3JAMi

Cryoem structure of 40s-eif1a-eif1 complex from yeast
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
96
structure length
96
Chain Sequence
b'PKRELIYKEEGQEYAQITKMLGNGRVEASCFDGNKRMAHIRGKLRKKVWMGQGDIILVSLRDFQDDQCDVVHKYNLDEARTLKNQGELPENAKINE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 18S rRNA
publication title Conformational Differences between Open and Closed States of the Eukaryotic Translation Initiation Complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Translation
total genus 16
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
i PF01176 eIF-1a Translation initiation factor 1A / IF-1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3jami00
4GKKL 2UUCQ 5FJ8H 2IHEA 4QL5A 3AYHB 4A3IH 4DV0Q 4NXML 2JJQA 4R4QA 3F2CA 3S15H 5IWAQ 1RIPA 3I7FA 4A3EG 1K8GA 4K0KQ 3E0EA 3CCMA 3GTJH 4UP9A 2ATWA 2NN6G 2R7ZG 3MXNB 2UUCL 1PYBA 1U0LA 4BY1G 1BVSA 5JEAJ 3G48A 3ULJA 1NY4A 3PUWA 4R4CA 4DV0L 1KD1C 4B3TL 3DM3A 1EFWA 1E7ZA 5FLXc 4QY7A 4DKAC 4YY3Q 4A3CG 4K0KL 4BBSH 3PUZA 3KJOA 5IY0A 4Y52H 4X6AH 3UE1A 3K7UC 3CCEA 2IT1A 1N33Q 2QA4A 1UE6A 4YY3L 1KQSA 4LF8Q 4EX5A 2VS1A 1OXUA 1SMXA 4HJ8A 1N8RC 4AYBG 2YYZA 1V43A 1PFSA 1VQDA 1Z9FA 2BH8A 2ZTCA 1SFOH 3CCQA 2N8NA 1CKMA 1T9HA 1YJWA 1R9TH 1S72A 4L5RC 4PZ7A 5C4JH 3H15A 5M3FG 4DV1L 1K9MC 4HIDA 1JB7A 2B3GA 1NMFA 1OXTA 2DUDA 2E8GA 4A3JH 4LF7L 2B63G 4LWCA 3CC7A 1MJEA 4A3BG 4OWWB 4IPHA 2K5VA 2RF4A 2AHOB 4JI8Q 2PMZE 1G291 2MO0A 4RG1A 1B7YB 4PG3A 1Z47A 2V1CC 2WFWA 3S17H 4OO1I 4L5QA 3CAMA 4OONA 1YIJA 3KFUA 1SLJA 2F3IA 1JJ2A 1VQ9A 1HR0Q 4R4TA 4JI8L 2UUBQ 4DUZQ 5HY6A 3PUVA 1GD7A 2AWOA 4GN5A 2N3SA 2OQKA 4YCWA 5BR8Q 2Q2HA 1EWIA 4NB3A 1EOVA 3D0FA 1WOCA 2Z6KC 3I2ZA 4R4IA 5IP9G 1KC8C 4DR4Q 1X9NA 1Y14B 4YCUA 4HIKA 4A3MH 2C35B 1HR0L 2UUBL 4DUZL 2JQOA 4C2MH 2WAQG 1X3FA 2CCZA 2WB1G 3ER0A 5BR8L 2ZJQA 3TRZA 4JOIC 3OYYA 2D0OA 3HKSA 2PNHA 3G71A 1VQJA 4JI3Q 4DR4L 2XTIA 4XTCS 3M4PA 1VQHA 3CC4A 1Q86C 2RHQB 1PH7A 1JMCA 4B3SQ 5M3MH 3W1BA 3GTOH 1H95A 3CCRA 1VQCA 5LMUQ 2GVBA 4JI3L 1TWAH 1VCIA 1IBMQ 1VQ7A 1IBLQ 4R1JA 3RNUA 2YTXA 2E2IH 2EIFA 2F4VQ 4BBRH 1VQPA 4BA2I 4JYAQ 3K7AH 4MNOA 4B3SL 1VQAA 3GD7A 1M90C 4JBMA 2H5XA 5IYDG 5LMUL 1KAWA 4DR5Q 4NXNQ 5ELOA 5LMNQ 2OTJA 1E1TA 1IBML 3FKIH 3BU2A 4DAMA 1IBLL 1X3EA 4LF5Q 3FHWA 2AKWB 2KCMA 5ELNA 2F4VL 4JYAL 3BZKA 5C4XG 1CKNA 2I5LX 4DNIA 5IE8A 2JA9A 1DGSA 4NXNL 4DR5L 1VQ8A 1PHJA 4TQUS 2VW9A 2CQOA 5LMNL 1K8AC 1UWVA 1AE2A 1VQLA 3RZOH 4A76A 1NJIC 4LF5L 2KHIA 2PQAB 3NELA 1XPOA 1NMGA 2K5NA 4UP7A 4JI4Q 5IP7G 3PV0A 4BY7H 4IFDG 4MZ9A 1YBYA 4YHHQ 3PUXA 1HNZL 4IFDI 3BJUA 1OXVA 2GVAA 4GKJQ 2R92G 4YWMA 2UU9Q 3I4OA 2JA5H 1MKHA 3HOUG 4P71A 2E2JH 4JI4L 2YV5A 4HJ9A 4KHZA 3I4NG 4YHHL 4DR2Q 1XPRA 2Y0SG 1N34Q 4A3FG 1KRTA 3J81i 1QVGA 1OTCA 4GKJL 5IYBH 3HOWH 2RCNA 4A3LG 2RHSB 4MTNA 1PVOA 1QUQB 1A8VA 3WWVA 1XTDA 1C7YA 4WJ4A 4PMWA 4UPAA 4DR2L 3GTMH 3GTPH 3JC66 3OTOQ 4A93G 1N34L 1PH2A 4QIWE 3GDEA 4A3KG 2NZOA 3KJPA 4X65Q 4IOCA 4QJFA 3HOYH 2K75A 5M5YH 1WCMH 5GAHC 1PH1A 1K73C 3PF4A 3EIVA 2OWOA 5C44H 3OTOL 2JA6H 1KHIA 1VQIA 1YNXA 3A74A 3BZCA 2ZJPA 3S2DH 1P8LA 3TQYA 4AYBE 2E5LQ 4X65L 1SRUA 2IHFA 4GN3B 5HGQA 4GOPB 4AQYQ 1IL2A 3FP9A 3HOVG 1HZ9A 3STBC 3I56A 1VQEA 4XIGS 1NBWA 1U5KA 4A3EH 2E5LL 3S1QH 1FJGQ 4JCVE 1XNRQ 1Q1EA 1V9PA 4AQYL 2VQEQ 2NN6I 3EBEA 2R7ZH 4BY1H 1UE5A 1ASZA 3RLOA 3B6YA 3KDFB 5IWAL 1HNWQ 4YWKA 4JI6Q 1GKHA 2BA0A 4RMFA 4GLXA 2K4KA 4JI2Q 1SE8A 1A0IA 4A3CH 1FJGL 1XNRL 2VUMG 2VQEL 2OTLA 1XNQQ 1EYGA 1X6OA 2GN5A 2MO1A 4PZ6A 2PQAA 1Q7YC 3HOZG 1HNWL 5K36G 1B8AA 4H02A 1EQQA 1WFQA 4HJ5A 4JI6L 3S16H 4KHPQ 4JI2L 3F1ZA 2UXBQ 1VQFA 1SN8A 1Y1VG 4GLAC 3H3VH 3H3VI 3M85A 1L2FA 1I3QH 1N33L 4KHPL 1JE5A 3UE0A 3L2PA 2MNAA 4LF8L 2WAQE 3J81c 3F2BA 2WB1E 1FVIA 4DV5Q 4GNXB 2HT1A 2N49A 2UXBL 3STBD 4IPGA 5M3FH 3PSIA 2HHHQ 1L1OC 1LYLA 2B63H 4A3BH 4UP8A 1QUQA 4UY8C 1AH9A 1G51A 1WYDA 4DV4Q 4DR7Q 2L15A 2I5HA 4LFCQ 4GS3A 2HHHL 2ID0A 4LW1A 3Q8DA 1L0WA 3OW2A 1XMQQ 3L7ZC 2EXDA 1YJNA 1KRSA 2NVYH 3CPFA 1PV4A 3PO2G 1CSQA 4DV4L 3PO2H 1WJJA 5GADC 3L0OA 1LM0A 4LFCL 3I4MH 4A3DG 1SROA 1W3SA 1I5FA 3I55A 2NVTH 1Q12A 3PGZA 5E7NA 5IP9H 4GOPA 1XMQL 1JT8A 3JAMi 3CQZH 2ALYB 1HZCA 4JI1Q 4IOAA 4GN4B 4A4IA 4DV2Q 4C3IH 2K14A 1CUKA 3KF6B 1YVCA 3K81C 4P74A 4DK6C 1G6PA 3NEMA 4X62Q 3KDFA 3IRBA 4B3MQ 4JI1L 3HOXG 3UDFA 3A0JA 5C0XG 4DV2L 1J6QA 1FGUA 3NBHB 1E24A 3ICEA 5JJKA 3CC2A 4DAYB 3PIPA 4BA1I 4X64Q 1LTLA 2YTVA 3F8TA 1PH4A 3G6EA 1D7QA 3I4MG 1VQNA 4B3ML 4IPDA 4DV6Q 2KENA 1VQOA 3T1YQ 4LNQA 4APVA 3TREA 2Y0SE 3PO3G 4JBJA 4OWXB 5IYDH 4X64L 2ZJRA 2UXCQ 2KHJA 1X54A 1PH6A 2QEXA 3CXCA 3GTKH 1CKOA 5FLMG 4DV6L 2CKZB 2HIXA 5M5XH 5C4XH 3T1YL 4GNXA 3W1GA 1ASYA 3HFZB 2UXCL 4C3JH 1I94Q 4JI7Q 2EQSA 1QZHA 1KXLA 3J7ZC 2VY3A 1XPUA 3J7A5 1O7IA 1VS0A 5IP7H 5GAEC 2KCTA 1LUZA 1HZBA 1B70B 2BA1A 2Q2IA 2R7DA 3S24A 5C3EG 1I94L 4JI7L 3PIOA 2JA8G 5GROA 1PH9A 1VQBA 2YU9H 2B29A 2HIVA 1Y1WG 3G4SA 2R92H 3HOUH 2IX1A 4B3RQ 2R93G 1UE1A 1BBWA 1HJPA 2IX0A 3NENA 1I6HH 1HZAA 1OXSC 3UDXA 4X66Q 1C9OA 4Y7NH 3K0XA 3RZDH 3H0GG 1VQMA 2N78A 3JAMc 1OXXK 2YTYA 3CCUA 4A3FH 4DR3Q 2UXDQ 2UU9L 1QZGA 4B3RL 4A3LH 3RR5A 3CCSA 1VQGA 1JJGA 3A5UA 1X55A 4X66L 4DR1Q 4AIMA 4A93H 4DR3L 2UXDL 1V1QA 4A3KH 2K5HA 1BKBA 3M4OH 1N32Q 1Q81C 1EQRA 3CMEA 3RLFA 4DR1L 1PYSB 4DR6Q 2VZAA 1IYJB 1TWHH 4GLVB 1N32L 4ALPA 3GTGH 3HOVH 3CD6A 4JG2A 5IYCG 2MFIA 1XMOQ 4DR6L 2AWNA 3D31A 1PH3A 4IJLA 3LGJA 3ULPA 1UEBA 1VQKA 1X65A 1YJ9A 4DPGA 3U50C 4LFAQ 1XMOL 1EIFA 2I0QA 1I50H 1C0AA 4KLKA 3M3YH 2VUMH 4JBKA 1EIYB 1WI5A 2PI2E 4HIOA 4LFAL 1A62A 4YCVA 5FJ8G 3HOZH 4POFA 3U58A 4OXPA 4A3IG 5JJLA 2LXJA 2MQHA 2Z6KA 1S40A 1GM5A 4B3TQ 1UE7A 3W5OA 1K83H 3U4VA 1Y1VH 5GAGC 2FXQA 1XNQL 1PA6A 1Q82C 2IY5B 4L5SA 1KL9A 4JBWA 3PF5A 1YEZA 3VDYA 4JOIA 4QQBX 3RN2A 4JI0Q 4A3GG 2NZHA 4A3GH 2PI2A 3KYHC 2A19A 3S14H 1NE3A 2VQFQ 1E22A 3S1NH 3M7NA 4BBSG 1PH5A 4OX9Q 4QGUA 3HKZG 1BBUA 1X56A 4IFDJ 3AFPA 4JI0L 4DV5L 2DGYA 1IZ6A 3AEVA 4AH6A 2VQFL 4JV5Q 4NPSA 4OX9L 4DV1Q 4DUYQ 1P16A 4FDBA 3TS2A 1EUJA 2ASBA 1IXRA 1SR3A 4EQ5A 1A63A 1JJCB 2UUAQ 4DR7L 2D0PA 4LF7Q 1MIUA 4ME3A 4J15A 1CKNB 4IO9A 3RLNA 1YI2A 1FL0A 3K80C 3UDGA 4JV5L 4A3DH 3CCVA 3J80i 4DUYL 4TVAB 1VQ6A 1HNXQ 2ZTEA 2WP8J 2A1AA 4A3JG 3RN5A 2UUAL 4KI0A 3CP0A 2JE6I 4HJAA 3SGIA 5J3BA 4HIMA 4P73A 4A75A 1HNXL 4OO1G 3ERSX 3U4ZA 4WJ3M 1TXYA 5EAYA 5H1SE 4DV3Q 3HOXH 1YITA 3GTQH 1TWGH 2AMCB 2CWAA 2OQ0A 2JEAI 2OCEA 3E9HA 5C0XI 1PH8A 4LF9Q 2JK8A 4HJ7A 4X62L 4P75A 1QVFA 3CF5A 1NTGA 4DV3L 4IPCA 4A3MG 1W2BA 1L1OB 3GO5A 3PUYA 1HH2P 3AQQA 4LF9L 1IBKQ 2JA7G 3PO3H 2ZTDA 2D62A 4JI5Q 1GO3E 2JA7H 4C3HH 1HR0W 1RL2A 5FLMH 4R4OA 5JEAG 1YZ6A 3KLWA 5M3MG 3K8AA 5IT9c 1YHBA 4JI5L 1IBKL 4POGA 3M9BA 4LUZA 1Q8KA 1VQ4A 2F52A 3A5ZB 2VL6A 1XJVA 4LF4Q 3S2HH 1E1OA 3ZJYC 4BBRG 4OWTB 1YHAA 5C3EH 4LUOA 2JA8H 2HQLA 3MEFA 2VNUD 3M4QA 3FKIG 2Q2TA 2ZM6Q 4LF6Q 2CFMA 4DK3C 1Y1WH 4LF4L 3AFQA 2R93H 3J80c 2E2HH 4GOPC 1M1KC 3CPWA 3H0GH 1S3OA 3ULLA 3I4NH 4BXXG 1TWCH 4BXXH 2XGTA 2R6GA 2ZM6L 4DV7Q 1HNZQ 5GQOA 4LF6L 2CWPA 3T1HQ 2BH2A 1TWFH 4IJHA 3PCOB 2NVQH 3CCJA 5LMNW 2QGQA 4BY7G 3KF6A 4LUVA 1Q46A 4PZ8A 2K52A 3EN2A 3TEHB 5AJ3Q 4DV7L 3KF8B 3E9IA 3T1HL 3DLLA 2JA5G 4P72A 1N36Q 5M5WH 1VQ5A 1CSPA 1AE3A 1Q1BA 1YHQA 2ES2A 1GVPA 1D8LA 1E3PA 1K3RA 1MJCA 4O2DA 5AJ3L 2LXKA 5IYBG 5IYCH 3S1RH 3HOWG 1X3GA 3CW2C 1N36L 2NVXH 3S1MH 2JEBI 3CMAA 4LFBQ 3GTLH 1L1OA 4O0AA 2I5MX 2LSSA 2R7FA 2Z0SA 1J5EQ 2A8VA 3HKZE 3TS0A 2KBNA 2K50A 1KIXA 3J81j 5C0XJ 4JC0A 4GNXC 3HOYG 1QVCA 5JJIA 4GKKQ 4LFBL 1WCMG 5DLQE 4YWLA 3F2DA 3CCLA 1N9WA 4L5TA 1K0RA 5C44G 2Q2UA 1J5EL 4NXMQ 2JA6G 3UDIA 3KOJA
chains in the Genus database with same CATH superfamily
5FJ8H 3A8KE 3J7YW 2PMZB 1A2TA 1JWSD 1SNDA 5FLXE 1BF4A 4R4QA 3F2CA 1RIPA 4K5VA 3CCMA 1D2BA 3MXNB 1PYBA 1QNKA 5D14A 4G7OC 1G91A 4E6IA 4DV0L 4H44C 3TSSA 1H9SA 2SDFA 5C4XB 2F0HA 4JVZA 4Y52H 4X6AH 1N33Q 2QA4A 3RZOB 1LT5D 1UE6A 1DXMA 2VS1A 5KRUA 1OXUA 1SMXA 5CYUA 1TS4A 4AYBG 1V43A 1VQDA 1Z9FA 2BH8A 1Q90A 4CDDC 1SFOH 2IW3A 2EJMA 1BBXC 1JB7A 2DUDA 4LF7L 4LWCA 2K5VA 1HCZA 4RKLA 1II3A 3URYA 1Z47A 2XWJB 4L5QA 3BG3A 1SLJA 5ELDA 1VQ9A 1TS3A 1ONLA 1TS2A 4JI8L 1I6VC 3L3OC 2AWOA 4GN5A 1Z6HA 5IP9G 2Z6KC 5IGFA 4DR4Q 3OW7A 4YCUA 1HR0L 4DUZL 1H9JA 2JQOA 2WAQG 3ER0A 3OYYA 1U4MA 2RBMA 4A3EB 3S1QB 2QILA 3IFTA 1U4LA 4XTCS 2F0IA 5C3XA 1VQHA 4JPBW 1WTOA 2O5IC 1PTOD 3I70A 2RHQB 1PH7A 4B3SQ 5M3MH 1AEXA 3CCRA 1KAAA 3DHQA 1TWAH 3EFXD 4RHRA 5EJWA 2QDBA 4MNOA 1RTNA 4IN3A 2H5XA 1B9MA 4H13C 5A2QL 5LMNQ 4RH6A 2M00A 4HR7B 1HQRD 4IUNA 1GHKA 2F4VL 4JYAL 5C4XG 1DGSA 4KY7A 4TQUS 2CQOA 2KHIA 1IKLA 1UNSA 1QG7A 1XPOA 1YNJD 3VR5A 4JI4Q 2DN8A 4A3BB 2FMMA 4MZ9A 1YBYA 4RHSA 4IFDI 5CMDA 3EJIA 2GVAA 2MP1A 3MTSA 4FP5D 4P71A 2YV5A 3T51B 2Z4IA 3P75A 2DNEA 4KJNA 1OTCA 4GKJL 1LACA 1F2YA 3K0YA 3KBXA 3I4MB 2Z4HA 3D6CA 1PVOA 3DUZA 4UPAA 3GTMH 3GTPH 4A93G 3JC66 1D1KA 3OTOQ 3GDEA 1CFMA 2NZOA 4FF4A 2WB1B 4X65Q 4C3IB 5DNFA 1WCMH 1PH1A 2B2WC 3A74A 2IPKD 2CQAA 4AYBE 2E5LQ 1QCBD 2OEOA 5HGQA 1IL2A 5ISRA 1KLUD 3I90A 4LK1C 4XIGS 1U5KA 2SOBA 4S3SA 4RWSC 5JPMC 5D3IB 4JCVE 2ZXOA 2NUCA 1Q1EA 4AQYL 2VQEQ 3R3OA 1HA6A 5IGBA 1LABA 3KDFB 5IWAL 1HNWQ 4JI6Q 1PZKD 4GLXA 2M9VA 1BCPF 1H9RA 1WD1A 2DY8A 5M5XB 2NWGA 1STEA 1SNQA 2K7VA 5DAUA 1EZ6A 4LAAA 3T56B 3J81L 1PTOH 3J81E 4H02A 3IAYA 3H09A 4JI2L 4CHTB 2UXBQ 1O7LA 1M8AA 1SN8A 1V1OA 4GLAC 3KUPA 1WTQA 2EYMA 3TN2A 4KHPL 1JE5A 2XNAC 2WAQE 4DV5Q 1FVIA 3PSIA 2F0EA 3I4NB 4CDCC 2AQ2B 4UY8C 2L15A 2HUGA 2LMCB 1CK1A 2HHHL 1L0WA 3OW2A 3L7ZC 2EXDA 1B1ZA 2NVYH 3MZ5A 1PV4A 3M4OB 1CSQA 1HRJA 1WJJA 1O80A 3V96A 1LM0A 1UUPA 1SROA 3NBIA 4CDFC 1I5FA 2SEBD 5IP9H 2K05A 3FRPB 1JT8A 1IYUA 1TWHB 3JAMi 3HRZC 3CQZH 2ALYB 4Z9CB 3TMEA 1MHWC 2R3ZA 5IGCA 4JI1Q 4GN4B 3TP6A 1CUKA 3KF6B 2B2VA 1YVCA 4OHJA 2N55A 2F0QA 3KDFA 3IRBA 4B3MQ 3HOXG 2JXMB 1LLRD 4P2CB 5C0XG 1NNXA 2NYZD 1FGUA 3NBHB 1E24A 5JJKA 2XRSD 4X64Q 1PH4A 2N88A 3M3YB 2VUMB 4IURA 2V4DA 1ET6A 3HG9A 4EVOA 1VQOA 5EKIA 3HOZB 1SE4A 4HMIA 4OWXB 1X54A 4C3HG 4IUQA 2QEXA 4FXDA 1Y1VB 5CR3A 1CKOA 1GUOA 5C4XH 3T1YL 3T13A 2NZ1D 2CH4A 1STNA 3S14B 1BNZA 1QZHA 1KXLA 4KV6A 1SDFA 1A3TA 2KUMA 2KCCA 5GAEC 2BA1A 1I94L 4K5WA 3K57A 2YU9H 3D3RA 1KLGD 1UAPA 1UE1A 2RSOA 1HJPA 5F2DA 1I6HH 1CM9A 3D4DA 3C1EA 3K0XA 4X66Q 1L0YB 3RZDH 1VQMA 2YTYA 4M1UB 1QZGA 4B3RL 1BR9A 4DR1Q 3P1HA 4A93H 2ZXPA 1U9RA 1BKBA 1EIGA 5CBEE 3NBHA 3QO2A 3GTQB 4PNYA 1N32L 2DY7A 3GTGH 2MFIA 2F0JA 1X65A 2RSNA 1LT4D 1AP0A 4UAIA 4FXKC 1EIFA 3MHBA 1G2SA 1B3QA 3QOLA 4J6HA 1EZ8A 3ND8A 2Z6KA 4QMGA 1LTRD 3A56A 3D8GA 3NP8A 2F0MA 2FXQA 5GAGC 1BDOA 1Q82C 3A7AB 2IY5B 2B2TC 5C3EB 1AW7A 2JA8B 3GV3A 1ENAA 4DAPA 2NZHA 4A3GH 2PI2A 2A19A 1Y1WB 3V05A 2R93B 1E22A 4R9WA 4BBSG 1PH5A 4OX9Q 3LWEA 3H0GB 3NTHA 2DGYA 1V8QA 2XIWA 4AH6A 5CV8A 2VQFL 1AN8A 1PFMA 2NVQB 3HZXA 4FDBA 3TS2A 1SR3A 2UUAQ 2Z9HA 4OGQC 4LF7Q 2I07B 4KKSA 4IO9A 4J15A 4JV5L 3RLNA 5M5WB 4DUYL 4B9XA 4XDXA 2Q8RE 1HNXQ 2A1AA 4A3JG 1PTOC 4WRDA 3S1RB 4KKTA 2NVXB 3DMUA 1JC7A 3O13A 4A75A 3GTLB 1WTRA 4WJ3M 5H1SE 3HOXH 4Q0FA 4CKEA 2PZUA 5C0XH 1TU2B 3E9HA 3NQIA 4HJ7A 5C5MA 4P75A 2CHBD 4A3MG 2RDFA 4FYDA 1PYWD 4RA8A 1F2LA 3AQQA 4ZLTF 1IBKQ 4LF9L 3VYSA 3LWUA 4JI5Q 1HPCA 2K1BA 4C3HH 1HR0W 1PXUA 4RCNA 1LTSD 1X32A 2A6ED 1GUGA 2K5QA 4RGMA 1BXTA 4QUFA 1SMYC 1ICFB 1YNND 3SK6A 1Q8KA 2B2WA 1RTOA 1VQ4A 2F52A 2WKDA 3J80L 3A5ZB 1XJVA 3HKZB 4BBRG 1IL8A 4OWTB 4LUOA 1U4RA 2HQLA 2VNUD 2PYKA 4IUPA 4DK3C 2ZM6Q 3AFQA 1KDAA 2RCFA 2E2HH 3CPWA 4BXXG 1SFOB 1EY9A 4DV7Q 5JVG3 2CWPA 2OXPA 4KD3A 2QGQA 4HMJA 4CBVA 1Q46A 2F3WA 3EN2A 4ZRZA 2WV6D 3PIP3 2KOLA 3E9IA 2L9HA 4P72A 1VQ5A 1D5ZC 1CSPA 2PZWA 3SE0A 2ES2A 1GVPA 1K3RA 1Q8IA 3HOWG 2L5TA 1BOSA 1LT6D 1JOQA 1W6JA 3G6JB 3TS0A 1KIXA 1CA5A 1SYGA 5C0XJ 1GUTA 1QB5D 4JC0A 4GNXC 3HOYG 2A68D 4GKKQ 3F2DA 1JB3A 4L5TA 2X6LA 4ZYSA 5C44G 4NXMQ 2JA6G 3BDOA 1F9PA 2PZTA 1WD0A 5KIXA 3KOJA 3ULLA 5M3MB 2PO4A 1TWAB 4TRDA 5IWAQ 4WFN3 1R4QB 3I7FA 3PQIA 3GTJH 2NN6G 3FPUB 4DNTB 2UUCL 2F0KA 2PW5A 3FDTA 4BY1G 2R7ZG 3G48A 4R4CA 4Q5VA 4OIJA 4QY7A 4DKAC 4YY3Q 4A3CG 4K0KL 1PZJD 4BBSH 3PUZA 5LL6S 3KJOA 1EY8A 4K5XA 5IY0A 3K7UC 1S5FD 2IT1A 1EU4A 1CQFA 1B9NA 4LJZC 4O1NA 2EYPA 2YYZA 2B39A 2F0LA 4K6DA 1STGA 2ZTCA 4L8JA 1K0SA 1A3UA 4DA2A 1CKMA 3IFDA 4L5RC 4RFBA 5D65A 5C4JH 3H15A 5M3FG 1C8CA 1JR0D 1OXTA 4A3JH 2B63G 3T4AC 1MJEA 4OWWB 4IPHA 2RF4A 1J9OA 1G291 2WFWA 3MFYA 4OO1I 3GTPB 3GTMB 1PZID 3KFUA 2SNMA 1JJ2A 4R4TA 1GD7A 1K28A 1WCMB 5BR8Q 2Q2HA 1EWIA 1EOVA 1T5XD 3D0FA 3I2ZA 5T1GA 4OL7A 4A3MH 2C35B 3KLRA 2UUBL 1X3FA 5KNCA 3TRZA 2F0SA 3HKSA 1WTVA 3EQLC 1ZYRD 1STAA 1DOLA 5IOCA 1Q86C 3P7JA 3TP5A 4O42A 1AZQA 3GTOH 3W1BA 3I73A 2F0TA 4JI3L 2HCIA 2AQ3B 1VQ7A 1IBLQ 4MN3A 4R1JA 1IKMA 4BBRH 4BA2I 3K7AH 3VR3A 1J8IA 1M90C 1PLFA 1PTOB 4CGYB 4DR5Q 5IYDG 5LMUL 1KAWA 1E1TA 1IBML 5M9OA 3BU2A 1X3EA 3FHWA 4RGOS 1DYQA 2AKWB 3X3MA 5ELNA 4AYBB 3BZKA 4C1NI 5DM73 4DNIA 4NXNL 1PHJA 2VW9A 4C3JG 1UWVA 1VQLA 1SNOA 1NJIC 4LF5L 5FK9C 2K5NA 3I3CA 2F0UA 2KEEA 1HNZL 1EYAA 2F0PA 2B2TA 5CV4A 4YHHL 2BOSA 2NVYB 2Y0SG 1N34Q 4A3FG 3HOWH 2RHSB 1XTDA 4WJ4A 4DR2L 3CQZB 1PH2A 4A3KG 4EQOA 2KVMA 2WAQB 4IOCA 2H1EA 4QJFA 3HOYH 3SXHA 2EYJA 3PF4A 2OWOA 5C44H 2JA6H 1VQIA 1P8LA 4MHEA 2XSCA 3BVGA 3HOVG 1VQEA 3SEBA 1FJGQ 1E2WA 2NN6H 2R7ZH 3FMCA 4BY1H 1UE5A 3P20A 2VB3X 4YWKA 2BA0A 2EXZA 4RMFA 4OEMB 4PV1C 4A3CH 4ZKBB 3L9AX 1XNRL 3DXJC 5EBDA 2LFNA 1EYGA 1X6OA 4L6TB 4PZ6A 1IW7D 4QF4A 1RJTA 2NB0A 1K8OA 5EBCA 4HJ5A 2B8GA 3DWAA 4PQXA 3KF8A 3H3VI 1EQTA 1JWMD 3M85A 1I3QH 1DOKA 3UE0A 2MNAA 2YU9B 4GNXB 4QUCA 3STBD 4IPGA 5M3FH 1I6HB 3RZDB 1LYLA 3QB3A 2B63H 1RODA 4UP8A 2G5DA 1SYFA 4FNFA 4LFCQ 2ID0A 4A93B 1GUSA 1XMQQ 4DV4L 1I4XA 3PO2H 5GADC 2EYLA 5IODA 3I55A 5E7NA 2NVTH 2B2YC 2A6HD 2KEDA 1SYBA 1WTHA 3GTGB 1HZCA 1SE2A 4A4IA 4DV2Q 5EKLA 3MXNA 3K81C 4P74A 1G6PA 1Y8NB 2ICIA 4DXGA 4DAVA 5EPKA 2AUJD 2IWHA 3UDFA 2EOTA 1I4QA 3ICEA 3CC2A 1PRTD 4DAYB 4BA1I 1LTLA 3G6EA 2IL8A 2KQ3A 2ZXRA 2KENA 1WTPA 2Y0SE 3OHXC 3PO3G 4JBJA 5IYDH 5A2QE 2KHJA 4FF1A 3CXCA 1R4PB 1F77A 4DV6L 2P5ZX 4GNXA 3W1GA 4PMBA 1DZ1A 3T53B 2UXCL 4A3GB 4C3JH 4JI7Q 2EQSA 1HXYD 2VY3A 1O7IA 1TIID 2E75C 3JAML 2X69A 1QOHA 2KCTA 5I2YA 1IYVA 5HGTA 2G9DA 2HIVA 3G4SA 1JWUD 2K04A 2IX0A 3NENA 1I4HA 1OXSC 1SSOA 2A69D 3UDXA 4Y7NH 2N78A 1OXXK 3DM1A 4A3FH 2A68C 3CCSA 3A5UA 1X55A 1WTXA 2WIIB 4DR3L 2UXDL 4A3KH 1FD7D 1GOZA 2NTTA 2RKSA 1U4PA 1Q81C 3RLFA 1PYSB 4DR6Q 5FOBB 3SK5A 3HOXB 4KN4C 4DAYA 5NUCA 4ALPA 3HOVH 4JG2A 3NTKA 1Y69U 1NAPA 3CHBD 2AWNA 3D31A 3LGJA 1EYCA 2EPBA 1YJ9A 2TMPA 3U50C 4LFAQ 1XMOL 2FINB 2KECA 4KKUA 4C3HB 1I50H 4KLKA 1Y8OB 5E4WC 4YCVA 4POFA 3U58A 4OXPA 4A3IG 5JJLA 2MQHA 3SHLA 4HCEA 3W5OA 2F0VA 3U4VA 4JK1C 1KL9A 4JBWA 1YEZA 1RDPD 3MXPA 4A3GG 2ICEC 5G3LD 3S1NH 2E2HB 4FVMA 2HCCA 4JI0L 1IZ6A 1LTTD 5JAVA 3J7AF 4K2LA 1EFID 3NSWA 3SVMA 3BYTB 1P16A 4MIUA 4N8X1 4BY7B 2VXWA 1A63A 4DR7L 2D0PA 3OIPA 4ME3A 1CKNB 3UDGA 3K80C 3RD4A 3OWFA 3CCVA 2C9OA 4G7HC 4TVAB 1VQ6A 5C5LA 2EYFA 3CP0A 4UHVA 3PMFA 2JE6I 2MUYA 3ERSX 2F0WA 1TXYA 5EAYA 5K5PA 2LY7A 4EQPA 4BWGB 3VA7A 1NTGA 4DV3L 3EROA 1W2BA 4XQQA 5IT9L 3NPPA 3W3AA 5IT9E 3PO3H 4M8AA 2D62A 2JA7H 2D2CC 1MI2A 5JJZA 3GTJB 3LNNA 1YZ6A 3KLWA 1YHBA 4I7AA 3M9BA 1NR2A 3VYUA 4H7BA 4BBSB 1SBBB 2Z1CA 4KD4A 1E1OA 2K5DA 2OT2A 4ABNA 1SJHD 4ZKCB 1K8MA 1MGSA 3FKIG 3MC0B 1AZPA 2Q2TA 2CFMA 1B2TA 2EY2A 2QDLA 4LF4L 4GOPC 3VYRA 5KYIA 4FF3A 2XGTA 4HSPA 4LF6L 1HNZQ 5C4JB 1TWFH 2J7ZA 4A3JB 4BY7G 3KF6A 4LUVA 4KJOA 3VYTA 4PZ8A 3VR2A 5AJ3Q 3DWQA 3NQTA 3T1HL 4XXEA 3DLLA 2JA5G 3BZDB 1JQYD 1Q1BA 3AMUA 1YHQA 1SEBD 2PCFB 2XWBB 5C4ZA 2F0GA 1HFGA 1X3GA 1N36L 3S1MH 2JEBI 4LFBQ 1DONA 2QKIC 2EE1A 1J5EQ 2Z0SA 4A3MB 4CKCA 2K50A 5LHY1 1OO9B 1VMPA 5DLQE 4DU9A 1SYEA 2TSSA 4J8QA 3PIO3 3GTOB 2IHEA 3AYHB 2J4XA 4A3IH 4DV0Q 2JJQA 1S5CD 3E0EA 4BBRB 2RDGA 3K7AB 2ATWA 4IUUA 4HJ8A 5JEAJ 1BVSA 1NY4A 3PUWA 1Y8PB 3DM3A 1EFWA 1E7ZA 2HQEA 5FLXc 3H91A 4X3TA 2ZT9C 2RA4A 3OWEB 1CZGA 2E2DC 1FNVA 2Z6BA 1N8RC 4ZCKA 2O5JC 3MVVA 1PFSA 5KNDA 1FGBD 5ELCA 3CCQA 5EKKA 2N8NA 5J1ZA 1YJWA 3WOFA 3U9OA 1S4ZA 4HIDA 2K33A 2VB2X 3T16A 2E8GA 2EYHA 4PMCA 3OMCA 3HOWB 1JE4A 3IL8A 2AHOB 4JI8Q 1PRTC 2MO0A 1SE3A 1B7YB 4PG3A 2V1CC 3K5MA 5CBAE 4OONA 1BUVT 2QEJC 1E0BA 2LS01 1HR0Q 4DUZQ 3HOYB 5HY6A 3PUVA 3K5OA 1L0XB 1XXGA 4YCWA 4NB3A 4R4IA 5C44B 2JA6B 1X9NA 1C48A 5JOBA 4HIKA 4F88A 3DEPA 1LTAD 3J7AV 4C2MH 2ZJQA 4ILWA 3QJYA 4HSVA 4JOIC 3NUCA 2PNHA 3G71A 1VQJA 1YNJC 4DR4L 2XTIA 3C3LA 3M4PA 2BE5D 1F9SA 2R7ZB 4BY1B 1JMCA 1H95A 1W6KA 1VQCA 4ODGA 3NHHA 3GQBA 3AU7A 3CKIB 1VCIA 1T5EA 4UDUC 3J80E 5EQ0A 4G7ZC 2YTXA 2E2IH 2F4VQ 1VF5C 4R8IA 4JYAQ 1E2ZA 4B3SL 4JBMA 3GD7A 1ILPA 1G2TA 5E4XA 1H9KA 1TKWB 1SAPA 1ZXTA 3FKIH 3GP7A 4DAMA 1F9RA 4K8JA 3I72A 5IIFA 1PDQA 4FF2A 1S5ED 2I5LX 1I3QB 2JA9A 3ITPA 1PTOF 1VQ8A 5LMNL 3E6ZX 1K8AC 1AE2A 4A76A 5M3FB 4J1MA 2F3VA 4UP7A 3PV0A 2B63B 4TSSA 4BY7H 1STHA 5ELBA 3PUXA 1KDBA 1ZKOA 4GKJQ 2R92G 3HOUG 2JA5H 5I9PA 4JI4L 2E2JH 3TZDA 1XYIA 4KHZA 4FXGC 2AQ1B 5CV7A 3A54A 3PO2B 4X3UA 1EY0A 4DF7A 1QUQB 1A8VA 3WWVA 5KEEA 2NVTB 4PMWA 5I2XA 4QIWE 4ZUIA 5M5YH 1GJXA 1A15A 1BCPD 3OTOL 1KHIA 1STBA 3S2DH 4X65L 1SRUA 2IHFA 4GN3B 4GOPB 4AQYQ 4XQNA 1HZ9A 1EYDA 3RUZA 1NBWA 1CTMA 1A3VA 3MXGA 2E5LL 3EBEA 1ASZA 3RLOA 2B2UC 1GKHA 2K4KA 4JI2Q 3C46A 1QILA 2VQEL 2GN5A 3ONAB 3MFGA 1HNWL 3N6RA 4C3JB 1EQQA 1WFQA 4JI6L 3S16H 4KHPQ 1EIHA 4KY5A 4F7XA 1VQFA 1I4PA 5C4HA 1S5DD 4LF8L 3J81c 2A5HA 2HT1A 2NTSA 2UXBL 5CV9A 2X6GA 5CGKA 4IZ8A 4Y7NB 2HHHQ 1L1OC 1NR4A 2Y0SB 4A3FB 1QUQA 1AH9A 2LKVA 4DR7Q 3E0JA 4KHVA 1NSNS 2MPMA 1YJNA 4A3KB 1KRSA 2EY6A 3PO2G 2F0NA 2F0FA 4A3DG 2FMCA 3KLSX 1Q12A 3PGZA 4GOPA 1PFBA 3MAQA 3HOVB 4IOAA 1EY5A 3KLSA 1HTPA 3OIQA 4DK6C 1EY7A 3MEHA 3NEMA 2ENBA 4JI1L 3DWPA 3A0JA 2F0OA 1J6QA 5COYA 4ME5A 1GUNA 1KABA 1I50B 3PIPA 1D7QA 2YTVA 3F8TA 1VQNA 4B3ML 2XRQD 5HURA 3T1YQ 4LNQA 3NXWA 3EA6A 3TREA 3TP8A 4X64L 2ZJRA 1PH6A 1PRTB 3ERQA 3R8BA 3GTKH 3UI2A 3R93A 2CKZB 2HIXA 2EJFC 1FR3A 3QWNA 3HFZB 1I94Q 4U68A 3S1NB 5IGEA 3J7A5 1VS0A 3BYYB 4RCOA 4G4KA 1RKNA 1LUZA 1B70B 2Q2IA 3MWYW 5JVH3 4LMQD 1S5BD 5GROA 2FHTA 1VQBA 2KJXA 2R92H 3HOUH 4B3RQ 2IX1A 1HZAA 2Q2UA 3LX0A 4ZAIA 4KY6A 2UU9L 2A73B 5J39A 2B2VC 4X66L 1X3QA 1V1QA 2WACA 3SDZA 4QCLA 1N32Q 1EQRA 4ULLA 4DR1L 4NDXA 1NUCA 1IYJB 1HUMA 4K6LA 3CD6A 5IYCG 3NK9A 4KMUC 4U673 4CJ1B 1PH3A 1QNUA 1JORA 2WKCA 5BN4A 3PO3B 4RAUC 4G57A 2I0QA 2JA7B 3K5NA 1C0AA 3BDCA 2RDHA 4R8NA 1G8ZD 2K03A 5A35A 5FLXL 1S40A 1GM5A 2OF1A 1UE7A 1XX8A 1K83H 1XNQL 1PA6A 3SK8A 3BVZA 3PF5A 3VDYA 4QQBX 4JOIA 3WDNA 3TP7A 2M2LA 3KYHC 3I91A 1RF2D 2VQFQ 1I4RA 1H9MA 1BBUA 1X56A 5IGGA 3AFPA 5I4DA 1HQMC 4RGTA 4JV5Q 4DNRB 1TWFB 4NPSA 4OX9L 4N9PA 4DUYQ 2Q8IB 1EUJA 2ASBA 4EQ5A 1JJCB 3GV6A 1MIUA 1GXDC 1B50A 1ESFA 4JW0A 4A3DH 3K59A 1ML0D 1F9QA 2A6EC 2BE5C 5KYLA 3RN5A 2UUAL 1EEFD 4KI0A 3K58A 1V1PB 1YNNC 3SGIA 3S1MB 4P73A 1HNXL 4OO1G 1ZEQX 5KNBA 4C1NK 1LTBD 1TY2A 1YITA 1TWGH 2AMCB 2OQ0A 2JEAI 2OCEA 5C0XI 1SJED 1Q3LA 1F2ZA 2IX3A 4LF9Q 2EY1A 2XVSA 4X62L 2D5DA 5IGDA 4IPCA 1EEID 1D1IA 1L1OB 3PUYA 1O7ZA 1CT1D 4A3IB 2JA7G 1GO3E 1MD2D 5CC4A 1EOTA 4R4OA 5JEAG 1IBKL 3K8AA 4XQJA 3IKJA 4JI5L 3FEWX 4LUZA 2KCNA 5CORA 3S2HH 3JAME 4CDEC 3MEFA 1EWHA 2CH4W 2EVBA 5TSSA 4OELB 5EPJA 3J80c 2NBFA 2B2UA 1TWCH 1B44D 2ZM6L 1ET9A 5GQOA 1BCPC 4IJHA 3PCOB 1V1PA 1HA5A 5LMNW 2A74C 2MJ8A 4XT3B 1HTLD 4DV7L 1SMYD 4N8FA 1JCKB 3NWSA 4TKOB 4XYOA 2HDLA 1E3PA 1MJCA 3C2PA 4O2DA 2HDMA 4RKBA 1NCVA 4X3SA 5IYBG 5IYCH 1SNPA 3CW2C 3CMAA 1L1OA 1LV9A 4O0AA 2LSSA 4ZQ3A 4ZUJA 1JOKA 1KTKA 2QW7A 2JP1A 2KBNA 4C2MB 1RHPA 3J81j 1QJOA 1WTWA 5JJIA 1DM0B 3CCLA 3K6OA 1K0RA 5KGUA 3M4YA 1CQVA 4B9WA 1EY4A 4GKKL 2UUCQ 4DN4M 4K8IA 4QL5A 5I6YA 4I7ZC 4NXML 3S15H 3U9SA 1EL0A 4DK1A 2AUKA 2DJGC 1CI3M 4A3EG 1K8GA 4K0KQ 2E2IB 1TQOA 2DJFC 4UP9A 2D9UA 1U0LA 3ULJA 4B3TL 1KD1C 1VMCA 3FKIB 2QCPX 2C5CA 4HEDA 1HFNA 2Q8TA 1E2VA 3UE1A 4IUTA 2RVLA 3CCEA 1ENCA 3A8JE 4YY3L 1KQSA 4LF8Q 4EX5A 1I4GA 2EDGA 1KNAA 3QR8A 4CJ0B 1T9HA 1R9TH 1S72A 2JA5B 4PZ7A 1ZYRC 4DV1L 1K9MC 2E2JB 2B3GA 1NMFA 2F1MA 4A3BG 1BQQT 3CC7A 1PMRA 2PMZE 4RG1A 3S17H 4OO1H 2CW0D 3CAMA 3Q23A 1YIJA 2F3IA 4HN7A 2UUBQ 5M5YB 1A6XA 3I4MG 2N3SA 1FYCA 1A2UA 1SYCA 2OQKA 2F0DA 1QVGA 1KC8C 1MBYA 1WOCA 3Q24A 3S2DB 1Y14B 1JICA 2CCZA 2WB1G 5BR8L 4C3IG 3R2TA 2D0OA 1CA6A 4IQZA 4JI3Q 1FNUA 4KK7A 4ID6A 5ELEA 3SK4A 1EQVA 1G6ZA 3CC4A 1TY0A 4F87A 3G7LA 5JEAH 5LMUQ 2GVBA 1FNWA 1AFPA 2JN4A 1IBMQ 2EZVA 1D6EC 3RNUA 4QIWB 2EIFA 1VQPA 2JSOA 4V0BA 4L5SA 1VQAA 4NXNQ 3BDLA 3S16B 5ELOA 2OTJA 1IBLL 4LF5Q 2PNRC 2KCMA 2L12A 1CKNA 5IE8A 3S9WA 4DR5L 1DD2A 2EYOA 3RZOH 1RCVD 2PQAB 3NELA 3HS0C 2O4XA 1NMGA 1ENFA 5IP7G 4IFDG 4YHHQ 3BJUA 1OXVA 1KNEA 4YWMA 3HEJA 3I4OA 2UU9Q 1MKHA 2K01A 5E3FA 1HHVA 4HJ9A 2FJ2A 4DR2Q 1XPRA 3A7LA 5D3DA 3I4NG 1KRTA 3J81i 2I46A 3R2IA 5IYBH 4EQNA 2RCNA 4A3LG 4MTNA 1C7YA 1N34L 2L4NA 1IW7C 4IALA 4MTKA 3KJPA 1TS5A 5FO8B 1EY6A 2K75A 5GAHC 4YIJA 1K73C 3EIVA 1VF7A 3CRLC 1YNXA 3BZCA 2ZJPA 3TQYA 3VR6A 3FP9A 3STBC 2B2YA 3TDQA 3I56A 4F8MA 4CKBA 1ESRA 1BCPB 1X3PA 4A3EH 3S1QH 3HP3A 1XNRQ 1V9PA 2NN6I 1Z7TA 3MXUA 1TT2A 4K14A 3B6YA 1STYA 1O7YA 1B4OA 3OOCA 4HCSA 1SE8A 1A0IA 3GTKB 1FJGL 4ZK9B 2VUMG 3ND9A 5EGTA 2OTLA 1XNQQ 1Q7YC 2MO1A 4WJWA 2PQAA 1KDCA 4CJ2C 3HOZG 1MSHA 5K36G 1B8AA 2QF7A 3QOJA 2FFKB 3F1ZA 1M4VA 1Y1VG 2A6HC 4C56C 1ICWA 3H3VH 2IJ0A 1L2FA 1N33L 3I4LA 3L2PA 3F2BA 2WB1E 4EGVA 2N49A 3HOUB 2R92B 1VDZA 2K28A 5LL6X 1LTID 5EPLA 5T1IA 4DXFA 2DNCA 4A3BH 1G51A 1WYDA 4DV4Q 4FO2A 2I5HA 4DFAA 3C1FA 4GS3A 5AFWA 4LW1A 3Q8DA 1JOOA 3QIAA 3CPFA 1DJRD 3L0OA 3TZUA 3E5SA 4LFCL 3I4MH 1W3SA 1DOMA 1XMQL 3MA2B 3D4RA 2H4OA 1C4QA 4C3IH 2K14A 3OSOA 3E3XA 5FO7B 3KBGA 4X62Q 4DV2L 1CHQD 3BVMA 2A69C 2XN9C 1SXTA 3M7GA 2KA7A 4IPDA 5BN3A 4DV6Q 3WOEA 4APVA 4NKLA 1PFNA 2UXCQ 1XWEA 1K83B 3TBIB 5FLMG 3H94A 3W2DA 5M5XH 1QE6A 1ASYA 4NW2A 1DCZA 1BO0A 1PRTF 3J7ZC 1XPUA 3NTIA 2BCOA 3D4WA 3EVQA 2MHVA 1QWYA 5IP7H 3K5LA 3S24A 1HZBA 5C3EG 4IFDH 2R7DA 4JI7L 2JA8G 3PIOA 1PH9A 2B29A 5E1FA 1Y1WG 2R93G 2RQXA 4GZYC 1BBWA 1C9OA 3I4NH 3H0GG 4OIKA 3CRKC 3JAMc 3CCUA 4DR3Q 2UXDQ 3H6MA 4A3LH 1TVXA 3D6WA 3RR5A 4A3DB 1VQGA 1JJGA 2E74C 5DEHA 4AIMA 1B3AA 1WVLA 1GHJA 1F2MA 1EU3A 2K5HA 3M4OH 3F2UA 3CMEA 3BS1A 5JPNC 1SYDA 4NP5A 2VZAA 1LTGD 3OMGA 2O2LD 1CZWA 1TWHH 1TWGB 2PW7A 4GLVB 4B08A 2G9HD 2K32A 1MSGA 5J22A 1XMOQ 4DR6L 4XYQA 2L11A 4IJLA 5ELFA 3ULPA 1UEBA 1VQKA 4DPGA 1CHPD 3M3YH 4XT1B 2VUMH 4JBKA 1EIYB 1WI5A 2PI2E 4HIOA 4LFAL 1A62A 5CV5A 5FJ8G 3HOZH 5K36H 1IHZA 2LXJA 2E76C 4B3TQ 1TR5A 5C6AA 3V2TA 1Y1VH 3S2HB 3Q6SA 3Q22A 3NE5B 3RN2A 4JI0Q 1SNMA 3S14H 1NE3A 2CW0C 3M7NA 4HAEA 3ZYYX 1SNCA 2B8FA 4QGUA 3HKZG 4IFDJ 3A55A 4DV5L 1TWCB 4KN7C 2SNSA 3AEVA 4I65A 4BS9A 4DV1Q 1K3BC 4WORA 4KTAA 1O78A 1IXRA 3KK7A 5DM63 1YI2A 4DK0A 1FL0A 5G3LF 4X3KA 4H0LC 3J80i 3I8ZA 2ZTEA 2WP8J 4N9TA 3VR4A 4K2KA 4HJAA 4HTHA 5J3BA 3NWTA 4HIMA 3H3VC 3U4ZA 4DV3Q 3GTQH 2CWAA 3N52A 1PH8A 3OPOA 2JK8A 5BN5A 1QVFA 3CF5A 2L0CA 3GO5A 2L1BA 1HH2P 2WINB 2ZTDA 3S15B 5CV6A 2EY5A 3CU7A 1RL2A 1D5XC 5FLMH 2JYOA 4V190 1ILQA 1LT3D 5M3MG 5IT9c 2HD3A 4POGA 3Q0AA 2Z8LA 1B53A 3HGBA 2VL6A 4LF4Q 3ZJYC 1UEAB 1YHAA 4NMZA 5C3EH 2JA8H 3VA5A 3M4QA 4L63B 4LF6Q 1Y1WH 2R93H 4IUVA 1M1KC 1H9SB 2EJGC 3H0GH 1S3OA 1D5MC 4BXXH 2R6GA 1R9TB 4DGZA 3T1HQ 2BH2A 2J0TD 2NVQH 3CCJA 1XTCD 1HUNA 2K52A 2L55A 3TEHB 3KF8B 2CVRA 3FVQA 1N36Q 5M5WH 3S17B 5FO9B 1AE3A 1EWCA 5C3WA 2MGSA 1RD9D 3AB9A 1D8LA 5AJ3L 3FPPA 1GUWA 2LXKA 5I9OA 3S1RH 2NVXH 2R61A 2K6AA 3X3NA 3GTLH 4RGNA 1LO5D 2GA4B 5I6WA 2I5MX 2PPBC 2R7FA 2BDNA 3DEOA 2A8VA 3A8IE 2BDOA 3HKZE 2F4IA 1QVCA 3QG1A 4LFBL 1WCMG 4YWLA 1N9WA 5FKAC 4QB4A 1J5EL 2KHSA 2K5WA 3RMHA 5L37A 2PQEA 3UDIA 2F03A 3SR1A
chains in the Genus database with same CATH topology
4GKKL 2UUCQ 5FJ8H 2IHEA 4QL5A 3AYHB 4A3IH 4DV0Q 4NXML 2JJQA 4R4QA 3F2CA 3S15H 5IWAQ 1RIPA 3I7FA 4A3EG 1K8GA 4K0KQ 3E0EA 3CCMA 3GTJH 4UP9A 2ATWA 2NN6G 2R7ZG 3MXNB 2UUCL 1PYBA 1U0LA 4BY1G 1BVSA 5JEAJ 3G48A 3ULJA 1NY4A 3PUWA 4R4CA 4DV0L 1KD1C 4B3TL 3DM3A 1EFWA 1E7ZA 5FLXc 4QY7A 4DKAC 4YY3Q 4A3CG 4K0KL 4BBSH 3PUZA 3KJOA 5IY0A 4Y52H 4X6AH 3UE1A 3K7UC 3CCEA 2IT1A 1N33Q 2QA4A 1UE6A 4YY3L 1KQSA 4LF8Q 4EX5A 2VS1A 1OXUA 1SMXA 4HJ8A 1N8RC 4AYBG 2YYZA 1V43A 1PFSA 1VQDA 1Z9FA 2BH8A 2ZTCA 1SFOH 3CCQA 2N8NA 1CKMA 1T9HA 1YJWA 1R9TH 1S72A 4L5RC 4PZ7A 5C4JH 3H15A 5M3FG 4DV1L 1K9MC 4HIDA 1JB7A 2B3GA 1NMFA 1OXTA 2DUDA 2E8GA 4A3JH 4LF7L 2B63G 4LWCA 3CC7A 1MJEA 4A3BG 4OWWB 4IPHA 2K5VA 2RF4A 2AHOB 4JI8Q 2PMZE 1G291 2MO0A 4RG1A 1B7YB 4PG3A 1Z47A 2V1CC 2WFWA 3S17H 4OO1I 4L5QA 3CAMA 4OONA 1YIJA 3KFUA 1SLJA 2F3IA 1JJ2A 1VQ9A 1HR0Q 4R4TA 4JI8L 2UUBQ 4DUZQ 5HY6A 3PUVA 1GD7A 2AWOA 4GN5A 2N3SA 2OQKA 4YCWA 5BR8Q 2Q2HA 1EWIA 4NB3A 1EOVA 3D0FA 1WOCA 2Z6KC 3I2ZA 4R4IA 5IP9G 1KC8C 4DR4Q 1X9NA 1Y14B 4YCUA 4HIKA 4A3MH 2C35B 1HR0L 2UUBL 4DUZL 2JQOA 4C2MH 2WAQG 1X3FA 2CCZA 2WB1G 3ER0A 5BR8L 2ZJQA 3TRZA 4JOIC 3OYYA 2D0OA 3HKSA 2PNHA 3G71A 1VQJA 4JI3Q 4DR4L 2XTIA 4XTCS 3M4PA 1VQHA 3CC4A 1Q86C 2RHQB 1PH7A 1JMCA 4B3SQ 5M3MH 3W1BA 3GTOH 1H95A 3CCRA 1VQCA 5LMUQ 2GVBA 4JI3L 1TWAH 1VCIA 1IBMQ 1VQ7A 1IBLQ 4R1JA 3RNUA 2YTXA 2E2IH 2EIFA 2F4VQ 4BBRH 1VQPA 4BA2I 4JYAQ 3K7AH 4MNOA 4B3SL 1VQAA 3GD7A 1M90C 4JBMA 2H5XA 5IYDG 5LMUL 1KAWA 4DR5Q 4NXNQ 5ELOA 5LMNQ 2OTJA 1E1TA 1IBML 3FKIH 3BU2A 4DAMA 1IBLL 1X3EA 4LF5Q 3FHWA 2AKWB 2KCMA 5ELNA 2F4VL 4JYAL 3BZKA 5C4XG 1CKNA 2I5LX 4DNIA 5IE8A 2JA9A 1DGSA 4NXNL 4DR5L 1VQ8A 1PHJA 4TQUS 2VW9A 2CQOA 5LMNL 1K8AC 1UWVA 1AE2A 1VQLA 3RZOH 4A76A 1NJIC 4LF5L 2KHIA 2PQAB 3NELA 1XPOA 1NMGA 2K5NA 4UP7A 4JI4Q 5IP7G 3PV0A 4BY7H 4IFDG 4MZ9A 1YBYA 4YHHQ 3PUXA 1HNZL 4IFDI 3BJUA 1OXVA 2GVAA 4GKJQ 2R92G 4YWMA 2UU9Q 3I4OA 2JA5H 1MKHA 3HOUG 4P71A 2E2JH 4JI4L 2YV5A 4HJ9A 4KHZA 3I4NG 4YHHL 4DR2Q 1XPRA 2Y0SG 1N34Q 4A3FG 1KRTA 3J81i 1QVGA 1OTCA 4GKJL 5IYBH 3HOWH 2RCNA 4A3LG 2RHSB 4MTNA 1PVOA 1QUQB 1A8VA 3WWVA 1XTDA 1C7YA 4WJ4A 4PMWA 4UPAA 4DR2L 3GTMH 3GTPH 3JC66 3OTOQ 4A93G 1N34L 1PH2A 4QIWE 3GDEA 4A3KG 2NZOA 3KJPA 4X65Q 4IOCA 4QJFA 3HOYH 2K75A 5M5YH 1WCMH 5GAHC 1PH1A 1K73C 3PF4A 3EIVA 2OWOA 5C44H 3OTOL 2JA6H 1KHIA 1VQIA 1YNXA 3A74A 3BZCA 2ZJPA 3S2DH 1P8LA 3TQYA 4AYBE 2E5LQ 4X65L 1SRUA 2IHFA 4GN3B 5HGQA 4GOPB 4AQYQ 1IL2A 3FP9A 3HOVG 1HZ9A 3STBC 3I56A 1VQEA 4XIGS 1NBWA 1U5KA 4A3EH 2E5LL 3S1QH 1FJGQ 4JCVE 1XNRQ 1Q1EA 1V9PA 4AQYL 2VQEQ 2NN6I 3EBEA 2R7ZH 4BY1H 1UE5A 1ASZA 3RLOA 3B6YA 3KDFB 5IWAL 1HNWQ 4YWKA 4JI6Q 1GKHA 2BA0A 4RMFA 4GLXA 2K4KA 4JI2Q 1SE8A 1A0IA 4A3CH 1FJGL 1XNRL 2VUMG 2VQEL 2OTLA 1XNQQ 1EYGA 1X6OA 2GN5A 2MO1A 4PZ6A 2PQAA 1Q7YC 3HOZG 1HNWL 5K36G 1B8AA 4H02A 1EQQA 1WFQA 4HJ5A 4JI6L 3S16H 4KHPQ 4JI2L 3F1ZA 2UXBQ 1VQFA 1SN8A 1Y1VG 4GLAC 3H3VH 3H3VI 3M85A 1L2FA 1I3QH 1N33L 4KHPL 1JE5A 3UE0A 3L2PA 2MNAA 4LF8L 2WAQE 3J81c 3F2BA 2WB1E 1FVIA 4DV5Q 4GNXB 2HT1A 2N49A 2UXBL 3STBD 4IPGA 5M3FH 3PSIA 2HHHQ 1L1OC 1LYLA 2B63H 4A3BH 4UP8A 1QUQA 4UY8C 1AH9A 1G51A 1WYDA 4DV4Q 4DR7Q 2L15A 2I5HA 4LFCQ 4GS3A 2HHHL 2ID0A 4LW1A 3Q8DA 1L0WA 3OW2A 1XMQQ 3L7ZC 2EXDA 1YJNA 1KRSA 2NVYH 3CPFA 1PV4A 3PO2G 1CSQA 4DV4L 3PO2H 1WJJA 5GADC 3L0OA 1LM0A 4LFCL 3I4MH 4A3DG 1SROA 1W3SA 1I5FA 3I55A 2NVTH 1Q12A 3PGZA 5E7NA 5IP9H 4GOPA 1XMQL 1JT8A 3JAMi 3CQZH 2ALYB 1HZCA 4JI1Q 4IOAA 4GN4B 4A4IA 4DV2Q 4C3IH 2K14A 1CUKA 3KF6B 1YVCA 3K81C 4P74A 4DK6C 1G6PA 3NEMA 4X62Q 3KDFA 3IRBA 4B3MQ 4JI1L 3HOXG 3UDFA 3A0JA 5C0XG 4DV2L 1J6QA 1FGUA 3NBHB 1E24A 3ICEA 5JJKA 3CC2A 4DAYB 3PIPA 4BA1I 4X64Q 1LTLA 2YTVA 3F8TA 1PH4A 3G6EA 1D7QA 3I4MG 1VQNA 4B3ML 4IPDA 4DV6Q 2KENA 1VQOA 3T1YQ 4LNQA 4APVA 3TREA 2Y0SE 3PO3G 4JBJA 4OWXB 5IYDH 4X64L 2ZJRA 2UXCQ 2KHJA 1X54A 1PH6A 2QEXA 3CXCA 3GTKH 1CKOA 5FLMG 4DV6L 2CKZB 2HIXA 5M5XH 5C4XH 3T1YL 4GNXA 3W1GA 1ASYA 3HFZB 2UXCL 4C3JH 1I94Q 4JI7Q 2EQSA 1QZHA 1KXLA 3J7ZC 2VY3A 1XPUA 3J7A5 1O7IA 1VS0A 5IP7H 5GAEC 2KCTA 1LUZA 1HZBA 1B70B 2BA1A 2Q2IA 2R7DA 3S24A 5C3EG 1I94L 4JI7L 3PIOA 2JA8G 5GROA 1PH9A 1VQBA 2YU9H 2B29A 2HIVA 1Y1WG 3G4SA 2R92H 3HOUH 2IX1A 4B3RQ 2R93G 1UE1A 1BBWA 1HJPA 2IX0A 3NENA 1I6HH 1HZAA 1OXSC 3UDXA 4X66Q 1C9OA 4Y7NH 3K0XA 3RZDH 3H0GG 1VQMA 2N78A 3JAMc 1OXXK 2YTYA 3CCUA 4A3FH 4DR3Q 2UXDQ 2UU9L 1QZGA 4B3RL 4A3LH 3RR5A 3CCSA 1VQGA 1JJGA 3A5UA 1X55A 4X66L 4DR1Q 4AIMA 4A93H 4DR3L 2UXDL 1V1QA 4A3KH 2K5HA 1BKBA 3M4OH 1N32Q 1Q81C 1EQRA 3CMEA 3RLFA 4DR1L 1PYSB 4DR6Q 2VZAA 1IYJB 1TWHH 4GLVB 1N32L 4ALPA 3GTGH 3HOVH 3CD6A 4JG2A 5IYCG 2MFIA 1XMOQ 4DR6L 2AWNA 3D31A 1PH3A 4IJLA 3LGJA 3ULPA 1UEBA 1VQKA 1X65A 1YJ9A 4DPGA 3U50C 4LFAQ 1XMOL 1EIFA 2I0QA 1I50H 1C0AA 4KLKA 3M3YH 2VUMH 4JBKA 1EIYB 1WI5A 2PI2E 4HIOA 4LFAL 1A62A 4YCVA 5FJ8G 3HOZH 4POFA 3U58A 4OXPA 4A3IG 5JJLA 2LXJA 2MQHA 2Z6KA 1S40A 1GM5A 4B3TQ 1UE7A 3W5OA 1K83H 3U4VA 1Y1VH 5GAGC 2FXQA 1XNQL 1PA6A 1Q82C 2IY5B 4L5SA 1KL9A 4JBWA 3PF5A 1YEZA 3VDYA 4JOIA 4QQBX 3RN2A 4JI0Q 4A3GG 2NZHA 4A3GH 2PI2A 3KYHC 2A19A 3S14H 1NE3A 2VQFQ 1E22A 3S1NH 3M7NA 4BBSG 1PH5A 4OX9Q 4QGUA 3HKZG 1BBUA 1X56A 4IFDJ 3AFPA 4JI0L 4DV5L 2DGYA 1IZ6A 3AEVA 4AH6A 2VQFL 4JV5Q 4NPSA 4OX9L 4DV1Q 4DUYQ 1P16A 4FDBA 3TS2A 1EUJA 2ASBA 1IXRA 1SR3A 4EQ5A 1A63A 1JJCB 2UUAQ 4DR7L 2D0PA 4LF7Q 1MIUA 4ME3A 4J15A 1CKNB 4IO9A 3RLNA 1YI2A 1FL0A 3K80C 3UDGA 4JV5L 4A3DH 3CCVA 3J80i 4DUYL 4TVAB 1VQ6A 1HNXQ 2ZTEA 2WP8J 2A1AA 4A3JG 3RN5A 2UUAL 4KI0A 3CP0A 2JE6I 4HJAA 3SGIA 5J3BA 4HIMA 4P73A 4A75A 1HNXL 4OO1G 3ERSX 3U4ZA 4WJ3M 1TXYA 5EAYA 5H1SE 4DV3Q 3HOXH 1YITA 3GTQH 1TWGH 2AMCB 2CWAA 2OQ0A 2JEAI 2OCEA 3E9HA 5C0XI 1PH8A 4LF9Q 2JK8A 4HJ7A 4X62L 4P75A 1QVFA 3CF5A 1NTGA 4DV3L 4IPCA 4A3MG 1W2BA 1L1OB 3GO5A 3PUYA 1HH2P 3AQQA 4LF9L 1IBKQ 2JA7G 3PO3H 2ZTDA 2D62A 4JI5Q 1GO3E 2JA7H 4C3HH 1HR0W 1RL2A 5FLMH 4R4OA 5JEAG 1YZ6A 3KLWA 5M3MG 3K8AA 5IT9c 1YHBA 4JI5L 1IBKL 4POGA 3M9BA 4LUZA 1Q8KA 1VQ4A 2F52A 3A5ZB 2VL6A 1XJVA 4LF4Q 3S2HH 1E1OA 3ZJYC 4BBRG 4OWTB 1YHAA 5C3EH 4LUOA 2JA8H 2HQLA 3MEFA 2VNUD 3M4QA 3FKIG 2Q2TA 2ZM6Q 4LF6Q 2CFMA 4DK3C 1Y1WH 4LF4L 3AFQA 2R93H 3J80c 2E2HH 4GOPC 1M1KC 3CPWA 3H0GH 1S3OA 3ULLA 3I4NH 4BXXG 1TWCH 4BXXH 2XGTA 2R6GA 2ZM6L 4DV7Q 1HNZQ 5GQOA 4LF6L 2CWPA 3T1HQ 2BH2A 1TWFH 4IJHA 3PCOB 2NVQH 3CCJA 5LMNW 2QGQA 4BY7G 3KF6A 4LUVA 1Q46A 4PZ8A 2K52A 3EN2A 3TEHB 5AJ3Q 4DV7L 3KF8B 3E9IA 3T1HL 3DLLA 2JA5G 4P72A 1N36Q 5M5WH 1VQ5A 1CSPA 1AE3A 1Q1BA 1YHQA 2ES2A 1GVPA 1D8LA 1E3PA 1K3RA 1MJCA 4O2DA 5AJ3L 2LXKA 5IYBG 5IYCH 3S1RH 3HOWG 1X3GA 3CW2C 1N36L 2NVXH 3S1MH 2JEBI 3CMAA 4LFBQ 3GTLH 1L1OA 4O0AA 2I5MX 2LSSA 2R7FA 2Z0SA 1J5EQ 2A8VA 3HKZE 3TS0A 2KBNA 2K50A 1KIXA 3J81j 5C0XJ 4JC0A 4GNXC 3HOYG 1QVCA 5JJIA 4GKKQ 4LFBL 1WCMG 5DLQE 4YWLA 3F2DA 3CCLA 1N9WA 4L5TA 1K0RA 5C44G 2Q2UA 1J5EL 4NXMQ 2JA6G 3UDIA 3KOJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GKK L;  2UUC Q;  5FJ8 H;  2IHE A;  4QL5 A;  3AYH B;  4A3I H;  4DV0 Q;  4NXM L;  2JJQ A;  4R4Q A;  3F2C A;  3S15 H;  5IWA Q;  1RIP A;  3I7F A;  4A3E G;  1K8G A;  4K0K Q;  3E0E A;  3CCM A;  3GTJ H;  4UP9 A;  2ATW A;  2NN6 G;  2R7Z G;  3MXN B;  2UUC L;  1PYB A;  1U0L A;  4BY1 G;  1BVS A;  5JEA J;  3G48 A;  3ULJ A;  1NY4 A;  3PUW A;  4R4C A;  4DV0 L;  1KD1 C;  4B3T L;  3DM3 A;  1EFW A;  1E7Z A;  5FLX c;  4QY7 A;  4DKA C;  4YY3 Q;  4A3C G;  4K0K L;  4BBS H;  3PUZ A;  3KJO A;  5IY0 A;  4Y52 H;  4X6A H;  3UE1 A;  3K7U C;  3CCE A;  2IT1 A;  1N33 Q;  2QA4 A;  1UE6 A;  4YY3 L;  1KQS A;  4LF8 Q;  4EX5 A;  2VS1 A;  1OXU A;  1SMX A;  4HJ8 A;  1N8R C;  4AYB G;  2YYZ A;  1V43 A;  1PFS A;  1VQD A;  1Z9F A;  2BH8 A;  2ZTC A;  1SFO H;  3CCQ A;  2N8N A;  1CKM A;  1T9H A;  1YJW A;  1R9T H;  1S72 A;  4L5R C;  4PZ7 A;  5C4J H;  3H15 A;  5M3F G;  4DV1 L;  1K9M C;  4HID A;  1JB7 A;  2B3G A;  1NMF A;  1OXT A;  2DUD A;  2E8G A;  4A3J H;  4LF7 L;  2B63 G;  4LWC A;  3CC7 A;  1MJE A;  4A3B G;  4OWW B;  4IPH A;  2K5V A;  2RF4 A;  2AHO B;  4JI8 Q;  2PMZ E;  1G29 1;  2MO0 A;  4RG1 A;  1B7Y B;  4PG3 A;  1Z47 A;  2V1C C;  2WFW A;  3S17 H;  4OO1 I;  4L5Q A;  3CAM A;  4OON A;  1YIJ A;  3KFU A;  1SLJ A;  2F3I A;  1JJ2 A;  1VQ9 A;  1HR0 Q;  4R4T A;  4JI8 L;  2UUB Q;  4DUZ Q;  5HY6 A;  3PUV A;  1GD7 A;  2AWO A;  4GN5 A;  2N3S A;  2OQK A;  4YCW A;  5BR8 Q;  2Q2H A;  1EWI A;  4NB3 A;  1EOV A;  3D0F A;  1WOC A;  2Z6K C;  3I2Z A;  4R4I A;  5IP9 G;  1KC8 C;  4DR4 Q;  1X9N A;  1Y14 B;  4YCU A;  4HIK A;  4A3M H;  2C35 B;  1HR0 L;  2UUB L;  4DUZ L;  2JQO A;  4C2M H;  2WAQ G;  1X3F A;  2CCZ A;  2WB1 G;  3ER0 A;  5BR8 L;  2ZJQ A;  3TRZ A;  4JOI C;  3OYY A;  2D0O A;  3HKS A;  2PNH A;  3G71 A;  1VQJ A;  4JI3 Q;  4DR4 L;  2XTI A;  4XTC S;  3M4P A;  1VQH A;  3CC4 A;  1Q86 C;  2RHQ B;  1PH7 A;  1JMC A;  4B3S Q;  5M3M H;  3W1B A;  3GTO H;  1H95 A;  3CCR A;  1VQC A;  5LMU Q;  2GVB A;  4JI3 L;  1TWA H;  1VCI A;  1IBM Q;  1VQ7 A;  1IBL Q;  4R1J A;  3RNU A;  2YTX A;  2E2I H;  2EIF A;  2F4V Q;  4BBR H;  1VQP A;  4BA2 I;  4JYA Q;  3K7A H;  4MNO A;  4B3S L;  1VQA A;  3GD7 A;  1M90 C;  4JBM A;  2H5X A;  5IYD G;  5LMU L;  1KAW A;  4DR5 Q;  4NXN Q;  5ELO A;  5LMN Q;  2OTJ A;  1E1T A;  1IBM L;  3FKI H;  3BU2 A;  4DAM A;  1IBL L;  1X3E A;  4LF5 Q;  3FHW A;  2AKW B;  2KCM A;  5ELN A;  2F4V L;  4JYA L;  3BZK A;  5C4X G;  1CKN A;  2I5L X;  4DNI A;  5IE8 A;  2JA9 A;  1DGS A;  4NXN L;  4DR5 L;  1VQ8 A;  1PHJ A;  4TQU S;  2VW9 A;  2CQO A;  5LMN L;  1K8A C;  1UWV A;  1AE2 A;  1VQL A;  3RZO H;  4A76 A;  1NJI C;  4LF5 L;  2KHI A;  2PQA B;  3NEL A;  1XPO A;  1NMG A;  2K5N A;  4UP7 A;  4JI4 Q;  5IP7 G;  3PV0 A;  4BY7 H;  4IFD G;  4MZ9 A;  1YBY A;  4YHH Q;  3PUX A;  1HNZ L;  4IFD I;  3BJU A;  1OXV A;  2GVA A;  4GKJ Q;  2R92 G;  4YWM A;  2UU9 Q;  3I4O A;  2JA5 H;  1MKH A;  3HOU G;  4P71 A;  2E2J H;  4JI4 L;  2YV5 A;  4HJ9 A;  4KHZ A;  3I4N G;  4YHH L;  4DR2 Q;  1XPR A;  2Y0S G;  1N34 Q;  4A3F G;  1KRT A;  3J81 i;  1QVG A;  1OTC A;  4GKJ L;  5IYB H;  3HOW H;  2RCN A;  4A3L G;  2RHS B;  4MTN A;  1PVO A;  1QUQ B;  1A8V A;  3WWV A;  1XTD A;  1C7Y A;  4WJ4 A;  4PMW A;  4UPA A;  4DR2 L;  3GTM H;  3GTP H;  3JC6 6;  3OTO Q;  4A93 G;  1N34 L;  1PH2 A;  4QIW E;  3GDE A;  4A3K G;  2NZO A;  3KJP A;  4X65 Q;  4IOC A;  4QJF A;  3HOY H;  2K75 A;  5M5Y H;  1WCM H;  5GAH C;  1PH1 A;  1K73 C;  3PF4 A;  3EIV A;  2OWO A;  5C44 H;  3OTO L;  2JA6 H;  1KHI A;  1VQI A;  1YNX A;  3A74 A;  3BZC A;  2ZJP A;  3S2D H;  1P8L A;  3TQY A;  4AYB E;  2E5L Q;  4X65 L;  1SRU A;  2IHF A;  4GN3 B;  5HGQ A;  4GOP B;  4AQY Q;  1IL2 A;  3FP9 A;  3HOV G;  1HZ9 A;  3STB C;  3I56 A;  1VQE A;  4XIG S;  1NBW A;  1U5K A;  4A3E H;  2E5L L;  3S1Q H;  1FJG Q;  4JCV E;  1XNR Q;  1Q1E A;  1V9P A;  4AQY L;  2VQE Q;  2NN6 I;  3EBE A;  2R7Z H;  4BY1 H;  1UE5 A;  1ASZ A;  3RLO A;  3B6Y A;  3KDF B;  5IWA L;  1HNW Q;  4YWK A;  4JI6 Q;  1GKH A;  2BA0 A;  4RMF A;  4GLX A;  2K4K A;  4JI2 Q;  1SE8 A;  1A0I A;  4A3C H;  1FJG L;  1XNR L;  2VUM G;  2VQE L;  2OTL A;  1XNQ Q;  1EYG A;  1X6O A;  2GN5 A;  2MO1 A;  4PZ6 A;  2PQA A;  1Q7Y C;  3HOZ G;  1HNW L;  5K36 G;  1B8A A;  4H02 A;  1EQQ A;  1WFQ A;  4HJ5 A;  4JI6 L;  3S16 H;  4KHP Q;  4JI2 L;  3F1Z A;  2UXB Q;  1VQF A;  1SN8 A;  1Y1V G;  4GLA C;  3H3V H;  3H3V I;  3M85 A;  1L2F A;  1I3Q H;  1N33 L;  4KHP L;  1JE5 A;  3UE0 A;  3L2P A;  2MNA A;  4LF8 L;  2WAQ E;  3J81 c;  3F2B A;  2WB1 E;  1FVI A;  4DV5 Q;  4GNX B;  2HT1 A;  2N49 A;  2UXB L;  3STB D;  4IPG A;  5M3F H;  3PSI A;  2HHH Q;  1L1O C;  1LYL A;  2B63 H;  4A3B H;  4UP8 A;  1QUQ A;  4UY8 C;  1AH9 A;  1G51 A;  1WYD A;  4DV4 Q;  4DR7 Q;  2L15 A;  2I5H A;  4LFC Q;  4GS3 A;  2HHH L;  2ID0 A;  4LW1 A;  3Q8D A;  1L0W A;  3OW2 A;  1XMQ Q;  3L7Z C;  2EXD A;  1YJN A;  1KRS A;  2NVY H;  3CPF A;  1PV4 A;  3PO2 G;  1CSQ A;  4DV4 L;  3PO2 H;  1WJJ A;  5GAD C;  3L0O A;  1LM0 A;  4LFC L;  3I4M H;  4A3D G;  1SRO A;  1W3S A;  1I5F A;  3I55 A;  2NVT H;  1Q12 A;  3PGZ A;  5E7N A;  5IP9 H;  4GOP A;  1XMQ L;  1JT8 A;  3JAM i;  3CQZ H;  2ALY B;  1HZC A;  4JI1 Q;  4IOA A;  4GN4 B;  4A4I A;  4DV2 Q;  4C3I H;  2K14 A;  1CUK A;  3KF6 B;  1YVC A;  3K81 C;  4P74 A;  4DK6 C;  1G6P A;  3NEM A;  4X62 Q;  3KDF A;  3IRB A;  4B3M Q;  4JI1 L;  3HOX G;  3UDF A;  3A0J A;  5C0X G;  4DV2 L;  1J6Q A;  1FGU A;  3NBH B;  1E24 A;  3ICE A;  5JJK A;  3CC2 A;  4DAY B;  3PIP A;  4BA1 I;  4X64 Q;  1LTL A;  2YTV A;  3F8T A;  1PH4 A;  3G6E A;  1D7Q A;  3I4M G;  1VQN A;  4B3M L;  4IPD A;  4DV6 Q;  2KEN A;  1VQO A;  3T1Y Q;  4LNQ A;  4APV A;  3TRE A;  2Y0S E;  3PO3 G;  4JBJ A;  4OWX B;  5IYD H;  4X64 L;  2ZJR A;  2UXC Q;  2KHJ A;  1X54 A;  1PH6 A;  2QEX A;  3CXC A;  3GTK H;  1CKO A;  5FLM G;  4DV6 L;  2CKZ B;  2HIX A;  5M5X H;  5C4X H;  3T1Y L;  4GNX A;  3W1G A;  1ASY A;  3HFZ B;  2UXC L;  4C3J H;  1I94 Q;  4JI7 Q;  2EQS A;  1QZH A;  1KXL A;  3J7Z C;  2VY3 A;  1XPU A;  3J7A 5;  1O7I A;  1VS0 A;  5IP7 H;  5GAE C;  2KCT A;  1LUZ A;  1HZB A;  1B70 B;  2BA1 A;  2Q2I A;  2R7D A;  3S24 A;  5C3E G;  1I94 L;  4JI7 L;  3PIO A;  2JA8 G;  5GRO A;  1PH9 A;  1VQB A;  2YU9 H;  2B29 A;  2HIV A;  1Y1W G;  3G4S A;  2R92 H;  3HOU H;  2IX1 A;  4B3R Q;  2R93 G;  1UE1 A;  1BBW A;  1HJP A;  2IX0 A;  3NEN A;  1I6H H;  1HZA A;  1OXS C;  3UDX A;  4X66 Q;  1C9O A;  4Y7N H;  3K0X A;  3RZD H;  3H0G G;  1VQM A;  2N78 A;  3JAM c;  1OXX K;  2YTY A;  3CCU A;  4A3F H;  4DR3 Q;  2UXD Q;  2UU9 L;  1QZG A;  4B3R L;  4A3L H;  3RR5 A;  3CCS A;  1VQG A;  1JJG A;  3A5U A;  1X55 A;  4X66 L;  4DR1 Q;  4AIM A;  4A93 H;  4DR3 L;  2UXD L;  1V1Q A;  4A3K H;  2K5H A;  1BKB A;  3M4O H;  1N32 Q;  1Q81 C;  1EQR A;  3CME A;  3RLF A;  4DR1 L;  1PYS B;  4DR6 Q;  2VZA A;  1IYJ B;  1TWH H;  4GLV B;  1N32 L;  4ALP A;  3GTG H;  3HOV H;  3CD6 A;  4JG2 A;  5IYC G;  2MFI A;  1XMO Q;  4DR6 L;  2AWN A;  3D31 A;  1PH3 A;  4IJL A;  3LGJ A;  3ULP A;  1UEB A;  1VQK A;  1X65 A;  1YJ9 A;  4DPG A;  3U50 C;  4LFA Q;  1XMO L;  1EIF A;  2I0Q A;  1I50 H;  1C0A A;  4KLK A;  3M3Y H;  2VUM H;  4JBK A;  1EIY B;  1WI5 A;  2PI2 E;  4HIO A;  4LFA L;  1A62 A;  4YCV A;  5FJ8 G;  3HOZ H;  4POF A;  3U58 A;  4OXP A;  4A3I G;  5JJL A;  2LXJ A;  2MQH A;  2Z6K A;  1S40 A;  1GM5 A;  4B3T Q;  1UE7 A;  3W5O A;  1K83 H;  3U4V A;  1Y1V H;  5GAG C;  2FXQ A;  1XNQ L;  1PA6 A;  1Q82 C;  2IY5 B;  4L5S A;  1KL9 A;  4JBW A;  3PF5 A;  1YEZ A;  3VDY A;  4JOI A;  4QQB X;  3RN2 A;  4JI0 Q;  4A3G G;  2NZH A;  4A3G H;  2PI2 A;  3KYH C;  2A19 A;  3S14 H;  1NE3 A;  2VQF Q;  1E22 A;  3S1N H;  3M7N A;  4BBS G;  1PH5 A;  4OX9 Q;  4QGU A;  3HKZ G;  1BBU A;  1X56 A;  4IFD J;  3AFP A;  4JI0 L;  4DV5 L;  2DGY A;  1IZ6 A;  3AEV A;  4AH6 A;  2VQF L;  4JV5 Q;  4NPS A;  4OX9 L;  4DV1 Q;  4DUY Q;  1P16 A;  4FDB A;  3TS2 A;  1EUJ A;  2ASB A;  1IXR A;  1SR3 A;  4EQ5 A;  1A63 A;  1JJC B;  2UUA Q;  4DR7 L;  2D0P A;  4LF7 Q;  1MIU A;  4ME3 A;  4J15 A;  1CKN B;  4IO9 A;  3RLN A;  1YI2 A;  1FL0 A;  3K80 C;  3UDG A;  4JV5 L;  4A3D H;  3CCV A;  3J80 i;  4DUY L;  4TVA B;  1VQ6 A;  1HNX Q;  2ZTE A;  2WP8 J;  2A1A A;  4A3J G;  3RN5 A;  2UUA L;  4KI0 A;  3CP0 A;  2JE6 I;  4HJA A;  3SGI A;  5J3B A;  4HIM A;  4P73 A;  4A75 A;  1HNX L;  4OO1 G;  3ERS X;  3U4Z A;  4WJ3 M;  1TXY A;  5EAY A;  5H1S E;  4DV3 Q;  3HOX H;  1YIT A;  3GTQ H;  1TWG H;  2AMC B;  2CWA A;  2OQ0 A;  2JEA I;  2OCE A;  3E9H A;  5C0X I;  1PH8 A;  4LF9 Q;  2JK8 A;  4HJ7 A;  4X62 L;  4P75 A;  1QVF A;  3CF5 A;  1NTG A;  4DV3 L;  4IPC A;  4A3M G;  1W2B A;  1L1O B;  3GO5 A;  3PUY A;  1HH2 P;  3AQQ A;  4LF9 L;  1IBK Q;  2JA7 G;  3PO3 H;  2ZTD A;  2D62 A;  4JI5 Q;  1GO3 E;  2JA7 H;  4C3H H;  1HR0 W;  1RL2 A;  5FLM H;  4R4O A;  5JEA G;  1YZ6 A;  3KLW A;  5M3M G;  3K8A A;  5IT9 c;  1YHB A;  4JI5 L;  1IBK L;  4POG A;  3M9B A;  4LUZ A;  1Q8K A;  1VQ4 A;  2F52 A;  3A5Z B;  2VL6 A;  1XJV A;  4LF4 Q;  3S2H H;  1E1O A;  3ZJY C;  4BBR G;  4OWT B;  1YHA A;  5C3E H;  4LUO A;  2JA8 H;  2HQL A;  3MEF A;  2VNU D;  3M4Q A;  3FKI G;  2Q2T A;  2ZM6 Q;  4LF6 Q;  2CFM A;  4DK3 C;  1Y1W H;  4LF4 L;  3AFQ A;  2R93 H;  3J80 c;  2E2H H;  4GOP C;  1M1K C;  3CPW A;  3H0G H;  1S3O A;  3ULL A;  3I4N H;  4BXX G;  1TWC H;  4BXX H;  2XGT A;  2R6G A;  2ZM6 L;  4DV7 Q;  1HNZ Q;  5GQO A;  4LF6 L;  2CWP A;  3T1H Q;  2BH2 A;  1TWF H;  4IJH A;  3PCO B;  2NVQ H;  3CCJ A;  5LMN W;  2QGQ A;  4BY7 G;  3KF6 A;  4LUV A;  1Q46 A;  4PZ8 A;  2K52 A;  3EN2 A;  3TEH B;  5AJ3 Q;  4DV7 L;  3KF8 B;  3E9I A;  3T1H L;  3DLL A;  2JA5 G;  4P72 A;  1N36 Q;  5M5W H;  1VQ5 A;  1CSP A;  1AE3 A;  1Q1B A;  1YHQ A;  2ES2 A;  1GVP A;  1D8L A;  1E3P A;  1K3R A;  1MJC A;  4O2D A;  5AJ3 L;  2LXK A;  5IYB G;  5IYC H;  3S1R H;  3HOW G;  1X3G A;  3CW2 C;  1N36 L;  2NVX H;  3S1M H;  2JEB I;  3CMA A;  4LFB Q;  3GTL H;  1L1O A;  4O0A A;  2I5M X;  2LSS A;  2R7F A;  2Z0S A;  1J5E Q;  2A8V A;  3HKZ E;  3TS0 A;  2KBN A;  2K50 A;  1KIX A;  3J81 j;  5C0X J;  4JC0 A;  4GNX C;  3HOY G;  1QVC A;  5JJI A;  4GKK Q;  4LFB L;  1WCM G;  5DLQ E;  4YWL A;  3F2D A;  3CCL A;  1N9W A;  4L5T A;  1K0R A;  5C44 G;  2Q2U A;  1J5E L;  4NXM Q;  2JA6 G;  3UDI A;  3KOJ A; 
#chains in the Genus database with same CATH topology
 5FJ8 H;  3A8K E;  3J7Y W;  2PMZ B;  1A2T A;  1JWS D;  1SND A;  5FLX E;  1BF4 A;  4R4Q A;  3F2C A;  1RIP A;  4K5V A;  3CCM A;  1D2B A;  3MXN B;  1PYB A;  1QNK A;  5D14 A;  4G7O C;  1G91 A;  4E6I A;  4DV0 L;  4H44 C;  3TSS A;  1H9S A;  2SDF A;  5C4X B;  2F0H A;  4JVZ A;  4Y52 H;  4X6A H;  1N33 Q;  2QA4 A;  3RZO B;  1LT5 D;  1UE6 A;  1DXM A;  2VS1 A;  5KRU A;  1OXU A;  1SMX A;  5CYU A;  1TS4 A;  4AYB G;  1V43 A;  1VQD A;  1Z9F A;  2BH8 A;  1Q90 A;  4CDD C;  1SFO H;  2IW3 A;  2EJM A;  1BBX C;  1JB7 A;  2DUD A;  4LF7 L;  4LWC A;  2K5V A;  1HCZ A;  4RKL A;  1II3 A;  3URY A;  1Z47 A;  2XWJ B;  4L5Q A;  3BG3 A;  1SLJ A;  5ELD A;  1VQ9 A;  1TS3 A;  1ONL A;  1TS2 A;  4JI8 L;  1I6V C;  3L3O C;  2AWO A;  4GN5 A;  1Z6H A;  5IP9 G;  2Z6K C;  5IGF A;  4DR4 Q;  3OW7 A;  4YCU A;  1HR0 L;  4DUZ L;  1H9J A;  2JQO A;  2WAQ G;  3ER0 A;  3OYY A;  1U4M A;  2RBM A;  4A3E B;  3S1Q B;  2QIL A;  3IFT A;  1U4L A;  4XTC S;  2F0I A;  5C3X A;  1VQH A;  4JPB W;  1WTO A;  2O5I C;  1PTO D;  3I70 A;  2RHQ B;  1PH7 A;  4B3S Q;  5M3M H;  1AEX A;  3CCR A;  1KAA A;  3DHQ A;  1TWA H;  3EFX D;  4RHR A;  5EJW A;  2QDB A;  4MNO A;  1RTN A;  4IN3 A;  2H5X A;  1B9M A;  4H13 C;  5A2Q L;  5LMN Q;  4RH6 A;  2M00 A;  4HR7 B;  1HQR D;  4IUN A;  1GHK A;  2F4V L;  4JYA L;  5C4X G;  1DGS A;  4KY7 A;  4TQU S;  2CQO A;  2KHI A;  1IKL A;  1UNS A;  1QG7 A;  1XPO A;  1YNJ D;  3VR5 A;  4JI4 Q;  2DN8 A;  4A3B B;  2FMM A;  4MZ9 A;  1YBY A;  4RHS A;  4IFD I;  5CMD A;  3EJI A;  2GVA A;  2MP1 A;  3MTS A;  4FP5 D;  4P71 A;  2YV5 A;  3T51 B;  2Z4I A;  3P75 A;  2DNE A;  4KJN A;  1OTC A;  4GKJ L;  1LAC A;  1F2Y A;  3K0Y A;  3KBX A;  3I4M B;  2Z4H A;  3D6C A;  1PVO A;  3DUZ A;  4UPA A;  3GTM H;  3GTP H;  4A93 G;  3JC6 6;  1D1K A;  3OTO Q;  3GDE A;  1CFM A;  2NZO A;  4FF4 A;  2WB1 B;  4X65 Q;  4C3I B;  5DNF A;  1WCM H;  1PH1 A;  2B2W C;  3A74 A;  2IPK D;  2CQA A;  4AYB E;  2E5L Q;  1QCB D;  2OEO A;  5HGQ A;  1IL2 A;  5ISR A;  1KLU D;  3I90 A;  4LK1 C;  4XIG S;  1U5K A;  2SOB A;  4S3S A;  4RWS C;  5JPM C;  5D3I B;  4JCV E;  2ZXO A;  2NUC A;  1Q1E A;  4AQY L;  2VQE Q;  3R3O A;  1HA6 A;  5IGB A;  1LAB A;  3KDF B;  5IWA L;  1HNW Q;  4JI6 Q;  1PZK D;  4GLX A;  2M9V A;  1BCP F;  1H9R A;  1WD1 A;  2DY8 A;  5M5X B;  2NWG A;  1STE A;  1SNQ A;  2K7V A;  5DAU A;  1EZ6 A;  4LAA A;  3T56 B;  3J81 L;  1PTO H;  3J81 E;  4H02 A;  3IAY A;  3H09 A;  4JI2 L;  4CHT B;  2UXB Q;  1O7L A;  1M8A A;  1SN8 A;  1V1O A;  4GLA C;  3KUP A;  1WTQ A;  2EYM A;  3TN2 A;  4KHP L;  1JE5 A;  2XNA C;  2WAQ E;  4DV5 Q;  1FVI A;  3PSI A;  2F0E A;  3I4N B;  4CDC C;  2AQ2 B;  4UY8 C;  2L15 A;  2HUG A;  2LMC B;  1CK1 A;  2HHH L;  1L0W A;  3OW2 A;  3L7Z C;  2EXD A;  1B1Z A;  2NVY H;  3MZ5 A;  1PV4 A;  3M4O B;  1CSQ A;  1HRJ A;  1WJJ A;  1O80 A;  3V96 A;  1LM0 A;  1UUP A;  1SRO A;  3NBI A;  4CDF C;  1I5F A;  2SEB D;  5IP9 H;  2K05 A;  3FRP B;  1JT8 A;  1IYU A;  1TWH B;  3JAM i;  3HRZ C;  3CQZ H;  2ALY B;  4Z9C B;  3TME A;  1MHW C;  2R3Z A;  5IGC A;  4JI1 Q;  4GN4 B;  3TP6 A;  1CUK A;  3KF6 B;  2B2V A;  1YVC A;  4OHJ A;  2N55 A;  2F0Q A;  3KDF A;  3IRB A;  4B3M Q;  3HOX G;  2JXM B;  1LLR D;  4P2C B;  5C0X G;  1NNX A;  2NYZ D;  1FGU A;  3NBH B;  1E24 A;  5JJK A;  2XRS D;  4X64 Q;  1PH4 A;  2N88 A;  3M3Y B;  2VUM B;  4IUR A;  2V4D A;  1ET6 A;  3HG9 A;  4EVO A;  1VQO A;  5EKI A;  3HOZ B;  1SE4 A;  4HMI A;  4OWX B;  1X54 A;  4C3H G;  4IUQ A;  2QEX A;  4FXD A;  1Y1V B;  5CR3 A;  1CKO A;  1GUO A;  5C4X H;  3T1Y L;  3T13 A;  2NZ1 D;  2CH4 A;  1STN A;  3S14 B;  1BNZ A;  1QZH A;  1KXL A;  4KV6 A;  1SDF A;  1A3T A;  2KUM A;  2KCC A;  5GAE C;  2BA1 A;  1I94 L;  4K5W A;  3K57 A;  2YU9 H;  3D3R A;  1KLG D;  1UAP A;  1UE1 A;  2RSO A;  1HJP A;  5F2D A;  1I6H H;  1CM9 A;  3D4D A;  3C1E A;  3K0X A;  4X66 Q;  1L0Y B;  3RZD H;  1VQM A;  2YTY A;  4M1U B;  1QZG A;  4B3R L;  1BR9 A;  4DR1 Q;  3P1H A;  4A93 H;  2ZXP A;  1U9R A;  1BKB A;  1EIG A;  5CBE E;  3NBH A;  3QO2 A;  3GTQ B;  4PNY A;  1N32 L;  2DY7 A;  3GTG H;  2MFI A;  2F0J A;  1X65 A;  2RSN A;  1LT4 D;  1AP0 A;  4UAI A;  4FXK C;  1EIF A;  3MHB A;  1G2S A;  1B3Q A;  3QOL A;  4J6H A;  1EZ8 A;  3ND8 A;  2Z6K A;  4QMG A;  1LTR D;  3A56 A;  3D8G A;  3NP8 A;  2F0M A;  2FXQ A;  5GAG C;  1BDO A;  1Q82 C;  3A7A B;  2IY5 B;  2B2T C;  5C3E B;  1AW7 A;  2JA8 B;  3GV3 A;  1ENA A;  4DAP A;  2NZH A;  4A3G H;  2PI2 A;  2A19 A;  1Y1W B;  3V05 A;  2R93 B;  1E22 A;  4R9W A;  4BBS G;  1PH5 A;  4OX9 Q;  3LWE A;  3H0G B;  3NTH A;  2DGY A;  1V8Q A;  2XIW A;  4AH6 A;  5CV8 A;  2VQF L;  1AN8 A;  1PFM A;  2NVQ B;  3HZX A;  4FDB A;  3TS2 A;  1SR3 A;  2UUA Q;  2Z9H A;  4OGQ C;  4LF7 Q;  2I07 B;  4KKS A;  4IO9 A;  4J15 A;  4JV5 L;  3RLN A;  5M5W B;  4DUY L;  4B9X A;  4XDX A;  2Q8R E;  1HNX Q;  2A1A A;  4A3J G;  1PTO C;  4WRD A;  3S1R B;  4KKT A;  2NVX B;  3DMU A;  1JC7 A;  3O13 A;  4A75 A;  3GTL B;  1WTR A;  4WJ3 M;  5H1S E;  3HOX H;  4Q0F A;  4CKE A;  2PZU A;  5C0X H;  1TU2 B;  3E9H A;  3NQI A;  4HJ7 A;  5C5M A;  4P75 A;  2CHB D;  4A3M G;  2RDF A;  4FYD A;  1PYW D;  4RA8 A;  1F2L A;  3AQQ A;  4ZLT F;  1IBK Q;  4LF9 L;  3VYS A;  3LWU A;  4JI5 Q;  1HPC A;  2K1B A;  4C3H H;  1HR0 W;  1PXU A;  4RCN A;  1LTS D;  1X32 A;  2A6E D;  1GUG A;  2K5Q A;  4RGM A;  1BXT A;  4QUF A;  1SMY C;  1ICF B;  1YNN D;  3SK6 A;  1Q8K A;  2B2W A;  1RTO A;  1VQ4 A;  2F52 A;  2WKD A;  3J80 L;  3A5Z B;  1XJV A;  3HKZ B;  4BBR G;  1IL8 A;  4OWT B;  4LUO A;  1U4R A;  2HQL A;  2VNU D;  2PYK A;  4IUP A;  4DK3 C;  2ZM6 Q;  3AFQ A;  1KDA A;  2RCF A;  2E2H H;  3CPW A;  4BXX G;  1SFO B;  1EY9 A;  4DV7 Q;  5JVG 3;  2CWP A;  2OXP A;  4KD3 A;  2QGQ A;  4HMJ A;  4CBV A;  1Q46 A;  2F3W A;  3EN2 A;  4ZRZ A;  2WV6 D;  3PIP 3;  2KOL A;  3E9I A;  2L9H A;  4P72 A;  1VQ5 A;  1D5Z C;  1CSP A;  2PZW A;  3SE0 A;  2ES2 A;  1GVP A;  1K3R A;  1Q8I A;  3HOW G;  2L5T A;  1BOS A;  1LT6 D;  1JOQ A;  1W6J A;  3G6J B;  3TS0 A;  1KIX A;  1CA5 A;  1SYG A;  5C0X J;  1GUT A;  1QB5 D;  4JC0 A;  4GNX C;  3HOY G;  2A68 D;  4GKK Q;  3F2D A;  1JB3 A;  4L5T A;  2X6L A;  4ZYS A;  5C44 G;  4NXM Q;  2JA6 G;  3BDO A;  1F9P A;  2PZT A;  1WD0 A;  5KIX A;  3KOJ A;  3ULL A;  5M3M B;  2PO4 A;  1TWA B;  4TRD A;  5IWA Q;  4WFN 3;  1R4Q B;  3I7F A;  3PQI A;  3GTJ H;  2NN6 G;  3FPU B;  4DNT B;  2UUC L;  2F0K A;  2PW5 A;  3FDT A;  4BY1 G;  2R7Z G;  3G48 A;  4R4C A;  4Q5V A;  4OIJ A;  4QY7 A;  4DKA C;  4YY3 Q;  4A3C G;  4K0K L;  1PZJ D;  4BBS H;  3PUZ A;  5LL6 S;  3KJO A;  1EY8 A;  4K5X A;  5IY0 A;  3K7U C;  1S5F D;  2IT1 A;  1EU4 A;  1CQF A;  1B9N A;  4LJZ C;  4O1N A;  2EYP A;  2YYZ A;  2B39 A;  2F0L A;  4K6D A;  1STG A;  2ZTC A;  4L8J A;  1K0S A;  1A3U A;  4DA2 A;  1CKM A;  3IFD A;  4L5R C;  4RFB A;  5D65 A;  5C4J H;  3H15 A;  5M3F G;  1C8C A;  1JR0 D;  1OXT A;  4A3J H;  2B63 G;  3T4A C;  1MJE A;  4OWW B;  4IPH A;  2RF4 A;  1J9O A;  1G29 1;  2WFW A;  3MFY A;  4OO1 I;  3GTP B;  3GTM B;  1PZI D;  3KFU A;  2SNM A;  1JJ2 A;  4R4T A;  1GD7 A;  1K28 A;  1WCM B;  5BR8 Q;  2Q2H A;  1EWI A;  1EOV A;  1T5X D;  3D0F A;  3I2Z A;  5T1G A;  4OL7 A;  4A3M H;  2C35 B;  3KLR A;  2UUB L;  1X3F A;  5KNC A;  3TRZ A;  2F0S A;  3HKS A;  1WTV A;  3EQL C;  1ZYR D;  1STA A;  1DOL A;  5IOC A;  1Q86 C;  3P7J A;  3TP5 A;  4O42 A;  1AZQ A;  3GTO H;  3W1B A;  3I73 A;  2F0T A;  4JI3 L;  2HCI A;  2AQ3 B;  1VQ7 A;  1IBL Q;  4MN3 A;  4R1J A;  1IKM A;  4BBR H;  4BA2 I;  3K7A H;  3VR3 A;  1J8I A;  1M90 C;  1PLF A;  1PTO B;  4CGY B;  4DR5 Q;  5IYD G;  5LMU L;  1KAW A;  1E1T A;  1IBM L;  5M9O A;  3BU2 A;  1X3E A;  3FHW A;  4RGO S;  1DYQ A;  2AKW B;  3X3M A;  5ELN A;  4AYB B;  3BZK A;  4C1N I;  5DM7 3;  4DNI A;  4NXN L;  1PHJ A;  2VW9 A;  4C3J G;  1UWV A;  1VQL A;  1SNO A;  1NJI C;  4LF5 L;  5FK9 C;  2K5N A;  3I3C A;  2F0U A;  2KEE A;  1HNZ L;  1EYA A;  2F0P A;  2B2T A;  5CV4 A;  4YHH L;  2BOS A;  2NVY B;  2Y0S G;  1N34 Q;  4A3F G;  3HOW H;  2RHS B;  1XTD A;  4WJ4 A;  4DR2 L;  3CQZ B;  1PH2 A;  4A3K G;  4EQO A;  2KVM A;  2WAQ B;  4IOC A;  2H1E A;  4QJF A;  3HOY H;  3SXH A;  2EYJ A;  3PF4 A;  2OWO A;  5C44 H;  2JA6 H;  1VQI A;  1P8L A;  4MHE A;  2XSC A;  3BVG A;  3HOV G;  1VQE A;  3SEB A;  1FJG Q;  1E2W A;  2NN6 H;  2R7Z H;  3FMC A;  4BY1 H;  1UE5 A;  3P20 A;  2VB3 X;  4YWK A;  2BA0 A;  2EXZ A;  4RMF A;  4OEM B;  4PV1 C;  4A3C H;  4ZKB B;  3L9A X;  1XNR L;  3DXJ C;  5EBD A;  2LFN A;  1EYG A;  1X6O A;  4L6T B;  4PZ6 A;  1IW7 D;  4QF4 A;  1RJT A;  2NB0 A;  1K8O A;  5EBC A;  4HJ5 A;  2B8G A;  3DWA A;  4PQX A;  3KF8 A;  3H3V I;  1EQT A;  1JWM D;  3M85 A;  1I3Q H;  1DOK A;  3UE0 A;  2MNA A;  2YU9 B;  4GNX B;  4QUC A;  3STB D;  4IPG A;  5M3F H;  1I6H B;  3RZD B;  1LYL A;  3QB3 A;  2B63 H;  1ROD A;  4UP8 A;  2G5D A;  1SYF A;  4FNF A;  4LFC Q;  2ID0 A;  4A93 B;  1GUS A;  1XMQ Q;  4DV4 L;  1I4X A;  3PO2 H;  5GAD C;  2EYL A;  5IOD A;  3I55 A;  5E7N A;  2NVT H;  2B2Y C;  2A6H D;  2KED A;  1SYB A;  1WTH A;  3GTG B;  1HZC A;  1SE2 A;  4A4I A;  4DV2 Q;  5EKL A;  3MXN A;  3K81 C;  4P74 A;  1G6P A;  1Y8N B;  2ICI A;  4DXG A;  4DAV A;  5EPK A;  2AUJ D;  2IWH A;  3UDF A;  2EOT A;  1I4Q A;  3ICE A;  3CC2 A;  1PRT D;  4DAY B;  4BA1 I;  1LTL A;  3G6E A;  2IL8 A;  2KQ3 A;  2ZXR A;  2KEN A;  1WTP A;  2Y0S E;  3OHX C;  3PO3 G;  4JBJ A;  5IYD H;  5A2Q E;  2KHJ A;  4FF1 A;  3CXC A;  1R4P B;  1F77 A;  4DV6 L;  2P5Z X;  4GNX A;  3W1G A;  4PMB A;  1DZ1 A;  3T53 B;  2UXC L;  4A3G B;  4C3J H;  4JI7 Q;  2EQS A;  1HXY D;  2VY3 A;  1O7I A;  1TII D;  2E75 C;  3JAM L;  2X69 A;  1QOH A;  2KCT A;  5I2Y A;  1IYV A;  5HGT A;  2G9D A;  2HIV A;  3G4S A;  1JWU D;  2K04 A;  2IX0 A;  3NEN A;  1I4H A;  1OXS C;  1SSO A;  2A69 D;  3UDX A;  4Y7N H;  2N78 A;  1OXX K;  3DM1 A;  4A3F H;  2A68 C;  3CCS A;  3A5U A;  1X55 A;  1WTX A;  2WII B;  4DR3 L;  2UXD L;  4A3K H;  1FD7 D;  1GOZ A;  2NTT A;  2RKS A;  1U4P A;  1Q81 C;  3RLF A;  1PYS B;  4DR6 Q;  5FOB B;  3SK5 A;  3HOX B;  4KN4 C;  4DAY A;  5NUC A;  4ALP A;  3HOV H;  4JG2 A;  3NTK A;  1Y69 U;  1NAP A;  3CHB D;  2AWN A;  3D31 A;  3LGJ A;  1EYC A;  2EPB A;  1YJ9 A;  2TMP A;  3U50 C;  4LFA Q;  1XMO L;  2FIN B;  2KEC A;  4KKU A;  4C3H B;  1I50 H;  4KLK A;  1Y8O B;  5E4W C;  4YCV A;  4POF A;  3U58 A;  4OXP A;  4A3I G;  5JJL A;  2MQH A;  3SHL A;  4HCE A;  3W5O A;  2F0V A;  3U4V A;  4JK1 C;  1KL9 A;  4JBW A;  1YEZ A;  1RDP D;  3MXP A;  4A3G G;  2ICE C;  5G3L D;  3S1N H;  2E2H B;  4FVM A;  2HCC A;  4JI0 L;  1IZ6 A;  1LTT D;  5JAV A;  3J7A F;  4K2L A;  1EFI D;  3NSW A;  3SVM A;  3BYT B;  1P16 A;  4MIU A;  4N8X 1;  4BY7 B;  2VXW A;  1A63 A;  4DR7 L;  2D0P A;  3OIP A;  4ME3 A;  1CKN B;  3UDG A;  3K80 C;  3RD4 A;  3OWF A;  3CCV A;  2C9O A;  4G7H C;  4TVA B;  1VQ6 A;  5C5L A;  2EYF A;  3CP0 A;  4UHV A;  3PMF A;  2JE6 I;  2MUY A;  3ERS X;  2F0W A;  1TXY A;  5EAY A;  5K5P A;  2LY7 A;  4EQP A;  4BWG B;  3VA7 A;  1NTG A;  4DV3 L;  3ERO A;  1W2B A;  4XQQ A;  5IT9 L;  3NPP A;  3W3A A;  5IT9 E;  3PO3 H;  4M8A A;  2D62 A;  2JA7 H;  2D2C C;  1MI2 A;  5JJZ A;  3GTJ B;  3LNN A;  1YZ6 A;  3KLW A;  1YHB A;  4I7A A;  3M9B A;  1NR2 A;  3VYU A;  4H7B A;  4BBS B;  1SBB B;  2Z1C A;  4KD4 A;  1E1O A;  2K5D A;  2OT2 A;  4ABN A;  1SJH D;  4ZKC B;  1K8M A;  1MGS A;  3FKI G;  3MC0 B;  1AZP A;  2Q2T A;  2CFM A;  1B2T A;  2EY2 A;  2QDL A;  4LF4 L;  4GOP C;  3VYR A;  5KYI A;  4FF3 A;  2XGT A;  4HSP A;  4LF6 L;  1HNZ Q;  5C4J B;  1TWF H;  2J7Z A;  4A3J B;  4BY7 G;  3KF6 A;  4LUV A;  4KJO A;  3VYT A;  4PZ8 A;  3VR2 A;  5AJ3 Q;  3DWQ A;  3NQT A;  3T1H L;  4XXE A;  3DLL A;  2JA5 G;  3BZD B;  1JQY D;  1Q1B A;  3AMU A;  1YHQ A;  1SEB D;  2PCF B;  2XWB B;  5C4Z A;  2F0G A;  1HFG A;  1X3G A;  1N36 L;  3S1M H;  2JEB I;  4LFB Q;  1DON A;  2QKI C;  2EE1 A;  1J5E Q;  2Z0S A;  4A3M B;  4CKC A;  2K50 A;  5LHY 1;  1OO9 B;  1VMP A;  5DLQ E;  4DU9 A;  1SYE A;  2TSS A;  4J8Q A;  3PIO 3;  3GTO B;  2IHE A;  3AYH B;  2J4X A;  4A3I H;  4DV0 Q;  2JJQ A;  1S5C D;  3E0E A;  4BBR B;  2RDG A;  3K7A B;  2ATW A;  4IUU A;  4HJ8 A;  5JEA J;  1BVS A;  1NY4 A;  3PUW A;  1Y8P B;  3DM3 A;  1EFW A;  1E7Z A;  2HQE A;  5FLX c;  3H91 A;  4X3T A;  2ZT9 C;  2RA4 A;  3OWE B;  1CZG A;  2E2D C;  1FNV A;  2Z6B A;  1N8R C;  4ZCK A;  2O5J C;  3MVV A;  1PFS A;  5KND A;  1FGB D;  5ELC A;  3CCQ A;  5EKK A;  2N8N A;  5J1Z A;  1YJW A;  3WOF A;  3U9O A;  1S4Z A;  4HID A;  2K33 A;  2VB2 X;  3T16 A;  2E8G A;  2EYH A;  4PMC A;  3OMC A;  3HOW B;  1JE4 A;  3IL8 A;  2AHO B;  4JI8 Q;  1PRT C;  2MO0 A;  1SE3 A;  1B7Y B;  4PG3 A;  2V1C C;  3K5M A;  5CBA E;  4OON A;  1BUV T;  2QEJ C;  1E0B A;  2LS0 1;  1HR0 Q;  4DUZ Q;  3HOY B;  5HY6 A;  3PUV A;  3K5O A;  1L0X B;  1XXG A;  4YCW A;  4NB3 A;  4R4I A;  5C44 B;  2JA6 B;  1X9N A;  1C48 A;  5JOB A;  4HIK A;  4F88 A;  3DEP A;  1LTA D;  3J7A V;  4C2M H;  2ZJQ A;  4ILW A;  3QJY A;  4HSV A;  4JOI C;  3NUC A;  2PNH A;  3G71 A;  1VQJ A;  1YNJ C;  4DR4 L;  2XTI A;  3C3L A;  3M4P A;  2BE5 D;  1F9S A;  2R7Z B;  4BY1 B;  1JMC A;  1H95 A;  1W6K A;  1VQC A;  4ODG A;  3NHH A;  3GQB A;  3AU7 A;  3CKI B;  1VCI A;  1T5E A;  4UDU C;  3J80 E;  5EQ0 A;  4G7Z C;  2YTX A;  2E2I H;  2F4V Q;  1VF5 C;  4R8I A;  4JYA Q;  1E2Z A;  4B3S L;  4JBM A;  3GD7 A;  1ILP A;  1G2T A;  5E4X A;  1H9K A;  1TKW B;  1SAP A;  1ZXT A;  3FKI H;  3GP7 A;  4DAM A;  1F9R A;  4K8J A;  3I72 A;  5IIF A;  1PDQ A;  4FF2 A;  1S5E D;  2I5L X;  1I3Q B;  2JA9 A;  3ITP A;  1PTO F;  1VQ8 A;  5LMN L;  3E6Z X;  1K8A C;  1AE2 A;  4A76 A;  5M3F B;  4J1M A;  2F3V A;  4UP7 A;  3PV0 A;  2B63 B;  4TSS A;  4BY7 H;  1STH A;  5ELB A;  3PUX A;  1KDB A;  1ZKO A;  4GKJ Q;  2R92 G;  3HOU G;  2JA5 H;  5I9P A;  4JI4 L;  2E2J H;  3TZD A;  1XYI A;  4KHZ A;  4FXG C;  2AQ1 B;  5CV7 A;  3A54 A;  3PO2 B;  4X3U A;  1EY0 A;  4DF7 A;  1QUQ B;  1A8V A;  3WWV A;  5KEE A;  2NVT B;  4PMW A;  5I2X A;  4QIW E;  4ZUI A;  5M5Y H;  1GJX A;  1A15 A;  1BCP D;  3OTO L;  1KHI A;  1STB A;  3S2D H;  4X65 L;  1SRU A;  2IHF A;  4GN3 B;  4GOP B;  4AQY Q;  4XQN A;  1HZ9 A;  1EYD A;  3RUZ A;  1NBW A;  1CTM A;  1A3V A;  3MXG A;  2E5L L;  3EBE A;  1ASZ A;  3RLO A;  2B2U C;  1GKH A;  2K4K A;  4JI2 Q;  3C46 A;  1QIL A;  2VQE L;  2GN5 A;  3ONA B;  3MFG A;  1HNW L;  3N6R A;  4C3J B;  1EQQ A;  1WFQ A;  4JI6 L;  3S16 H;  4KHP Q;  1EIH A;  4KY5 A;  4F7X A;  1VQF A;  1I4P A;  5C4H A;  1S5D D;  4LF8 L;  3J81 c;  2A5H A;  2HT1 A;  2NTS A;  2UXB L;  5CV9 A;  2X6G A;  5CGK A;  4IZ8 A;  4Y7N B;  2HHH Q;  1L1O C;  1NR4 A;  2Y0S B;  4A3F B;  1QUQ A;  1AH9 A;  2LKV A;  4DR7 Q;  3E0J A;  4KHV A;  1NSN S;  2MPM A;  1YJN A;  4A3K B;  1KRS A;  2EY6 A;  3PO2 G;  2F0N A;  2F0F A;  4A3D G;  2FMC A;  3KLS X;  1Q12 A;  3PGZ A;  4GOP A;  1PFB A;  3MAQ A;  3HOV B;  4IOA A;  1EY5 A;  3KLS A;  1HTP A;  3OIQ A;  4DK6 C;  1EY7 A;  3MEH A;  3NEM A;  2ENB A;  4JI1 L;  3DWP A;  3A0J A;  2F0O A;  1J6Q A;  5COY A;  4ME5 A;  1GUN A;  1KAB A;  1I50 B;  3PIP A;  1D7Q A;  2YTV A;  3F8T A;  1VQN A;  4B3M L;  2XRQ D;  5HUR A;  3T1Y Q;  4LNQ A;  3NXW A;  3EA6 A;  3TRE A;  3TP8 A;  4X64 L;  2ZJR A;  1PH6 A;  1PRT B;  3ERQ A;  3R8B A;  3GTK H;  3UI2 A;  3R93 A;  2CKZ B;  2HIX A;  2EJF C;  1FR3 A;  3QWN A;  3HFZ B;  1I94 Q;  4U68 A;  3S1N B;  5IGE A;  3J7A 5;  1VS0 A;  3BYY B;  4RCO A;  4G4K A;  1RKN A;  1LUZ A;  1B70 B;  2Q2I A;  3MWY W;  5JVH 3;  4LMQ D;  1S5B D;  5GRO A;  2FHT A;  1VQB A;  2KJX A;  2R92 H;  3HOU H;  4B3R Q;  2IX1 A;  1HZA A;  2Q2U A;  3LX0 A;  4ZAI A;  4KY6 A;  2UU9 L;  2A73 B;  5J39 A;  2B2V C;  4X66 L;  1X3Q A;  1V1Q A;  2WAC A;  3SDZ A;  4QCL A;  1N32 Q;  1EQR A;  4ULL A;  4DR1 L;  4NDX A;  1NUC A;  1IYJ B;  1HUM A;  4K6L A;  3CD6 A;  5IYC G;  3NK9 A;  4KMU C;  4U67 3;  4CJ1 B;  1PH3 A;  1QNU A;  1JOR A;  2WKC A;  5BN4 A;  3PO3 B;  4RAU C;  4G57 A;  2I0Q A;  2JA7 B;  3K5N A;  1C0A A;  3BDC A;  2RDH A;  4R8N A;  1G8Z D;  2K03 A;  5A35 A;  5FLX L;  1S40 A;  1GM5 A;  2OF1 A;  1UE7 A;  1XX8 A;  1K83 H;  1XNQ L;  1PA6 A;  3SK8 A;  3BVZ A;  3PF5 A;  3VDY A;  4QQB X;  4JOI A;  3WDN A;  3TP7 A;  2M2L A;  3KYH C;  3I91 A;  1RF2 D;  2VQF Q;  1I4R A;  1H9M A;  1BBU A;  1X56 A;  5IGG A;  3AFP A;  5I4D A;  1HQM C;  4RGT A;  4JV5 Q;  4DNR B;  1TWF B;  4NPS A;  4OX9 L;  4N9P A;  4DUY Q;  2Q8I B;  1EUJ A;  2ASB A;  4EQ5 A;  1JJC B;  3GV6 A;  1MIU A;  1GXD C;  1B50 A;  1ESF A;  4JW0 A;  4A3D H;  3K59 A;  1ML0 D;  1F9Q A;  2A6E C;  2BE5 C;  5KYL A;  3RN5 A;  2UUA L;  1EEF D;  4KI0 A;  3K58 A;  1V1P B;  1YNN C;  3SGI A;  3S1M B;  4P73 A;  1HNX L;  4OO1 G;  1ZEQ X;  5KNB A;  4C1N K;  1LTB D;  1TY2 A;  1YIT A;  1TWG H;  2AMC B;  2OQ0 A;  2JEA I;  2OCE A;  5C0X I;  1SJE D;  1Q3L A;  1F2Z A;  2IX3 A;  4LF9 Q;  2EY1 A;  2XVS A;  4X62 L;  2D5D A;  5IGD A;  4IPC A;  1EEI D;  1D1I A;  1L1O B;  3PUY A;  1O7Z A;  1CT1 D;  4A3I B;  2JA7 G;  1GO3 E;  1MD2 D;  5CC4 A;  1EOT A;  4R4O A;  5JEA G;  1IBK L;  3K8A A;  4XQJ A;  3IKJ A;  4JI5 L;  3FEW X;  4LUZ A;  2KCN A;  5COR A;  3S2H H;  3JAM E;  4CDE C;  3MEF A;  1EWH A;  2CH4 W;  2EVB A;  5TSS A;  4OEL B;  5EPJ A;  3J80 c;  2NBF A;  2B2U A;  1TWC H;  1B44 D;  2ZM6 L;  1ET9 A;  5GQO A;  1BCP C;  4IJH A;  3PCO B;  1V1P A;  1HA5 A;  5LMN W;  2A74 C;  2MJ8 A;  4XT3 B;  1HTL D;  4DV7 L;  1SMY D;  4N8F A;  1JCK B;  3NWS A;  4TKO B;  4XYO A;  2HDL A;  1E3P A;  1MJC A;  3C2P A;  4O2D A;  2HDM A;  4RKB A;  1NCV A;  4X3S A;  5IYB G;  5IYC H;  1SNP A;  3CW2 C;  3CMA A;  1L1O A;  1LV9 A;  4O0A A;  2LSS A;  4ZQ3 A;  4ZUJ A;  1JOK A;  1KTK A;  2QW7 A;  2JP1 A;  2KBN A;  4C2M B;  1RHP A;  3J81 j;  1QJO A;  1WTW A;  5JJI A;  1DM0 B;  3CCL A;  3K6O A;  1K0R A;  5KGU A;  3M4Y A;  1CQV A;  4B9W A;  1EY4 A;  4GKK L;  2UUC Q;  4DN4 M;  4K8I A;  4QL5 A;  5I6Y A;  4I7Z C;  4NXM L;  3S15 H;  3U9S A;  1EL0 A;  4DK1 A;  2AUK A;  2DJG C;  1CI3 M;  4A3E G;  1K8G A;  4K0K Q;  2E2I B;  1TQO A;  2DJF C;  4UP9 A;  2D9U A;  1U0L A;  3ULJ A;  4B3T L;  1KD1 C;  1VMC A;  3FKI B;  2QCP X;  2C5C A;  4HED A;  1HFN A;  2Q8T A;  1E2V A;  3UE1 A;  4IUT A;  2RVL A;  3CCE A;  1ENC A;  3A8J E;  4YY3 L;  1KQS A;  4LF8 Q;  4EX5 A;  1I4G A;  2EDG A;  1KNA A;  3QR8 A;  4CJ0 B;  1T9H A;  1R9T H;  1S72 A;  2JA5 B;  4PZ7 A;  1ZYR C;  4DV1 L;  1K9M C;  2E2J B;  2B3G A;  1NMF A;  2F1M A;  4A3B G;  1BQQ T;  3CC7 A;  1PMR A;  2PMZ E;  4RG1 A;  3S17 H;  4OO1 H;  2CW0 D;  3CAM A;  3Q23 A;  1YIJ A;  2F3I A;  4HN7 A;  2UUB Q;  5M5Y B;  1A6X A;  3I4M G;  2N3S A;  1FYC A;  1A2U A;  1SYC A;  2OQK A;  2F0D A;  1QVG A;  1KC8 C;  1MBY A;  1WOC A;  3Q24 A;  3S2D B;  1Y14 B;  1JIC A;  2CCZ A;  2WB1 G;  5BR8 L;  4C3I G;  3R2T A;  2D0O A;  1CA6 A;  4IQZ A;  4JI3 Q;  1FNU A;  4KK7 A;  4ID6 A;  5ELE A;  3SK4 A;  1EQV A;  1G6Z A;  3CC4 A;  1TY0 A;  4F87 A;  3G7L A;  5JEA H;  5LMU Q;  2GVB A;  1FNW A;  1AFP A;  2JN4 A;  1IBM Q;  2EZV A;  1D6E C;  3RNU A;  4QIW B;  2EIF A;  1VQP A;  2JSO A;  4V0B A;  4L5S A;  1VQA A;  4NXN Q;  3BDL A;  3S16 B;  5ELO A;  2OTJ A;  1IBL L;  4LF5 Q;  2PNR C;  2KCM A;  2L12 A;  1CKN A;  5IE8 A;  3S9W A;  4DR5 L;  1DD2 A;  2EYO A;  3RZO H;  1RCV D;  2PQA B;  3NEL A;  3HS0 C;  2O4X A;  1NMG A;  1ENF A;  5IP7 G;  4IFD G;  4YHH Q;  3BJU A;  1OXV A;  1KNE A;  4YWM A;  3HEJ A;  3I4O A;  2UU9 Q;  1MKH A;  2K01 A;  5E3F A;  1HHV A;  4HJ9 A;  2FJ2 A;  4DR2 Q;  1XPR A;  3A7L A;  5D3D A;  3I4N G;  1KRT A;  3J81 i;  2I46 A;  3R2I A;  5IYB H;  4EQN A;  2RCN A;  4A3L G;  4MTN A;  1C7Y A;  1N34 L;  2L4N A;  1IW7 C;  4IAL A;  4MTK A;  3KJP A;  1TS5 A;  5FO8 B;  1EY6 A;  2K75 A;  5GAH C;  4YIJ A;  1K73 C;  3EIV A;  1VF7 A;  3CRL C;  1YNX A;  3BZC A;  2ZJP A;  3TQY A;  3VR6 A;  3FP9 A;  3STB C;  2B2Y A;  3TDQ A;  3I56 A;  4F8M A;  4CKB A;  1ESR A;  1BCP B;  1X3P A;  4A3E H;  3S1Q H;  3HP3 A;  1XNR Q;  1V9P A;  2NN6 I;  1Z7T A;  3MXU A;  1TT2 A;  4K14 A;  3B6Y A;  1STY A;  1O7Y A;  1B4O A;  3OOC A;  4HCS A;  1SE8 A;  1A0I A;  3GTK B;  1FJG L;  4ZK9 B;  2VUM G;  3ND9 A;  5EGT A;  2OTL A;  1XNQ Q;  1Q7Y C;  2MO1 A;  4WJW A;  2PQA A;  1KDC A;  4CJ2 C;  3HOZ G;  1MSH A;  5K36 G;  1B8A A;  2QF7 A;  3QOJ A;  2FFK B;  3F1Z A;  1M4V A;  1Y1V G;  2A6H C;  4C56 C;  1ICW A;  3H3V H;  2IJ0 A;  1L2F A;  1N33 L;  3I4L A;  3L2P A;  3F2B A;  2WB1 E;  4EGV A;  2N49 A;  3HOU B;  2R92 B;  1VDZ A;  2K28 A;  5LL6 X;  1LTI D;  5EPL A;  5T1I A;  4DXF A;  2DNC A;  4A3B H;  1G51 A;  1WYD A;  4DV4 Q;  4FO2 A;  2I5H A;  4DFA A;  3C1F A;  4GS3 A;  5AFW A;  4LW1 A;  3Q8D A;  1JOO A;  3QIA A;  3CPF A;  1DJR D;  3L0O A;  3TZU A;  3E5S A;  4LFC L;  3I4M H;  1W3S A;  1DOM A;  1XMQ L;  3MA2 B;  3D4R A;  2H4O A;  1C4Q A;  4C3I H;  2K14 A;  3OSO A;  3E3X A;  5FO7 B;  3KBG A;  4X62 Q;  4DV2 L;  1CHQ D;  3BVM A;  2A69 C;  2XN9 C;  1SXT A;  3M7G A;  2KA7 A;  4IPD A;  5BN3 A;  4DV6 Q;  3WOE A;  4APV A;  4NKL A;  1PFN A;  2UXC Q;  1XWE A;  1K83 B;  3TBI B;  5FLM G;  3H94 A;  3W2D A;  5M5X H;  1QE6 A;  1ASY A;  4NW2 A;  1DCZ A;  1BO0 A;  1PRT F;  3J7Z C;  1XPU A;  3NTI A;  2BCO A;  3D4W A;  3EVQ A;  2MHV A;  1QWY A;  5IP7 H;  3K5L A;  3S24 A;  1HZB A;  5C3E G;  4IFD H;  2R7D A;  4JI7 L;  2JA8 G;  3PIO A;  1PH9 A;  2B29 A;  5E1F A;  1Y1W G;  2R93 G;  2RQX A;  4GZY C;  1BBW A;  1C9O A;  3I4N H;  3H0G G;  4OIK A;  3CRK C;  3JAM c;  3CCU A;  4DR3 Q;  2UXD Q;  3H6M A;  4A3L H;  1TVX A;  3D6W A;  3RR5 A;  4A3D B;  1VQG A;  1JJG A;  2E74 C;  5DEH A;  4AIM A;  1B3A A;  1WVL A;  1GHJ A;  1F2M A;  1EU3 A;  2K5H A;  3M4O H;  3F2U A;  3CME A;  3BS1 A;  5JPN C;  1SYD A;  4NP5 A;  2VZA A;  1LTG D;  3OMG A;  2O2L D;  1CZW A;  1TWH H;  1TWG B;  2PW7 A;  4GLV B;  4B08 A;  2G9H D;  2K32 A;  1MSG A;  5J22 A;  1XMO Q;  4DR6 L;  4XYQ A;  2L11 A;  4IJL A;  5ELF A;  3ULP A;  1UEB A;  1VQK A;  4DPG A;  1CHP D;  3M3Y H;  4XT1 B;  2VUM H;  4JBK A;  1EIY B;  1WI5 A;  2PI2 E;  4HIO A;  4LFA L;  1A62 A;  5CV5 A;  5FJ8 G;  3HOZ H;  5K36 H;  1IHZ A;  2LXJ A;  2E76 C;  4B3T Q;  1TR5 A;  5C6A A;  3V2T A;  1Y1V H;  3S2H B;  3Q6S A;  3Q22 A;  3NE5 B;  3RN2 A;  4JI0 Q;  1SNM A;  3S14 H;  1NE3 A;  2CW0 C;  3M7N A;  4HAE A;  3ZYY X;  1SNC A;  2B8F A;  4QGU A;  3HKZ G;  4IFD J;  3A55 A;  4DV5 L;  1TWC B;  4KN7 C;  2SNS A;  3AEV A;  4I65 A;  4BS9 A;  4DV1 Q;  1K3B C;  4WOR A;  4KTA A;  1O78 A;  1IXR A;  3KK7 A;  5DM6 3;  1YI2 A;  4DK0 A;  1FL0 A;  5G3L F;  4X3K A;  4H0L C;  3J80 i;  3I8Z A;  2ZTE A;  2WP8 J;  4N9T A;  3VR4 A;  4K2K A;  4HJA A;  4HTH A;  5J3B A;  3NWT A;  4HIM A;  3H3V C;  3U4Z A;  4DV3 Q;  3GTQ H;  2CWA A;  3N52 A;  1PH8 A;  3OPO A;  2JK8 A;  5BN5 A;  1QVF A;  3CF5 A;  2L0C A;  3GO5 A;  2L1B A;  1HH2 P;  2WIN B;  2ZTD A;  3S15 B;  5CV6 A;  2EY5 A;  3CU7 A;  1RL2 A;  1D5X C;  5FLM H;  2JYO A;  4V19 0;  1ILQ A;  1LT3 D;  5M3M G;  5IT9 c;  2HD3 A;  4POG A;  3Q0A A;  2Z8L A;  1B53 A;  3HGB A;  2VL6 A;  4LF4 Q;  3ZJY C;  1UEA B;  1YHA A;  4NMZ A;  5C3E H;  2JA8 H;  3VA5 A;  3M4Q A;  4L63 B;  4LF6 Q;  1Y1W H;  2R93 H;  4IUV A;  1M1K C;  1H9S B;  2EJG C;  3H0G H;  1S3O A;  1D5M C;  4BXX H;  2R6G A;  1R9T B;  4DGZ A;  3T1H Q;  2BH2 A;  2J0T D;  2NVQ H;  3CCJ A;  1XTC D;  1HUN A;  2K52 A;  2L55 A;  3TEH B;  3KF8 B;  2CVR A;  3FVQ A;  1N36 Q;  5M5W H;  3S17 B;  5FO9 B;  1AE3 A;  1EWC A;  5C3W A;  2MGS A;  1RD9 D;  3AB9 A;  1D8L A;  5AJ3 L;  3FPP A;  1GUW A;  2LXK A;  5I9O A;  3S1R H;  2NVX H;  2R61 A;  2K6A A;  3X3N A;  3GTL H;  4RGN A;  1LO5 D;  2GA4 B;  5I6W A;  2I5M X;  2PPB C;  2R7F A;  2BDN A;  3DEO A;  2A8V A;  3A8I E;  2BDO A;  3HKZ E;  2F4I A;  1QVC A;  3QG1 A;  4LFB L;  1WCM G;  4YWL A;  1N9W A;  5FKA C;  4QB4 A;  1J5E L;  2KHS A;  2K5W A;  3RMH A;  5L37 A;  2PQE A;  3UDI A;  2F03 A;  3SR1 A; 
#chains in the Genus database with same CATH homology
 4GKK L;  2UUC Q;  5FJ8 H;  2IHE A;  4QL5 A;  3AYH B;  4A3I H;  4DV0 Q;  4NXM L;  2JJQ A;  4R4Q A;  3F2C A;  3S15 H;  5IWA Q;  1RIP A;  3I7F A;  4A3E G;  1K8G A;  4K0K Q;  3E0E A;  3CCM A;  3GTJ H;  4UP9 A;  2ATW A;  2NN6 G;  2R7Z G;  3MXN B;  2UUC L;  1PYB A;  1U0L A;  4BY1 G;  1BVS A;  5JEA J;  3G48 A;  3ULJ A;  1NY4 A;  3PUW A;  4R4C A;  4DV0 L;  1KD1 C;  4B3T L;  3DM3 A;  1EFW A;  1E7Z A;  5FLX c;  4QY7 A;  4DKA C;  4YY3 Q;  4A3C G;  4K0K L;  4BBS H;  3PUZ A;  3KJO A;  5IY0 A;  4Y52 H;  4X6A H;  3UE1 A;  3K7U C;  3CCE A;  2IT1 A;  1N33 Q;  2QA4 A;  1UE6 A;  4YY3 L;  1KQS A;  4LF8 Q;  4EX5 A;  2VS1 A;  1OXU A;  1SMX A;  4HJ8 A;  1N8R C;  4AYB G;  2YYZ A;  1V43 A;  1PFS A;  1VQD A;  1Z9F A;  2BH8 A;  2ZTC A;  1SFO H;  3CCQ A;  2N8N A;  1CKM A;  1T9H A;  1YJW A;  1R9T H;  1S72 A;  4L5R C;  4PZ7 A;  5C4J H;  3H15 A;  5M3F G;  4DV1 L;  1K9M C;  4HID A;  1JB7 A;  2B3G A;  1NMF A;  1OXT A;  2DUD A;  2E8G A;  4A3J H;  4LF7 L;  2B63 G;  4LWC A;  3CC7 A;  1MJE A;  4A3B G;  4OWW B;  4IPH A;  2K5V A;  2RF4 A;  2AHO B;  4JI8 Q;  2PMZ E;  1G29 1;  2MO0 A;  4RG1 A;  1B7Y B;  4PG3 A;  1Z47 A;  2V1C C;  2WFW A;  3S17 H;  4OO1 I;  4L5Q A;  3CAM A;  4OON A;  1YIJ A;  3KFU A;  1SLJ A;  2F3I A;  1JJ2 A;  1VQ9 A;  1HR0 Q;  4R4T A;  4JI8 L;  2UUB Q;  4DUZ Q;  5HY6 A;  3PUV A;  1GD7 A;  2AWO A;  4GN5 A;  2N3S A;  2OQK A;  4YCW A;  5BR8 Q;  2Q2H A;  1EWI A;  4NB3 A;  1EOV A;  3D0F A;  1WOC A;  2Z6K C;  3I2Z A;  4R4I A;  5IP9 G;  1KC8 C;  4DR4 Q;  1X9N A;  1Y14 B;  4YCU A;  4HIK A;  4A3M H;  2C35 B;  1HR0 L;  2UUB L;  4DUZ L;  2JQO A;  4C2M H;  2WAQ G;  1X3F A;  2CCZ A;  2WB1 G;  3ER0 A;  5BR8 L;  2ZJQ A;  3TRZ A;  4JOI C;  3OYY A;  2D0O A;  3HKS A;  2PNH A;  3G71 A;  1VQJ A;  4JI3 Q;  4DR4 L;  2XTI A;  4XTC S;  3M4P A;  1VQH A;  3CC4 A;  1Q86 C;  2RHQ B;  1PH7 A;  1JMC A;  4B3S Q;  5M3M H;  3W1B A;  3GTO H;  1H95 A;  3CCR A;  1VQC A;  5LMU Q;  2GVB A;  4JI3 L;  1TWA H;  1VCI A;  1IBM Q;  1VQ7 A;  1IBL Q;  4R1J A;  3RNU A;  2YTX A;  2E2I H;  2EIF A;  2F4V Q;  4BBR H;  1VQP A;  4BA2 I;  4JYA Q;  3K7A H;  4MNO A;  4B3S L;  1VQA A;  3GD7 A;  1M90 C;  4JBM A;  2H5X A;  5IYD G;  5LMU L;  1KAW A;  4DR5 Q;  4NXN Q;  5ELO A;  5LMN Q;  2OTJ A;  1E1T A;  1IBM L;  3FKI H;  3BU2 A;  4DAM A;  1IBL L;  1X3E A;  4LF5 Q;  3FHW A;  2AKW B;  2KCM A;  5ELN A;  2F4V L;  4JYA L;  3BZK A;  5C4X G;  1CKN A;  2I5L X;  4DNI A;  5IE8 A;  2JA9 A;  1DGS A;  4NXN L;  4DR5 L;  1VQ8 A;  1PHJ A;  4TQU S;  2VW9 A;  2CQO A;  5LMN L;  1K8A C;  1UWV A;  1AE2 A;  1VQL A;  3RZO H;  4A76 A;  1NJI C;  4LF5 L;  2KHI A;  2PQA B;  3NEL A;  1XPO A;  1NMG A;  2K5N A;  4UP7 A;  4JI4 Q;  5IP7 G;  3PV0 A;  4BY7 H;  4IFD G;  4MZ9 A;  1YBY A;  4YHH Q;  3PUX A;  1HNZ L;  4IFD I;  3BJU A;  1OXV A;  2GVA A;  4GKJ Q;  2R92 G;  4YWM A;  2UU9 Q;  3I4O A;  2JA5 H;  1MKH A;  3HOU G;  4P71 A;  2E2J H;  4JI4 L;  2YV5 A;  4HJ9 A;  4KHZ A;  3I4N G;  4YHH L;  4DR2 Q;  1XPR A;  2Y0S G;  1N34 Q;  4A3F G;  1KRT A;  3J81 i;  1QVG A;  1OTC A;  4GKJ L;  5IYB H;  3HOW H;  2RCN A;  4A3L G;  2RHS B;  4MTN A;  1PVO A;  1QUQ B;  1A8V A;  3WWV A;  1XTD A;  1C7Y A;  4WJ4 A;  4PMW A;  4UPA A;  4DR2 L;  3GTM H;  3GTP H;  3JC6 6;  3OTO Q;  4A93 G;  1N34 L;  1PH2 A;  4QIW E;  3GDE A;  4A3K G;  2NZO A;  3KJP A;  4X65 Q;  4IOC A;  4QJF A;  3HOY H;  2K75 A;  5M5Y H;  1WCM H;  5GAH C;  1PH1 A;  1K73 C;  3PF4 A;  3EIV A;  2OWO A;  5C44 H;  3OTO L;  2JA6 H;  1KHI A;  1VQI A;  1YNX A;  3A74 A;  3BZC A;  2ZJP A;  3S2D H;  1P8L A;  3TQY A;  4AYB E;  2E5L Q;  4X65 L;  1SRU A;  2IHF A;  4GN3 B;  5HGQ A;  4GOP B;  4AQY Q;  1IL2 A;  3FP9 A;  3HOV G;  1HZ9 A;  3STB C;  3I56 A;  1VQE A;  4XIG S;  1NBW A;  1U5K A;  4A3E H;  2E5L L;  3S1Q H;  1FJG Q;  4JCV E;  1XNR Q;  1Q1E A;  1V9P A;  4AQY L;  2VQE Q;  2NN6 I;  3EBE A;  2R7Z H;  4BY1 H;  1UE5 A;  1ASZ A;  3RLO A;  3B6Y A;  3KDF B;  5IWA L;  1HNW Q;  4YWK A;  4JI6 Q;  1GKH A;  2BA0 A;  4RMF A;  4GLX A;  2K4K A;  4JI2 Q;  1SE8 A;  1A0I A;  4A3C H;  1FJG L;  1XNR L;  2VUM G;  2VQE L;  2OTL A;  1XNQ Q;  1EYG A;  1X6O A;  2GN5 A;  2MO1 A;  4PZ6 A;  2PQA A;  1Q7Y C;  3HOZ G;  1HNW L;  5K36 G;  1B8A A;  4H02 A;  1EQQ A;  1WFQ A;  4HJ5 A;  4JI6 L;  3S16 H;  4KHP Q;  4JI2 L;  3F1Z A;  2UXB Q;  1VQF A;  1SN8 A;  1Y1V G;  4GLA C;  3H3V H;  3H3V I;  3M85 A;  1L2F A;  1I3Q H;  1N33 L;  4KHP L;  1JE5 A;  3UE0 A;  3L2P A;  2MNA A;  4LF8 L;  2WAQ E;  3J81 c;  3F2B A;  2WB1 E;  1FVI A;  4DV5 Q;  4GNX B;  2HT1 A;  2N49 A;  2UXB L;  3STB D;  4IPG A;  5M3F H;  3PSI A;  2HHH Q;  1L1O C;  1LYL A;  2B63 H;  4A3B H;  4UP8 A;  1QUQ A;  4UY8 C;  1AH9 A;  1G51 A;  1WYD A;  4DV4 Q;  4DR7 Q;  2L15 A;  2I5H A;  4LFC Q;  4GS3 A;  2HHH L;  2ID0 A;  4LW1 A;  3Q8D A;  1L0W A;  3OW2 A;  1XMQ Q;  3L7Z C;  2EXD A;  1YJN A;  1KRS A;  2NVY H;  3CPF A;  1PV4 A;  3PO2 G;  1CSQ A;  4DV4 L;  3PO2 H;  1WJJ A;  5GAD C;  3L0O A;  1LM0 A;  4LFC L;  3I4M H;  4A3D G;  1SRO A;  1W3S A;  1I5F A;  3I55 A;  2NVT H;  1Q12 A;  3PGZ A;  5E7N A;  5IP9 H;  4GOP A;  1XMQ L;  1JT8 A;  3JAM i;  3CQZ H;  2ALY B;  1HZC A;  4JI1 Q;  4IOA A;  4GN4 B;  4A4I A;  4DV2 Q;  4C3I H;  2K14 A;  1CUK A;  3KF6 B;  1YVC A;  3K81 C;  4P74 A;  4DK6 C;  1G6P A;  3NEM A;  4X62 Q;  3KDF A;  3IRB A;  4B3M Q;  4JI1 L;  3HOX G;  3UDF A;  3A0J A;  5C0X G;  4DV2 L;  1J6Q A;  1FGU A;  3NBH B;  1E24 A;  3ICE A;  5JJK A;  3CC2 A;  4DAY B;  3PIP A;  4BA1 I;  4X64 Q;  1LTL A;  2YTV A;  3F8T A;  1PH4 A;  3G6E A;  1D7Q A;  3I4M G;  1VQN A;  4B3M L;  4IPD A;  4DV6 Q;  2KEN A;  1VQO A;  3T1Y Q;  4LNQ A;  4APV A;  3TRE A;  2Y0S E;  3PO3 G;  4JBJ A;  4OWX B;  5IYD H;  4X64 L;  2ZJR A;  2UXC Q;  2KHJ A;  1X54 A;  1PH6 A;  2QEX A;  3CXC A;  3GTK H;  1CKO A;  5FLM G;  4DV6 L;  2CKZ B;  2HIX A;  5M5X H;  5C4X H;  3T1Y L;  4GNX A;  3W1G A;  1ASY A;  3HFZ B;  2UXC L;  4C3J H;  1I94 Q;  4JI7 Q;  2EQS A;  1QZH A;  1KXL A;  3J7Z C;  2VY3 A;  1XPU A;  3J7A 5;  1O7I A;  1VS0 A;  5IP7 H;  5GAE C;  2KCT A;  1LUZ A;  1HZB A;  1B70 B;  2BA1 A;  2Q2I A;  2R7D A;  3S24 A;  5C3E G;  1I94 L;  4JI7 L;  3PIO A;  2JA8 G;  5GRO A;  1PH9 A;  1VQB A;  2YU9 H;  2B29 A;  2HIV A;  1Y1W G;  3G4S A;  2R92 H;  3HOU H;  2IX1 A;  4B3R Q;  2R93 G;  1UE1 A;  1BBW A;  1HJP A;  2IX0 A;  3NEN A;  1I6H H;  1HZA A;  1OXS C;  3UDX A;  4X66 Q;  1C9O A;  4Y7N H;  3K0X A;  3RZD H;  3H0G G;  1VQM A;  2N78 A;  3JAM c;  1OXX K;  2YTY A;  3CCU A;  4A3F H;  4DR3 Q;  2UXD Q;  2UU9 L;  1QZG A;  4B3R L;  4A3L H;  3RR5 A;  3CCS A;  1VQG A;  1JJG A;  3A5U A;  1X55 A;  4X66 L;  4DR1 Q;  4AIM A;  4A93 H;  4DR3 L;  2UXD L;  1V1Q A;  4A3K H;  2K5H A;  1BKB A;  3M4O H;  1N32 Q;  1Q81 C;  1EQR A;  3CME A;  3RLF A;  4DR1 L;  1PYS B;  4DR6 Q;  2VZA A;  1IYJ B;  1TWH H;  4GLV B;  1N32 L;  4ALP A;  3GTG H;  3HOV H;  3CD6 A;  4JG2 A;  5IYC G;  2MFI A;  1XMO Q;  4DR6 L;  2AWN A;  3D31 A;  1PH3 A;  4IJL A;  3LGJ A;  3ULP A;  1UEB A;  1VQK A;  1X65 A;  1YJ9 A;  4DPG A;  3U50 C;  4LFA Q;  1XMO L;  1EIF A;  2I0Q A;  1I50 H;  1C0A A;  4KLK A;  3M3Y H;  2VUM H;  4JBK A;  1EIY B;  1WI5 A;  2PI2 E;  4HIO A;  4LFA L;  1A62 A;  4YCV A;  5FJ8 G;  3HOZ H;  4POF A;  3U58 A;  4OXP A;  4A3I G;  5JJL A;  2LXJ A;  2MQH A;  2Z6K A;  1S40 A;  1GM5 A;  4B3T Q;  1UE7 A;  3W5O A;  1K83 H;  3U4V A;  1Y1V H;  5GAG C;  2FXQ A;  1XNQ L;  1PA6 A;  1Q82 C;  2IY5 B;  4L5S A;  1KL9 A;  4JBW A;  3PF5 A;  1YEZ A;  3VDY A;  4JOI A;  4QQB X;  3RN2 A;  4JI0 Q;  4A3G G;  2NZH A;  4A3G H;  2PI2 A;  3KYH C;  2A19 A;  3S14 H;  1NE3 A;  2VQF Q;  1E22 A;  3S1N H;  3M7N A;  4BBS G;  1PH5 A;  4OX9 Q;  4QGU A;  3HKZ G;  1BBU A;  1X56 A;  4IFD J;  3AFP A;  4JI0 L;  4DV5 L;  2DGY A;  1IZ6 A;  3AEV A;  4AH6 A;  2VQF L;  4JV5 Q;  4NPS A;  4OX9 L;  4DV1 Q;  4DUY Q;  1P16 A;  4FDB A;  3TS2 A;  1EUJ A;  2ASB A;  1IXR A;  1SR3 A;  4EQ5 A;  1A63 A;  1JJC B;  2UUA Q;  4DR7 L;  2D0P A;  4LF7 Q;  1MIU A;  4ME3 A;  4J15 A;  1CKN B;  4IO9 A;  3RLN A;  1YI2 A;  1FL0 A;  3K80 C;  3UDG A;  4JV5 L;  4A3D H;  3CCV A;  3J80 i;  4DUY L;  4TVA B;  1VQ6 A;  1HNX Q;  2ZTE A;  2WP8 J;  2A1A A;  4A3J G;  3RN5 A;  2UUA L;  4KI0 A;  3CP0 A;  2JE6 I;  4HJA A;  3SGI A;  5J3B A;  4HIM A;  4P73 A;  4A75 A;  1HNX L;  4OO1 G;  3ERS X;  3U4Z A;  4WJ3 M;  1TXY A;  5EAY A;  5H1S E;  4DV3 Q;  3HOX H;  1YIT A;  3GTQ H;  1TWG H;  2AMC B;  2CWA A;  2OQ0 A;  2JEA I;  2OCE A;  3E9H A;  5C0X I;  1PH8 A;  4LF9 Q;  2JK8 A;  4HJ7 A;  4X62 L;  4P75 A;  1QVF A;  3CF5 A;  1NTG A;  4DV3 L;  4IPC A;  4A3M G;  1W2B A;  1L1O B;  3GO5 A;  3PUY A;  1HH2 P;  3AQQ A;  4LF9 L;  1IBK Q;  2JA7 G;  3PO3 H;  2ZTD A;  2D62 A;  4JI5 Q;  1GO3 E;  2JA7 H;  4C3H H;  1HR0 W;  1RL2 A;  5FLM H;  4R4O A;  5JEA G;  1YZ6 A;  3KLW A;  5M3M G;  3K8A A;  5IT9 c;  1YHB A;  4JI5 L;  1IBK L;  4POG A;  3M9B A;  4LUZ A;  1Q8K A;  1VQ4 A;  2F52 A;  3A5Z B;  2VL6 A;  1XJV A;  4LF4 Q;  3S2H H;  1E1O A;  3ZJY C;  4BBR G;  4OWT B;  1YHA A;  5C3E H;  4LUO A;  2JA8 H;  2HQL A;  3MEF A;  2VNU D;  3M4Q A;  3FKI G;  2Q2T A;  2ZM6 Q;  4LF6 Q;  2CFM A;  4DK3 C;  1Y1W H;  4LF4 L;  3AFQ A;  2R93 H;  3J80 c;  2E2H H;  4GOP C;  1M1K C;  3CPW A;  3H0G H;  1S3O A;  3ULL A;  3I4N H;  4BXX G;  1TWC H;  4BXX H;  2XGT A;  2R6G A;  2ZM6 L;  4DV7 Q;  1HNZ Q;  5GQO A;  4LF6 L;  2CWP A;  3T1H Q;  2BH2 A;  1TWF H;  4IJH A;  3PCO B;  2NVQ H;  3CCJ A;  5LMN W;  2QGQ A;  4BY7 G;  3KF6 A;  4LUV A;  1Q46 A;  4PZ8 A;  2K52 A;  3EN2 A;  3TEH B;  5AJ3 Q;  4DV7 L;  3KF8 B;  3E9I A;  3T1H L;  3DLL A;  2JA5 G;  4P72 A;  1N36 Q;  5M5W H;  1VQ5 A;  1CSP A;  1AE3 A;  1Q1B A;  1YHQ A;  2ES2 A;  1GVP A;  1D8L A;  1E3P A;  1K3R A;  1MJC A;  4O2D A;  5AJ3 L;  2LXK A;  5IYB G;  5IYC H;  3S1R H;  3HOW G;  1X3G A;  3CW2 C;  1N36 L;  2NVX H;  3S1M H;  2JEB I;  3CMA A;  4LFB Q;  3GTL H;  1L1O A;  4O0A A;  2I5M X;  2LSS A;  2R7F A;  2Z0S A;  1J5E Q;  2A8V A;  3HKZ E;  3TS0 A;  2KBN A;  2K50 A;  1KIX A;  3J81 j;  5C0X J;  4JC0 A;  4GNX C;  3HOY G;  1QVC A;  5JJI A;  4GKK Q;  4LFB L;  1WCM G;  5DLQ E;  4YWL A;  3F2D A;  3CCL A;  1N9W A;  4L5T A;  1K0R A;  5C44 G;  2Q2U A;  1J5E L;  4NXM Q;  2JA6 G;  3UDI A;  3KOJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...