36 Q;  4GN4 B;  4BBR H;  4DR4 L;  3U4V A;  2I5L X;  3HOZ G;  3AEV A;  4NXN Q;  1Q7Y C;  4GKJ Q;  4JC0 A;  2ATW A;  4A3M H;  3M85 A;  4X65 Q;  1WOC A;  2ZTC A;  1VQO A;  3GTL H;  5IP7 H;  4KHZ A;  5IP9 H;  3PO3 G;  1IBL Q;  3F1Z A;  2Z6K C;  3I4O A;  4JBK A;  1A8V A;  1YIJ A;  1QVC A;  2EQS A;  1G51 A;  1L2F A;  3TRE A;  2WB1 E;  1I50 H;  4A3B H;  2JEA I;  1EOV A;  1VQD A;  4KHP L;  1NE3 A;  1XPR A;  2UXD L;  1M90 C;  1EQR A;  4B3T Q;  1XMQ Q;  4X6A H;  4GKK Q;  4UP8 A;  5C4J H;  4YY3 L;  4GLX A;  2Z6K A;  4J15 A;  1ASZ A;  1PH9 A;  3PUZ A;  1E24 A;  2ZJP A;  3DM3 A;  4A75 A;  1ASY A;  4LF9 Q;  3CPF A;  1NY4 A;  2PI2 E;  4C2M H;  3K8A A;  3E0E A;  1OXU A;  2HHH Q;  5IT9 c;  2BA1 A;  5C3E G;  4POF A;  4YWM A;  1JJC B;  3J80 i;  1YIT A;  3I4N H;  4KLK A;  4OO1 I;  3CC7 A;  4BBS G;  2NVQ H;  3RNU A;  3PO2 G;  4X62 Q;  3M9B A;  1N9W A;  1H95 A;  1YEZ A;  3S16 H;  5C4X H;  4UP9 A;  4JV5 L;  1NJI C;  1Y1W G;  4BXX H;  1X65 A;  1W3S A;  5C44 G;  4A3E G;  3HOW G;  1HNX Q;  3ICE A;  4R4I A;  3HKS A;  1VQE A;  4JYA L;  1CUK A;  2I0Q A;  1B70 B;  2CFM A;  3KF6 A;  4IPC A;  1UWV A;  3I55 A;  4LF4 L;  2L15 A;  3PUV A;  4WJ4 A;  4LF7 L;  2KHJ A;  4DR2 Q;  2R92 H;  1Z47 A;  1S40 A;  3CC2 A;  4B3S Q;  4A3F G;  3HKZ E;  2GVB A;  4C3H H;  1L0W A;  5IYC H;  1VQC A;  3TS0 A;  1HR0 L;  2Y0S G;  1CKM A;  2NZO A;  4OWT B;  4A3I H;  4DV4 L;  1IBM Q;  1N32 Q;  3S14 H;  3H0G H;  2AMC B;  4JI8 L;  2B63 G;  5JJK A;  5FLX c;  2HQL A;  5JEA G;  4AYB G;  4AQY L;  3KYH C;  2UU9 L;  3M4O H;  1HNZ L;  2N49 A;  3S1M H;  3U4Z A;  2NN6 I;  1K73 C;  1VCI A;  4R4T A;  2C35 B;  3BJU A;  2VL6 A;  2D0P A;  2N8N A;  1I3Q H;  1LUZ A;  2JE6 I;  2WAQ E;  4PZ8 A;  5M5Y H;  2MQH A;  1PH3 A;  5FLM G;  4LF5 L;  2MO0 A;  4DV1 L;  1S72 A;  2JA8 H;  2ZM6 Q;  1V43 A;  3ZJY C;  2Q2T A;  1HH2 P;  2PNH A;  1TWH H;  5IWA Q;  1I5F A;  4DUY L;  3CF5 A;  1U0L A;  5LMN L;  1VQM A;  4QGU A;  2XGT A;  1J5E L;  4NXM Q;  3PF5 A;  1Y1V G;  5IYB H;  3CCJ A;  3DLL A;  4P71 A;  3CCE A;  1D7Q A;  2OWO A;  4OX9 Q;  3GTM H;  1YBY A;  1FJG L;  1HJP A;  2MFI A;  3EBE A;  3UDI A;  2N78 A;  4HJ5 A;  1C7Y A;  1N33 Q;  3RZO H;  2GN5 A;  4QY7 A;  4IOA A;  5M5X H;  2VQF L;  3J7A 5;  3TQY A;  2VW9 A;  3HOV G;  1VQB A;  3IRB A;  1PYB A;  4H02 A;  4A4I A;  5C0X J;  3OTO Q;  3RN5 A;  1CKO A;  2JA7 H;  1XPU A;  4IOC A;  3MEF A;  4A93 G;  1JJG A;  2ID0 A;  1O7I A;  2Z0S A;  2KBN A;  2ZTE A;  3HOX H;  4JI0 Q;  4A3C G;  1R9T H;  3G48 A;  4LF8 L;  1X3G A;  3PIP A;  1KXL A;  5FJ8 H;  2VUM G;  5BR8 Q;  1E22 A;  2D62 A;  3BZC A;  4DV2 L;  4B3R Q;  3FKI H;  2ZJR A;  4GOP B;  1Q12 A;  3K80 C;  1SR3 A;  4OWW B;  2B63 H;  4IJH A;  3LGJ A;  4TVA B;  4GNX B;  2LXJ A;  4GOP C;  4LFB L;  5LMU Q;  1PH5 A;  2K52 A;  1VQ5 A;  4BA1 I;  1MIU A;  4Y7N H;  1L1O B;  2IHE A;  4A3J H;  1EYG A;  4YHH Q;  2JQO A;  3I56 A;  4DV0 Q;  4OO1 G;  4LFC Q;  2VZA A;  1G29 1;  1L1O C;  2EIF A;  2LXK A;  1QVG A;  1V9P A;  4QIW E;  4DV7 Q;  2RF4 A;  1UEB A;  4DR4 Q;  4QQB X;  3UDG A;  4JI1 L;  3I7F A;  1JJ2 A;  4JG2 A;  4GOP A;  1PH6 A;  1T9H A;  1Z9F A;  1MKH A;  2RHQ B;  1CKN B;  3WWV A;  4OWX B;  3CCU A;  4Y52 H;  1B7Y B;  4DAM A;  4JOI A;  1DGS A;  1TWG H;  1X3F A;  4GNX A;  3A0J A;  4IJL A;  2UXC L;  1YI2 A;  3UE1 A;  1HNW L;  4DR7 L;  2HT1 A;  2ALY B;  1L1O A;  4JI4 Q;  4P75 A;  3CME A;  1VQ4 A;  1WJJ A;  1NBW A;  1JB7 A;  2ASB A;  4A76 A;  1Q86 C;  1HZ9 A;  4A3K G;  3HKZ G;  2UXD Q;  3I4M H;  2F4V Q;  3T1H L;  4BY7 G;  3CC4 A;  1Q1E A;  4JBW A;  3W1B A;  2WFW A;  5J3B A;  2VQE L;  4X64 L;  1XNR L;  3HOY G;  1VS0 A;  2KEN A;  4YY3 Q;  1CKN A;  2K5H A;  2NN6 G;  2MO1 A;  4JI6 L;  2OTL A;  4IPD A;  1SRO A;  1VQN A;  2K4K A;  2OCE A;  3J81 c;  4DUZ Q;  1PFS A;  1SFO H;  2JA6 G;  4R4C A;  3CCQ A;  1SMX A;  3CQZ H;  4LF6 Q;  2OQ0 A;  1N36 L;  3B6Y A;  1HZC A;  5HY6 A;  2R93 G;  2NZH A;  4NXN L;  2V1C C;  3PSI A;  4DR6 Q;  2YTX A;  1VQJ A;  1WCM H;  2Q2I A;  2UUB Q;  3S17 H;  4X66 Q;  5GAD C;  3CAM A;  4DAY B;  3UDF A;  4A3L H;  1XJV A;  1IBL L;  2R7Z G;  3HOU G;  1PH4 A;  4DV6 Q;  3GTQ H;  2QGQ A;  1PH2 A;  3U58 A;  4R1J A;  1XMO L;  3RZD H;  1YHB A;  2YU9 H;  1J6Q A;  4JI3 Q;  4UY8 C;  4LF4 Q;  3CCS A;  3CPW A;  1FL0 A;  1WFQ A;  2PI2 A;  3BU2 A;  3S1R H;  1KQS A;  4DR1 L;  4B3T L;  3G4S A;  3HOZ H;  1IYJ B;  1KC8 C;  1HR0 Q;  4XIG S;  1SE8 A;  1UE1 A;  1SRU A;  4BA2 I;  2ES2 A;  2WP8 J;  1YZ6 A;  2BA0 A;  3E9I A;  4DK6 C;  1A0I A;  1PH7 A;  2EXD A;  4TQU S;  1X54 A;  3VDY A;  4MTN A;  2GVA A;  1Q8K A;  1YHA A;  1IXR A;  2HHH L;  3PO3 H;  4AQY Q;  3GD7 A;  1HNZ Q;  2YTY A;  1G6P A;  4RG1 A;  3ERS X;  4L5T A;  1OXT A;  4A3K H;  1PVO A;  2FXQ A;  2AHO B;  1EQQ A;  1Q82 C;  3JAM c;  3GO5 A;  4IFD J;  4DV3 L;  1S3O A;  1FVI A;  5JJI A;  3ULL A;  3J81 j;  5ELO A;  2UXB Q;  4DV1 Q;  5M3F G;  4POG A;  1XPO A;  3GTP H;  1PHJ A;  3RLN A;  1JT8 A;  1N34 L;  1XNQ L;  1AE3 A;  3UE0 A;  2KHI A;  3A74 A;  2IX0 A;  4QJF A;  4BY1 G;  1X55 A;  3S1Q H;  2JA5 G;  1J5E Q;  4A3D G;  2OTJ A;  3PIO A;  5LMN Q;  4LFA Q;  3J81 i;  4GS3 A;  4DR3 L;  3MXN B;  5GAE C;  3AFQ A;  2E5L Q;  2AKW B;  1VQA A;  4DR2 L;  2NVT H;  1BBW A;  1FJG Q;  3OYY A;  5E7N A;  5C3E H;  4DV5 L;  1NMG A;  1A63 A;  3G6E A;  5AJ3 Q;  4BBS H;  3PO2 H;  2IT1 A;  5IY0 A;  3CXC A;  1CSQ A;  3U50 C;  1K8G A;  1N32 L;  2F52 A;  3F2C A;  1VQH A;  1IBK Q;  5C0X I;  1Y1W H;  4LF6 L;  2K5V A;  3HOW H;  4A3E H;  5C44 H;  3EIV A;  1HR0 W;  3RR5 A;  1WI5 A;  5IYD G;  3F2D A;  1I94 L;  1BBU A;  2BH8 A;  4B3M Q;  4A3G G;  2K75 A;  4YWL A;  4EQ5 A;  1TWA H;  2WB1 G;  4OXP A;  4BBR G;  5M3M G;  2UUC L;  2R7Z H;  1GKH A;  1GD7 A;  4A3F H;  2ZM6 L;  3H3V H;  2MNA A;  3RLO A;  1VQ9 A;  4HJ8 A;  2R7F A;  4GLA C;  4JCV E;  3TEH B;  4A3M G;  4EX5 A;  3T1Y L;  1QZG A;  5IWA L;  4JBM A;  1VQP A;  2RHS B;  5IP9 G;  5IP7 G;  4HID A;  4NXM L;  2I5M X;  3AQQ A;  2UUA L;  4JI2 L;  4JI7 Q;  1I6H H;  3L7Z C;  3L0O A;  1TWC H;  4L5S A;  4PMW A;  4K0K Q;  3S15 H;  3S2D H;  3M3Y H;  2CWP A;  3KJO A;  2LSS A;  3S1N H;  4A3B G;  4JI1 Q;  2VS1 A;  2IHF A;  1QZH A;  3M4Q A;  1LTL A;  2ZTD A;  1PH1 A;  3JAM i;  3RN2 A;  3STB D;  4YWK A;  1GVP A;  1TXY A;  3NEM A;  4JBJ A;  2VNU D;  1QUQ B;  2Y0S E;  5FLM H;  1LM0 A;  4JI5 L;  3CCR A;  4P72 A;  1VQ8 A;  2PQA B;  4WJ3 M;  1GM5 A;  3D31 A;  1P8L A;  2UXC Q;  1HNW Q;  4DR7 Q;  1K0R A;  4YCU A;  4LWC A;  3CCV A;  1UE5 A;  1VQG A;  2F3I A;  1GO3 E;  4AYB E;  1OTC A;  1P16 A;  3PV0 A;  1KAW A;  2YV5 A;  1Y1V H;  2I5H A;  1OXX K;  1JE5 A;  1K8A C;  1KD1 C;  3I4N G;  2CQO A;  2KCM A;  3CMA A;  5JEA J;  1E3P A;  4IO9 A;  2VQE Q;  4KHP Q;  3HOV H;  1QUQ A;  5DLQ E;  5C4X G;  5JJL A;  3CD6 A;  4JI6 Q;  4A93 H;  2PQA A;  4LFC L;  4FDB A;  2K5N A;  4NB3 A;  2CWA A;  1FGU A;  2K14 A;  1N8R C;  4DR5 L;  4BXX G;  1OXS C;  4ME3 A;  3KLW A;  3GTG H;  1E7Z A;  4A3C H;  4R4O A;  4DV7 L;  3NEL A;  3FP9 A;  4APV A;  5M3M H;  1SN8 A;  3K7A H;  2E8G A;  2JEB I;  2VUM H;  1Q81 C;  3HFZ B;  4GLV B;  1KL9 A;  5IE8 A;  4DKA C;  5M5W H;  4HIM A;  2R92 G;  1BKB A;  2WAQ G;  5IYC G;  1A62 A;  1MJE A;  4GKJ L;  5GRO A;  5GAH C;  1K83 H;  1VQF A;  4A3I G;  3H0G G;  4X65 L;  4GN3 B;  1X9N A;  3CCL A;  4JI4 L;  4JV5 Q;  1XMO Q;  3L2P A;  3GTJ H;  1HZB A;  3S24 A;  4L5R C;  3PUX A;  3PF4 A;  2D0O A;  4L5Q A;  3CP0 A;  1YNX A;  2F4V L;  1VQK A;  1K3R A;  4XTC S;  5C0X G;  4DR1 Q;  2A8V A;  4JYA Q;  4P74 A;  4HIK A;  3K0X A;  2IX1 A;  4ALP A;  1SLJ A;  1AH9 A;  1Q1B A;  4LF7 Q;  1U5K A;  1B8A A;  1VQI A;  3G71 A;  2JA8 G;  2A19 A;  3CW2 C;  5GQO A;  1M1K C;  4DUZ L;  1PH8 A;  1PV4 A;  1XMQ L;  1IL2 A;  1YVC A;  1NTG A;  2JJQ A;  3ER0 A;  3KF6 B;  1OXV A;  3M4P A;  4GKK L;  1HZA A;  4LUV A;  1UE7 A;  5K36 G;  1EWI A;  4DV4 Q;  4JI8 Q;  4PZ7 A;  4LF9 L;  5IYB G;  2KCT A;  2DUD A;  4DR6 L;  3GTK H;  3KOJ A;  3KFU A;  4PG3 A;  2UUB L;  2UU9 Q;  4DV3 Q;  4O0A A;  4X66 L;  1IZ6 A;  4IPH A;  5GAG C;  4IFD I;  2PMZ E;  1YHQ A;  1EIY B;  4O2D A;  2Q2H A;  2E2J H;  2ZJQ A;  4BY7 H;  3NEN A;  3GDE A;  1YJN A;  1N34 Q;  1XNQ Q;  3S2H H;  1KHI A;  4X62 L;  1E1T A;  2OQK A;  4DV6 L;  2E2H H;  3HOY H;  4LW1 A;  4HIO A;  2JA7 G;  1EIF A;  4LF5 Q;  1WYD A;  4OON A;  3D0F A;  3HOX G;  2JA6 H;  4JI3 L;  1X3E A;  4DR3 Q;  1VQL A;  1HNX L;  2IY5 B;  3K81 C;  1YJW A;  2NVY H;  3OW2 A;  4MZ9 A;  4DUY Q;  2R93 H;  5FJ8 G;  4DV5 Q;  1X6O A;  1V1Q A;  1Y14 B;  3FKI G;  1C9O A;  1EFW A;  3RLF A;  1XTD A;  4IPG A;  3AFP A;  2B29 A;  3SGI A;  3ULJ A;  4B3S L;  2JK8 A;  3M7N A;  1MJC A;  2DGY A;  2HIV A;  2VQF Q;  2HIX A;  3J7Z C;  1E1O A;  2A1A A;  2RCN A;  3BZK A;  5EAY A;  1UE6 A;  4LUZ A;  2CKZ B;  3STB C;  4AH6 A;  4A3J G;  1IBM L;  1PA6 A;  3W5O A;  3HOU H;  1C0A A;  2YYZ A;  2Q2U A;  1AE2 A;  1I94 Q;  4UPA A;  4DNI A;  4PZ6 A;  4YCW A;  1EUJ A;  3KF8 B;  2VY3 A;  3TRZ A;  1BVS A;  3NBH B;  4LF8 Q;  3A5U A;  2NVX H;  1K9M C;  3W1G A;  2UUC Q;  4LNQ A;  2UXB L;  3E9H A;  4HJ7 A;  4YCV A;  2AWN A;  4DV2 Q;  2YTV A;  3T1Y Q;  3F2B A;  2AWO A;  3KDF B;  1VQ7 A;  4LFB Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...