3JAMi

Cryoem structure of 40s-eif1a-eif1 complex from yeast
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
96
structure length
96
Chain Sequence
PKRELIYKEEGQEYAQITKMLGNGRVEASCFDGNKRMAHIRGKLRKKVWMGQGDIILVSLRDFQDDQCDVVHKYNLDEARTLKNQGELPENAKINE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational Differences between Open and Closed States of the Eukaryotic Translation Initiation Complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Translation
molecule keywords 18S rRNA
total genus 16
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
i PF01176 eIF-1a Translation initiation factor 1A / IF-1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3jami00
2I5HA 4BY7G 4GKKL 2WAQE 3HOVG 3F8TA 4NB3A 3CPWA 1PYBA 2XGTA 1YJ9A 1Q12A 2AMCB 4B3SQ 4A3IG 3HFZB 1EUJA 1HH2P 5FLXc 2OQ0A 1RIPA 3PCOB 2A8VA 3M4OH 2B29A 4DR6Q 4HIDA 1OTCA 2JA8H 2KENA 3CP0A 1V1QA 4J15A 1EFWA 4B3RL 1YZ6A 2F3IA 1IBML 1BBWA 1VQMA 2R93G 1LYLA 3BZCA 1K73C 3M3YH 3E0EA 2UXCL 3J80i 2VQEL 1HNZL 4NPSA 1FJGQ 1OXVA 3S17H 1PV4A 1QVFA 1HR0W 3T1HQ 3ICEA 1KHIA 4A3LH 1N32L 4HJ9A 1Y1VG 1E1OA 2FXQA 3I55A 4AH6A 4JI7L 3KF8B 4GLXA 4HIMA 4GS3A 2ZTDA 2KBNA 1Q46A 1WJJA 5AJ3Q 1PH9A 1A62A 2WAQG 4UP9A 3PSIA 4GKKQ 2VQFL 2MNAA 3BZKA 4BBRG 4JI8Q 1PH5A 1W2BA 2I5MX 5IYBH 1Y1WH 3WWVA 2RHSB 5C0XI 4H02A 1B70B 1M90C 4JI5L 3J81i 2UUBQ 4DV2L 3RLOA 4OWTB 3PIPA 3CCQA 4YCVA 4A3DG 3TQYA 3KDFB 4LFCQ 1N32Q 3GD7A 1V43A 2H5XA 4HJ8A 2KHJA 1HNWL 4DV0Q 2MQHA 4NXNL 4A3CH 1C9OA 4KHZA 3PIOA 3JC66 4BBSH 2ASBA 2NVTH 4JI4L 2GVAA 3KF6B 5JJLA 5FLMG 1D7QA 4XTCS 3EBEA 4OO1I 1B7YB 1RL2A 2K4KA 4LUVA 4GOPC 1JJ2A 1NE3A 1V9PA 5M3MH 4DR2L 1PH2A 1IL2A 4A3GH 3A5UA 2MO1A 4DV4Q 4QQBX 1L1OC 4A76A 3M9BA 5C44H 1E22A 1VQGA 4B3SL 5GQOA 4LF5Q 1X3EA 4BXXH 1XMOQ 1XNRL 4WJ4A 2YTXA 1E24A 5IYBG 2WB1E 4LF9Q 1O7IA 1NJIC 3PUXA 3U4VA 3F2BA 4JI8L 2VUMH 1S3OA 4R1JA 2JA9A 1VQJA 1K8GA 1VQNA 3I4MG 3EN2A 3KYHC 3PUYA 4UPAA 3NBHB 5C4XH 4DV4L 3S1RH 5FJ8H 4OWWB 3GTOH 4LFBQ 4DNIA 2UXBL 1I3QH 3H15A 3ER0A 2WB1G 4K0KL 1WI5A 1YEZA 3PGZA 3OTOQ 5C3EG 4X66Q 3CMAA 5C0XJ 2OTLA 2E2JH 4A93G 3I4OA 1HZAA 3PUVA 1YHAA 2F52A 4DV2Q 2BH8A 1X65A 2IX0A 3RN5A 2K50A 2EXDA 1HNXQ 4POFA 3AEVA 4DKAC 1SROA 4GNXB 3GTLH 1U0LA 1KD1C 4FDBA 1QZHA 2NVYH 3K7AH 4DR3Q 1WCMH 4DR4L 4QGUA 1VQ7A 1TWHH 3S16H 4A3MH 1X54A 1A8VA 1HR0Q 1SFOH 1VQIA 3TEHB 3ZJYC 3CXCA 2K75A 1CKMA 5GAHC 4HIKA 2JA5G 5FJ8G 3GTPH 1K83H 3VDYA 2NVXH 1KRSA 1XNQQ 2KHIA 3HOXG 3I4NH 1J6QA 4POGA 4IOCA 1TWGH 2HIXA 1X6OA 2N49A 4KHPL 1E3PA 3L2PA 1SR3A 1EYGA 4A3BG 3AQQA 4DV5L 4JI3L 3U50C 2N8NA 4O0AA 5HGQA 4DR6L 1CKNB 4DUYQ 1AH9A 1VQ8A 5ELOA 1QZGA 1T9HA 1UEBA 2WP8J 4JI5Q 2GN5A 5IYCH 4LF6Q 2K52A 4ME3A 4LF9L 3HOWG 1XMQL 4OO1G 4A3IH 1VQHA 5C44G 4P74A 2GVBA 3M4PA 1L2FA 3BU2A 3PUZA 2ZM6L 4GNXA 4GLAC 2E5LQ 1N9WA 3LGJA 2VNUD 3RLFA 1YVCA 2A1AA 2AKWB 2CWPA 4IPHA 5ELNA 2QGQA 3L0OA 2E2HH 4BY1H 2R7ZH 3GTMH 2NN6G 3UDFA 2IX1A 4IOAA 2UXDQ 2ES2A 3ERSX 5IT9c 1KIXA 3CAMA 5JEAG 2YTYA 1BVSA 2NZOA 3KJPA 1CUKA 2I5LX 2AHOB 2LSSA 1N8RC 2IT1A 1QUQB 3HOYG 5IP7G 2R7FA 1C7YA 1ASZA 2UUCQ 4JI0Q 2CWAA 1EIFA 4OONA 2CKZB 2ZJPA 4R4IA 1Z47A 4K0KQ 1NBWA 2D0PA 3HKZG 3CCVA 1OXUA 1HZ9A 2B63G 4LF8Q 3GO5A 1XJVA 4JBKA 4YWMA 2E8GA 4R4QA 2UXCQ 1HNWQ 5M3FG 1AE2A 1UWVA 1PH1A 3MXNB 3GTGH 3H3VH 4LNQA 3K0XA 4OXPA 3CD6A 1U5KA 4PMWA 2CCZA 2JJQA 3PV0A 4KLKA 2HHHQ 2I0QA 4BY7H 4JV5Q 3HKSA 1YITA 1YIJA 2E5LL 4WJ3M 4R4CA 3GTJH 3TS0A 4A3DH 1SE8A 1K3RA 2Q2UA 1M1KC 2R7DA 1W3SA 3FKIH 2VZAA 4A3CG 1S72A 3J80c 4DV3Q 2CFMA 3NELA 3T1HL 1KXLA 2JA8G 1AE3A 3H0GG 1XMQQ 2D62A 2DUDA 1G51A 2YYZA 4JI2Q 4P75A 3ULLA 3CMEA 4A3FG 5IP7H 2UUAQ 5LMUL 4C3HH 3J81j 1PH3A 1VQDA 4IFDI 4UP8A 3UDXA 3HOUH 1UE6A 3A5ZB 4UY8C 4PZ6A 1I6HH 3RZOH 2BA0A 4EQ5A 2JE6I 5M3FH 2E2IH 1UE7A 1XNRQ 2YV5A 1Q1EA 3S15H 5IY0A 4A3GG 4DV1Q 3KLWA 2B3GA 1WCMG 1TWCH 4YY3L 1N36Q 2JK8A 2K5VA 2A19A 5E7NA 2JA7H 3OW2A 1WOCA 4NXML 3HOWH 5C4JH 3RNUA 2Z0SA 4LUZA 4C3IH 1TXYA 2PQAB 1N36L 4BBRH 1Q1BA 3TREA 1R9TH 2Q2HA 4KI0A 5JJIA 3JAMi 1EWIA 1OXXK 2Z6KA 5GADC 4A3KG 4DR2Q 3E9HA 4B3ML 4RMFA 4DUYL 5IP9H 4DV1L 4DR5Q 3NENA 4DR1L 2YU9H 1PH8A 5IWAL 4NXNQ 3CCSA 3A74A 3U4ZA 4A3LG 4GOPA 5JEAJ 4IPGA 1CSQA 4DV5Q 4PZ7A 4QJFA 4MTNA 3CCUA 1XPOA 1PHJA 3K7UC 4YCUA 3I56A 5FLMH 2MFIA 2ZTCA 2CQOA 3STBD 1VQ9A 2OWOA 1XNQL 3KF6A 1N33Q 2WFWA 1TWAH 1KRTA 4DV0L 4GKJQ 4JV5L 2LXJA 4A3MG 4C2MH 3CCLA 1XPRA 2UU9L 4UP7A 3KOJA 1IBKQ 1PVOA 3PF4A 2Q2TA 2HT1A 2N3SA 5EAYA 4GKJL 1XMOL 2K5HA 1Q8KA 3PO2H 1X55A 1CSPA 3HKZE 1VQ6A 4JI6Q 2QA4A 1UE1A 2JQOA 2YTVA 4QL5A 3STBC 4HJ5A 5M5YH 2L15A 4Y7NH 1FGUA 4IO9A 4DAYB 1YHBA 3JAMc 1IXRA 4X64L 3EIVA 2R92H 1BBUA 4P72A 3S24A 4YCWA 3W1BA 1SRUA 4A3JH 4X62Q 2RCNA 1VQOA 1VQPA 3PO3H 4GNXC 4DUZQ 3HOZH 4IPCA 4JG2A 1EOVA 1HZBA 4LFBL 4P73A 3H3VI 2UXBQ 4MZ9A 1GM5A 2PI2A 1TWFH 2BH2A 2DGYA 1CKNA 1IBMQ 1NMGA 1PFSA 2AWOA 2HIVA 1YBYA 2VY3A 1L1OB 4DV3L 1Q86C 2LXKA 4ALPA 3DLLA 1VQ4A 1WFQA 3D31A 2NVQH 1YI2A 3S2DH 3I7FA 4DR3L 2JA7G 3S14H 4DR7L 2VQFQ 1SMXA 3CCMA 3MEFA 2R7ZG 1J5EQ 3S1NH 2NZHA 4EX5A 1MJCA 1IYJB 4DV7L 1PH4A 4LF8L 1X56A 3CC7A 2ZM6Q 1PYSB 1A63A 4DV6L 3PF5A 1K9MC 1MKHA 1MIUA 4TQUS 1MJEA 3S1MH 2JA6G 1H95A 4JI0L 1LTLA 4R4OA 4DK3C 4A3KH 3RZDH 5DLQE 3AFPA 4JI1Q 5LMUQ 5J3BA 3KJOA 4A3JG 1L0WA 5IYDH 3T1YL 1S40A 1K8AC 4A3BH 4JI4Q 4X64Q 1GVPA 2ZJQA 4OX9L 2ATWA 4JI3Q 2VL6A 3ULJA 3OTOL 1P16A 1JE5A 3CPFA 3I2ZA 3B6YA 3M4QA 4LFCL 1PH7A 2IHFA 3FHWA 3RLNA 5M3MG 5M5WH 1I94Q 1KQSA 4DR4Q 4QIWE 3F1ZA 4IJHA 3UE1A 1N34L 4LFAL 2UXDL 2MO0A 1KL9A 2PQAA 4LF6L 2K5NA 4A3EG 1X3FA 1EIYB 3KDFA 2ZJRA 5HY6A 4B3TQ 2QEXA 2D0OA 3J7A5 3HOVH 4IFDJ 4DUZL 4X6AH 2PMZE 4GN3B 2VS1A 1IBKL 1OXTA 4A3FH 5AJ3L 3PO2G 1VQLA 3I4MH 3G48A 3M7NA 1NY4A 2F4VQ 3RR5A 3CQZH 2BA1A 1E7ZA 2K14A 2NN6I 3L7ZC 4TVAB 1ASYA 1SN8A 3D0FA 1I94L 1C0AA 3H0GH 1JB7A 1XTDA 3CCEA 2C35B 1KAWA 1EQRA 1YJWA 4JYAQ 4OX9Q 2JEBI 3SGIA 1UE5A 3K8AA 4GOPB 1YJNA 3E9IA 5IYCG 5BR8L 1K0RA 4B3MQ 3W1GA 1I50H 4X65Q 4DPGA 1A0IA 1B8AA 1GD7A 1VQAA 4A75A 2UUBL 4GN5A 3RN2A 2IHEA 3FP9A 1J5EL 3S2HH 2IY5B 4BA2I 4Y52H 4YWLA 4L5TA 3W5OA 4JOIA 3A0JA 3G71A 3J81c 4GLVB 3Q8DA 3CW2C 1HR0L 1QVCA 1NTGA 4DAMA 3GTKH 4LF5L 1YNXA 1VS0A 5GAGC 3CC2A 1D8LA 2R6GA 3OYYA 3CC4A 4X66L 3UE0A 5C3EH 3T1YQ 2PNHA 1BKBA 3HOXH 1PA6A 1E1TA 2UUCL 4LF4L 1G291 2AWNA 2R92G 1CKOA 4AIMA 1OXSC 3K80C 5H1SE 1JMCA 4A93H 4HJ7A 2Q2IA 2XTIA 2B63H 5LMNW 5GROA 2ALYB 2RF4A 2Z6KC 4JI1L 2ZTEA 4HJAA 1Q81C 5IWAQ 1FL0A 5K36G 2EQSA 4LUOA 4JI6L 1Y1WG 4JBJA 3K81C 4JI2L 4GN4B 3PUWA 1VQEA 1Q7YC 5JJKA 3M85A 4C3JH 4YY3Q 2VUMG 4IFDG 3TRZA 3AYHB 1PH6A 1IBLL 4PZ8A 2KCTA 1SLJA 4JI7Q 1VQ5A 3UDGA 4BXXG 1X3GA 4A3EH 3S1QH 3FKIG 1VCIA 1DGSA 4IPDA 5LMNL 1JJCB 3AFQA 4RG1A 5BR8Q 4JBMA 2KCMA 4A4IA 3G6EA 1IBLQ 2JA6H 1HZCA 1VQCA 4X65L 3ULPA 4IJLA 4BA1I 1Y14B 4JOIC 1VQKA 5IE8A 3NEMA 1JJGA 4L5QA 1N33L 5C4XG 4X62L 1GO3E 2ID0A 3F2CA 4HIOA 1QVGA 1LUZA 2F4VL 3HOUG 1Y1VH 4P71A 3CCRA 5GAEC 1L1OA 1WYDA 4BBSG 1VQBA 3HOYH 2JEAI 2VQEQ 1HNZQ 3UDIA 1JT8A 4O2DA 3DM3A 4JCVE 4DV6Q 4L5RC 5LMNQ 3TS2A 4APVA 1I5FA 3IRBA 3G4SA 4QY7A 3HOZG 1P8LA 1LM0A 4DR5L 4B3RQ 3F2DA 4NXMQ 4DR7Q 4LW1A 4LFAQ 1N34Q 2OCEA 4YHHQ 4DV7Q 1FVIA 3BJUA 2UU9Q 4AYBE 1Z9FA 2JA5H 2Y0SG 4B3TL 2HQLA 2RHQB 4BY1G 4YHHL 4OWXB 3I4NG 2N78A 5IP9G 5M5XH 1HNXL 4L5SA 1NMFA 1Q82C 2OTJA 2PI2E 4XIGS 4AQYL 4LF7L 2VW9A 1VQFA 3GDEA 3CF5A 4PG3A 2EIFA 4AYBG 4JC0A 3J7ZC 3GTQH 4YWKA 5C0XG 1IZ6A 3KFUA 2R93H 1XPUA 1FJGL 4AQYQ 4LF7Q 1KC8C 4KHPQ 4R4TA 1QUQA 4JYAL 4JBWA 1YHQA 5IYDG 1X9NA 4LF4Q 1GKHA 4DR1Q 3CCJA 1HJPA 3PO3G 1G6PA 2V1CC 2Y0SE 4MNOA 1EQQA 3U58A 4DK6C 2UUAL 2HHHL 2OQKA 4LWCA
chains in the Genus database with same CATH superfamily
4BY7G 4GKKL 3TN2A 3HOVG 4NB3A 1IL8A 2AMCB 2XIWA 4RCNA 1EUJA 1HH2P 5FLXc 5EPKA 4DR6Q 3S1NB 4B3RL 3NQIA 2F3IA 1IBML 2WAQB 1BBWA 2EZVA 3DWPA 1DONA 4NPSA 2MP1A 1O7YA 3ICEA 1LTID 3EFXD 1Y1VG 1LT6D 3I72A 4FP5D 4GS3A 2FJ2A 1Q46A 1B1ZA 1PH9A 3FEWX 3J81E 1WCMB 4PMCA 4C3JB 2MNAA 4BBRG 5M5WB 2RHSB 1X3PA 1TVXA 4I65A 1ZEQX 4JI5L 3PIPA 3CU7A 4A3DG 1N32Q 4LFCQ 1SAPA 1MI2A 4NW2A 1SJHD 4OIKA 2PZUA 2CH4A 1JOOA 2MQHA 4NXNL 4A3CH 1PDQA 1E2ZA 3JC66 2JA8B 4IUNA 4BBSH 4JI4L 4OO1I 3EBEA 1B7YB 1RL2A 2K4KA 3A8KE 4DV4Q 2P5ZX 4QQBX 2GA4B 4A76A 3TSSA 1F9RA 1VQGA 2Q8TA 3A7LA 3KLSA 4F7XA 4LF9Q 1O7IA 3FDTA 2VUMH 4JI8L 1S3OA 1VQJA 1K8GA 1KLUD 2B8GA 2ZT9C 1XNRL 1IW7C 1DOMA 3FMCA 4LFBQ 2UXBL 1V1PB 4EQPA 4DNIA 1I3QH 4K0KL 5G3LD 4X66Q 4A93G 2CW0C 4WRDA 1HA5A 2BH8A 3HOUB 4DKAC 1SROA 2JYOA 4GNXB 3GTLH 1MD2D 1QZHA 1TS3A 4J1MA 3K7AH 4DR3Q 2DNCA 1VQ7A 1FNVA 3S16H 1X54A 2WV6D 1EL0A 1GUSA 1VQIA 3TEHB 3ZJYC 1HUNA 4DXGA 2K75A 3P1HA 3GTPH 2F0NA 4KY6A 2KHIA 4FVMA 1TWFB 1J6QA 3BDLA 4KD4A 2N49A 1I4XA 1XYIA 3BVGA 3J7YW 1C48A 1SMYD 1CZWA 4WFN3 3P7JA 1CT1D 4RFBA 4TKOB 1SDFA 5CBAE 1T9HA 1R4PB 2WP8J 2K52A 4LF9L 3S17H 5C44G 2GVBA 3M4PA 1GOZA 1QOHA 1N9WA 2ZXOA 2AKWB 4GZYC 3GTKB 3D6CA 2XNAC 3NBIA 2E2HH 4BY1H 2R7ZH 3UDFA 4Q0FA 2UXDQ 1S5DD 5IT9c 3CAMA 3HGBA 2I5LX 4CDEC 1QUQB 3DMUA 2BOSA 2UUCQ 1EIFA 5C0XH 4R4IA 1Z47A 4K0KQ 5C4ZA 1NBWA 2D0PA 2PPBC 1LACA 4DAVA 1HZ9A 1F2YA 2B63G 1NCVA 3GO5A 1X32A 1CZGA 1ET9A 5BN4A 1XJVA 4JBKA 4PV1C 2F0QA 3H3VH 1U4MA 4LJZC 4LNQA 1V1OA 2KA7A 3CD6A 4KV6A 2CCZA 4NKLA 1TU2B 2JJQA 3PV0A 2I0QA 4JV5Q 1B50A 1SNOA 3HKSA 5ELCA 4K2LA 4K5XA 3S2DB 1W3SA 1PFNA 1PRTC 3J80c 2DJFC 3H0GG 2DUDA 4A3FG 3ULLA 5LMUL 2KOLA 3VR4A 5M3FB 4IFDI 3NUCA 4A3KB 1A3VA 2F0FA 4PZ6A 1HFGA 3R93A 3RZOH 4EQ5A 2E2IH 2J0TD 2XRQD 4F88A 1Q1EA 2F1MA 4DV1Q 2B3GA 4YY3L 4Q5VA 2JA7H 4ILWA 3PMFA 3T16A 2F3VA 3CHBD 5AFWA 2ZXPA 4P2CB 1SBBB 2PQAB 1SNDA 4BBRH 3T51B 1SJED 2Q2HA 4KI0A 4ODGA 4F87A 5JJZA 4YIJA 3MFGA 1X3QA 2WACA 3Q0AA 5GADC 2KUMA 3CRKC 3E9HA 3T56B 4DR1L 1PH8A 1NSNS 1K8OA 3NBHA 2EYFA 1S5BD 3QOLA 3CCSA 3L9AX 3A74A 1CSQA 4PZ7A 4MTNA 3CCUA 1PHJA 4YCUA 1QJOA 1K83B 1ML0D 1VQ9A 1XNQL 3KF6A 1KRTA 4JV5L 4C2MH 1KLGD 4JVZA 1L0YB 1PVOA 3PF4A 2N3SA 2L4NA 1D2BA 2CQAA 1JWSD 5FK9C 1YNJC 1GUWA 1F9SA 4FYDA 2JQOA 5M5YH 2L15A 1FGUA 4UHVA 3W1BA 3TP5A 2F0OA 5CMDA 1HZBA 1DZ1A 4P73A 4J8QA 1TY2A 1CKNA 2AWOA 1EYDA 2HIVA 4ALPA 4DNTB 1WFQA 2AQ3B 1KABA 2JA7G 3S14H 4J6HA 2BE5C 1J5EQ 2NZHA 2V4DA 1MJCA 1IYJB 4DV7L 2G9DA 3CC7A 1SNMA 1H95A 3MA2B 1LTLA 4A3KH 3K0YA 4EQNA 5LMUQ 5ISRA 1L0WA 1Y1VB 4JI4Q 4X64Q 2KVMA 3ULJA 4CDFC 5IODA 1JE5A 3I2ZA 4IUPA 4H44C 3M4QA 2IHFA 3FHWA 4RGNA 1KQSA 4DR4Q 4IJHA 1N34L 2F0TA 1KL9A 4A3EG 4IFDJ 5HY6A 3J7A5 3HOVH 4XQJA 2K5QA 2RCFA 3VR3A 1VQLA 3I4MH 3M7NA 2F4VQ 2NN6I 1E7ZA 1CFMA 4TVAB 3S15B 3D8GA 1I94L 4K5VA 3H0GH 4Y7NB 2F0UA 1JB7A 3CCEA 2C35B 2Z4HA 2NBFA 4HSVA 1ZYRD 4OX9Q 2JEBI 1TWHB 2KEDA 4GOPB 2EPBA 3E6ZX 3K6OA 1GD7A 1PZID 1J5EL 1OO9B 2IHEA 3TZDA 4G7HC 4YWLA 3W5OA 3S14B 1VMPA 2AUJD 4HEDA 1NTGA 3MWYW 2PQEA 3K5NA 2RA4A 3R3OA 5DM63 2QDBA 4X66L 3VR6A 3HOXH 2M00A 1A3TA 3UI2A 1XTCD 2RKSA 2XTIA 5LMNW 2RF4A 2Z6KC 4LAAA 1S5CD 2K5WA 5K36G 5IWAQ 1FL0A 1I6HB 2EQSA 4LUOA 1B9NA 1R9TB 4JI6L 5FO8B 4G57A 4GN4B 4FF2A 1AP0A 3PUWA 1BF4A 5IGBA 4IFDG 3TRZA 2HUGA 3OHXC 1PH6A 3IL8A 3UDGA 1TT2A 3GTLB 5LMNL 2A6EC 1DGSA 4A4IA 2JA6H 2MHVA 1JOQA 1VQCA 1TR5A 3I90A 4A3MB 4L5QA 2PZTA 3A54A 2F4VL 1EU3A 3HOUG 1SNCA 3CCRA 1L1OA 1FNUA 2SNSA 1HNZQ 2K28A 4O2DA 4JCVE 4L5RC 4APVA 4B3RQ 3F2DA 1NR2A 4LW1A 1N34Q 1GUTA 4UAIA 1FVIA 3BJUA 1Z9FA 2RHQB 2HCCA 4YHHL 2WIIB 3OIQA 5M5XH 2OTJA 2PI2E 4XIGS 1VQFA 1LABA 4PG3A 4AYBG 4JC0A 4ULLA 2RSOA 2E2IB 3W2DA 1XPUA 2PW5A 5IGGA 2B2WA 4M1UB 1QG7A 1S4ZA 3NTKA 1QUQA 4JBWA 1YHQA 5IYDG 1X9NA 2E2JB 3OMCA 2V1CC 2Y0SE 2B2VC 5C3WA 3K5LA 1LT3D 2I5HA 1PMRA 3F8TA 3VR5A 1PYBA 2XGTA 1DJRD 1JQYD 3PCOB 1PTOB 4N9TA 1QNUA 4K2KA 4B9WA 4HIDA 4XQQA 1V1QA 2EJFC 1EFWA 5I6YA 1YZ6A 1BBXC 2R93G 2WB1B 3M3YH 3K59A 1GUNA 1D1IA 3E0EA 4FXGC 1HNZL 5I6WA 3A7AB 1LT4D 1PV4A 2OT2A 3T1HQ 4A3LH 2F0MA 2SOBA 4HJ9A 4JI7L 3KF8B 4CDDC 1GHKA 4ID6A 2ZTDA 5AJ3Q 3LWEA 2Z6BA 4UP9A 2WAQG 3RMHA 3PSIA 2NVYB 4JI8Q 1G2TA 2AUKA 3A8JE 4CHTB 1O7ZA 5DEHA 4R9WA 4E6IA 1SNPA 4H02A 3J81i 2UUBQ 1TWCB 4OWTB 4FNFA 4L6TB 3GD7A 1HNWL 1ILQA 5D65A 1AN8A 4KHZA 3X3MA 3FVQA 4C1NI 1WTOA 2GVAA 5JJLA 5FLMG 1PTOC 4XTCS 3V2TA 4A3GH 5M3MH 1PH2A 1EZ6A 3A5UA 2J4XA 3DWQA 1L1OC 2MGSA 5ELBA 3M9BA 3AU7A 4LF5Q 1ICFB 1X3EA 2YTXA 1E24A 1NJIC 4R1JA 2JA9A 1DXMA 1VQNA 3EN2A 3PUYA 3GTOH 3MVVA 5C4XH 4F8MA 3S1RH 1Y8PB 3GTQB 1SE3A 4PQXA 1PZKD 4A3FB 4ZRZA 5C0XJ 2OTLA 2E2JH 4DV2Q 1EYAA 1EFID 2F52A 5EKLA 1WVLA 3RZOB 2EXDA 1A6XA 4POFA 3IFDA 1KDAA 3JAML 4A3EB 2EYLA 4FDBA 3EJIA 2NVYH 4DR4L 2QCPX 2ZXRA 1KDCA 1TWHH 2RBMA 4A3MH 2F0PA 5CYUA 1A8VA 1HR0Q 3DEPA 5CV4A 5GAHC 3H91A 2NVXH 1ESFA 1RJTA 4POGA 4IOCA 3MEHA 2SNMA 1X6OA 3QWNA 1E3PA 1SR3A 1EYGA 2BDNA 2QILA 4DV5L 4ZLTF 2JA5B 5IGFA 3E3XA 4DR6L 1RKNA 3E0JA 2XVSA 1AZQA 1VQ8A 3BYTB 2K04A 4JI5Q 1BCPB 1RTNA 1VQHA 1L2FA 3BU2A 2E75C 3I3CA 3PUZA 4GLAC 4GNXA 1WD0A 2Z9HA 1K0SA 4IPHA 5DAUA 2K01A 2NTTA 1KIXA 3OIPA 1EQVA 1BVSA 3MC0B 3QIAA 3J7AV 5IP7G 3OOCA 4JI0Q 2EY1A 2CWAA 4K6DA 2B2UA 1L0XB 2M9VA 1EY6A 3SE0A 2EYHA 3HOYB 3TDQA 2UXCQ 4R4QA 5HURA 3WOFA 3K0XA 1U5KA 1U4PA 1STEA 3H0GB 4PMWA 2N88A 3I73A 2E5LL 5EGTA 4I7AA 4R4CA 4DU9A 3TS0A 3GTPB 1IYUA 1K3RA 1M1KC 2R7DA 4C3IG 4CJ2C 3SK6A 3FKIH 4DV3Q 2CFMA 4G4KA 5LL6X 1EWCA 2UUAQ 2HCIA 1B44D 4C3HH 1PH3A 1VQDA 3KLRA 1G2SA 3HOUH 2IL8A 3A5ZB 4R8NA 4UY8C 1QWYA 2F0JA 2JE6I 5M3FH 3WDNA 1UE7A 1XNRQ 1CTMA 2YV5A 1U9RA 5IY0A 4A3GG 3QJYA 3KLWA 1TWCH 2JK8A 2F0DA 3NWSA 3OW2A 3HOWH 4OEMB 5C4JH 3RNUA 2Z0SA 4LUZA 1N36L 1B9MA 1R9TH 1Q1BA 1SXTA 1LO5D 5JJIA 5KIXA 1EWIA 1OXXK 1EU4A 1LV9A 4NDXA 1ONLA 1STGA 4DR2Q 1DCZA 1H9KA 2NN6H 2O2LD 4RMFA 4DR5Q 3NENA 1O80A 2L11A 3M7GA 4G7ZC 2F3WA 1JWUD 1XPOA 4DV5Q 4QJFA 5FLMH 2MFIA 3J80E 4NMZA 1RCVD 3SVMA 2OWOA 3C1EA 1BUVT 2WFWA 5EJWA 4DV0L 2LXJA 4ZYSA 1XPRA 4RHSA 2B39A 1DYQA 2F03A 1PFBA 3KOJA 5KYLA 1IBKQ 2G5DA 5DM73 3ERQA 4GKJL 4X3TA 1XMOL 1Q8KA 3D3RA 4RKBA 3Q24A 3J80L 4ZQ3A 3C1FA 1PTOD 4M8AA 2K5DA 4N8X1 4Y7NH 4IO9A 2CW0D 2DY8A 2EY2A 4FF4A 2Z4IA 1BXTA 4X64L 3U9SA 4KK7A 4C3HG 4YCWA 2B2WC 1VQOA 1JC7A 1AZPA 1VQPA 1F9QA 4GNXC 3HOZH 2JA7B 3H3VI 1TWFH 2DGYA 5CV6A 1IBMQ 5D14A 1YBYA 1L1OB 3HOZB 2LXKA 3DLLA 4Z9CB 3D31A 1YI2A 3NE5B 2F0EA 1TWAB 3CCMA 3MEFA 3S1NH 4EX5A 1PH4A 1WTXA 1UAPA 2IX3A 1DOLA 2ZM6Q 1A63A 1STHA 3PF5A 2ICIA 1MIUA 4TQUS 1MJEA 3VYTA 3D4WA 4EGVA 1K9MC 1Q8IA 3SK8A 5CBEE 4R4OA 4DK3C 3RZDH 3AFPA 3EA6A 5JEAH 3PIP3 1TKWB 4A3JG 5EBDA 3T1YL 1S40A 5IYDH 3NQTA 4OX9L 3I4NB 4WJWA 2ATWA 4JI3Q 3MAQA 1ZKOA 4L8JA 3VYUA 3OTOL 3HZXA 2RDHA 1P16A 2KQ3A 5IGDA 4LFCL 1PH7A 2R93B 1H9MA 3UE1A 4MIUA 2MO0A 1CK1A 3MXGA 4LF6L 5KEEA 2J7ZA 2K5NA 3MXNA 4KKSA 4QF4A 2D0OA 4IZ8A 1SYCA 4ZUIA 2EYJA 4C3IB 2PMZE 4X6AH 1ZXTA 1IBKL 1OXTA 4DN4M 4DNRB 3G48A 3KBGA 1ASYA 1RF2D 3D0FA 2VXWA 1C0AA 2L0CA 3PO3B 1QNKA 1YJWA 5HGTA 2XRSD 1IHZA 4U673 2K05A 3SGIA 1UE5A 1YJNA 1ENAA 5C5MA 1I50H 4DPGA 1VQAA 2OXPA 4WORA 1BO0A 3S2HH 3RD4A 1LTGD 4BA2I 2IY5B 1TY0A 4JOIA 2A74C 3A0JA 3BZDB 3J81c 3Q8DA 3CW2C 1HR0L 4MTKA 1Q90A 4PMBA 1FR3A 3GTKH 3CC2A 2LKVA 2R6GA 3TP8A 2EVBA 3CC4A 1A15A 3T1YQ 1BKBA 1RODA 3I4LA 4LF4L 1RDPD 2R92G 1CKOA 4AIMA 1OXSC 1YNNC 3PO2B 3ND9A 2A73B 2OF1A 5GROA 4S3SA 3J7AF 1EY9A 2C9OA 4HJAA 3Q6SA 4BBRB 4JBJA 1EIHA 4JI2L 2NWGA 1BCPC 2O5IC 5D3DA 1U4RA 4HSPA 1DD2A 2KCTA 1SLJA 1B3QA 4BY1B 1X3GA 2Y0SB 3FKIG 5BR8Q 2OEOA 4X65L 3ULPA 1B4OA 4IJLA 2RQXA 1Y14B 2X6LA 4JOIC 1VQKA 1KNEA 4HAEA 3MXPA 1JJGA 4IQZA 1N33L 2EY5A 3F2CA 1QVGA 3A8IE 1Y1VH 5GAEC 1WYDA 3RUZA 2LFNA 2Z8LA 3HOYH 2DNEA 2VQEQ 2AQ1B 3DHQA 2PNRC 3K58A 1TWGB 4KKTA 5JPNC 1BNZA 3S1RB 4CKBA 1STNA 4QY7A 5C4XB 1P8LA 1LM0A 4NXMQ 1SYDA 2OCEA 4YHHQ 4K6LA 4MHEA 4DV7Q 2PCFB 3I8ZA 2JA5H 2Y0SG 3FKIB 1SYBA 5IP9G 1HNXL 4KKUA 2HD3A 3QG1A 3GTQH 5C0XG 1IZ6A 5KNCA 4LF7Q 1HFNA 4KHPQ 4R4TA 4LF4Q 5M5YB 2F0LA 5E3FA 3PO3G 4RH6A 3BVMA 4JK1C 1LTTD 1VMCA 4DK6C 2K33A 4LWCA 5EPLA 2WAQE 3CPWA 4A3DB 1YJ9A 4B3SQ 2OQ0A 2A8VA 4DA2A 3C2PA 1I4QA 1MGSA 4J15A 1TS2A 1JE4A 1WTVA 2FMCA 1VQMA 4QUCA 3BZCA 3KF8A 2NB0A 1JR0D 3J80i 2VQEL 5ELFA 1H9SA 3QO2A 4KTAA 4DAPA 1QVFA 1Y69U 1N32L 2F4IA 1E1OA 2FXQA 3KUPA 3I55A 4HIMA 5CV8A 2KBNA 2VUMB 4PNYA 4K8IA 1A62A 2H4OA 5IIFA 2Z1CA 2H1EA 1RD9D 3BZKA 1W2BA 5IYBH 5C0XI 1Z6HA 1J8IA 5EKKA 1B70B 1M8AA 4DV2L 3RLOA 4RAUC 3KDFB 1V43A 4HJ8A 2KHJA 1PRTB 3PIOA 1E2WA 2ASBA 1D7QA 3N52A 2K7VA 1EY0A 1W6JA 4LUVA 5K36H 1SE4A 1D5MC 1NE3A 1V9PA 5IT9E 3SR1A 1IL2A 5ELEA 2LS01 3TMEA 1LTRD 5T1GA 1E22A 3GP7A 1KAAA 4B3SL 5GQOA 1HRJA 1XMOQ 3GV3A 5IYBG 2WB1E 1ENCA 3GTOB 3U4VA 4FF1A 1CHQD 3F2BA 4IFDH 2B63B 2K32A 2D5DA 3I4MG 4KD3A 2R61A 3KYHC 3NBHB 3DM1A 3ONAB 4DV4L 2B2VA 1LTAD 1I4RA 3H15A 2TSSA 2KCCA 1WI5A 3PGZA 3OTOQ 3JAME 5C3EG 1WTWA 4DK0A 3FRPB 4XYOA 3I4OA 3PUVA 3RN5A 1YHAA 3OW7A 1IKMA 2IX0A 1X65A 2X6GA 3QOJA 1IKLA 2EYMA 5I2XA 3S9WA 2FINB 3F2UA 5FLXE 3BDCA 3S1QB 1U0LA 1MSHA 4KY5A 1WCMH 1YNJD 4QGUA 3CQZB 4KMUC 3T53B 3KK7A 3KBXA 1CKMA 4O42A 1FYCA 2JA5G 1K83H 2SEBD 3VDYA 3A56A 1KRSA 3M4YA 4BS9A 2F0HA 3I4NH 1A2UA 2PO4A 1TWGH 2HIXA 5CR3A 3L2PA 4JW0A 2F0SA 2JA6B 4A3BG 5TSSA 4QB4A 1BR9A 4JI3L 3BYYB 2L55A 2JN4A 3MFYA 3OPOA 1B3AA 1CKNB 1EY4A 3EQLC 4DUYQ 5C3XA 1K3BC 1UEBA 5CC4A 5IYCH 4LF6Q 4OO1G 5J39A 2EJMA 5CV9A 3M3YB 2E5LQ 2VNUD 1YVCA 2CWPA 3K7AB 2PZWA 2QGQA 2B2TC 3L0OA 4IOAA 1HTLD 3HG9A 3IFTA 2EJGC 3ERSX 4XDXA 3NHHA 2B8FA 2YTYA 3NXWA 2NZOA 3KJPA 5FO7B 2AHOB 1N8RC 2IT1A 3HOYG 3TP7A 2R7FA 4LMQD 1ASZA 1BOSA 4QCLA 4OONA 2ZJPA 5I2YA 4KN4C 4LF8Q 3Q22A 5ELDA 4ME5A 5I9OA 2E8GA 1HNWQ 1PH1A 3GTGH 4OXPA 3J81L 1YITA 3URYA 3PIO3 1YIJA 4WJ3M 2XN9C 3GTJH 3EVQA 2Q2UA 3P20A 1GHJA 4A3CG 1S72A 4RGMA 2XWJB 3NELA 1SMYC 1KXLA 1AE3A 1XMQQ 2D62A 1G51A 4HR7B 3CMEA 1KTKA 5CGKA 1XXGA 4DFAA 3J81j 2FHTA 1UE6A 3HKZB 1I6HH 2G9HD 2L1BA 4FXDA 1STBA 2CH4W 4FO2A 3W3AA 2A69D 1N36Q 2NTSA 2A19A 5E7NA 5KRUA 2QW7A 4NXML 2NUCA 5K5PA 4C3IH 1TXYA 4HCEA 3BS1A 3TREA 1PRTF 5CORA 1WTPA 1SE2A 3OWFA 4B3ML 3EROA 4DV1L 5IP9H 2B2YC 5EKIA 5IWAL 4K5WA 1BCPD 4GOPA 5JEAJ 4IPGA 4EQOA 1DM0B 5CV7A 3I56A 1H9JA 3STBD 3ZYYX 5C3EB 2IJ0A 4GKJQ 3GTGB 3CCLA 2O5JC 2NZ1D 3HOXB 4ZKCB 5JOBA 3A55A 4B9XA 1D6EC 2Q2TA 2HT1A 5EAYA 4TSSA 2K5HA 2B2UC 3PO2H 1AEXA 1VQ6A 2QA4A 1UE1A 4HJ5A 3STBC 1MSGA 1YNND 4DAYB 5BN5A 2R92H 1IXRA 1VF7A 1BBUA 4P72A 4KHVA 4A3JH 4XT3B 4CBVA 4X62Q 2RCNA 1BCPF 3R2TA 1HQRD 2IW3A 4IPCA 1H9SB 4JG2A 5I9PA 4OIJA 4LFBL 2UXBQ 1GM5A 4DF7A 1PFSA 3KLSX 4DV3L 1VQ4A 1EIGA 3S2DH 3I7FA 2EOTA 3I4MB 4DR7L 2R7ZG 5C5LA 1X56A 1CA6A 3BDOA 3D6WA 4DV6L 4K14A 1WD1A 2WKCA 1MHWC 4IUTA 4JI0L 2LMCB 1PZJD 5DLQE 4JI1Q 1RTOA 1I50B 3TP6A 4A3BH 2D2CC 2ZJQA 1GVPA 1Y8OB 1SYGA 2VL6A 3VA7A 1QILA 4IUQA 3OSOA 3CPFA 3PQIA 3IAYA 1I4GA 1VF5C 1I94Q 1ILPA 5M5WH 4QIWE 3F1ZA 4LFAL 5E4WC 2UXDL 2PQAA 4OO1H 3KDFA 2ZJRA 4B3TQ 2PW7A 2QEXA 4ZUJA 1C4QA 4DUZL 2EXZA 2VS1A 2XSCA 3O13A 5AJ3L 3PO2G 1NY4A 1U4LA 3RR5A 3CQZH 2BA1A 1HUMA 3L7ZC 1SN8A 1QCBD 2Q8IB 1HA6A 2Q8RE 5KYIA 3D4RA 1R4QB 4JYAQ 1HHVA 3MTSA 2NYZD 3K8AA 4C56C 1T5XD 5BR8L 1UEAB 4X65Q 1A0IA 2UUBL 5JAVA 3RN2A 3FP9A 4Y52H 2QDLA 2YU9B 5T1IA 4GLVB 4XQNA 2B2YA 2RDGA 3S17B 5C6AA 4LF5L 5GAGC 5BN3A 3H94A 3UE0A 5C3EH 2PNHA 1G91A 1IW7D 1UNSA 1G291 2AWNA 3NK9A 1JMCA 2E2HB 1A2TA 5H1SE 4HJ7A 2QF7A 2Q2IA 4IN3A 3AB9A 2ALYB 2HDMA 4JI1L 2ZTEA 1KNAA 1Q3LA 1Y1WG 1VQEA 1Q7YC 5FO9B 1QE6A 2VUMG 5A35A 4CJ0B 1VQ5A 1II3A 1M4VA 5D3IB 4V190 3WOEA 3S1QH 4JBMA 4IPDA 3AFQA 4RG1A 1NUCA 2KCMA 3G6EA 1IBLQ 1HZCA 4ZAIA 4BA1I 5IE8A 1EEID 5C4XG 2ID0A 4KN7C 3SEBA 1LUZA 1FNWA 3GV6A 2ENBA 4NP5A 4BBSG 3MXUA 3UDIA 5IGCA 1JT8A 1GUOA 3DM3A 5LMNQ 1I5FA 1PTOH 3IRBA 3S1MB 3G4SA 1IYVA 3HOZG 4BY7B 3H3VC 4LFAQ 5EQ0A 2KECA 4U68A 3TBIB 2UU9Q 2DN8A 1J9OA 5J22A 1CQVA 4B3TL 2HQLA 4BY1G 4C3HB 4OWXB 2N78A 1NMFA 2EYPA 4LF7L 2VW9A 1ET6A 1EY7A 4H7BA 3CF5A 1EWHA 1F2LA 2F0GA 3V96A 5EPJA 3KFUA 4AQYQ 2VB3X 1EQTA 1KC8C 4UDUC 1LLRD 2VB2X 4DK1A 3HEJA 4JYAL 1GKHA 2KEEA 3CCJA 1HJPA 4MNOA 1EQQA 2MJ8A 5KGUA 1F2ZA 2BCOA 2UUAL 2HDLA 2OQKA 1Y1WH 1Q12A 4R8IA 4A3IG 3LWUA 3HFZB 4XT1B 3VYSA 1RIPA 4ZCKA 1D5ZC 2B29A 1OTCA 2JA8H 2KENA 3CP0A 4BBSB 3K5OA 2N55A 1TS4A 1LYLA 1K73C 2UXCL 2EDGA 1FJGQ 1OXVA 1HR0W 1KHIA 2A68D 4A3JB 4AH6A 4GLXA 2I07B 4RA8A 2L9HA 3IKJA 4RGTA 3NTHA 1WJJA 4XXEA 5NUCA 4GKKQ 1SYFA 2VQFL 5G3LF 4O1NA 1FD7D 5FLXL 1PH5A 2I5MX 3H09A 3WWVA 1LTBD 5M9OA 1M90C 1H9RA 1EY5A 3CCQA 4YCVA 1F2MA 3TQYA 4DAYA 2H5XA 3VA5A 1CA5A 3C3LA 4DV0Q 1C9OA 3I70A 1A3UA 5M3MB 2NVTH 4CJ1B 5JVH3 3KF6B 4GOPC 1JJ2A 4MN3A 4DR2L 2MO1A 2EY6A 4KY7A 5IGEA 3AMUA 5C44H 4BXXH 1I3QB 2IWHA 4WJ4A 4CKEA 1Y8NB 4CKCA 4OELB 3PUXA 1ICWA 1SYEA 2JXMB 3R2IA 2QKIC 1S5FD 2E2DC 1VDZA 4UPAA 5E1FA 3P75A 3RZDB 5FJ8H 4OWWB 4BWGB 3ER0A 2WB1G 1E0BA 1YEZA 3MHBA 3D4DA 3CMAA 4DXFA 1NR4A 1CQFA 1HZAA 1JORA 3VR2A 3X3NA 4A93B 5JVG3 2K50A 2PYKA 3DXJC 1HNXQ 2A6HC 3NTIA 3AEVA 1AFPA 3V05A 2M2LA 1KD1C 2DY7A 3HOVB 3CKIB 2A68C 1SFOH 3CXCA 4XYQA 1SSOA 5FOBB 1SEBD 4JPBW 3SHLA 5FJ8G 4HIKA 3GTJB 1TQOA 3I91A 1XNQQ 5C4HA 3HOXG 4KHPL 1QB5D 1EZ8A 3AQQA 4N8FA 3U50C 2N8NA 4O0AA 5HGQA 3HRZC 3HP3A 1AH9A 5ELOA 1QZGA 2GN5A 2L5TA 4ME3A 5M5XB 3HOWG 1XMQL 4A3IH 1PTOF 3M4OH 3DEOA 4P74A 2ZM6L 3LGJA 1D5XC 3RLFA 3QR8A 1JB3A 2A1AA 3K5MA 1PXUA 2I46A 2WINB 5ELNA 1UUPA 3NPPA 5A2QL 3GTMH 2NN6G 2IX1A 5FKAC 4FXKC 2ES2A 4RCOA 5JEAG 1F77A 1CUKA 2LSSA 1JICA 1W6KA 1C7YA 3LNNA 2CKZB 3SDZA 1T5EA 4DGZA 4RWSC 3HKZG 3CCVA 1OXUA 4RKLA 4YWMA 5M3FG 1JOKA 1AE2A 1UWVA 3U9OA 3MXNB 2XWBB 1CI3M 3N6RA 1WTRA 4KLKA 2HHHQ 2A69C 2F0WA 4BY7H 1C8CA 4A3DH 1SE8A 5EBCA 2LY7A 2VZAA 5C44B 3Q23A 3T1HL 2JA8G 3SXHA 2YYZA 4JI2Q 4IALA 4P75A 5IP7H 1WTQA 2R3ZA 4X3UA 4UP8A 4HMIA 3UDXA 4IURA 1STAA 5IT9L 1MBYA 2BA0A 3NP8A 2IPKD 3NSWA 1TS5A 1ZYRC 3S15H 1O7LA 1WCMG 1K8MA 1RHPA 4CDCC 5KNBA 2K5VA 4KJOA 2ICEC 2MPMA 1WOCA 1V1PA 4ZKBB 2JP1A 4LK1C 3SK5A 5E4XA 1O78A 5JPMC 5LHY1 3JAMi 2Z6KA 3G6JB 4A3KG 3K57A 3QB3A 4DUYL 2A5HA 3HOWB 5DNFA 2TMPA 4NXNQ 4A3LG 3U4ZA 3ND8A 4H0LC 1PLFA 2RSNA 3K7UC 3MZ5A 3ITPA 1HPCA 2ZTCA 2CQOA 4N9PA 5LL6S 1N33Q 2DJGC 1TWAH 4C3JG 4IUUA 4A3MG 1Z7TA 1AW7A 2UU9L 4UP7A 1G8ZD 1XX8A 2JSOA 2RVLA 4C1NK 1I6VC 2K03A 1S5ED 1X55A 1CSPA 3HKZE 5I4DA 4QMGA 1KDBA 4JI6Q 3G7LA 1HQMC 4QL5A 5CV5A 2YTVA 5IOCA 4OL7A 1YHBA 2FMMA 1FGBD 3JAMc 3EIVA 3S24A 4X3KA 3HS0C 1SRUA 3PO3H 1XWEA 2R7ZB 1I4HA 4DUZQ 2NVQB 1EOVA 2R92B 4MZ9A 4IUVA 2PI2A 2BH2A 1CHPD 3VYRA 1EEFD 3BG3A 1NMGA 2BE5D 2VY3A 2AQ2B 1JWMD 1LT5D 2K1BA 1Q86C 2NVQH 3H6MA 1EOTA 4HTHA 4DR3L 1E2VA 2HQEA 2VQFQ 1SMXA 3S2HB 4RHRA 4LF8L 1EYCA 1JCKB 1PYSB 2KJXA 1F9PA 4C2MB 1MKHA 3S1MH 2JA6G 4A3BB 3OMGA 4RGOS 2L12A 5J3BA 3KJOA 1K8AC 4TRDA 1BQQT 2QEJC 4I7ZC 1NNXA 1D1KA 1STYA 2PMZB 3B6YA 5M3MG 3RLNA 3DWAA 2E74C 2X69A 4ZK9B 1X3FA 1EIYB 3FPPA 3LX0A 3GQBA 4GN3B 2B2TA 3OWEB 1BDOA 4A3FH 1HTPA 2WKDA 1HCZA 2FFKB 2K14A 5F2DA 3DUZA 1GXDC 2A6ED 1XTDA 1KAWA 4HMJA 4V0BA 1EQRA 5A2QE 2O4XA 2CHBD 2BDOA 4K8JA 4G7OC 3E9IA 5IYCG 4B3MQ 1ENFA 1K0RA 3BVZA 3W1GA 4B08A 3S16B 1B8AA 2KCNA 4A75A 1GUGA 4GN5A 4A3GB 4HN7A 1Y1WB 3FPUB 4L5TA 5L37A 3G71A 1CM9A 1QVCA 3SK4A 4A3IB 3M4OB 1PYWD 4DAMA 2D9UA 1YNXA 1HXYD 1VS0A 1D8LA 3OYYA 2EE1A 2EYOA 3R8BA 1PA6A 1E1TA 4HCSA 2UUCL 4QIWB 3K80C 1GJXA 4A93H 4EVOA 4X3SA 2B63H 3L3OC 2F0VA 1WTHA 1Q81C 1ESRA 4ABNA 3K81C 1DOKA 4H13C 5JJKA 3M85A 2CVRA 4C3JH 4YY3Q 1PFMA 3AYHB 1V8QA 1IBLL 4PZ8A 3TZUA 1B2TA 4QUFA 4JI7Q 2K6AA 4BXXG 5C4JB 4A3EH 1I4PA 1TIID 1VCIA 2C5CA 1JJCB 2SDFA 3E5SA 1LTSD 2E76C 2A6HD 3NEMA 5COYA 4X62L 1GO3E 1PRTD 4HIOA 4L63B 3C46A 4P71A 1VQBA 2NVXB 2JEAI 5KNDA 4DV6Q 1G6ZA 3TS2A 4KJNA 4DR5L 2MUYA 3T4AC 4DR7Q 1NAPA 3NWTA 4AYBE 4FF3A 5J1ZA 3GTMB 3I4NG 4L5SA 1Q82C 4OHJA 4AQYL 3GDEA 2EIFA 3CRLC 4OGQC 3J7ZC 4AYBB 2F0KA 1B53A 4YWKA 2KHSA 2R93H 1FJGL 1K28A 2RDFA 1SFOB 2NVTB 4DR1Q 1G6PA 4CGYB 3T13A 3U58A 1EY8A 1SNQA 2HHHL 2F0IA 2YU9H
chains in the Genus database with same CATH topology
2I5HA 4BY7G 4GKKL 2WAQE 3HOVG 3F8TA 4NB3A 3CPWA 1PYBA 2XGTA 1YJ9A 1Q12A 2AMCB 4B3SQ 4A3IG 3HFZB 1EUJA 1HH2P 5FLXc 2OQ0A 1RIPA 3PCOB 2A8VA 3M4OH 2B29A 4DR6Q 4HIDA 1OTCA 2JA8H 2KENA 3CP0A 1V1QA 4J15A 1EFWA 4B3RL 1YZ6A 2F3IA 1IBML 1BBWA 1VQMA 2R93G 1LYLA 3BZCA 1K73C 3M3YH 3E0EA 2UXCL 3J80i 2VQEL 1HNZL 4NPSA 1FJGQ 1OXVA 3S17H 1PV4A 1QVFA 1HR0W 3T1HQ 3ICEA 1KHIA 4A3LH 1N32L 4HJ9A 1Y1VG 1E1OA 2FXQA 3I55A 4AH6A 4JI7L 3KF8B 4GLXA 4HIMA 4GS3A 2ZTDA 2KBNA 1Q46A 1WJJA 5AJ3Q 1PH9A 1A62A 2WAQG 4UP9A 3PSIA 4GKKQ 2VQFL 2MNAA 3BZKA 4BBRG 4JI8Q 1PH5A 1W2BA 2I5MX 5IYBH 1Y1WH 3WWVA 2RHSB 5C0XI 4H02A 1B70B 1M90C 4JI5L 3J81i 2UUBQ 4DV2L 3RLOA 4OWTB 3PIPA 3CCQA 4YCVA 4A3DG 3TQYA 3KDFB 4LFCQ 1N32Q 3GD7A 1V43A 2H5XA 4HJ8A 2KHJA 1HNWL 4DV0Q 2MQHA 4NXNL 4A3CH 1C9OA 4KHZA 3PIOA 3JC66 4BBSH 2ASBA 2NVTH 4JI4L 2GVAA 3KF6B 5JJLA 5FLMG 1D7QA 4XTCS 3EBEA 4OO1I 1B7YB 1RL2A 2K4KA 4LUVA 4GOPC 1JJ2A 1NE3A 1V9PA 5M3MH 4DR2L 1PH2A 1IL2A 4A3GH 3A5UA 2MO1A 4DV4Q 4QQBX 1L1OC 4A76A 3M9BA 5C44H 1E22A 1VQGA 4B3SL 5GQOA 4LF5Q 1X3EA 4BXXH 1XMOQ 1XNRL 4WJ4A 2YTXA 1E24A 5IYBG 2WB1E 4LF9Q 1O7IA 1NJIC 3PUXA 3U4VA 3F2BA 4JI8L 2VUMH 1S3OA 4R1JA 2JA9A 1VQJA 1K8GA 1VQNA 3I4MG 3EN2A 3KYHC 3PUYA 4UPAA 3NBHB 5C4XH 4DV4L 3S1RH 5FJ8H 4OWWB 3GTOH 4LFBQ 4DNIA 2UXBL 1I3QH 3H15A 3ER0A 2WB1G 4K0KL 1WI5A 1YEZA 3PGZA 3OTOQ 5C3EG 4X66Q 3CMAA 5C0XJ 2OTLA 2E2JH 4A93G 3I4OA 1HZAA 3PUVA 1YHAA 2F52A 4DV2Q 2BH8A 1X65A 2IX0A 3RN5A 2K50A 2EXDA 1HNXQ 4POFA 3AEVA 4DKAC 1SROA 4GNXB 3GTLH 1U0LA 1KD1C 4FDBA 1QZHA 2NVYH 3K7AH 4DR3Q 1WCMH 4DR4L 4QGUA 1VQ7A 1TWHH 3S16H 4A3MH 1X54A 1A8VA 1HR0Q 1SFOH 1VQIA 3TEHB 3ZJYC 3CXCA 2K75A 1CKMA 5GAHC 4HIKA 2JA5G 5FJ8G 3GTPH 1K83H 3VDYA 2NVXH 1KRSA 1XNQQ 2KHIA 3HOXG 3I4NH 1J6QA 4POGA 4IOCA 1TWGH 2HIXA 1X6OA 2N49A 4KHPL 1E3PA 3L2PA 1SR3A 1EYGA 4A3BG 3AQQA 4DV5L 4JI3L 3U50C 2N8NA 4O0AA 5HGQA 4DR6L 1CKNB 4DUYQ 1AH9A 1VQ8A 5ELOA 1QZGA 1T9HA 1UEBA 2WP8J 4JI5Q 2GN5A 5IYCH 4LF6Q 2K52A 4ME3A 4LF9L 3HOWG 1XMQL 4OO1G 4A3IH 1VQHA 5C44G 4P74A 2GVBA 3M4PA 1L2FA 3BU2A 3PUZA 2ZM6L 4GNXA 4GLAC 2E5LQ 1N9WA 3LGJA 2VNUD 3RLFA 1YVCA 2A1AA 2AKWB 2CWPA 4IPHA 5ELNA 2QGQA 3L0OA 2E2HH 4BY1H 2R7ZH 3GTMH 2NN6G 3UDFA 2IX1A 4IOAA 2UXDQ 2ES2A 3ERSX 5IT9c 1KIXA 3CAMA 5JEAG 2YTYA 1BVSA 2NZOA 3KJPA 1CUKA 2I5LX 2AHOB 2LSSA 1N8RC 2IT1A 1QUQB 3HOYG 5IP7G 2R7FA 1C7YA 1ASZA 2UUCQ 4JI0Q 2CWAA 1EIFA 4OONA 2CKZB 2ZJPA 4R4IA 1Z47A 4K0KQ 1NBWA 2D0PA 3HKZG 3CCVA 1OXUA 1HZ9A 2B63G 4LF8Q 3GO5A 1XJVA 4JBKA 4YWMA 2E8GA 4R4QA 2UXCQ 1HNWQ 5M3FG 1AE2A 1UWVA 1PH1A 3MXNB 3GTGH 3H3VH 4LNQA 3K0XA 4OXPA 3CD6A 1U5KA 4PMWA 2CCZA 2JJQA 3PV0A 4KLKA 2HHHQ 2I0QA 4BY7H 4JV5Q 3HKSA 1YITA 1YIJA 2E5LL 4WJ3M 4R4CA 3GTJH 3TS0A 4A3DH 1SE8A 1K3RA 2Q2UA 1M1KC 2R7DA 1W3SA 3FKIH 2VZAA 4A3CG 1S72A 3J80c 4DV3Q 2CFMA 3NELA 3T1HL 1KXLA 2JA8G 1AE3A 3H0GG 1XMQQ 2D62A 2DUDA 1G51A 2YYZA 4JI2Q 4P75A 3ULLA 3CMEA 4A3FG 5IP7H 2UUAQ 5LMUL 4C3HH 3J81j 1PH3A 1VQDA 4IFDI 4UP8A 3UDXA 3HOUH 1UE6A 3A5ZB 4UY8C 4PZ6A 1I6HH 3RZOH 2BA0A 4EQ5A 2JE6I 5M3FH 2E2IH 1UE7A 1XNRQ 2YV5A 1Q1EA 3S15H 5IY0A 4A3GG 4DV1Q 3KLWA 2B3GA 1WCMG 1TWCH 4YY3L 1N36Q 2JK8A 2K5VA 2A19A 5E7NA 2JA7H 3OW2A 1WOCA 4NXML 3HOWH 5C4JH 3RNUA 2Z0SA 4LUZA 4C3IH 1TXYA 2PQAB 1N36L 4BBRH 1Q1BA 3TREA 1R9TH 2Q2HA 4KI0A 5JJIA 3JAMi 1EWIA 1OXXK 2Z6KA 5GADC 4A3KG 4DR2Q 3E9HA 4B3ML 4RMFA 4DUYL 5IP9H 4DV1L 4DR5Q 3NENA 4DR1L 2YU9H 1PH8A 5IWAL 4NXNQ 3CCSA 3A74A 3U4ZA 4A3LG 4GOPA 5JEAJ 4IPGA 1CSQA 4DV5Q 4PZ7A 4QJFA 4MTNA 3CCUA 1XPOA 1PHJA 3K7UC 4YCUA 3I56A 5FLMH 2MFIA 2ZTCA 2CQOA 3STBD 1VQ9A 2OWOA 1XNQL 3KF6A 1N33Q 2WFWA 1TWAH 1KRTA 4DV0L 4GKJQ 4JV5L 2LXJA 4A3MG 4C2MH 3CCLA 1XPRA 2UU9L 4UP7A 3KOJA 1IBKQ 1PVOA 3PF4A 2Q2TA 2HT1A 2N3SA 5EAYA 4GKJL 1XMOL 2K5HA 1Q8KA 3PO2H 1X55A 1CSPA 3HKZE 1VQ6A 4JI6Q 2QA4A 1UE1A 2JQOA 2YTVA 4QL5A 3STBC 4HJ5A 5M5YH 2L15A 4Y7NH 1FGUA 4IO9A 4DAYB 1YHBA 3JAMc 1IXRA 4X64L 3EIVA 2R92H 1BBUA 4P72A 3S24A 4YCWA 3W1BA 1SRUA 4A3JH 4X62Q 2RCNA 1VQOA 1VQPA 3PO3H 4GNXC 4DUZQ 3HOZH 4IPCA 4JG2A 1EOVA 1HZBA 4LFBL 4P73A 3H3VI 2UXBQ 4MZ9A 1GM5A 2PI2A 1TWFH 2BH2A 2DGYA 1CKNA 1IBMQ 1NMGA 1PFSA 2AWOA 2HIVA 1YBYA 2VY3A 1L1OB 4DV3L 1Q86C 2LXKA 4ALPA 3DLLA 1VQ4A 1WFQA 3D31A 2NVQH 1YI2A 3S2DH 3I7FA 4DR3L 2JA7G 3S14H 4DR7L 2VQFQ 1SMXA 3CCMA 3MEFA 2R7ZG 1J5EQ 3S1NH 2NZHA 4EX5A 1MJCA 1IYJB 4DV7L 1PH4A 4LF8L 1X56A 3CC7A 2ZM6Q 1PYSB 1A63A 4DV6L 3PF5A 1K9MC 1MKHA 1MIUA 4TQUS 1MJEA 3S1MH 2JA6G 1H95A 4JI0L 1LTLA 4R4OA 4DK3C 4A3KH 3RZDH 5DLQE 3AFPA 4JI1Q 5LMUQ 5J3BA 3KJOA 4A3JG 1L0WA 5IYDH 3T1YL 1S40A 1K8AC 4A3BH 4JI4Q 4X64Q 1GVPA 2ZJQA 4OX9L 2ATWA 4JI3Q 2VL6A 3ULJA 3OTOL 1P16A 1JE5A 3CPFA 3I2ZA 3B6YA 3M4QA 4LFCL 1PH7A 2IHFA 3FHWA 3RLNA 5M3MG 5M5WH 1I94Q 1KQSA 4DR4Q 4QIWE 3F1ZA 4IJHA 3UE1A 1N34L 4LFAL 2UXDL 2MO0A 1KL9A 2PQAA 4LF6L 2K5NA 4A3EG 1X3FA 1EIYB 3KDFA 2ZJRA 5HY6A 4B3TQ 2QEXA 2D0OA 3J7A5 3HOVH 4IFDJ 4DUZL 4X6AH 2PMZE 4GN3B 2VS1A 1IBKL 1OXTA 4A3FH 5AJ3L 3PO2G 1VQLA 3I4MH 3G48A 3M7NA 1NY4A 2F4VQ 3RR5A 3CQZH 2BA1A 1E7ZA 2K14A 2NN6I 3L7ZC 4TVAB 1ASYA 1SN8A 3D0FA 1I94L 1C0AA 3H0GH 1JB7A 1XTDA 3CCEA 2C35B 1KAWA 1EQRA 1YJWA 4JYAQ 4OX9Q 2JEBI 3SGIA 1UE5A 3K8AA 4GOPB 1YJNA 3E9IA 5IYCG 5BR8L 1K0RA 4B3MQ 3W1GA 1I50H 4X65Q 4DPGA 1A0IA 1B8AA 1GD7A 1VQAA 4A75A 2UUBL 4GN5A 3RN2A 2IHEA 3FP9A 1J5EL 3S2HH 2IY5B 4BA2I 4Y52H 4YWLA 4L5TA 3W5OA 4JOIA 3A0JA 3G71A 3J81c 4GLVB 3Q8DA 3CW2C 1HR0L 1QVCA 1NTGA 4DAMA 3GTKH 4LF5L 1YNXA 1VS0A 5GAGC 3CC2A 1D8LA 2R6GA 3OYYA 3CC4A 4X66L 3UE0A 5C3EH 3T1YQ 2PNHA 1BKBA 3HOXH 1PA6A 1E1TA 2UUCL 4LF4L 1G291 2AWNA 2R92G 1CKOA 4AIMA 1OXSC 3K80C 5H1SE 1JMCA 4A93H 4HJ7A 2Q2IA 2XTIA 2B63H 5LMNW 5GROA 2ALYB 2RF4A 2Z6KC 4JI1L 2ZTEA 4HJAA 1Q81C 5IWAQ 1FL0A 5K36G 2EQSA 4LUOA 4JI6L 1Y1WG 4JBJA 3K81C 4JI2L 4GN4B 3PUWA 1VQEA 1Q7YC 5JJKA 3M85A 4C3JH 4YY3Q 2VUMG 4IFDG 3TRZA 3AYHB 1PH6A 1IBLL 4PZ8A 2KCTA 1SLJA 4JI7Q 1VQ5A 3UDGA 4BXXG 1X3GA 4A3EH 3S1QH 3FKIG 1VCIA 1DGSA 4IPDA 5LMNL 1JJCB 3AFQA 4RG1A 5BR8Q 4JBMA 2KCMA 4A4IA 3G6EA 1IBLQ 2JA6H 1HZCA 1VQCA 4X65L 3ULPA 4IJLA 4BA1I 1Y14B 4JOIC 1VQKA 5IE8A 3NEMA 1JJGA 4L5QA 1N33L 5C4XG 4X62L 1GO3E 2ID0A 3F2CA 4HIOA 1QVGA 1LUZA 2F4VL 3HOUG 1Y1VH 4P71A 3CCRA 5GAEC 1L1OA 1WYDA 4BBSG 1VQBA 3HOYH 2JEAI 2VQEQ 1HNZQ 3UDIA 1JT8A 4O2DA 3DM3A 4JCVE 4DV6Q 4L5RC 5LMNQ 3TS2A 4APVA 1I5FA 3IRBA 3G4SA 4QY7A 3HOZG 1P8LA 1LM0A 4DR5L 4B3RQ 3F2DA 4NXMQ 4DR7Q 4LW1A 4LFAQ 1N34Q 2OCEA 4YHHQ 4DV7Q 1FVIA 3BJUA 2UU9Q 4AYBE 1Z9FA 2JA5H 2Y0SG 4B3TL 2HQLA 2RHQB 4BY1G 4YHHL 4OWXB 3I4NG 2N78A 5IP9G 5M5XH 1HNXL 4L5SA 1NMFA 1Q82C 2OTJA 2PI2E 4XIGS 4AQYL 4LF7L 2VW9A 1VQFA 3GDEA 3CF5A 4PG3A 2EIFA 4AYBG 4JC0A 3J7ZC 3GTQH 4YWKA 5C0XG 1IZ6A 3KFUA 2R93H 1XPUA 1FJGL 4AQYQ 4LF7Q 1KC8C 4KHPQ 4R4TA 1QUQA 4JYAL 4JBWA 1YHQA 5IYDG 1X9NA 4LF4Q 1GKHA 4DR1Q 3CCJA 1HJPA 3PO3G 1G6PA 2V1CC 2Y0SE 4MNOA 1EQQA 3U58A 4DK6C 2UUAL 2HHHL 2OQKA 4LWCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I5H A;  4BY7 G;  4GKK L;  2WAQ E;  3HOV G;  3F8T A;  4NB3 A;  3CPW A;  1PYB A;  2XGT A;  1YJ9 A;  1Q12 A;  2AMC B;  4B3S Q;  4A3I G;  3HFZ B;  1EUJ A;  1HH2 P;  5FLX c;  2OQ0 A;  1RIP A;  3PCO B;  2A8V A;  3M4O H;  2B29 A;  4DR6 Q;  4HID A;  1OTC A;  2JA8 H;  2KEN A;  3CP0 A;  1V1Q A;  4J15 A;  1EFW A;  4B3R L;  1YZ6 A;  2F3I A;  1IBM L;  1BBW A;  1VQM A;  2R93 G;  1LYL A;  3BZC A;  1K73 C;  3M3Y H;  3E0E A;  2UXC L;  3J80 i;  2VQE L;  1HNZ L;  4NPS A;  1FJG Q;  1OXV A;  3S17 H;  1PV4 A;  1QVF A;  1HR0 W;  3T1H Q;  3ICE A;  1KHI A;  4A3L H;  1N32 L;  4HJ9 A;  1Y1V G;  1E1O A;  2FXQ A;  3I55 A;  4AH6 A;  4JI7 L;  3KF8 B;  4GLX A;  4HIM A;  4GS3 A;  2ZTD A;  2KBN A;  1Q46 A;  1WJJ A;  5AJ3 Q;  1PH9 A;  1A62 A;  2WAQ G;  4UP9 A;  3PSI A;  4GKK Q;  2VQF L;  2MNA A;  3BZK A;  4BBR G;  4JI8 Q;  1PH5 A;  1W2B A;  2I5M X;  5IYB H;  1Y1W H;  3WWV A;  2RHS B;  5C0X I;  4H02 A;  1B70 B;  1M90 C;  4JI5 L;  3J81 i;  2UUB Q;  4DV2 L;  3RLO A;  4OWT B;  3PIP A;  3CCQ A;  4YCV A;  4A3D G;  3TQY A;  3KDF B;  4LFC Q;  1N32 Q;  3GD7 A;  1V43 A;  2H5X A;  4HJ8 A;  2KHJ A;  1HNW L;  4DV0 Q;  2MQH A;  4NXN L;  4A3C H;  1C9O A;  4KHZ A;  3PIO A;  3JC6 6;  4BBS H;  2ASB A;  2NVT H;  4JI4 L;  2GVA A;  3KF6 B;  5JJL A;  5FLM G;  1D7Q A;  4XTC S;  3EBE A;  4OO1 I;  1B7Y B;  1RL2 A;  2K4K A;  4LUV A;  4GOP C;  1JJ2 A;  1NE3 A;  1V9P A;  5M3M H;  4DR2 L;  1PH2 A;  1IL2 A;  4A3G H;  3A5U A;  2MO1 A;  4DV4 Q;  4QQB X;  1L1O C;  4A76 A;  3M9B A;  5C44 H;  1E22 A;  1VQG A;  4B3S L;  5GQO A;  4LF5 Q;  1X3E A;  4BXX H;  1XMO Q;  1XNR L;  4WJ4 A;  2YTX A;  1E24 A;  5IYB G;  2WB1 E;  4LF9 Q;  1O7I A;  1NJI C;  3PUX A;  3U4V A;  3F2B A;  4JI8 L;  2VUM H;  1S3O A;  4R1J A;  2JA9 A;  1VQJ A;  1K8G A;  1VQN A;  3I4M G;  3EN2 A;  3KYH C;  3PUY A;  4UPA A;  3NBH B;  5C4X H;  4DV4 L;  3S1R H;  5FJ8 H;  4OWW B;  3GTO H;  4LFB Q;  4DNI A;  2UXB L;  1I3Q H;  3H15 A;  3ER0 A;  2WB1 G;  4K0K L;  1WI5 A;  1YEZ A;  3PGZ A;  3OTO Q;  5C3E G;  4X66 Q;  3CMA A;  5C0X J;  2OTL A;  2E2J H;  4A93 G;  3I4O A;  1HZA A;  3PUV A;  1YHA A;  2F52 A;  4DV2 Q;  2BH8 A;  1X65 A;  2IX0 A;  3RN5 A;  2K50 A;  2EXD A;  1HNX Q;  4POF A;  3AEV A;  4DKA C;  1SRO A;  4GNX B;  3GTL H;  1U0L A;  1KD1 C;  4FDB A;  1QZH A;  2NVY H;  3K7A H;  4DR3 Q;  1WCM H;  4DR4 L;  4QGU A;  1VQ7 A;  1TWH H;  3S16 H;  4A3M H;  1X54 A;  1A8V A;  1HR0 Q;  1SFO H;  1VQI A;  3TEH B;  3ZJY C;  3CXC A;  2K75 A;  1CKM A;  5GAH C;  4HIK A;  2JA5 G;  5FJ8 G;  3GTP H;  1K83 H;  3VDY A;  2NVX H;  1KRS A;  1XNQ Q;  2KHI A;  3HOX G;  3I4N H;  1J6Q A;  4POG A;  4IOC A;  1TWG H;  2HIX A;  1X6O A;  2N49 A;  4KHP L;  1E3P A;  3L2P A;  1SR3 A;  1EYG A;  4A3B G;  3AQQ A;  4DV5 L;  4JI3 L;  3U50 C;  2N8N A;  4O0A A;  5HGQ A;  4DR6 L;  1CKN B;  4DUY Q;  1AH9 A;  1VQ8 A;  5ELO A;  1QZG A;  1T9H A;  1UEB A;  2WP8 J;  4JI5 Q;  2GN5 A;  5IYC H;  4LF6 Q;  2K52 A;  4ME3 A;  4LF9 L;  3HOW G;  1XMQ L;  4OO1 G;  4A3I H;  1VQH A;  5C44 G;  4P74 A;  2GVB A;  3M4P A;  1L2F A;  3BU2 A;  3PUZ A;  2ZM6 L;  4GNX A;  4GLA C;  2E5L Q;  1N9W A;  3LGJ A;  2VNU D;  3RLF A;  1YVC A;  2A1A A;  2AKW B;  2CWP A;  4IPH A;  5ELN A;  2QGQ A;  3L0O A;  2E2H H;  4BY1 H;  2R7Z H;  3GTM H;  2NN6 G;  3UDF A;  2IX1 A;  4IOA A;  2UXD Q;  2ES2 A;  3ERS X;  5IT9 c;  1KIX A;  3CAM A;  5JEA G;  2YTY A;  1BVS A;  2NZO A;  3KJP A;  1CUK A;  2I5L X;  2AHO B;  2LSS A;  1N8R C;  2IT1 A;  1QUQ B;  3HOY G;  5IP7 G;  2R7F A;  1C7Y A;  1ASZ A;  2UUC Q;  4JI0 Q;  2CWA A;  1EIF A;  4OON A;  2CKZ B;  2ZJP A;  4R4I A;  1Z47 A;  4K0K Q;  1NBW A;  2D0P A;  3HKZ G;  3CCV A;  1OXU A;  1HZ9 A;  2B63 G;  4LF8 Q;  3GO5 A;  1XJV A;  4JBK A;  4YWM A;  2E8G A;  4R4Q A;  2UXC Q;  1HNW Q;  5M3F G;  1AE2 A;  1UWV A;  1PH1 A;  3MXN B;  3GTG H;  3H3V H;  4LNQ A;  3K0X A;  4OXP A;  3CD6 A;  1U5K A;  4PMW A;  2CCZ A;  2JJQ A;  3PV0 A;  4KLK A;  2HHH Q;  2I0Q A;  4BY7 H;  4JV5 Q;  3HKS A;  1YIT A;  1YIJ A;  2E5L L;  4WJ3 M;  4R4C A;  3GTJ H;  3TS0 A;  4A3D H;  1SE8 A;  1K3R A;  2Q2U A;  1M1K C;  2R7D A;  1W3S A;  3FKI H;  2VZA A;  4A3C G;  1S72 A;  3J80 c;  4DV3 Q;  2CFM A;  3NEL A;  3T1H L;  1KXL A;  2JA8 G;  1AE3 A;  3H0G G;  1XMQ Q;  2D62 A;  2DUD A;  1G51 A;  2YYZ A;  4JI2 Q;  4P75 A;  3ULL A;  3CME A;  4A3F G;  5IP7 H;  2UUA Q;  5LMU L;  4C3H H;  3J81 j;  1PH3 A;  1VQD A;  4IFD I;  4UP8 A;  3UDX A;  3HOU H;  1UE6 A;  3A5Z B;  4UY8 C;  4PZ6 A;  1I6H H;  3RZO H;  2BA0 A;  4EQ5 A;  2JE6 I;  5M3F H;  2E2I H;  1UE7 A;  1XNR Q;  2YV5 A;  1Q1E A;  3S15 H;  5IY0 A;  4A3G G;  4DV1 Q;  3KLW A;  2B3G A;  1WCM G;  1TWC H;  4YY3 L;  1N36 Q;  2JK8 A;  2K5V A;  2A19 A;  5E7N A;  2JA7 H;  3OW2 A;  1WOC A;  4NXM L;  3HOW H;  5C4J H;  3RNU A;  2Z0S A;  4LUZ A;  4C3I H;  1TXY A;  2PQA B;  1N36 L;  4BBR H;  1Q1B A;  3TRE A;  1R9T H;  2Q2H A;  4KI0 A;  5JJI A;  3JAM i;  1EWI A;  1OXX K;  2Z6K A;  5GAD C;  4A3K G;  4DR2 Q;  3E9H A;  4B3M L;  4RMF A;  4DUY L;  5IP9 H;  4DV1 L;  4DR5 Q;  3NEN A;  4DR1 L;  2YU9 H;  1PH8 A;  5IWA L;  4NXN Q;  3CCS A;  3A74 A;  3U4Z A;  4A3L G;  4GOP A;  5JEA J;  4IPG A;  1CSQ A;  4DV5 Q;  4PZ7 A;  4QJF A;  4MTN A;  3CCU A;  1XPO A;  1PHJ A;  3K7U C;  4YCU A;  3I56 A;  5FLM H;  2MFI A;  2ZTC A;  2CQO A;  3STB D;  1VQ9 A;  2OWO A;  1XNQ L;  3KF6 A;  1N33 Q;  2WFW A;  1TWA H;  1KRT A;  4DV0 L;  4GKJ Q;  4JV5 L;  2LXJ A;  4A3M G;  4C2M H;  3CCL A;  1XPR A;  2UU9 L;  4UP7 A;  3KOJ A;  1IBK Q;  1PVO A;  3PF4 A;  2Q2T A;  2HT1 A;  2N3S A;  5EAY A;  4GKJ L;  1XMO L;  2K5H A;  1Q8K A;  3PO2 H;  1X55 A;  1CSP A;  3HKZ E;  1VQ6 A;  4JI6 Q;  2QA4 A;  1UE1 A;  2JQO A;  2YTV A;  4QL5 A;  3STB C;  4HJ5 A;  5M5Y H;  2L15 A;  4Y7N H;  1FGU A;  4IO9 A;  4DAY B;  1YHB A;  3JAM c;  1IXR A;  4X64 L;  3EIV A;  2R92 H;  1BBU A;  4P72 A;  3S24 A;  4YCW A;  3W1B A;  1SRU A;  4A3J H;  4X62 Q;  2RCN A;  1VQO A;  1VQP A;  3PO3 H;  4GNX C;  4DUZ Q;  3HOZ H;  4IPC A;  4JG2 A;  1EOV A;  1HZB A;  4LFB L;  4P73 A;  3H3V I;  2UXB Q;  4MZ9 A;  1GM5 A;  2PI2 A;  1TWF H;  2BH2 A;  2DGY A;  1CKN A;  1IBM Q;  1NMG A;  1PFS A;  2AWO A;  2HIV A;  1YBY A;  2VY3 A;  1L1O B;  4DV3 L;  1Q86 C;  2LXK A;  4ALP A;  3DLL A;  1VQ4 A;  1WFQ A;  3D31 A;  2NVQ H;  1YI2 A;  3S2D H;  3I7F A;  4DR3 L;  2JA7 G;  3S14 H;  4DR7 L;  2VQF Q;  1SMX A;  3CCM A;  3MEF A;  2R7Z G;  1J5E Q;  3S1N H;  2NZH A;  4EX5 A;  1MJC A;  1IYJ B;  4DV7 L;  1PH4 A;  4LF8 L;  1X56 A;  3CC7 A;  2ZM6 Q;  1PYS B;  1A63 A;  4DV6 L;  3PF5 A;  1K9M C;  1MKH A;  1MIU A;  4TQU S;  1MJE A;  3S1M H;  2JA6 G;  1H95 A;  4JI0 L;  1LTL A;  4R4O A;  4DK3 C;  4A3K H;  3RZD H;  5DLQ E;  3AFP A;  4JI1 Q;  5LMU Q;  5J3B A;  3KJO A;  4A3J G;  1L0W A;  5IYD H;  3T1Y L;  1S40 A;  1K8A C;  4A3B H;  4JI4 Q;  4X64 Q;  1GVP A;  2ZJQ A;  4OX9 L;  2ATW A;  4JI3 Q;  2VL6 A;  3ULJ A;  3OTO L;  1P16 A;  1JE5 A;  3CPF A;  3I2Z A;  3B6Y A;  3M4Q A;  4LFC L;  1PH7 A;  2IHF A;  3FHW A;  3RLN A;  5M3M G;  5M5W H;  1I94 Q;  1KQS A;  4DR4 Q;  4QIW E;  3F1Z A;  4IJH A;  3UE1 A;  1N34 L;  4LFA L;  2UXD L;  2MO0 A;  1KL9 A;  2PQA A;  4LF6 L;  2K5N A;  4A3E G;  1X3F A;  1EIY B;  3KDF A;  2ZJR A;  5HY6 A;  4B3T Q;  2QEX A;  2D0O A;  3J7A 5;  3HOV H;  4IFD J;  4DUZ L;  4X6A H;  2PMZ E;  4GN3 B;  2VS1 A;  1IBK L;  1OXT A;  4A3F H;  5AJ3 L;  3PO2 G;  1VQL A;  3I4M H;  3G48 A;  3M7N A;  1NY4 A;  2F4V Q;  3RR5 A;  3CQZ H;  2BA1 A;  1E7Z A;  2K14 A;  2NN6 I;  3L7Z C;  4TVA B;  1ASY A;  1SN8 A;  3D0F A;  1I94 L;  1C0A A;  3H0G H;  1JB7 A;  1XTD A;  3CCE A;  2C35 B;  1KAW A;  1EQR A;  1YJW A;  4JYA Q;  4OX9 Q;  2JEB I;  3SGI A;  1UE5 A;  3K8A A;  4GOP B;  1YJN A;  3E9I A;  5IYC G;  5BR8 L;  1K0R A;  4B3M Q;  3W1G A;  1I50 H;  4X65 Q;  4DPG A;  1A0I A;  1B8A A;  1GD7 A;  1VQA A;  4A75 A;  2UUB L;  4GN5 A;  3RN2 A;  2IHE A;  3FP9 A;  1J5E L;  3S2H H;  2IY5 B;  4BA2 I;  4Y52 H;  4YWL A;  4L5T A;  3W5O A;  4JOI A;  3A0J A;  3G71 A;  3J81 c;  4GLV B;  3Q8D A;  3CW2 C;  1HR0 L;  1QVC A;  1NTG A;  4DAM A;  3GTK H;  4LF5 L;  1YNX A;  1VS0 A;  5GAG C;  3CC2 A;  1D8L A;  2R6G A;  3OYY A;  3CC4 A;  4X66 L;  3UE0 A;  5C3E H;  3T1Y Q;  2PNH A;  1BKB A;  3HOX H;  1PA6 A;  1E1T A;  2UUC L;  4LF4 L;  1G29 1;  2AWN A;  2R92 G;  1CKO A;  4AIM A;  1OXS C;  3K80 C;  5H1S E;  1JMC A;  4A93 H;  4HJ7 A;  2Q2I A;  2XTI A;  2B63 H;  5LMN W;  5GRO A;  2ALY B;  2RF4 A;  2Z6K C;  4JI1 L;  2ZTE A;  4HJA A;  1Q81 C;  5IWA Q;  1FL0 A;  5K36 G;  2EQS A;  4LUO A;  4JI6 L;  1Y1W G;  4JBJ A;  3K81 C;  4JI2 L;  4GN4 B;  3PUW A;  1VQE A;  1Q7Y C;  5JJK A;  3M85 A;  4C3J H;  4YY3 Q;  2VUM G;  4IFD G;  3TRZ A;  3AYH B;  1PH6 A;  1IBL L;  4PZ8 A;  2KCT A;  1SLJ A;  4JI7 Q;  1VQ5 A;  3UDG A;  4BXX G;  1X3G A;  4A3E H;  3S1Q H;  3FKI G;  1VCI A;  1DGS A;  4IPD A;  5LMN L;  1JJC B;  3AFQ A;  4RG1 A;  5BR8 Q;  4JBM A;  2KCM A;  4A4I A;  3G6E A;  1IBL Q;  2JA6 H;  1HZC A;  1VQC A;  4X65 L;  3ULP A;  4IJL A;  4BA1 I;  1Y14 B;  4JOI C;  1VQK A;  5IE8 A;  3NEM A;  1JJG A;  4L5Q A;  1N33 L;  5C4X G;  4X62 L;  1GO3 E;  2ID0 A;  3F2C A;  4HIO A;  1QVG A;  1LUZ A;  2F4V L;  3HOU G;  1Y1V H;  4P71 A;  3CCR A;  5GAE C;  1L1O A;  1WYD A;  4BBS G;  1VQB A;  3HOY H;  2JEA I;  2VQE Q;  1HNZ Q;  3UDI A;  1JT8 A;  4O2D A;  3DM3 A;  4JCV E;  4DV6 Q;  4L5R C;  5LMN Q;  3TS2 A;  4APV A;  1I5F A;  3IRB A;  3G4S A;  4QY7 A;  3HOZ G;  1P8L A;  1LM0 A;  4DR5 L;  4B3R Q;  3F2D A;  4NXM Q;  4DR7 Q;  4LW1 A;  4LFA Q;  1N34 Q;  2OCE A;  4YHH Q;  4DV7 Q;  1FVI A;  3BJU A;  2UU9 Q;  4AYB E;  1Z9F A;  2JA5 H;  2Y0S G;  4B3T L;  2HQL A;  2RHQ B;  4BY1 G;  4YHH L;  4OWX B;  3I4N G;  2N78 A;  5IP9 G;  5M5X H;  1HNX L;  4L5S A;  1NMF A;  1Q82 C;  2OTJ A;  2PI2 E;  4XIG S;  4AQY L;  4LF7 L;  2VW9 A;  1VQF A;  3GDE A;  3CF5 A;  4PG3 A;  2EIF A;  4AYB G;  4JC0 A;  3J7Z C;  3GTQ H;  4YWK A;  5C0X G;  1IZ6 A;  3KFU A;  2R93 H;  1XPU A;  1FJG L;  4AQY Q;  4LF7 Q;  1KC8 C;  4KHP Q;  4R4T A;  1QUQ A;  4JYA L;  4JBW A;  1YHQ A;  5IYD G;  1X9N A;  4LF4 Q;  1GKH A;  4DR1 Q;  3CCJ A;  1HJP A;  3PO3 G;  1G6P A;  2V1C C;  2Y0S E;  4MNO A;  1EQQ A;  3U58 A;  4DK6 C;  2UUA L;  2HHH L;  2OQK A;  4LWC A; 
#chains in the Genus database with same CATH topology
 4BY7 G;  4GKK L;  3TN2 A;  3HOV G;  4NB3 A;  1IL8 A;  2AMC B;  2XIW A;  4RCN A;  1EUJ A;  1HH2 P;  5FLX c;  5EPK A;  4DR6 Q;  3S1N B;  4B3R L;  3NQI A;  2F3I A;  1IBM L;  2WAQ B;  1BBW A;  2EZV A;  3DWP A;  1DON A;  4NPS A;  2MP1 A;  1O7Y A;  3ICE A;  1LTI D;  3EFX D;  1Y1V G;  1LT6 D;  3I72 A;  4FP5 D;  4GS3 A;  2FJ2 A;  1Q46 A;  1B1Z A;  1PH9 A;  3FEW X;  3J81 E;  1WCM B;  4PMC A;  4C3J B;  2MNA A;  4BBR G;  5M5W B;  2RHS B;  1X3P A;  1TVX A;  4I65 A;  1ZEQ X;  4JI5 L;  3PIP A;  3CU7 A;  4A3D G;  1N32 Q;  4LFC Q;  1SAP A;  1MI2 A;  4NW2 A;  1SJH D;  4OIK A;  2PZU A;  2CH4 A;  1JOO A;  2MQH A;  4NXN L;  4A3C H;  1PDQ A;  1E2Z A;  3JC6 6;  2JA8 B;  4IUN A;  4BBS H;  4JI4 L;  4OO1 I;  3EBE A;  1B7Y B;  1RL2 A;  2K4K A;  3A8K E;  4DV4 Q;  2P5Z X;  4QQB X;  2GA4 B;  4A76 A;  3TSS A;  1F9R A;  1VQG A;  2Q8T A;  3A7L A;  3KLS A;  4F7X A;  4LF9 Q;  1O7I A;  3FDT A;  2VUM H;  4JI8 L;  1S3O A;  1VQJ A;  1K8G A;  1KLU D;  2B8G A;  2ZT9 C;  1XNR L;  1IW7 C;  1DOM A;  3FMC A;  4LFB Q;  2UXB L;  1V1P B;  4EQP A;  4DNI A;  1I3Q H;  4K0K L;  5G3L D;  4X66 Q;  4A93 G;  2CW0 C;  4WRD A;  1HA5 A;  2BH8 A;  3HOU B;  4DKA C;  1SRO A;  2JYO A;  4GNX B;  3GTL H;  1MD2 D;  1QZH A;  1TS3 A;  4J1M A;  3K7A H;  4DR3 Q;  2DNC A;  1VQ7 A;  1FNV A;  3S16 H;  1X54 A;  2WV6 D;  1EL0 A;  1GUS A;  1VQI A;  3TEH B;  3ZJY C;  1HUN A;  4DXG A;  2K75 A;  3P1H A;  3GTP H;  2F0N A;  4KY6 A;  2KHI A;  4FVM A;  1TWF B;  1J6Q A;  3BDL A;  4KD4 A;  2N49 A;  1I4X A;  1XYI A;  3BVG A;  3J7Y W;  1C48 A;  1SMY D;  1CZW A;  4WFN 3;  3P7J A;  1CT1 D;  4RFB A;  4TKO B;  1SDF A;  5CBA E;  1T9H A;  1R4P B;  2WP8 J;  2K52 A;  4LF9 L;  3S17 H;  5C44 G;  2GVB A;  3M4P A;  1GOZ A;  1QOH A;  1N9W A;  2ZXO A;  2AKW B;  4GZY C;  3GTK B;  3D6C A;  2XNA C;  3NBI A;  2E2H H;  4BY1 H;  2R7Z H;  3UDF A;  4Q0F A;  2UXD Q;  1S5D D;  5IT9 c;  3CAM A;  3HGB A;  2I5L X;  4CDE C;  1QUQ B;  3DMU A;  2BOS A;  2UUC Q;  1EIF A;  5C0X H;  4R4I A;  1Z47 A;  4K0K Q;  5C4Z A;  1NBW A;  2D0P A;  2PPB C;  1LAC A;  4DAV A;  1HZ9 A;  1F2Y A;  2B63 G;  1NCV A;  3GO5 A;  1X32 A;  1CZG A;  1ET9 A;  5BN4 A;  1XJV A;  4JBK A;  4PV1 C;  2F0Q A;  3H3V H;  1U4M A;  4LJZ C;  4LNQ A;  1V1O A;  2KA7 A;  3CD6 A;  4KV6 A;  2CCZ A;  4NKL A;  1TU2 B;  2JJQ A;  3PV0 A;  2I0Q A;  4JV5 Q;  1B50 A;  1SNO A;  3HKS A;  5ELC A;  4K2L A;  4K5X A;  3S2D B;  1W3S A;  1PFN A;  1PRT C;  3J80 c;  2DJF C;  3H0G G;  2DUD A;  4A3F G;  3ULL A;  5LMU L;  2KOL A;  3VR4 A;  5M3F B;  4IFD I;  3NUC A;  4A3K B;  1A3V A;  2F0F A;  4PZ6 A;  1HFG A;  3R93 A;  3RZO H;  4EQ5 A;  2E2I H;  2J0T D;  2XRQ D;  4F88 A;  1Q1E A;  2F1M A;  4DV1 Q;  2B3G A;  4YY3 L;  4Q5V A;  2JA7 H;  4ILW A;  3PMF A;  3T16 A;  2F3V A;  3CHB D;  5AFW A;  2ZXP A;  4P2C B;  1SBB B;  2PQA B;  1SND A;  4BBR H;  3T51 B;  1SJE D;  2Q2H A;  4KI0 A;  4ODG A;  4F87 A;  5JJZ A;  4YIJ A;  3MFG A;  1X3Q A;  2WAC A;  3Q0A A;  5GAD C;  2KUM A;  3CRK C;  3E9H A;  3T56 B;  4DR1 L;  1PH8 A;  1NSN S;  1K8O A;  3NBH A;  2EYF A;  1S5B D;  3QOL A;  3CCS A;  3L9A X;  3A74 A;  1CSQ A;  4PZ7 A;  4MTN A;  3CCU A;  1PHJ A;  4YCU A;  1QJO A;  1K83 B;  1ML0 D;  1VQ9 A;  1XNQ L;  3KF6 A;  1KRT A;  4JV5 L;  4C2M H;  1KLG D;  4JVZ A;  1L0Y B;  1PVO A;  3PF4 A;  2N3S A;  2L4N A;  1D2B A;  2CQA A;  1JWS D;  5FK9 C;  1YNJ C;  1GUW A;  1F9S A;  4FYD A;  2JQO A;  5M5Y H;  2L15 A;  1FGU A;  4UHV A;  3W1B A;  3TP5 A;  2F0O A;  5CMD A;  1HZB A;  1DZ1 A;  4P73 A;  4J8Q A;  1TY2 A;  1CKN A;  2AWO A;  1EYD A;  2HIV A;  4ALP A;  4DNT B;  1WFQ A;  2AQ3 B;  1KAB A;  2JA7 G;  3S14 H;  4J6H A;  2BE5 C;  1J5E Q;  2NZH A;  2V4D A;  1MJC A;  1IYJ B;  4DV7 L;  2G9D A;  3CC7 A;  1SNM A;  1H95 A;  3MA2 B;  1LTL A;  4A3K H;  3K0Y A;  4EQN A;  5LMU Q;  5ISR A;  1L0W A;  1Y1V B;  4JI4 Q;  4X64 Q;  2KVM A;  3ULJ A;  4CDF C;  5IOD A;  1JE5 A;  3I2Z A;  4IUP A;  4H44 C;  3M4Q A;  2IHF A;  3FHW A;  4RGN A;  1KQS A;  4DR4 Q;  4IJH A;  1N34 L;  2F0T A;  1KL9 A;  4A3E G;  4IFD J;  5HY6 A;  3J7A 5;  3HOV H;  4XQJ A;  2K5Q A;  2RCF A;  3VR3 A;  1VQL A;  3I4M H;  3M7N A;  2F4V Q;  2NN6 I;  1E7Z A;  1CFM A;  4TVA B;  3S15 B;  3D8G A;  1I94 L;  4K5V A;  3H0G H;  4Y7N B;  2F0U A;  1JB7 A;  3CCE A;  2C35 B;  2Z4H A;  2NBF A;  4HSV A;  1ZYR D;  4OX9 Q;  2JEB I;  1TWH B;  2KED A;  4GOP B;  2EPB A;  3E6Z X;  3K6O A;  1GD7 A;  1PZI D;  1J5E L;  1OO9 B;  2IHE A;  3TZD A;  4G7H C;  4YWL A;  3W5O A;  3S14 B;  1VMP A;  2AUJ D;  4HED A;  1NTG A;  3MWY W;  2PQE A;  3K5N A;  2RA4 A;  3R3O A;  5DM6 3;  2QDB A;  4X66 L;  3VR6 A;  3HOX H;  2M00 A;  1A3T A;  3UI2 A;  1XTC D;  2RKS A;  2XTI A;  5LMN W;  2RF4 A;  2Z6K C;  4LAA A;  1S5C D;  2K5W A;  5K36 G;  5IWA Q;  1FL0 A;  1I6H B;  2EQS A;  4LUO A;  1B9N A;  1R9T B;  4JI6 L;  5FO8 B;  4G57 A;  4GN4 B;  4FF2 A;  1AP0 A;  3PUW A;  1BF4 A;  5IGB A;  4IFD G;  3TRZ A;  2HUG A;  3OHX C;  1PH6 A;  3IL8 A;  3UDG A;  1TT2 A;  3GTL B;  5LMN L;  2A6E C;  1DGS A;  4A4I A;  2JA6 H;  2MHV A;  1JOQ A;  1VQC A;  1TR5 A;  3I90 A;  4A3M B;  4L5Q A;  2PZT A;  3A54 A;  2F4V L;  1EU3 A;  3HOU G;  1SNC A;  3CCR A;  1L1O A;  1FNU A;  2SNS A;  1HNZ Q;  2K28 A;  4O2D A;  4JCV E;  4L5R C;  4APV A;  4B3R Q;  3F2D A;  1NR2 A;  4LW1 A;  1N34 Q;  1GUT A;  4UAI A;  1FVI A;  3BJU A;  1Z9F A;  2RHQ B;  2HCC A;  4YHH L;  2WII B;  3OIQ A;  5M5X H;  2OTJ A;  2PI2 E;  4XIG S;  1VQF A;  1LAB A;  4PG3 A;  4AYB G;  4JC0 A;  4ULL A;  2RSO A;  2E2I B;  3W2D A;  1XPU A;  2PW5 A;  5IGG A;  2B2W A;  4M1U B;  1QG7 A;  1S4Z A;  3NTK A;  1QUQ A;  4JBW A;  1YHQ A;  5IYD G;  1X9N A;  2E2J B;  3OMC A;  2V1C C;  2Y0S E;  2B2V C;  5C3W A;  3K5L A;  1LT3 D;  2I5H A;  1PMR A;  3F8T A;  3VR5 A;  1PYB A;  2XGT A;  1DJR D;  1JQY D;  3PCO B;  1PTO B;  4N9T A;  1QNU A;  4K2K A;  4B9W A;  4HID A;  4XQQ A;  1V1Q A;  2EJF C;  1EFW A;  5I6Y A;  1YZ6 A;  1BBX C;  2R93 G;  2WB1 B;  3M3Y H;  3K59 A;  1GUN A;  1D1I A;  3E0E A;  4FXG C;  1HNZ L;  5I6W A;  3A7A B;  1LT4 D;  1PV4 A;  2OT2 A;  3T1H Q;  4A3L H;  2F0M A;  2SOB A;  4HJ9 A;  4JI7 L;  3KF8 B;  4CDD C;  1GHK A;  4ID6 A;  2ZTD A;  5AJ3 Q;  3LWE A;  2Z6B A;  4UP9 A;  2WAQ G;  3RMH A;  3PSI A;  2NVY B;  4JI8 Q;  1G2T A;  2AUK A;  3A8J E;  4CHT B;  1O7Z A;  5DEH A;  4R9W A;  4E6I A;  1SNP A;  4H02 A;  3J81 i;  2UUB Q;  1TWC B;  4OWT B;  4FNF A;  4L6T B;  3GD7 A;  1HNW L;  1ILQ A;  5D65 A;  1AN8 A;  4KHZ A;  3X3M A;  3FVQ A;  4C1N I;  1WTO A;  2GVA A;  5JJL A;  5FLM G;  1PTO C;  4XTC S;  3V2T A;  4A3G H;  5M3M H;  1PH2 A;  1EZ6 A;  3A5U A;  2J4X A;  3DWQ A;  1L1O C;  2MGS A;  5ELB A;  3M9B A;  3AU7 A;  4LF5 Q;  1ICF B;  1X3E A;  2YTX A;  1E24 A;  1NJI C;  4R1J A;  2JA9 A;  1DXM A;  1VQN A;  3EN2 A;  3PUY A;  3GTO H;  3MVV A;  5C4X H;  4F8M A;  3S1R H;  1Y8P B;  3GTQ B;  1SE3 A;  4PQX A;  1PZK D;  4A3F B;  4ZRZ A;  5C0X J;  2OTL A;  2E2J H;  4DV2 Q;  1EYA A;  1EFI D;  2F52 A;  5EKL A;  1WVL A;  3RZO B;  2EXD A;  1A6X A;  4POF A;  3IFD A;  1KDA A;  3JAM L;  4A3E B;  2EYL A;  4FDB A;  3EJI A;  2NVY H;  4DR4 L;  2QCP X;  2ZXR A;  1KDC A;  1TWH H;  2RBM A;  4A3M H;  2F0P A;  5CYU A;  1A8V A;  1HR0 Q;  3DEP A;  5CV4 A;  5GAH C;  3H91 A;  2NVX H;  1ESF A;  1RJT A;  4POG A;  4IOC A;  3MEH A;  2SNM A;  1X6O A;  3QWN A;  1E3P A;  1SR3 A;  1EYG A;  2BDN A;  2QIL A;  4DV5 L;  4ZLT F;  2JA5 B;  5IGF A;  3E3X A;  4DR6 L;  1RKN A;  3E0J A;  2XVS A;  1AZQ A;  1VQ8 A;  3BYT B;  2K04 A;  4JI5 Q;  1BCP B;  1RTN A;  1VQH A;  1L2F A;  3BU2 A;  2E75 C;  3I3C A;  3PUZ A;  4GLA C;  4GNX A;  1WD0 A;  2Z9H A;  1K0S A;  4IPH A;  5DAU A;  2K01 A;  2NTT A;  1KIX A;  3OIP A;  1EQV A;  1BVS A;  3MC0 B;  3QIA A;  3J7A V;  5IP7 G;  3OOC A;  4JI0 Q;  2EY1 A;  2CWA A;  4K6D A;  2B2U A;  1L0X B;  2M9V A;  1EY6 A;  3SE0 A;  2EYH A;  3HOY B;  3TDQ A;  2UXC Q;  4R4Q A;  5HUR A;  3WOF A;  3K0X A;  1U5K A;  1U4P A;  1STE A;  3H0G B;  4PMW A;  2N88 A;  3I73 A;  2E5L L;  5EGT A;  4I7A A;  4R4C A;  4DU9 A;  3TS0 A;  3GTP B;  1IYU A;  1K3R A;  1M1K C;  2R7D A;  4C3I G;  4CJ2 C;  3SK6 A;  3FKI H;  4DV3 Q;  2CFM A;  4G4K A;  5LL6 X;  1EWC A;  2UUA Q;  2HCI A;  1B44 D;  4C3H H;  1PH3 A;  1VQD A;  3KLR A;  1G2S A;  3HOU H;  2IL8 A;  3A5Z B;  4R8N A;  4UY8 C;  1QWY A;  2F0J A;  2JE6 I;  5M3F H;  3WDN A;  1UE7 A;  1XNR Q;  1CTM A;  2YV5 A;  1U9R A;  5IY0 A;  4A3G G;  3QJY A;  3KLW A;  1TWC H;  2JK8 A;  2F0D A;  3NWS A;  3OW2 A;  3HOW H;  4OEM B;  5C4J H;  3RNU A;  2Z0S A;  4LUZ A;  1N36 L;  1B9M A;  1R9T H;  1Q1B A;  1SXT A;  1LO5 D;  5JJI A;  5KIX A;  1EWI A;  1OXX K;  1EU4 A;  1LV9 A;  4NDX A;  1ONL A;  1STG A;  4DR2 Q;  1DCZ A;  1H9K A;  2NN6 H;  2O2L D;  4RMF A;  4DR5 Q;  3NEN A;  1O80 A;  2L11 A;  3M7G A;  4G7Z C;  2F3W A;  1JWU D;  1XPO A;  4DV5 Q;  4QJF A;  5FLM H;  2MFI A;  3J80 E;  4NMZ A;  1RCV D;  3SVM A;  2OWO A;  3C1E A;  1BUV T;  2WFW A;  5EJW A;  4DV0 L;  2LXJ A;  4ZYS A;  1XPR A;  4RHS A;  2B39 A;  1DYQ A;  2F03 A;  1PFB A;  3KOJ A;  5KYL A;  1IBK Q;  2G5D A;  5DM7 3;  3ERQ A;  4GKJ L;  4X3T A;  1XMO L;  1Q8K A;  3D3R A;  4RKB A;  3Q24 A;  3J80 L;  4ZQ3 A;  3C1F A;  1PTO D;  4M8A A;  2K5D A;  4N8X 1;  4Y7N H;  4IO9 A;  2CW0 D;  2DY8 A;  2EY2 A;  4FF4 A;  2Z4I A;  1BXT A;  4X64 L;  3U9S A;  4KK7 A;  4C3H G;  4YCW A;  2B2W C;  1VQO A;  1JC7 A;  1AZP A;  1VQP A;  1F9Q A;  4GNX C;  3HOZ H;  2JA7 B;  3H3V I;  1TWF H;  2DGY A;  5CV6 A;  1IBM Q;  5D14 A;  1YBY A;  1L1O B;  3HOZ B;  2LXK A;  3DLL A;  4Z9C B;  3D31 A;  1YI2 A;  3NE5 B;  2F0E A;  1TWA B;  3CCM A;  3MEF A;  3S1N H;  4EX5 A;  1PH4 A;  1WTX A;  1UAP A;  2IX3 A;  1DOL A;  2ZM6 Q;  1A63 A;  1STH A;  3PF5 A;  2ICI A;  1MIU A;  4TQU S;  1MJE A;  3VYT A;  3D4W A;  4EGV A;  1K9M C;  1Q8I A;  3SK8 A;  5CBE E;  4R4O A;  4DK3 C;  3RZD H;  3AFP A;  3EA6 A;  5JEA H;  3PIP 3;  1TKW B;  4A3J G;  5EBD A;  3T1Y L;  1S40 A;  5IYD H;  3NQT A;  4OX9 L;  3I4N B;  4WJW A;  2ATW A;  4JI3 Q;  3MAQ A;  1ZKO A;  4L8J A;  3VYU A;  3OTO L;  3HZX A;  2RDH A;  1P16 A;  2KQ3 A;  5IGD A;  4LFC L;  1PH7 A;  2R93 B;  1H9M A;  3UE1 A;  4MIU A;  2MO0 A;  1CK1 A;  3MXG A;  4LF6 L;  5KEE A;  2J7Z A;  2K5N A;  3MXN A;  4KKS A;  4QF4 A;  2D0O A;  4IZ8 A;  1SYC A;  4ZUI A;  2EYJ A;  4C3I B;  2PMZ E;  4X6A H;  1ZXT A;  1IBK L;  1OXT A;  4DN4 M;  4DNR B;  3G48 A;  3KBG A;  1ASY A;  1RF2 D;  3D0F A;  2VXW A;  1C0A A;  2L0C A;  3PO3 B;  1QNK A;  1YJW A;  5HGT A;  2XRS D;  1IHZ A;  4U67 3;  2K05 A;  3SGI A;  1UE5 A;  1YJN A;  1ENA A;  5C5M A;  1I50 H;  4DPG A;  1VQA A;  2OXP A;  4WOR A;  1BO0 A;  3S2H H;  3RD4 A;  1LTG D;  4BA2 I;  2IY5 B;  1TY0 A;  4JOI A;  2A74 C;  3A0J A;  3BZD B;  3J81 c;  3Q8D A;  3CW2 C;  1HR0 L;  4MTK A;  1Q90 A;  4PMB A;  1FR3 A;  3GTK H;  3CC2 A;  2LKV A;  2R6G A;  3TP8 A;  2EVB A;  3CC4 A;  1A15 A;  3T1Y Q;  1BKB A;  1ROD A;  3I4L A;  4LF4 L;  1RDP D;  2R92 G;  1CKO A;  4AIM A;  1OXS C;  1YNN C;  3PO2 B;  3ND9 A;  2A73 B;  2OF1 A;  5GRO A;  4S3S A;  3J7A F;  1EY9 A;  2C9O A;  4HJA A;  3Q6S A;  4BBR B;  4JBJ A;  1EIH A;  4JI2 L;  2NWG A;  1BCP C;  2O5I C;  5D3D A;  1U4R A;  4HSP A;  1DD2 A;  2KCT A;  1SLJ A;  1B3Q A;  4BY1 B;  1X3G A;  2Y0S B;  3FKI G;  5BR8 Q;  2OEO A;  4X65 L;  3ULP A;  1B4O A;  4IJL A;  2RQX A;  1Y14 B;  2X6L A;  4JOI C;  1VQK A;  1KNE A;  4HAE A;  3MXP A;  1JJG A;  4IQZ A;  1N33 L;  2EY5 A;  3F2C A;  1QVG A;  3A8I E;  1Y1V H;  5GAE C;  1WYD A;  3RUZ A;  2LFN A;  2Z8L A;  3HOY H;  2DNE A;  2VQE Q;  2AQ1 B;  3DHQ A;  2PNR C;  3K58 A;  1TWG B;  4KKT A;  5JPN C;  1BNZ A;  3S1R B;  4CKB A;  1STN A;  4QY7 A;  5C4X B;  1P8L A;  1LM0 A;  4NXM Q;  1SYD A;  2OCE A;  4YHH Q;  4K6L A;  4MHE A;  4DV7 Q;  2PCF B;  3I8Z A;  2JA5 H;  2Y0S G;  3FKI B;  1SYB A;  5IP9 G;  1HNX L;  4KKU A;  2HD3 A;  3QG1 A;  3GTQ H;  5C0X G;  1IZ6 A;  5KNC A;  4LF7 Q;  1HFN A;  4KHP Q;  4R4T A;  4LF4 Q;  5M5Y B;  2F0L A;  5E3F A;  3PO3 G;  4RH6 A;  3BVM A;  4JK1 C;  1LTT D;  1VMC A;  4DK6 C;  2K33 A;  4LWC A;  5EPL A;  2WAQ E;  3CPW A;  4A3D B;  1YJ9 A;  4B3S Q;  2OQ0 A;  2A8V A;  4DA2 A;  3C2P A;  1I4Q A;  1MGS A;  4J15 A;  1TS2 A;  1JE4 A;  1WTV A;  2FMC A;  1VQM A;  4QUC A;  3BZC A;  3KF8 A;  2NB0 A;  1JR0 D;  3J80 i;  2VQE L;  5ELF A;  1H9S A;  3QO2 A;  4KTA A;  4DAP A;  1QVF A;  1Y69 U;  1N32 L;  2F4I A;  1E1O A;  2FXQ A;  3KUP A;  3I55 A;  4HIM A;  5CV8 A;  2KBN A;  2VUM B;  4PNY A;  4K8I A;  1A62 A;  2H4O A;  5IIF A;  2Z1C A;  2H1E A;  1RD9 D;  3BZK A;  1W2B A;  5IYB H;  5C0X I;  1Z6H A;  1J8I A;  5EKK A;  1B70 B;  1M8A A;  4DV2 L;  3RLO A;  4RAU C;  3KDF B;  1V43 A;  4HJ8 A;  2KHJ A;  1PRT B;  3PIO A;  1E2W A;  2ASB A;  1D7Q A;  3N52 A;  2K7V A;  1EY0 A;  1W6J A;  4LUV A;  5K36 H;  1SE4 A;  1D5M C;  1NE3 A;  1V9P A;  5IT9 E;  3SR1 A;  1IL2 A;  5ELE A;  2LS0 1;  3TME A;  1LTR D;  5T1G A;  1E22 A;  3GP7 A;  1KAA A;  4B3S L;  5GQO A;  1HRJ A;  1XMO Q;  3GV3 A;  5IYB G;  2WB1 E;  1ENC A;  3GTO B;  3U4V A;  4FF1 A;  1CHQ D;  3F2B A;  4IFD H;  2B63 B;  2K32 A;  2D5D A;  3I4M G;  4KD3 A;  2R61 A;  3KYH C;  3NBH B;  3DM1 A;  3ONA B;  4DV4 L;  2B2V A;  1LTA D;  1I4R A;  3H15 A;  2TSS A;  2KCC A;  1WI5 A;  3PGZ A;  3OTO Q;  3JAM E;  5C3E G;  1WTW A;  4DK0 A;  3FRP B;  4XYO A;  3I4O A;  3PUV A;  3RN5 A;  1YHA A;  3OW7 A;  1IKM A;  2IX0 A;  1X65 A;  2X6G A;  3QOJ A;  1IKL A;  2EYM A;  5I2X A;  3S9W A;  2FIN B;  3F2U A;  5FLX E;  3BDC A;  3S1Q B;  1U0L A;  1MSH A;  4KY5 A;  1WCM H;  1YNJ D;  4QGU A;  3CQZ B;  4KMU C;  3T53 B;  3KK7 A;  3KBX A;  1CKM A;  4O42 A;  1FYC A;  2JA5 G;  1K83 H;  2SEB D;  3VDY A;  3A56 A;  1KRS A;  3M4Y A;  4BS9 A;  2F0H A;  3I4N H;  1A2U A;  2PO4 A;  1TWG H;  2HIX A;  5CR3 A;  3L2P A;  4JW0 A;  2F0S A;  2JA6 B;  4A3B G;  5TSS A;  4QB4 A;  1BR9 A;  4JI3 L;  3BYY B;  2L55 A;  2JN4 A;  3MFY A;  3OPO A;  1B3A A;  1CKN B;  1EY4 A;  3EQL C;  4DUY Q;  5C3X A;  1K3B C;  1UEB A;  5CC4 A;  5IYC H;  4LF6 Q;  4OO1 G;  5J39 A;  2EJM A;  5CV9 A;  3M3Y B;  2E5L Q;  2VNU D;  1YVC A;  2CWP A;  3K7A B;  2PZW A;  2QGQ A;  2B2T C;  3L0O A;  4IOA A;  1HTL D;  3HG9 A;  3IFT A;  2EJG C;  3ERS X;  4XDX A;  3NHH A;  2B8F A;  2YTY A;  3NXW A;  2NZO A;  3KJP A;  5FO7 B;  2AHO B;  1N8R C;  2IT1 A;  3HOY G;  3TP7 A;  2R7F A;  4LMQ D;  1ASZ A;  1BOS A;  4QCL A;  4OON A;  2ZJP A;  5I2Y A;  4KN4 C;  4LF8 Q;  3Q22 A;  5ELD A;  4ME5 A;  5I9O A;  2E8G A;  1HNW Q;  1PH1 A;  3GTG H;  4OXP A;  3J81 L;  1YIT A;  3URY A;  3PIO 3;  1YIJ A;  4WJ3 M;  2XN9 C;  3GTJ H;  3EVQ A;  2Q2U A;  3P20 A;  1GHJ A;  4A3C G;  1S72 A;  4RGM A;  2XWJ B;  3NEL A;  1SMY C;  1KXL A;  1AE3 A;  1XMQ Q;  2D62 A;  1G51 A;  4HR7 B;  3CME A;  1KTK A;  5CGK A;  1XXG A;  4DFA A;  3J81 j;  2FHT A;  1UE6 A;  3HKZ B;  1I6H H;  2G9H D;  2L1B A;  4FXD A;  1STB A;  2CH4 W;  4FO2 A;  3W3A A;  2A69 D;  1N36 Q;  2NTS A;  2A19 A;  5E7N A;  5KRU A;  2QW7 A;  4NXM L;  2NUC A;  5K5P A;  4C3I H;  1TXY A;  4HCE A;  3BS1 A;  3TRE A;  1PRT F;  5COR A;  1WTP A;  1SE2 A;  3OWF A;  4B3M L;  3ERO A;  4DV1 L;  5IP9 H;  2B2Y C;  5EKI A;  5IWA L;  4K5W A;  1BCP D;  4GOP A;  5JEA J;  4IPG A;  4EQO A;  1DM0 B;  5CV7 A;  3I56 A;  1H9J A;  3STB D;  3ZYY X;  5C3E B;  2IJ0 A;  4GKJ Q;  3GTG B;  3CCL A;  2O5J C;  2NZ1 D;  3HOX B;  4ZKC B;  5JOB A;  3A55 A;  4B9X A;  1D6E C;  2Q2T A;  2HT1 A;  5EAY A;  4TSS A;  2K5H A;  2B2U C;  3PO2 H;  1AEX A;  1VQ6 A;  2QA4 A;  1UE1 A;  4HJ5 A;  3STB C;  1MSG A;  1YNN D;  4DAY B;  5BN5 A;  2R92 H;  1IXR A;  1VF7 A;  1BBU A;  4P72 A;  4KHV A;  4A3J H;  4XT3 B;  4CBV A;  4X62 Q;  2RCN A;  1BCP F;  3R2T A;  1HQR D;  2IW3 A;  4IPC A;  1H9S B;  4JG2 A;  5I9P A;  4OIJ A;  4LFB L;  2UXB Q;  1GM5 A;  4DF7 A;  1PFS A;  3KLS X;  4DV3 L;  1VQ4 A;  1EIG A;  3S2D H;  3I7F A;  2EOT A;  3I4M B;  4DR7 L;  2R7Z G;  5C5L A;  1X56 A;  1CA6 A;  3BDO A;  3D6W A;  4DV6 L;  4K14 A;  1WD1 A;  2WKC A;  1MHW C;  4IUT A;  4JI0 L;  2LMC B;  1PZJ D;  5DLQ E;  4JI1 Q;  1RTO A;  1I50 B;  3TP6 A;  4A3B H;  2D2C C;  2ZJQ A;  1GVP A;  1Y8O B;  1SYG A;  2VL6 A;  3VA7 A;  1QIL A;  4IUQ A;  3OSO A;  3CPF A;  3PQI A;  3IAY A;  1I4G A;  1VF5 C;  1I94 Q;  1ILP A;  5M5W H;  4QIW E;  3F1Z A;  4LFA L;  5E4W C;  2UXD L;  2PQA A;  4OO1 H;  3KDF A;  2ZJR A;  4B3T Q;  2PW7 A;  2QEX A;  4ZUJ A;  1C4Q A;  4DUZ L;  2EXZ A;  2VS1 A;  2XSC A;  3O13 A;  5AJ3 L;  3PO2 G;  1NY4 A;  1U4L A;  3RR5 A;  3CQZ H;  2BA1 A;  1HUM A;  3L7Z C;  1SN8 A;  1QCB D;  2Q8I B;  1HA6 A;  2Q8R E;  5KYI A;  3D4R A;  1R4Q B;  4JYA Q;  1HHV A;  3MTS A;  2NYZ D;  3K8A A;  4C56 C;  1T5X D;  5BR8 L;  1UEA B;  4X65 Q;  1A0I A;  2UUB L;  5JAV A;  3RN2 A;  3FP9 A;  4Y52 H;  2QDL A;  2YU9 B;  5T1I A;  4GLV B;  4XQN A;  2B2Y A;  2RDG A;  3S17 B;  5C6A A;  4LF5 L;  5GAG C;  5BN3 A;  3H94 A;  3UE0 A;  5C3E H;  2PNH A;  1G91 A;  1IW7 D;  1UNS A;  1G29 1;  2AWN A;  3NK9 A;  1JMC A;  2E2H B;  1A2T A;  5H1S E;  4HJ7 A;  2QF7 A;  2Q2I A;  4IN3 A;  3AB9 A;  2ALY B;  2HDM A;  4JI1 L;  2ZTE A;  1KNA A;  1Q3L A;  1Y1W G;  1VQE A;  1Q7Y C;  5FO9 B;  1QE6 A;  2VUM G;  5A35 A;  4CJ0 B;  1VQ5 A;  1II3 A;  1M4V A;  5D3I B;  4V19 0;  3WOE A;  3S1Q H;  4JBM A;  4IPD A;  3AFQ A;  4RG1 A;  1NUC A;  2KCM A;  3G6E A;  1IBL Q;  1HZC A;  4ZAI A;  4BA1 I;  5IE8 A;  1EEI D;  5C4X G;  2ID0 A;  4KN7 C;  3SEB A;  1LUZ A;  1FNW A;  3GV6 A;  2ENB A;  4NP5 A;  4BBS G;  3MXU A;  3UDI A;  5IGC A;  1JT8 A;  1GUO A;  3DM3 A;  5LMN Q;  1I5F A;  1PTO H;  3IRB A;  3S1M B;  3G4S A;  1IYV A;  3HOZ G;  4BY7 B;  3H3V C;  4LFA Q;  5EQ0 A;  2KEC A;  4U68 A;  3TBI B;  2UU9 Q;  2DN8 A;  1J9O A;  5J22 A;  1CQV A;  4B3T L;  2HQL A;  4BY1 G;  4C3H B;  4OWX B;  2N78 A;  1NMF A;  2EYP A;  4LF7 L;  2VW9 A;  1ET6 A;  1EY7 A;  4H7B A;  3CF5 A;  1EWH A;  1F2L A;  2F0G A;  3V96 A;  5EPJ A;  3KFU A;  4AQY Q;  2VB3 X;  1EQT A;  1KC8 C;  4UDU C;  1LLR D;  2VB2 X;  4DK1 A;  3HEJ A;  4JYA L;  1GKH A;  2KEE A;  3CCJ A;  1HJP A;  4MNO A;  1EQQ A;  2MJ8 A;  5KGU A;  1F2Z A;  2BCO A;  2UUA L;  2HDL A;  2OQK A;  1Y1W H;  1Q12 A;  4R8I A;  4A3I G;  3LWU A;  3HFZ B;  4XT1 B;  3VYS A;  1RIP A;  4ZCK A;  1D5Z C;  2B29 A;  1OTC A;  2JA8 H;  2KEN A;  3CP0 A;  4BBS B;  3K5O A;  2N55 A;  1TS4 A;  1LYL A;  1K73 C;  2UXC L;  2EDG A;  1FJG Q;  1OXV A;  1HR0 W;  1KHI A;  2A68 D;  4A3J B;  4AH6 A;  4GLX A;  2I07 B;  4RA8 A;  2L9H A;  3IKJ A;  4RGT A;  3NTH A;  1WJJ A;  4XXE A;  5NUC A;  4GKK Q;  1SYF A;  2VQF L;  5G3L F;  4O1N A;  1FD7 D;  5FLX L;  1PH5 A;  2I5M X;  3H09 A;  3WWV A;  1LTB D;  5M9O A;  1M90 C;  1H9R A;  1EY5 A;  3CCQ A;  4YCV A;  1F2M A;  3TQY A;  4DAY A;  2H5X A;  3VA5 A;  1CA5 A;  3C3L A;  4DV0 Q;  1C9O A;  3I70 A;  1A3U A;  5M3M B;  2NVT H;  4CJ1 B;  5JVH 3;  3KF6 B;  4GOP C;  1JJ2 A;  4MN3 A;  4DR2 L;  2MO1 A;  2EY6 A;  4KY7 A;  5IGE A;  3AMU A;  5C44 H;  4BXX H;  1I3Q B;  2IWH A;  4WJ4 A;  4CKE A;  1Y8N B;  4CKC A;  4OEL B;  3PUX A;  1ICW A;  1SYE A;  2JXM B;  3R2I A;  2QKI C;  1S5F D;  2E2D C;  1VDZ A;  4UPA A;  5E1F A;  3P75 A;  3RZD B;  5FJ8 H;  4OWW B;  4BWG B;  3ER0 A;  2WB1 G;  1E0B A;  1YEZ A;  3MHB A;  3D4D A;  3CMA A;  4DXF A;  1NR4 A;  1CQF A;  1HZA A;  1JOR A;  3VR2 A;  3X3N A;  4A93 B;  5JVG 3;  2K50 A;  2PYK A;  3DXJ C;  1HNX Q;  2A6H C;  3NTI A;  3AEV A;  1AFP A;  3V05 A;  2M2L A;  1KD1 C;  2DY7 A;  3HOV B;  3CKI B;  2A68 C;  1SFO H;  3CXC A;  4XYQ A;  1SSO A;  5FOB B;  1SEB D;  4JPB W;  3SHL A;  5FJ8 G;  4HIK A;  3GTJ B;  1TQO A;  3I91 A;  1XNQ Q;  5C4H A;  3HOX G;  4KHP L;  1QB5 D;  1EZ8 A;  3AQQ A;  4N8F A;  3U50 C;  2N8N A;  4O0A A;  5HGQ A;  3HRZ C;  3HP3 A;  1AH9 A;  5ELO A;  1QZG A;  2GN5 A;  2L5T A;  4ME3 A;  5M5X B;  3HOW G;  1XMQ L;  4A3I H;  1PTO F;  3M4O H;  3DEO A;  4P74 A;  2ZM6 L;  3LGJ A;  1D5X C;  3RLF A;  3QR8 A;  1JB3 A;  2A1A A;  3K5M A;  1PXU A;  2I46 A;  2WIN B;  5ELN A;  1UUP A;  3NPP A;  5A2Q L;  3GTM H;  2NN6 G;  2IX1 A;  5FKA C;  4FXK C;  2ES2 A;  4RCO A;  5JEA G;  1F77 A;  1CUK A;  2LSS A;  1JIC A;  1W6K A;  1C7Y A;  3LNN A;  2CKZ B;  3SDZ A;  1T5E A;  4DGZ A;  4RWS C;  3HKZ G;  3CCV A;  1OXU A;  4RKL A;  4YWM A;  5M3F G;  1JOK A;  1AE2 A;  1UWV A;  3U9O A;  3MXN B;  2XWB B;  1CI3 M;  3N6R A;  1WTR A;  4KLK A;  2HHH Q;  2A69 C;  2F0W A;  4BY7 H;  1C8C A;  4A3D H;  1SE8 A;  5EBC A;  2LY7 A;  2VZA A;  5C44 B;  3Q23 A;  3T1H L;  2JA8 G;  3SXH A;  2YYZ A;  4JI2 Q;  4IAL A;  4P75 A;  5IP7 H;  1WTQ A;  2R3Z A;  4X3U A;  4UP8 A;  4HMI A;  3UDX A;  4IUR A;  1STA A;  5IT9 L;  1MBY A;  2BA0 A;  3NP8 A;  2IPK D;  3NSW A;  1TS5 A;  1ZYR C;  3S15 H;  1O7L A;  1WCM G;  1K8M A;  1RHP A;  4CDC C;  5KNB A;  2K5V A;  4KJO A;  2ICE C;  2MPM A;  1WOC A;  1V1P A;  4ZKB B;  2JP1 A;  4LK1 C;  3SK5 A;  5E4X A;  1O78 A;  5JPM C;  5LHY 1;  3JAM i;  2Z6K A;  3G6J B;  4A3K G;  3K57 A;  3QB3 A;  4DUY L;  2A5H A;  3HOW B;  5DNF A;  2TMP A;  4NXN Q;  4A3L G;  3U4Z A;  3ND8 A;  4H0L C;  1PLF A;  2RSN A;  3K7U C;  3MZ5 A;  3ITP A;  1HPC A;  2ZTC A;  2CQO A;  4N9P A;  5LL6 S;  1N33 Q;  2DJG C;  1TWA H;  4C3J G;  4IUU A;  4A3M G;  1Z7T A;  1AW7 A;  2UU9 L;  4UP7 A;  1G8Z D;  1XX8 A;  2JSO A;  2RVL A;  4C1N K;  1I6V C;  2K03 A;  1S5E D;  1X55 A;  1CSP A;  3HKZ E;  5I4D A;  4QMG A;  1KDB A;  4JI6 Q;  3G7L A;  1HQM C;  4QL5 A;  5CV5 A;  2YTV A;  5IOC A;  4OL7 A;  1YHB A;  2FMM A;  1FGB D;  3JAM c;  3EIV A;  3S24 A;  4X3K A;  3HS0 C;  1SRU A;  3PO3 H;  1XWE A;  2R7Z B;  1I4H A;  4DUZ Q;  2NVQ B;  1EOV A;  2R92 B;  4MZ9 A;  4IUV A;  2PI2 A;  2BH2 A;  1CHP D;  3VYR A;  1EEF D;  3BG3 A;  1NMG A;  2BE5 D;  2VY3 A;  2AQ2 B;  1JWM D;  1LT5 D;  2K1B A;  1Q86 C;  2NVQ H;  3H6M A;  1EOT A;  4HTH A;  4DR3 L;  1E2V A;  2HQE A;  2VQF Q;  1SMX A;  3S2H B;  4RHR A;  4LF8 L;  1EYC A;  1JCK B;  1PYS B;  2KJX A;  1F9P A;  4C2M B;  1MKH A;  3S1M H;  2JA6 G;  4A3B B;  3OMG A;  4RGO S;  2L12 A;  5J3B A;  3KJO A;  1K8A C;  4TRD A;  1BQQ T;  2QEJ C;  4I7Z C;  1NNX A;  1D1K A;  1STY A;  2PMZ B;  3B6Y A;  5M3M G;  3RLN A;  3DWA A;  2E74 C;  2X69 A;  4ZK9 B;  1X3F A;  1EIY B;  3FPP A;  3LX0 A;  3GQB A;  4GN3 B;  2B2T A;  3OWE B;  1BDO A;  4A3F H;  1HTP A;  2WKD A;  1HCZ A;  2FFK B;  2K14 A;  5F2D A;  3DUZ A;  1GXD C;  2A6E D;  1XTD A;  1KAW A;  4HMJ A;  4V0B A;  1EQR A;  5A2Q E;  2O4X A;  2CHB D;  2BDO A;  4K8J A;  4G7O C;  3E9I A;  5IYC G;  4B3M Q;  1ENF A;  1K0R A;  3BVZ A;  3W1G A;  4B08 A;  3S16 B;  1B8A A;  2KCN A;  4A75 A;  1GUG A;  4GN5 A;  4A3G B;  4HN7 A;  1Y1W B;  3FPU B;  4L5T A;  5L37 A;  3G71 A;  1CM9 A;  1QVC A;  3SK4 A;  4A3I B;  3M4O B;  1PYW D;  4DAM A;  2D9U A;  1YNX A;  1HXY D;  1VS0 A;  1D8L A;  3OYY A;  2EE1 A;  2EYO A;  3R8B A;  1PA6 A;  1E1T A;  4HCS A;  2UUC L;  4QIW B;  3K80 C;  1GJX A;  4A93 H;  4EVO A;  4X3S A;  2B63 H;  3L3O C;  2F0V A;  1WTH A;  1Q81 C;  1ESR A;  4ABN A;  3K81 C;  1DOK A;  4H13 C;  5JJK A;  3M85 A;  2CVR A;  4C3J H;  4YY3 Q;  1PFM A;  3AYH B;  1V8Q A;  1IBL L;  4PZ8 A;  3TZU A;  1B2T A;  4QUF A;  4JI7 Q;  2K6A A;  4BXX G;  5C4J B;  4A3E H;  1I4P A;  1TII D;  1VCI A;  2C5C A;  1JJC B;  2SDF A;  3E5S A;  1LTS D;  2E76 C;  2A6H D;  3NEM A;  5COY A;  4X62 L;  1GO3 E;  1PRT D;  4HIO A;  4L63 B;  3C46 A;  4P71 A;  1VQB A;  2NVX B;  2JEA I;  5KND A;  4DV6 Q;  1G6Z A;  3TS2 A;  4KJN A;  4DR5 L;  2MUY A;  3T4A C;  4DR7 Q;  1NAP A;  3NWT A;  4AYB E;  4FF3 A;  5J1Z A;  3GTM B;  3I4N G;  4L5S A;  1Q82 C;  4OHJ A;  4AQY L;  3GDE A;  2EIF A;  3CRL C;  4OGQ C;  3J7Z C;  4AYB B;  2F0K A;  1B53 A;  4YWK A;  2KHS A;  2R93 H;  1FJG L;  1K28 A;  2RDF A;  1SFO B;  2NVT B;  4DR1 Q;  1G6P A;  4CGY B;  3T13 A;  3U58 A;  1EY8 A;  1SNQ A;  2HHH L;  2F0I A;  2YU9 H; 
#chains in the Genus database with same CATH homology
 2I5H A;  4BY7 G;  4GKK L;  2WAQ E;  3HOV G;  3F8T A;  4NB3 A;  3CPW A;  1PYB A;  2XGT A;  1YJ9 A;  1Q12 A;  2AMC B;  4B3S Q;  4A3I G;  3HFZ B;  1EUJ A;  1HH2 P;  5FLX c;  2OQ0 A;  1RIP A;  3PCO B;  2A8V A;  3M4O H;  2B29 A;  4DR6 Q;  4HID A;  1OTC A;  2JA8 H;  2KEN A;  3CP0 A;  1V1Q A;  4J15 A;  1EFW A;  4B3R L;  1YZ6 A;  2F3I A;  1IBM L;  1BBW A;  1VQM A;  2R93 G;  1LYL A;  3BZC A;  1K73 C;  3M3Y H;  3E0E A;  2UXC L;  3J80 i;  2VQE L;  1HNZ L;  4NPS A;  1FJG Q;  1OXV A;  3S17 H;  1PV4 A;  1QVF A;  1HR0 W;  3T1H Q;  3ICE A;  1KHI A;  4A3L H;  1N32 L;  4HJ9 A;  1Y1V G;  1E1O A;  2FXQ A;  3I55 A;  4AH6 A;  4JI7 L;  3KF8 B;  4GLX A;  4HIM A;  4GS3 A;  2ZTD A;  2KBN A;  1Q46 A;  1WJJ A;  5AJ3 Q;  1PH9 A;  1A62 A;  2WAQ G;  4UP9 A;  3PSI A;  4GKK Q;  2VQF L;  2MNA A;  3BZK A;  4BBR G;  4JI8 Q;  1PH5 A;  1W2B A;  2I5M X;  5IYB H;  1Y1W H;  3WWV A;  2RHS B;  5C0X I;  4H02 A;  1B70 B;  1M90 C;  4JI5 L;  3J81 i;  2UUB Q;  4DV2 L;  3RLO A;  4OWT B;  3PIP A;  3CCQ A;  4YCV A;  4A3D G;  3TQY A;  3KDF B;  4LFC Q;  1N32 Q;  3GD7 A;  1V43 A;  2H5X A;  4HJ8 A;  2KHJ A;  1HNW L;  4DV0 Q;  2MQH A;  4NXN L;  4A3C H;  1C9O A;  4KHZ A;  3PIO A;  3JC6 6;  4BBS H;  2ASB A;  2NVT H;  4JI4 L;  2GVA A;  3KF6 B;  5JJL A;  5FLM G;  1D7Q A;  4XTC S;  3EBE A;  4OO1 I;  1B7Y B;  1RL2 A;  2K4K A;  4LUV A;  4GOP C;  1JJ2 A;  1NE3 A;  1V9P A;  5M3M H;  4DR2 L;  1PH2 A;  1IL2 A;  4A3G H;  3A5U A;  2MO1 A;  4DV4 Q;  4QQB X;  1L1O C;  4A76 A;  3M9B A;  5C44 H;  1E22 A;  1VQG A;  4B3S L;  5GQO A;  4LF5 Q;  1X3E A;  4BXX H;  1XMO Q;  1XNR L;  4WJ4 A;  2YTX A;  1E24 A;  5IYB G;  2WB1 E;  4LF9 Q;  1O7I A;  1NJI C;  3PUX A;  3U4V A;  3F2B A;  4JI8 L;  2VUM H;  1S3O A;  4R1J A;  2JA9 A;  1VQJ A;  1K8G A;  1VQN A;  3I4M G;  3EN2 A;  3KYH C;  3PUY A;  4UPA A;  3NBH B;  5C4X H;  4DV4 L;  3S1R H;  5FJ8 H;  4OWW B;  3GTO H;  4LFB Q;  4DNI A;  2UXB L;  1I3Q H;  3H15 A;  3ER0 A;  2WB1 G;  4K0K L;  1WI5 A;  1YEZ A;  3PGZ A;  3OTO Q;  5C3E G;  4X66 Q;  3CMA A;  5C0X J;  2OTL A;  2E2J H;  4A93 G;  3I4O A;  1HZA A;  3PUV A;  1YHA A;  2F52 A;  4DV2 Q;  2BH8 A;  1X65 A;  2IX0 A;  3RN5 A;  2K50 A;  2EXD A;  1HNX Q;  4POF A;  3AEV A;  4DKA C;  1SRO A;  4GNX B;  3GTL H;  1U0L A;  1KD1 C;  4FDB A;  1QZH A;  2NVY H;  3K7A H;  4DR3 Q;  1WCM H;  4DR4 L;  4QGU A;  1VQ7 A;  1TWH H;  3S16 H;  4A3M H;  1X54 A;  1A8V A;  1HR0 Q;  1SFO H;  1VQI A;  3TEH B;  3ZJY C;  3CXC A;  2K75 A;  1CKM A;  5GAH C;  4HIK A;  2JA5 G;  5FJ8 G;  3GTP H;  1K83 H;  3VDY A;  2NVX H;  1KRS A;  1XNQ Q;  2KHI A;  3HOX G;  3I4N H;  1J6Q A;  4POG A;  4IOC A;  1TWG H;  2HIX A;  1X6O A;  2N49 A;  4KHP L;  1E3P A;  3L2P A;  1SR3 A;  1EYG A;  4A3B G;  3AQQ A;  4DV5 L;  4JI3 L;  3U50 C;  2N8N A;  4O0A A;  5HGQ A;  4DR6 L;  1CKN B;  4DUY Q;  1AH9 A;  1VQ8 A;  5ELO A;  1QZG A;  1T9H A;  1UEB A;  2WP8 J;  4JI5 Q;  2GN5 A;  5IYC H;  4LF6 Q;  2K52 A;  4ME3 A;  4LF9 L;  3HOW G;  1XMQ L;  4OO1 G;  4A3I H;  1VQH A;  5C44 G;  4P74 A;  2GVB A;  3M4P A;  1L2F A;  3BU2 A;  3PUZ A;  2ZM6 L;  4GNX A;  4GLA C;  2E5L Q;  1N9W A;  3LGJ A;  2VNU D;  3RLF A;  1YVC A;  2A1A A;  2AKW B;  2CWP A;  4IPH A;  5ELN A;  2QGQ A;  3L0O A;  2E2H H;  4BY1 H;  2R7Z H;  3GTM H;  2NN6 G;  3UDF A;  2IX1 A;  4IOA A;  2UXD Q;  2ES2 A;  3ERS X;  5IT9 c;  1KIX A;  3CAM A;  5JEA G;  2YTY A;  1BVS A;  2NZO A;  3KJP A;  1CUK A;  2I5L X;  2AHO B;  2LSS A;  1N8R C;  2IT1 A;  1QUQ B;  3HOY G;  5IP7 G;  2R7F A;  1C7Y A;  1ASZ A;  2UUC Q;  4JI0 Q;  2CWA A;  1EIF A;  4OON A;  2CKZ B;  2ZJP A;  4R4I A;  1Z47 A;  4K0K Q;  1NBW A;  2D0P A;  3HKZ G;  3CCV A;  1OXU A;  1HZ9 A;  2B63 G;  4LF8 Q;  3GO5 A;  1XJV A;  4JBK A;  4YWM A;  2E8G A;  4R4Q A;  2UXC Q;  1HNW Q;  5M3F G;  1AE2 A;  1UWV A;  1PH1 A;  3MXN B;  3GTG H;  3H3V H;  4LNQ A;  3K0X A;  4OXP A;  3CD6 A;  1U5K A;  4PMW A;  2CCZ A;  2JJQ A;  3PV0 A;  4KLK A;  2HHH Q;  2I0Q A;  4BY7 H;  4JV5 Q;  3HKS A;  1YIT A;  1YIJ A;  2E5L L;  4WJ3 M;  4R4C A;  3GTJ H;  3TS0 A;  4A3D H;  1SE8 A;  1K3R A;  2Q2U A;  1M1K C;  2R7D A;  1W3S A;  3FKI H;  2VZA A;  4A3C G;  1S72 A;  3J80 c;  4DV3 Q;  2CFM A;  3NEL A;  3T1H L;  1KXL A;  2JA8 G;  1AE3 A;  3H0G G;  1XMQ Q;  2D62 A;  2DUD A;  1G51 A;  2YYZ A;  4JI2 Q;  4P75 A;  3ULL A;  3CME A;  4A3F G;  5IP7 H;  2UUA Q;  5LMU L;  4C3H H;  3J81 j;  1PH3 A;  1VQD A;  4IFD I;  4UP8 A;  3UDX A;  3HOU H;  1UE6 A;  3A5Z B;  4UY8 C;  4PZ6 A;  1I6H H;  3RZO H;  2BA0 A;  4EQ5 A;  2JE6 I;  5M3F H;  2E2I H;  1UE7 A;  1XNR Q;  2YV5 A;  1Q1E A;  3S15 H;  5IY0 A;  4A3G G;  4DV1 Q;  3KLW A;  2B3G A;  1WCM G;  1TWC H;  4YY3 L;  1N36 Q;  2JK8 A;  2K5V A;  2A19 A;  5E7N A;  2JA7 H;  3OW2 A;  1WOC A;  4NXM L;  3HOW H;  5C4J H;  3RNU A;  2Z0S A;  4LUZ A;  4C3I H;  1TXY A;  2PQA B;  1N36 L;  4BBR H;  1Q1B A;  3TRE A;  1R9T H;  2Q2H A;  4KI0 A;  5JJI A;  3JAM i;  1EWI A;  1OXX K;  2Z6K A;  5GAD C;  4A3K G;  4DR2 Q;  3E9H A;  4B3M L;  4RMF A;  4DUY L;  5IP9 H;  4DV1 L;  4DR5 Q;  3NEN A;  4DR1 L;  2YU9 H;  1PH8 A;  5IWA L;  4NXN Q;  3CCS A;  3A74 A;  3U4Z A;  4A3L G;  4GOP A;  5JEA J;  4IPG A;  1CSQ A;  4DV5 Q;  4PZ7 A;  4QJF A;  4MTN A;  3CCU A;  1XPO A;  1PHJ A;  3K7U C;  4YCU A;  3I56 A;  5FLM H;  2MFI A;  2ZTC A;  2CQO A;  3STB D;  1VQ9 A;  2OWO A;  1XNQ L;  3KF6 A;  1N33 Q;  2WFW A;  1TWA H;  1KRT A;  4DV0 L;  4GKJ Q;  4JV5 L;  2LXJ A;  4A3M G;  4C2M H;  3CCL A;  1XPR A;  2UU9 L;  4UP7 A;  3KOJ A;  1IBK Q;  1PVO A;  3PF4 A;  2Q2T A;  2HT1 A;  2N3S A;  5EAY A;  4GKJ L;  1XMO L;  2K5H A;  1Q8K A;  3PO2 H;  1X55 A;  1CSP A;  3HKZ E;  1VQ6 A;  4JI6 Q;  2QA4 A;  1UE1 A;  2JQO A;  2YTV A;  4QL5 A;  3STB C;  4HJ5 A;  5M5Y H;  2L15 A;  4Y7N H;  1FGU A;  4IO9 A;  4DAY B;  1YHB A;  3JAM c;  1IXR A;  4X64 L;  3EIV A;  2R92 H;  1BBU A;  4P72 A;  3S24 A;  4YCW A;  3W1B A;  1SRU A;  4A3J H;  4X62 Q;  2RCN A;  1VQO A;  1VQP A;  3PO3 H;  4GNX C;  4DUZ Q;  3HOZ H;  4IPC A;  4JG2 A;  1EOV A;  1HZB A;  4LFB L;  4P73 A;  3H3V I;  2UXB Q;  4MZ9 A;  1GM5 A;  2PI2 A;  1TWF H;  2BH2 A;  2DGY A;  1CKN A;  1IBM Q;  1NMG A;  1PFS A;  2AWO A;  2HIV A;  1YBY A;  2VY3 A;  1L1O B;  4DV3 L;  1Q86 C;  2LXK A;  4ALP A;  3DLL A;  1VQ4 A;  1WFQ A;  3D31 A;  2NVQ H;  1YI2 A;  3S2D H;  3I7F A;  4DR3 L;  2JA7 G;  3S14 H;  4DR7 L;  2VQF Q;  1SMX A;  3CCM A;  3MEF A;  2R7Z G;  1J5E Q;  3S1N H;  2NZH A;  4EX5 A;  1MJC A;  1IYJ B;  4DV7 L;  1PH4 A;  4LF8 L;  1X56 A;  3CC7 A;  2ZM6 Q;  1PYS B;  1A63 A;  4DV6 L;  3PF5 A;  1K9M C;  1MKH A;  1MIU A;  4TQU S;  1MJE A;  3S1M H;  2JA6 G;  1H95 A;  4JI0 L;  1LTL A;  4R4O A;  4DK3 C;  4A3K H;  3RZD H;  5DLQ E;  3AFP A;  4JI1 Q;  5LMU Q;  5J3B A;  3KJO A;  4A3J G;  1L0W A;  5IYD H;  3T1Y L;  1S40 A;  1K8A C;  4A3B H;  4JI4 Q;  4X64 Q;  1GVP A;  2ZJQ A;  4OX9 L;  2ATW A;  4JI3 Q;  2VL6 A;  3ULJ A;  3OTO L;  1P16 A;  1JE5 A;  3CPF A;  3I2Z A;  3B6Y A;  3M4Q A;  4LFC L;  1PH7 A;  2IHF A;  3FHW A;  3RLN A;  5M3M G;  5M5W H;  1I94 Q;  1KQS A;  4DR4 Q;  4QIW E;  3F1Z A;  4IJH A;  3UE1 A;  1N34 L;  4LFA L;  2UXD L;  2MO0 A;  1KL9 A;  2PQA A;  4LF6 L;  2K5N A;  4A3E G;  1X3F A;  1EIY B;  3KDF A;  2ZJR A;  5HY6 A;  4B3T Q;  2QEX A;  2D0O A;  3J7A 5;  3HOV H;  4IFD J;  4DUZ L;  4X6A H;  2PMZ E;  4GN3 B;  2VS1 A;  1IBK L;  1OXT A;  4A3F H;  5AJ3 L;  3PO2 G;  1VQL A;  3I4M H;  3G48 A;  3M7N A;  1NY4 A;  2F4V Q;  3RR5 A;  3CQZ H;  2BA1 A;  1E7Z A;  2K14 A;  2NN6 I;  3L7Z C;  4TVA B;  1ASY A;  1SN8 A;  3D0F A;  1I94 L;  1C0A A;  3H0G H;  1JB7 A;  1XTD A;  3CCE A;  2C35 B;  1KAW A;  1EQR A;  1YJW A;  4JYA Q;  4OX9 Q;  2JEB I;  3SGI A;  1UE5 A;  3K8A A;  4GOP B;  1YJN A;  3E9I A;  5IYC G;  5BR8 L;  1K0R A;  4B3M Q;  3W1G A;  1I50 H;  4X65 Q;  4DPG A;  1A0I A;  1B8A A;  1GD7 A;  1VQA A;  4A75 A;  2UUB L;  4GN5 A;  3RN2 A;  2IHE A;  3FP9 A;  1J5E L;  3S2H H;  2IY5 B;  4BA2 I;  4Y52 H;  4YWL A;  4L5T A;  3W5O A;  4JOI A;  3A0J A;  3G71 A;  3J81 c;  4GLV B;  3Q8D A;  3CW2 C;  1HR0 L;  1QVC A;  1NTG A;  4DAM A;  3GTK H;  4LF5 L;  1YNX A;  1VS0 A;  5GAG C;  3CC2 A;  1D8L A;  2R6G A;  3OYY A;  3CC4 A;  4X66 L;  3UE0 A;  5C3E H;  3T1Y Q;  2PNH A;  1BKB A;  3HOX H;  1PA6 A;  1E1T A;  2UUC L;  4LF4 L;  1G29 1;  2AWN A;  2R92 G;  1CKO A;  4AIM A;  1OXS C;  3K80 C;  5H1S E;  1JMC A;  4A93 H;  4HJ7 A;  2Q2I A;  2XTI A;  2B63 H;  5LMN W;  5GRO A;  2ALY B;  2RF4 A;  2Z6K C;  4JI1 L;  2ZTE A;  4HJA A;  1Q81 C;  5IWA Q;  1FL0 A;  5K36 G;  2EQS A;  4LUO A;  4JI6 L;  1Y1W G;  4JBJ A;  3K81 C;  4JI2 L;  4GN4 B;  3PUW A;  1VQE A;  1Q7Y C;  5JJK A;  3M85 A;  4C3J H;  4YY3 Q;  2VUM G;  4IFD G;  3TRZ A;  3AYH B;  1PH6 A;  1IBL L;  4PZ8 A;  2KCT A;  1SLJ A;  4JI7 Q;  1VQ5 A;  3UDG A;  4BXX G;  1X3G A;  4A3E H;  3S1Q H;  3FKI G;  1VCI A;  1DGS A;  4IPD A;  5LMN L;  1JJC B;  3AFQ A;  4RG1 A;  5BR8 Q;  4JBM A;  2KCM A;  4A4I A;  3G6E A;  1IBL Q;  2JA6 H;  1HZC A;  1VQC A;  4X65 L;  3ULP A;  4IJL A;  4BA1 I;  1Y14 B;  4JOI C;  1VQK A;  5IE8 A;  3NEM A;  1JJG A;  4L5Q A;  1N33 L;  5C4X G;  4X62 L;  1GO3 E;  2ID0 A;  3F2C A;  4HIO A;  1QVG A;  1LUZ A;  2F4V L;  3HOU G;  1Y1V H;  4P71 A;  3CCR A;  5GAE C;  1L1O A;  1WYD A;  4BBS G;  1VQB A;  3HOY H;  2JEA I;  2VQE Q;  1HNZ Q;  3UDI A;  1JT8 A;  4O2D A;  3DM3 A;  4JCV E;  4DV6 Q;  4L5R C;  5LMN Q;  3TS2 A;  4APV A;  1I5F A;  3IRB A;  3G4S A;  4QY7 A;  3HOZ G;  1P8L A;  1LM0 A;  4DR5 L;  4B3R Q;  3F2D A;  4NXM Q;  4DR7 Q;  4LW1 A;  4LFA Q;  1N34 Q;  2OCE A;  4YHH Q;  4DV7 Q;  1FVI A;  3BJU A;  2UU9 Q;  4AYB E;  1Z9F A;  2JA5 H;  2Y0S G;  4B3T L;  2HQL A;  2RHQ B;  4BY1 G;  4YHH L;  4OWX B;  3I4N G;  2N78 A;  5IP9 G;  5M5X H;  1HNX L;  4L5S A;  1NMF A;  1Q82 C;  2OTJ A;  2PI2 E;  4XIG S;  4AQY L;  4LF7 L;  2VW9 A;  1VQF A;  3GDE A;  3CF5 A;  4PG3 A;  2EIF A;  4AYB G;  4JC0 A;  3J7Z C;  3GTQ H;  4YWK A;  5C0X G;  1IZ6 A;  3KFU A;  2R93 H;  1XPU A;  1FJG L;  4AQY Q;  4LF7 Q;  1KC8 C;  4KHP Q;  4R4T A;  1QUQ A;  4JYA L;  4JBW A;  1YHQ A;  5IYD G;  1X9N A;  4LF4 Q;  1GKH A;  4DR1 Q;  3CCJ A;  1HJP A;  3PO3 G;  1G6P A;  2V1C C;  2Y0S E;  4MNO A;  1EQQ A;  3U58 A;  4DK6 C;  2UUA L;  2HHH L;  2OQK A;  4LWC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...