3JARB

Cryo-em structure of gdp-microtubule co-polymerized with eb3
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
429
structure length
429
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanistic Origin of Microtubule Dynamic Instability and Its Modulation by EB Proteins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
molecule keywords Tubulin alpha-1B chain
total genus 151
structure length 429
sequence length 429
chains with identical sequence D, F, G, H, I
ec nomenclature
pdb deposition date 2015-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3jarB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 3jarB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 3jarB01
2VAPA 3JATA 4O2AB 3VPAA 4O4JA 4O2BA 4O4HB 4O4LA 5IJ0B 4O4IA 1W581 3WGMA 4EI7A 3VO8A 2Q1XA 3ZBPA 3R4VA 4DRXB 5GONA 3JASA 4X1IB 5EIBC 3HKDA 4FFBB 5EZYB 5FNVA 4I55A 5BMVA 5EIBD 5J2TA 3N2KA 3E22A 5IYZB 4U3JA 3ZBQA 4LNUA 4HNAB 4EI8A 1W59A 4TUYA 5CA0A 1TUBB 4ZI7B 5LYJA 5KMGA 1SA0A 1JFFA 5J2UB 4X1YA 2BTQB 5JH7A 5LXTA 2XKBA 4WBNA 5ITZB 4EB6B 3JARB 3HKCA 4TV8B 3RYFB 2VAMA 5KX5A 2RHJA 5CA1B 3JALB 3ZIDA 3JAWB 5IJ9A 3UT5A 3JAKA 4O4HA 4O2BB 3M89A 4B45A 4TV9A 4U39A 3HKEA 1FFXA 4X1KA 4DXDA 4X20B 5C8YB 3C8LA 5CB4B 5LOVA 5BMVB 2VAWA 1TVKA 3N2GB 5LA6A 5EYPB 2RHHA 5J2TB 4I50B 2R751 5IYZA 4ZOLB 3CB2A 5LP6C 4ZHQB 1TUBA 5CA0B 1W5FA 2Q1YA 1OFUA 3HKBB 4YJ2B 4IHJA 3V3TA 3JATB 4O2AA 3M8KA 4YJ3A 4EB6A 5JQGB 3HKCB 3RYFA 4KWEA 4IIJB 1RLUA 5MN5A 5JVDA 3JASB 5FNVB 4FFBA 2BTOA 5EZYA 4I55B 5LP6B 2XKAA 3JAKB 2R6R1 4LNUB 3RYIA 4X1KB 4B46A 1W5AA 3WGNA 2RHLA 3WGKA 5CB4A 4F6RB 5LOVB 1Z5WA 4E6EA 5JCOC 4U3JB 3RYCB 4HNAA 3RYHB 5EYPA 3VOBA 4I50A 1RQ2A 4X1YB 5JH7B 5LXTB 4TUYB 4WBNB 4I4TB 1Z5VA 4ZI7A 5MN4A 4EI9A 5KMGB 5LYJB 2RHOA 4ZHQA 4O4JB 2BTQA 3JAWA 4O4LB 3HKBA 4O4IB 5IJ9B 5IJ0A 4YJ2A 4IHJB 4M8IA 3WGLA 5MN6A 3VOAA 3VO9A 4TV8A 1W5EA 1W5BA 5KX5B 4YJ3B 5CA1A 4TV9B 5JQGA 4DRXA 3HKEB 1FFXB 5GONB 3WGJA 4X1IA 3HKDB 1RQ7A 3UT5B 3N2KB 2GVIA 3E22B 5LP6A 4X20A 4ZOLA 5C8YA 2VXYA 1FSZA 5JCOA 3RYIB 3RB8A 5M7EA 1TVKB 3N2GA 1JFFB 1SA0B 5LA6B 5J2UA 4XCQA 4F6RA 5ITZA 3RYCA 3RYHA 3JARA 4I4TA 3JALA 4IIJA 5JVDB
chains in the Genus database with same CATH superfamily
5HY0A 2PA0A 1B8NA 1Z0ZA 3LXRA 1ZD3A 1QD9A 1J6UA 3BWDD 4O08A 5HDBB 1HFWA 3SX4A 2GETA 4UAVA 4XSHA 4OJQA 3T1QA 1DKQA 4L4UA 1WV0A 4X8HA 4DV4O 3RW0A 1JQJC 4IIJF 5EMHA 2Y66A 4LRXA 3BB1A 1ZH0A 3M6MD 4R2JA 1TK9A 2VYFA 3N2KA 1ZN2A 1B3RA 1PM9A 1OYVA 4Q4LA 3SY8A 3PXDA 5CEFA 4R2XA 3RHZA 5CDUA 3WJPA 4KQ2A 3AK1A 2BFCA 1YCFA 3NWJA 1TIBA 4LJSA 2E1RA 4R0NA 3WIVA 4PDRA 4D41A 1YDGA 2B21A 5FWNA 2CXNA 1OHHG 4CM1A 4ZDWA 2JI4A 3EEYA 3WK9A 3CUVA 4Q16A 1H1TA 3GZNB 5EOVA 1GNLA 1NT2A 3V7QA 3V1TC 2VHTA 3RYFB 1N33O 2MSWA 4PYKA 3VNRA 5M2QA 3U7HB 3EG9A 2XNHA 4UMEA 5GMOA 1NJSA 2P8JA 2EFEB 2HPAA 1RVDA 4JTDB 3R0QA 3NHFA 4TLMB 4DLLA 5JSUA 2RONA 2JGKA 3ZHZA 1FQKA 1V2HE 2BKAA 4TKVA 3IX7A 2N0SA 1XQ8A 2PL1A 2QRJA 5GZ1A 1NATA 2VAWA 3FHJA 1WXDA 3ECSA 4E51A 1I1QB 2HS3A 3K0FA 3TG2A 4N48A 5A4DA 1HG0A 3SIVA 4NCNA 2ZOSA 4PVCA 3AQ4A 4ITRC 3NOOA 2G8NA 1SQPH 4R31A 2Z04A 1FY2A 1FU8A 2IVZA 4KFTA 1XZBA 2WP8J 2VQEB 1H6BA 5D3ZA 2FCAA 2CY0A 3PI7A 1NV8A 1SB9A 4GPAA 1B7GO 1NONA 4NH0A 4B4DA 4UTPA 4YTEA 2HP8A 5HMLA 3SXPA 1WJGA 2IDKA 2RHCA 1DBWA 3T61A 2BSAA 2C82A 2GJKA 4IL6Z 3K94A 5TEVA 1FLNA 3NRJA 2RC5A 4GYYA 4UZEA 4W1SA 3THXA 3O2QB 4Y1GA 3ICVA 5KWVA 3TNLA 4J2TA 4BQOA 2XUFA 4XPZA 3UO3A 4Z1MA 3RDPA 2W8BB 2UZIR 2DWUA 3WL5A 3R9XB 3WL7A 4UNIA 4ZAGA 1ESEA 2OHGA 1JR2A 1RHMA 4AB1A 2YUAA 4PA7A 1D2EA 1VL2A 2PUTA 4GLBA 4OSEA 4QU8A 4C07A 4FX2A 1E4YA 1XTSA 3ZU6A 4DCOA 4US1R 3C6MA 3EVBA 3RT7A 4PPQA 3U31A 2FOLA 1A8UA 4ZT5A 4IXDA 1PHRA 1R5NA 4URFA 3HLYA 4PZEA 1EN6A 4KXLA 4JI6B 4IP0A 2GVIA 1YJ5A 1E2HA 2AWOA 1Y4SA 1NXTA 1VKZA 2DX7A 2B1GA 2VK4A 4QDXA 3X0DA 1AN0A 3FLMA 4US2R 3K9BA 1L7DA 1N0WA 1OBVA 2XOKD 2G76A 2VNAA 3GH1A 3KHKA 1WY7A 3OX2A 3FVTA 1U0JA 4TN5A 5EA2A 2GA8A 5IT5A 3N2GA 2HWKA 3K9AA 3BPSA 4XCQA 5MGBA 1KO5A 3CCMV 2JAWA 3A2NA 4DIUA 1FNDA 2HRQA 2OXFA 5C8YF 5IPFA 2CMDA 3GGJA 4IIXA 4J0GA 4R7TA 5CN0A 2Z1TA 2DLDA 5ADWA 1YFKA 2PR7A 4I8IA 4D6XA 1E61A 2P6MA 1AI7A 2O0KA 3B36A 3ODPA 3Q9SA 3QWFA 4D5EA 4QGPA 3UVEA 3QBEA 2OIEA 1OC4A 4U9HS 5E6RA 3WYEA 1LPSA 4NCBA 3HM9A 5EJ7A 4G4ZA 1Q86H 3KJJA 3FNRA 5FRDA 2IPNA 2XDYA 1Z29A 2BFFA 2G1UA 2JDID 3OEHD 4IOLA 2QD1A 1F4MA 1H2SB 1E1MA 5DBOA 5I7FA 3TGUH 4MQEB 1UT6A 3IFXA 1FNKA 1ORHA 2JJ1D 3IT3A 3LWZA 5KAMA 3CWQA 3IHTA 5HJ5A 2I0FA 3M1AA 4P86A 4H17A 5BR8O 4WWHA 1N6PA 3CCRF 4YJ2F 3L0IB 3MWEB 3CD6F 3NTXA 2G5PA 4J7ZA 1BWSA 4JB3A 4ND8A 4PIVA 4Q39A 4EITA 4F3TA 1TYEB 5H1YA 3VR3A 4X54A 3U3ZA 2JLUA 2CHFA 3TKLA 1Z8HA 3KR9A 2UUCB 3IT2A 2B4YA 5KHLB 5LZ2A 1GZ7A 1QYVA 4NCIA 1G21B 2V5AA 1M56C 1IZ8A 3CA8A 3ABSB 1DAGA 2BEKA 2PWBA 3JRXA 4GVXA 1Z7WA 4ZDJA 2CL5A 3HVIA 3QVJA 1ZR2A 1T3SA 5TQ2B 3TSYA 4EK9A 3QOYA 1USWA 3VR6D 5CEEA 1O0CA 1EA5A 2C3YA 3MOIA 4DHEA 5C52B 2OLKA 2C5EA 1Z6PA 2CZGA 3JQ9C 5CNKA 3EJ6A 3RSFA 1U3PA 1ZH6A 6GPBA 3W90A 2NQTA 1UZUA 3KQVA 3VPSA 4BN4A 1ORIA 3FGNA 4YRDA 4B3FX 2WILA 1P8JA 5K3OA 2OORC 2WHXA 1K06A 2WWGA 3OSUA 4CG1A 3TG8A 2JJ1G 3OUUA 1N2SA 2IAFA 1SU8A 2OHOA 3BSSA 3LDFA 4WGFA 2GM4A 2HQSC 4XD2A 2G71A 3SYTA 1DCMA 4ML3A 3VAAA 1MB3A 3DE1X 4X3OA 3WZ2A 4YLYA 2BTOA 4MVSA 2YHSA 3LIIA 1KI8A 3QLEA 4OIFA 3PNYA 3S1AA 5E8RA 1DAIA 1VQ8F 5L9AA 4IQFA 1WQ4A 4COKA 5A5EA 3P9SA 1WZNA 3H86A 3GAZA 1Q2UA 4GMHA 3KPVA 1T3LA 3ML1A 3TLKA 5AXBA 4AC9A 1RCUA 4MV8A 1LDYA 1IQRA 1TAGA 3PCRB 4TLAA 3CVJA 1NNI1 4CWAA 1Y7PA 1AKEA 3OCJA 1VE7A 1OKKA 4IRMA 2DBZA 2O4CA 1YHYA 3LWVC 5A9RA 1LSOA 3AMVA 3P4UA 3RV4A 4AJEA 3RS7A 4ND7A 3KYIB 1GPBA 3KM0A 4FHGA 4HDNB 3KQHA 2ZBFA 1PR1A 1U96A 1FDTA 1GV0A 2QXUA 3ER9A 5GONB 3HKDB 1OPRA 3VSBA 4NONA 1VI5A 2BTUA 1L0BA 1LLDA 2V8BA 3IV7A 5FFFA 2RIRA 3T52A 5GTDA 4XGIA 3TOVA 3O3CA 1KZ7B 3E6AA 3TLJA 2VT2A 2BL4A 1RWVA 3N58A 3U4GA 3RV3A 2FGKA 4L4YA 4ZTZB 1WXGA 2GEJA 1B0ZA 4JI3B 4M9SA 4L15A 3K4QA 1YAHA 2RMKA 3D02A 3C5VA 1IY0A 1N3BA 1P33A 4BX9A 4EY6A 3L9WA 4E3WA 3TX6A 2ZUDA 3ZK7A 3STLC 1FSFA 2PT9A 3H1PA 2AT1A 4JI8O 2IQQA 3BSWA 4B4VA 3IDSA 3WB9A 1CQXA 3OUTA 1KQFA 1NVVR 4N9QA 1UADA 5KU1A 3G0HA 3UWSA 5DBEX 4RWZA 1FMLA 1NFFA 2IPLA 1BYUA 2I62A 4JI5O 3C4VA 3U0OA 1V1RA 1P3DA 4EF6A 1G4AE 2XIJA 5FOTA 4HWOA 1XWWA 1D1TA 4Y3UA 1QP8A 2FL4A 3FFTA 4G1FA 1FNJA 3H1LH 1E5QA 1D0IA 2XUQA 4MVWA 4QPKA 4FSXA 1PK7A 4TQAA 1TUGA 2DERA 3H42B 1W59A 2PZAA 2X1MA 1D04A 1EE9A 4TUYA 5IT4A 3O8BA 1GAJA 1W8IA 2XCSB 2C7OA 1XTBA 4KMMA 4MS4B 1WWKA 4TKMA 4UU1A 2CVLA 2NXEA 5CVCA 2H2HA 1P1BA 2HP3A 1ULZA 4HB2A 4MDHA 3KTDA 3T7RA 2OC4A 2WHPB 3TRHA 1N3LA 3WYCA 3PV0A 3SDLA 1KYXA 1SWVA 2EDAA 1TL7C 2G9IA 1A9TA 2H7XA 2DPHA 2R84A 4J0KA 4QJBA 1R1BA 3E03A 5E9AA 1IB6A 3LI2A 2AG0A 1QIIA 1OTYA 3TTSA 5DN6D 2AB0A 3JTMA 4TKUA 3PCXA 4JBXA 1KBHA 2J67A 3MBKA 2EEPA 3GFFA 3DBLB 1ULAA 5KOHA 4DXDA 1ZNYA 4OM7A 5HF5A 4HSEA 4JC0A 1EA7A 4N3NA 2JATA 1QP4A 3L8EA 1PT6A 1T3GA 4M55A 3UAVA 4UOZA 5K0CA 5KNBA 2YVKA 3AO0B 2KBEA 1DRUA 1H7MA 3BJMA 1J39A 5EZ5A 1QCEA 4OQEA 3GJZA 3NTVA 1ZUNA 3P9PA 3IGAC 3JYNA 5FBZA 4RF2A 4KR2A 1D2MA 1WEKA 4V39A 1I5YA 3H1IH 4IHJA 2Y1KA 2R79A 2OYQA 3D36A 1E99A 5ICFA 1KERA 3W6UA 4JXZA 4BQPA 2J85A 1M4UA 4M60A 3KTOA 1N32O 3RFVA 3I2IA 3DM9B 3OTQA 1VKOA 3LNCA 4JI8B 1IZYA 4GRAA 1XQ6A 3BWYA 3R6LA 1I6KA 2PLRA 3DMYA 3VYWA 3CC7F 3R4CA 1QH8A 4LTNA 1YJ8A 3AY3A 4UCFA 3ORFA 5FNZA 3ZUGA 1AH2A 5A5DA 3VU9B 2J4FA 1RM0A 3K6JA 1YF3A 2V8OA 1U5BA 2FGJA 3WFIA 3ON1A 2WLKA 5AKYA 5ALOA 3UMGA 3GJSA 1TF5A 2B3TA 2QV0A 1E6MA 1HE5A 5EKXA 5JE8A 4K9DA 3DXFA 5KOJB 1M0EA 1G5IA 4PWZA 2XADA 3PPIA 4RVHA 1DAHA 1E7KA 1K75A 5BSRA 3GLIE 1ETUA 4IJUA 1L5QA 1MFZA 3PU6A 3VPGA 3VZDA 2LTAA 3NKVA 3NZEA 4PRKA 4C7MA 5DEOA 2HPVA 1YUNA 4YWJA 3VAZA 2FSVC 4TMWA 4R81A 1ODFA 2XB9A 1LCIA 2C57A 3VNSA 4OFZA 1UZMA 5HKKA 4PF1A 1KQ3A 1ECLA 3ITEA 4EUHA 1KEEA 1D7AA 2OAEA 3F6RA 5AJTA 3NEAA 1O95C 1YCGA 3E22B 4UBLA 5CG2A 3T7DA 1JQBA 3IA2A 1SQQH 1TE2A 2X0IA 3DPIA 3EMDA 3LUAA 3V8NA 4CCSA 1W2BU 4NXNO 1O96B 1TQ2A 1UP6A 3B3AA 3DO8A 3OCWA 4ND3A 1CQJB 2PUJA 4OP1A 5TMDA 2O8CA 1B0AA 5JCJA 4UVIA 1B1CA 3ABTA 3G88A 3JRWA 2ZSJA 1JPXA 1FEZA 3N70A 4UVHA 3HPLC 4ZVVA 2XDWA 5TVGA 2AH5A 1AUOA 3IMKA 1S3SA 4JJGA 2WTNA 1Z4IA 2HEPA 3AFMA 1EDOA 3QUQA 4BFWA 4E2FA 1J8DA 1TVMA 2I87A 3D4BA 4QJ4A 1S9HA 4RFLA 5IS2A 2XMGA 1XVUA 4HATA 4ZC8A 2WKQA 4TWIA 4BBJA 4EAAA 3APOA 1Z16A 2V74B 2OZLB 2VNSA 3W7AA 1XHZA 1YO6A 2D54A 3FWYA 4DREA 2WINI 2I34A 5K3FA 3AESA 3F7TA 3EFFK 4FFBB 2NIPA 3TZEA 4YAKA 1VIYA 4OQZA 4RC9A 4LGYA 4CFSA 2YN0A 1PE0A 1VGVA 1L1EA 3SMVA 1DELA 1G21E 1GYRA 4DQ0A 2UVPB 3LLVA 4KXXA 2GUGA 3THXB 1B0UA 4PQRA 1CRQA 4MCIA 1C41A 5TF0A 1T9AA 3ZV5A 5CA0A 5HXAA 1IV1A 2DUJA 2FX5A 3C1AA 1H1LB 2R85A 2F1MA 1Z28A 4H9GA 4RORA 4U8HA 5KI6A 4CIWA 3K12A 3QGMA 3R9XA 3D6VA 1D0VA 2XMRA 3KOXA 1L5KA 3AIKA 2V7QG 4L87A 1FP4A 5EB0A 1UFVA 3O26A 3PZBA 4AZSA 3ZD8A 1A98A 5EHGA 3FTFA 3JCUZ 1P4RA 1IXKA 1YE5A 2IYYA 4GRDA 5DNVA 2OHXA 3UATA 4EW1A 2MYTA 5AW6A 5HY4A 1W75A 4LF9B 5K3SA 1TW3A 1XKXA 1RPRA 2DT4A 2IW3A 2R1UA 2Z3VA 3C6QA 3CX6A 4LOLA 4P22A 5KUTA 1AHPA 4D99A 2WG2A 2VDKB 4DLVA 3FPCA 2ZRJA 4UUOA 3E86A 1G5HA 4D9IA 4YRKA 4FBGA 2IXBA 4YMUA 1Z7EA 5ESWA 3A1EA 4B76A 5E3IA 5ECWA 1PUJA 3ZHRA 1R5OA 1PW7A 1CUHA 2H18A 1E63A 3CJHA 4TRMA 1A88A 3ORRA 3I3OA 4K81B 2QDXA 3W2TA 4AULA 3G7NA 2VHCA 3FSRA 4FVTA 2G25A 3A4YA 2HDOA 4UBNA 3NH6A 4MPJA 3K35A 3V3TA 2VOJA 1UZNA 1IDSA 4UHBA 3AYXB 3KQKA 1KU6A 1SKUA 4RL4A 3TBFA 3T7TA 3GVMA 2GDSA 3C7AA 4FLMA 3OLQA 4IIJB 3TSCA 5K3AA 3R3WA 1YBAA 3I9LA 4ZZ2A 5KTMA 3HC7A 2JLZA 5J47A 1N57A 4MVJG 5LJLA 2XWBF 3JD2A 3ASUA 3BERA 2F67A 4FEGA 4D57A 4KGVA 4WLVA 3UHPA 2REXB 1KNKA 1DRWA 1XU4A 3Q88A 4NAHA 4DCUA 1DGSA 5CB6A 5D86A 3D2AA 4FJ2A 1AKQA 2BZSA 2J6HA 4TL7A 5CM9C 1LVUA 5IBQA 4CDGA 3F4BA 2CCGA 2CUZA 3CLUC 3M4SA 4CKEA 1DVRA 2X2OA 4BT2A 4JKOA 5COAA 3U9TA 3OZRA 4QPJA 3GHZA 1KIAA 1N2CE 2MYPA 2VDQB 2SKCA 2HVKC 1S1MA 3GNSA 1Z8FA 4P2GA 1P81A 3FY4A 4NCXA 3CZRA 4GUAA 2P9QA 4C6RA 3GGOA 2BR4A 3H2GA 5JNVA 2CXPA 2FMKA 3NDRA 2LIPA 4QC2A 1KEZA 3IAFA 3RD5A 3H6GA 3KWMA 4H16A 2W2LD 3FDFA 1IX9A 4P4UA 4D9FA 1OAOC 4P31A 3SZMA 1S8AA 2Y1GA 5B1NA 3FR8A 4LQ4A 4P81A 3IAM1 4HLCA 4R7GA 2CVOA 3ISTA 3OFKA 1NNUA 3BHMA 4V2IA 4BZPA 3I6QA 2VR1A 3GNTA 2YZKA 3KD3A 5DRYA 3AIOA 4EQ6A 1G8PA 1Z4JA 5LMZA 3FYUC 4RM2A 2P5TB 3U1BA 5C34B 4BS9A 3KQNA 4QYMA 2GYVA 3D6FA 2HG5C 1Y42X 4MUNA 4X62B 4NY1A 1TVKB 1YR2A 3H83A 1IN8A 1ENOA 3EGDB 4P36A 5JARA 2O3SA 1KVTA 1VP7A 4WFIA 1V16B 5JDIA 2GK6A 3O91A 4I4TA 1Q0QA 1FB5A 2AR9A 2N9UA 1PUIA 3RC2A 2QY6A 1Z37A 2XJ9A 3RI3A 5A2QM 3F8TA 3IDZA 4GD3Q 1E2MA 5HM8A 1BKSB 1UPGA 4MOWA 2KE5A 4O4IA 3Q7TA 1F9AA 4GMXA 3BJRA 1FS0G 4BWAA 3A1SA 4ZCIA 3O9MA 1E2PA 1EPUA 3A14A 1VQKF 2NMUA 4AT1A 5JQGF 1MG1A 3O3NB 4A27A 4XJTA 1BFKA 2X7JA 1QYXA 2H1OA 2XAHA 5HK8A 3DAHA 1LA2A 4PLWA 1DT9A 3LT4A 2DR2A 1ONPA 5KO2A 3QRWA 3UF0A 3LYHA 1CY6A 1EUDA 1MVLA 1PN3A 4NARA 1DTSA 1MA0A 8OHMA 2WIFA 3IBFA 4GQAA 2QUJA 4XDKA 3H9VA 1XUQA 2WR8A 1T9GR 1YI2V 2CV2A 1Y8AA 2V0NA 3CN7A 3F5MA 5ALIA 5KX5A 1W3EX 3OZXA 1EFHA 1QHTA 4YK7A 4BBZA 1K8YB 1ZK3A 2XR1A 5DYYA 4RZ2A 4MV0A 2NUAB 4PEVA 1UDBA 4G6ZA 2WAOA 4M88A 3MCVA 1M57C 1G63A 1I3MA 2OHVA 4A0SA 3S81A 4CG2A 4LFBB 4RZIA 3L0PA 1MZVA 1BE6A 3KV1A 3QNWA 4PYQA 3PFFA 4QQKA 3WNBA 5B3JC 4F7WA 4RW0A 1I2AA 2QA5A 2ECPA 5HILA 1N6LA 5FJIA 5T6BA 2R72A 4JASA 2CB0A 4Z9BA 2JHFA 2V58A 3I4FA 2O4UX 4P5PA 4ZOLB 3K1YA 3K16A 2IHYA 4G1EB 2C54A 1ZOOA 4NPCA 1IXMA 2G5CA 3DCIA 3G23A 2BGKA 4B3TO 3NWEA 1V0JA 4UQLA 4EJMA 5KTRA 1A5ZA 3PLAE 1KH1A 1ZR4A 3DCNA 3ASVA 1PS8A 1LBHA 1W0JA 1WETA 3C98A 2AX4A 3NX4A 1XHXA 2IU6A 1R0RE 3OBWA 2B1RA 1R5BA 1DKOA 5BOSA 3IALA 4NXMO 1JVNA 1V7CA 2AJDA 2Z1NA 1QX4A 1E3WA 3QKWA 4MB2A 3TEJA 4ZYTA 3DCYA 2IP1A 3P1JA 1RWPA 1G9SA 4YUYA 3LK6A 2V54A 4ZU6X 1GNVA 3G2NA 5LIPA 5B5EZ 4B46A 2WSMA 3IQZA 3T5CA 4BFTA 1GN4A 2QUHA 2Y4NA 5HQJA 3WGVA 4QFCA 3SYQA 1XK6A 1U9CA 4KO3S 5IT0A 2RGEA 2BZ0A 2Z8YA 2XQIA 4TUYB 3A36A 5JQWA 4KV7A 3EGXA 4HTFB 1I2DA 2EIKC 1N5KA 3DR5A 4CNBA 1Z4OA 4ALJA 2PFGA 3F97A 3QUAA 3P4EA 4HNUA 1ADYA 5ELXA 4YJ2A 1LTHR 2QZSA 3S2EA 3LWQC 4DA6A 3GVHA 2WHPA 1XLTC 2XCQA 3AR7A 1HOXA 3CCLF 1ZK2A 2PPVA 1IBCA 3CUSA 3DOFA 3FVQA 3SJCA 3UB4A 3WICA 1WM1A 5FQNA 1CE8A 5HS6A 2YXZA 4CLOB 1YONA 4ZU1X 3N2KB 1GRRA 4WNAA 2E6UX 4ZZ0A 4HKTA 1GUDA 1DJPA 2SNIE 3QJYA 2G38A 1GSHA 1FNMA 1T8YA 3DFKA 1G1AA 3NT2A 5FOXA 5C8YA 1QONA 1U6JA 2V7EA 4AX4A 3RB8A 4PAGA 4QELA 4X63A 2EIMB 3ND7A 5AXDA 4IY1A 5HIKA 2IJKA 3M1XA 4H7FA 4MUXA 5AOAA 1NPTO 4YECA 4D3YA 4JT2A 3NEJA 4AMYA 1ZUNB 5CVEA 3HXOA 1M73E 3DMNA 4L9AA 4LWOA 4YT4A 2Z4SA 1Y7HA 3M83A 2F9ZC 5FA5A 5JJEB 1UBJS 4F1WA 1TUEB 2FR8A 4UE2A 3HUDA 3CIOA 3VNVA 1JJ2U 1Q92A 2ZYGA 3RVDA 4CXMA 4AY6A 3IC5A 3IP5A 5AVTA 1X1TA 4WFHA 3DAYA 2GD1O 4GP7A 3EZ9A 4GAEA 3JYLA 2ERXA 1UBHS 3CNNA 5FADA 5TQVA 4BO8A 3FNQA 1PJSA 1KE1A 2AEEA 3B1VA 4RY8A 1MJGM 4PG4A 1E98A 1AXRA 4R2LA 1YCDA 3ZS8C 4J75A 2VDWA 1D3AA 4BJ5A 2GM9A 3D3IA 3QO5A 2AA3A 4CT0A 2UXBO 1ZC3A 2VJAA 4G0NA 4CYMA 3VU9A 4YMIA 4F5YA 3AUSA 1VE5A 3Q4GA 2ATXA 2X6TA 1ZIXA 5B6JA 3RAGA 4C81A 4E7PA 4Q1BA 4TROA 2NZWA 3BX1A 1M2OB 3A4LA 3PUXA 5BYJA 2GD6A 4BRZA 4CS4A 4PC3A 5EMNA 1UXKA 3DXXA 2ODAA 5FOWA 1DADA 1N5DA 2I6QA 3CMMA 3P32A 1A8IA 2ZDQA 1N9GB 5H4HA 3VJLA 2GZRA 1WHSB 1MA3A 2G07A 3H4IA 3QUCA 4NHEA 3VR4A 4BEJA 4F46A 3O8DA 4OXKA 3EVKA 1L4UA 4AN0A 3FYCA 4FINA 1I5OA 2XXAB 4EG6A 3OIDA 1GO3F 3W3AH 4LC0A 2OO5C 1D1SA 2NV0A 3PWKA 4PSUA 4YYZA 5A3SA 1HT1E 2W2MA 1ZIDA 2QQ5A 4XX0B 1I14A 1PVVA 1TU0A 3A1UA 3MWDA 2NW6A 3X2SA 1TEZA 1GKYA 1CU1A 2FYUH 3HYLA 4CM8B 4QXAA 4A91A 4RIHA 1LR1A 3WJAA 3NHRA 5DCYA 4OKIA 3LQYA 2AJCA 2PMCA 2BFOA 4UCUA 5AM1A 4K6OA 4OOEA 3TDKA 1XEQA 3OMLA 2QTPA 4G63A 4TL9A 1CIJA 4IXTA 3LUTB 1QG2A 3BMQB 3CTMA 4Q3LA 1XCOA 1WVIA 1FSPA 1DC7A 3HHEA 3STTA 2QBYB 1B93A 2PTHA 1DE0A 3IR9A 2NAPA 4KAXA 4Z1MD 3L1IA 3JASB 2WFAA 3ABIA 1OX4A 1OXUA 2IHTA 2FDRA 3DP7A 4NNPA 5PNTA 3VU8A 1QQAA 3OD1A 4X6YA 2JAQA 2P2LA 4LHYA 3NALA 1ONOA 4MGIR 4OXYA 4YRAA 1EBBA 1JDPA 1MX1A 1RMYA 3BTSA 3E9NA 3MMXA 4G5GA 3VM6A 4Z1MG 4E7OA 3PI6A 3WGUA 3WGKA 2Y1OA 3WKEA 4D5GA 4YJFB 4UVCA 4CEHA 2OV1A 2GBOA 3NIWA 1NT4A 3ANNA 5A6SA 1IOWA 2QZPA 4U0KA 3BA6A 1VQLV 2A8YA 4KN6A 4M83A 3EEIA 4L4XA 2A86A 2VYVA 3BIWA 4CLRA 2V45A 2HLPA 3RNLA 4A6XA 1QYDA 1RAGA 2I6UA 4UHHA 5F2NA 4RELA 3HV2A 1VYHA 1RPZA 3TUJC 3WNDA 2YOGA 4AI8A 5TF4A 1UEXC 3GP3A 1ZCFA 3QBTA 3NVIB 1R27A 3LY5A 4PQFA 2A9QA 1TZMA 3ZCSA 1G20E 2OHWA 3L01A 4J9VA 2H9AA 3W04A 3VPCA 2BZ1A 9ATCA 2Q6TA 2FZGA 4K88A 1UBGA 1IEXA 1P18A 4MQEA 2Q2WA 4HZGA 1OLUB 4JJZA 1N8KA 1NGSA 1W4RA 4IPTA 4PSDA 1FFTB 4XDHA 3CC2F 3FKSG 1L9XA 2I2AA 3KB6A 3DBRA 3ISVA 4IDAA 2JD2A 5AJZA 2X0LA 4QZVA 4YPVA 1F4LA 4GXNA 3ZVMA 3PGXA 5ENVA 5K6RA 1W87A 1FUUA 4EB0A 2YV1A 2VCHA 5EJ9A 1JYFA 1SK9A 5IX8A 2VPQA 1Y1RA 4JLKA 3RSLA 1UUFA 5CYPA 3V1UA 2JW5A 2VJMA 4DVGA 5JTTA 4BE7B 5G40A 3VZRA 3GD7A 3CPEA 3WJ2A 1JZSA 3UCSC 2JHPA 2QVYX 1CY8A 1SDSA 2R2GA 3BRWD 2OORA 4ZO6A 8LDHA 1Z13A 2Z3WA 1WLEA 1XZJA 2AFRA 5DGIA 3ZBPA 1I3CA 2IEAA 3KT3A 1WUIS 4ZRMA 3V6LA 4OHCA 2E4XA 1VMGA 4WCDA 2Q9LA 1YS2X 2FVXA 5H80A 4OQLA 2RCVA 4HUQB 2FW8A 3JQ9A 4RY2A 3T5PA 3KUXA 3V7YA 3D81A 1Y33E 4YREA 4UTZA 1C30B 5JCXA 3GLGE 3COJA 2NXNA 2HIGA 2JCXA 3N0VA 4P8RA 1G6OA 2QTMA 1H0SA 3RC7A 3O4HA 1MAHA 1EUQA 3F98A 1XRJA 3GK3A 5LKRA 3GRCA 1YQXA 1JFFA 1ONNA 5HPYB 4JYBA 1FRQA 1TAHA 3MUOA 1CUWA 1NF8A 3O4VA 2W6QA 3QE2A 4MP3A 3PQ4A 3WLFA 2ZYRA 2YXDA 5EXDA 4A26A 4JVMA 1E58A 4BN5A 2M6RA 1YITV 3IAXA 2ECQA 1SZTA 3L1KA 3BKXA 3VX3A 4H0FA 4OP3A 3T54A 5ALTA 4D81A 4GICA 3DV9A 2WQ6A 2G08A 3E61A 4MKGA 3BS4A 1CLUA 5DIZA 4LWSA 4YP7A 4BT6A 1QRRA 3K4PA 3OAAA 4U2KA 5BR8B 1S96A 1AB6A 4G56A 1T8UA 1G5QA 3HSSA 4IJKA 2YWGA 5AJVB 5EIHA 2Z5LA 2PEZA 5KCZA 1KJ9A 1RJFA 3TEFA 1GQYA 1PRYA 4HN2A 3TLBA 4MVOA 1NHWA 1NM5A 1TXGA 3OQIA 2WSSG 2Q0AA 2HS0A 3MB8A 5EUQB 3WL8A 3BQNB 2PUDA 3I3SR 2A9RA 3HY6A 2WA4A 2V7WA 2AI2A 4RMIA 4QLAA 1QS0A 2A5YB 2G4VA 3ONDA 4DB4A 5LXTF 4J10A 2K1SA 3GVIA 3TIGA 2AI3A 3AG3C 3P26A 2R65A 3AP1A 2R2AA 2PYJA 1E3SA 1ZMXA 1J5EB 3Q6IA 3SDSA 3VR1A 5LP6B 2LFRA 3DE3X 1GY8A 3DT6A 2IGTA 1I3KA 4I5DA 1QQ6A 4O5OA 3RSQA 5THXA 4F3YA 2GHYA 2KMLA 1E79G 3JQPA 3JZFA 4DPLA 1W7AA 1VKHA 2HOQA 1V9LA 3KJIA 4BT7A 3HEAA 5IXYA 2LKDA 4WF9V 1JN0A 3QE4A 5COBA 2OUKA 3UJCA 3GB9A 3TQQA 3X2FA 4EUFA 1T4MA 3KU4A 1F1BA 3ESRA 4AVYA 4C05A 2B0JA 2WF5A 2AG8A 3NK7A 3HO6A 1NLZA 1K27A 2CHSA 1EUDB 4LPKA 4G67A 3QVVA 4NH4A 3HZHA 5H82A 1M8FA 2FX2A 5HIIA 4M76B 1M6VB 5IJ9B 3OP1A 3K53A 2Z8ZA 3FHOA 5DYNA 2Q73A 3VOAA 4H08A 5JDCC 5U4QA 3VR2D 3WQSB 2GRAA 4IF4A 1GFWA 2CDNA 1AR1B 4A5UB 2O8NA 1W52X 1TW2A 2H4XA 4FR0A 4F9FA 5CM8B 4DABA 3WXMA 1NN3A 1B23P 3CNHA 1CSEE 1CUSA 1YRWA 1F4PA 1P0FA 4N5MA 4RU1A 2QRQA 2I4LA 3ZGYA 4PGFA 5E1MA 4ZI2A 4W5WA 1NVPB 2XZLA 5D00A 1ZJYA 5KPJA 2OAP1 1X9GA 3P9KA 5HDQA 2AFHA 4L6AA 5CT9A 1HUQA 3TIIA 4YT8A 2DN9A 2ZIZA 1GKKA 4J9ZB 3SJAC 1DC5A 1NQ5A 2QTVA 1BMQA 5BP7A 2PKWA 1SBZA 2LO1A 3FDJA 3IVGA 4D3XA 4JBLA 3AK4A 5KQLA 2PL3A 3D4PA 2IKQA 1AXEA 3IAM6 2X0EA 1YF2A 2GSMB 1L3IA 1YUMA 1FMCA 2PSHA 4TT3D 4FMTA 2XGOA 4C04A 4KCGA 1KK1A 3DNMA 2VZ9A 3R77A 2IYPA 1QNFA 4YO7A 1UCFA 4QUIA 4RZUA 1AMOA 3K2XA 3KAJA 1OW3B 4G0QA 1ZI9A 3R4VA 1OAOA 2QKYA 1JAHA 2FV8A 2COUA 5FUYA 1QJ4A 2YJ4A 2IYFA 3D8UA 3UPUA 5F64A 4HAMA 1E3WB 3X1WA 2BGWA 1S2LA 2YXBA 2I1QA 3EULA 3MGCA 1NI5A 4RPKA 2A1UA 2UYJA 2FNAA 5E7IA 3WNQA 2Z83A 1P2FA 4KQKA 1HT3A 1LC0A 5KJ6A 1XTKA 3LQQA 3HB9A 4WESB 4BFCA 5FPQA 4PYMA 2A9FA 1IBMO 5ALDA 3LECA 1T5EA 4K6MA 1ZN8A 3AG2B 2FFAA 1BX1A 2I4NA 2WB4A 5IM4A 3T7JA 3BXOA 5ALXA 3SM9A 4W1RA 4KIWA 4RH0A 4DXAA 3UC9A 1RP1A 5LHHA 4ZPJA 2PE5A 5BWBA 2P4UA 3PSAA 4LDJA 1H8HG 2QRUA 1XHEA 3UGTA 2WUEA 2WWVD 1U11A 2QVXX 2HGSA 3ZCQA 4AG3A 1TYZA 4JC5A 4QHYA 4REQA 4AURA 2A14A 2HREA 4HFRA 5KU7A 3Q41A 2QT9A 5I7SA 3K5LA 1WQ3A 1DO8A 4M0UA 5DMHA 2E18A 3LGAA 3Q8HA 1NYTA 1C7IA 3PL5A 5E38A 5HW0A 4C7KA 5DH9A 5K8VA 2AJBA 3IUEA 4BT4A 4RX1A 3PUYA 1TO1E 1D5NA 3PR3A 4R6XA 3TB6A 2OM6A 4JI5B 1BH2A 4I5EA 3OEEG 2JK1A 4KWEA 3HABA 3DUWA 2O8EB 3K0CC 4YUWA 1GZVA 1JDUA 3HA3A 4RHXA 2LP7A 4D4IA 3L0CA 2GOYA 3L70H 4PAQA 3H6KA 5KZMB 1GD1O 4IM7A 3ROGA 2BVNA 3QUWA 3T6KA 1RADA 1HA3A 1YHQF 1R4AA 3CZQA 2VS1A 3AF3A 4KBGA 4WH0A 4BVTA 2QPLA 1HH4A 4ZPXA 1WCXA 2AK3A 5H9WA 4FLUA 4ZBMA 3OOEA 3AETA 2OV8A 1QIJA 3CBGA 4H33A 2K7FA 2XWSA 3JQAD 3ZE9A 4B7ZA 4DR6O 1NU6A 4DCJA 1JR3A 2BGTA 1EGQA 4N23A 3MGGA 1SMKA 4WBSA 2ZRCA 1YE8A 5LUAA 3JQFC 4MXDA 1LSUA 1DZ3A 4YXWG 3FCOA 5PGMA 2RHOA 3MJ4A 3GWOA 2UZ1B 3NR2A 4C5AA 1M7GA 1O97D 2YZMA 3TB4A 2RCYA 3CCBA 1BXKA 3RF6A 4NBRA 2X9NA 1GUYA 4I9FA 2P2NA 1JQLB 1U28A 4KBYA 1NDQA 1XVLA 2A9OA 1QZ3A 2R44A 4QREA 5JPIA 2P27A 4B2PA 1YFJA 3EIUA 1JEOA 1RLJA 1SHLA 1XKTA 3VDMA 1DQYA 4JDUA 3EC7A 2F9LA 5IE9A 4QG7A 1HR0O 4TXNA 3TAHA 5K20A 1M5UA 1X4TA 2JGLA 2D5BA 2XGJA 3A1CA 1I0HA 2RSLA 5CNJA 1QGUA 4DMMA 3HI4A 4X24A 1Q82H 2AZ2A 1UPXA 2J07A 1EBOA 1RQPA 2NWQA 3HJUA 3AUFA 3WA6A 4DC0A 4DY6A 1XCBA 1OLSA 1RM4A 3EQ2A 4MS1A 4AY4A 3AF1A 1JHAA 1IFXA 3IHLA 2QUBA 3IJ5A 4J90A 1U7OA 3OJFA 4TQUS 4B87A 4DIEA 4G86A 1VPDA 4BVRA 5HY2A 1EGAA 4CQJA 1AR5A 3EDYA 3G8AA 4GKBA 3FZGA 1PFQA 1KYWA 3D6TB 4Q01A 5IVIA 1LBIA 2B8JA 1NC3A 1OKKD 2GYWA 3K2EA 4YRQA 4BNWA 4BRSA 4M1YA 5GIOC 1ULTA 5ALZA 4GZLA 2ONJA 1QH0A 3R6WA 1DAKA 3I76A 3OE7A 2BISA 4BVLA 2ZRIA 4RDXA 2QJ1A 1XRPA 5LQCA 2V59A 1DOAA 3JASA 2AXPA 5KSYA 4YCLA 4LBVA 1QQTA 2ZCVA 3C39A 4K28A 1ZMTA 4Z7NB 4Q1DA 2ZAGA 3W1VA 1P5ZB 4TX1A 4DBVO 2BTEA 2OK8A 2GRUA 4Y1EA 2ODMA 3MHTA 1COWA 1VL8A 1DU4A 2Z5UA 1SRYA 1Z88A 2WHYA 3A31A 2QWPB 2Z09A 2B36A 3RRMA 4A6PA 4ZYZA 4KVGA 1AQUA 2WVAA 2ARKA 1KD1W 2XUJA 4YCAA 3RWMB 3X1XA 1KEUA 5G0VA 1UFOA 3NB0A 3H9UA 3PYLA 2ZXFA 3SYAA 4FMBB 4TM7A 2QM3A 1EX7A 4LS3A 1QHFA 4TTVA 4AW9A 1XPRA 5E7QA 2W5UA 3BEDA 2EFDB 2IV7A 4C0JA 2VYNA 3ZE2B 1DLJA 5HZHA 2ZUSA 1KC3A 1Z47A 1A71A 2GPWA 3CU5A 4JQSA 4CW7A 1VMAA 4KE8A 2CAZC 2Q9BA 1OCCC 2YVUA 3ORQA 3OT1B 5C8ZA 1F0NA 2XT0A 1NS1A 3LYBA 3BCUA 2VP4A 2AC4A 3MHPA 4XUGB 4MSWC 1Y3HA 5E9WA 4MJXA 4MI3A 5J9FA 3VR4D 3B9QA 5BSTA 1ZK4A 1U2DC 2W00A 2IH5A 3IJPA 4B35A 1PT7A 1TUIA 3T1YB 2GLXA 4H7HA 5FL7D 5CRIA 1KSGA 3BAZA 1CQPA 3H8JA 1RMTA 2WAXA 3ZDZB 2DFNA 5IDXA 2WYVA 2EIMC 3SC2A 3IA7A 3H9QA 3ZQJA 2D1TA 5K0EA 3QKRB 3W5UA 2NYVA 3SZ3A 3QF4B 4WK0B 1XX6A 4M1QA 4XJXA 5EZYA 4D8WA 4W5HA 4A8PA 2L17A 1U0EA 4OUDA 3BVOA 2CXSA 4NB5A 1N8NA 3CX8A 2VUHB 4N7RA 2CJPA 4H44B 1FQOA 5KC9A 3GDWA 3LWBA 1LKZA 4KACA 4NYJQ 5IBPA 4LOIA 5FWYA 3CCSF 4S1TA 2Z1UA 3VKGA 3L6CA 3PQ3A 3PE6A 3ETQA 5CT4A 3GHHA 5IKOA 5C80A 4NU6A 2O2EA 5KYUB 4MAAA 2WA2A 1WABA 5DWVA 1NUUA 5E2BA 3T9FA 3TZLA 2N46A 5JY1A 4R8LA 2QW8A 3SOZA 4TRJA 4WDRA 5AVUA 3SGLA 1X80B 1WPXA 4TV9B 3NANA 1PWYE 3RFTA 5HJ7A 3EZYA 3FUTA 1BHAA 1NG1A 1ZX3A 2E4WA 2H5IA 1M2KA 4MVJF 4PYOA 2O54A 4BTVA 3GDHA 4TRRA 3HLTA 3AR8A 2IEDA 3RSZA 1USUA 2ADPA 6LDHA 5LDHA 3R9WA 1LNSA 4BIZA 1A32A 1RM5A 5KYXB 2KG4A 3WB0A 4AXBA 2RI1A 5A4AA 3DFMA 4WL0A 3LWOC 3JAMA 3E9CA 1S3FA 3B1KA 4MGKR 1DS6A 3F0DA 1L6IA 1YKSA 2Q6LA 1N8SA 3ZMZA 1RP7A 2RGCA 2XRYA 3DAFA 2O7VA 4FOSA 2JGUA 3BRWA 3TTYA 3UOGA 3VHXB 3KWFA 3QBDA 3LO5A 3NM6B 1T0AA 1ZC4A 2OG2A 2R6GA 4PDMA 2RK4A 3DMHA 3AM3A 2J1LA 2AZ4A 2Q5IA 3AHDA 3HS3A 1P2TA 1PF7E 1KOJA 3NWPA 4UFOA 4XKJA 3WIEA 3RVZA 4YY3O 2HBRA 3DFUA 3D00A 3DZFA 2YFKA 3WWZA 8ABPA 3TXQA 1WXHA 1X7HA 4INPA 2JJYA 2NNWB 4LV6A 3VSCA 4C0QC 2OBFA 1CF4A 5K0NA 2RHMA 4DRXB 1V55C 4B2IA 5GONA 1IXZA 5IT9N 1OJLA 1VMKA 2DUUA 2O5VA 4PJ0Z 3OZCA 4TXHA 1H8HA 3TLYA 4ARVA 3AJ8A 1MB9A 5K9ZA 4NKGB 1EU1A 3GAMA 4KQ6A 1IQUA 1G16A 1Q74A 1KP9A 2AHOA 2FWIA 2WIJA 1WUJS 4IH9A 5AW4A 1KAEA 1LLUA 3OA2A 2X9QA 4IYHA 1W40A 4XIJA 1AF4A 3KSDO 4RO2A 4IW3B 1LW7A 3P2KA 2ENUA 2RHTA 1QR2A 5EC1C 5LYJA 1PSDA 2YCBA 3F7OA 3EH1A 3GDGA 3LKDA 1P84F 2IYEA 2NO6A 2QTFA 4INJA 5G1OA 4D8YA 1S7GA 3PN1A 1GZ6A 1L4HA 1YMVA 4G25A 4TV8B 3DHVA 2HVYD 5CNMA 4Q1EA 3N4ZA 3EHDA 2BOVA 4Q3AA 4ZO9A 1A9SA 1RZUA 2R6JA 1C8LA 2GJ9A 1ORTA 1CPYA 5IJ9A 5LHGA 1K33A 2AIZP 3IKEA 1KPIA 1VB5A 1XDWA 1T3TA 2GAFA 2P0EA 2QAGC 2W83A 1PZMA 2X0JA 4IDOA 1Y5RA 3IOCA 1E9CA 3CH5A 5EE1A 4GCZA 1ODJA 3V48A 2D8MA 5B3SC 2ZWOA 2DTXA 3G7SA 5A0TA 4QBIA 2EQBA 3EZXA 2DYKA 3FOCA 4N0DA 3LWPC 1IN7A 1VJ1A 1MXHA 3QVUA 1L4GA 2A0XA 5F9MA 3ZLVA 1WOYA 5J2TB 2R4TA 3OMXA 4H0LB 5LR6A 1L7VC 3O4IA 5AVQA 5DYTA 5C53B 4LEIA 1EDEA 1XMOB 3RRZA 1E0DA 1L7BA 1XXHE 3GUYA 4KYUA 3A05A 5CBFA 3KD2A 4TVSA 4XVCA 5IT9M 4ZVUA 4MVRA 5G4KB 1BEZA 1JG7A 4FI3F 4JBHA 4BMYA 2B1IA 1J21A 1K68A 1RWBA 1SD1A 1XMPA 4FUTA 4JOCA 1V26A 3I55F 3EQ7A 4KI0A 1DC6A 4M9UA 1EZ4A 1E9DA 2G4CA 3OT5A 3C3WA 4RPJA 3CLUD 2VDMB 2QLNA 1NURA 4ZANA 4RIFA 4QOSA 3MJRA 5JCJD 3TL2A 1H85A 1ENZA 4DUGA 4W99A 3N07A 2IDMA 1JSRA 5LQUA 4LGMA 4FMCB 4FYMA 3KR1A 5ICEA 1THMA 1EWTA 2XVZA 1L5LA 4EG1A 1QP7A 4QXRA 3AUAA 3V7WA 1CRLA 3K70B 3HBMA 2HMAA 3KZNA 3AR9A 2C7BA 1NVDA 1KDVA 2X22A 3AZPA 2WU8A 2HO5A 1E6WA 3PXGA 1DXOA 2R4UA 4EA6A 1W1IA 1E3MA 1NULA 1YFZA 3D59A 2BR3A 2EBUA 1CUGA 4LMRA 2WMOB 3O47A 4AJLA 5IKMA 5E95A 1XRLA 3HXMA 1D9XA 5A4KA 3H1AA 4DIFA 2YYSA 4U7WA 4BWGA 5I5EA 2HX1A 2ZF8A 3B60A 3ECCA 3ZX5A 2YC2C 1SU7A 1DXQA 2PS0A 4OK5A 2OCBA 4PVDA 3U0BA 2WPDG 2PBLA 4ER0A 4N0QA 1TX4B 3KOUA 4BLQA 3SR0A 3EFEA 1ILWA 3GD5A 4DCTA 3T9DA 2FRDA 4E88A 4OH1A 5IVKA 4QUBA 3SQMA 2HPZA 4EATA 2QEXV 4LV8B 2DVMA 1TOAA 2QWQB 1EP9A 3DOJA 4N3BA 3STXA 2CC2A 3T99A 4AMZA 2BKXA 2QPTA 1DEHA 1WV1A 2ZBVA 4FE4A 4GU5A 4JMPA 2VSQA 3P0JA 2EX0A 1VPLA 3T38A 2JS3A 1OLXB 4FYKA 4ND2A 4WHMA 3TTTA 2ZWPA 2PBRA 4IKOA 3PD0A 2A0WA 2AUTA 3W9YA 4EP1A 4KRFA 4NBNA 4IDDA 3S5UA 3HFGA 4HP8A 3TDMA 4O2AB 1H2HA 4F3NA 3OZ7A 3T1TA 1P0QA 1YQWA 1R1DA 1COWG 2O8EA 3WWDA 1KD1H 1YHQV 1H47A 3A6EA 4IVQA 3BHJA 1EINA 4KGDA 3UW1A 1MOFA 3WYDA 5JEEA 3IEQA 4RIIA 1YNSA 3ZJUA 1KXZA 2YFQA 3OKCA 5A5FA 1TO6A 3AVQA 4Q1CA 3IDFA 4QPZA 5IW8A 2ZYUX 3B1ZA 1Y9DA 6ABPA 1JQDA 1ODEA 4QLBA 1T0UA 2QE6A 3UV6A 3AETB 3RAPR 5IHPA 4AZ0A 2XUIA 3EXHC 4I66A 2PJRA 3JQEA 5J2UB 4M0PA 1H3EA 1I7FA 1RDFA 3C43A 1C1HA 1W6RA 4DW0A 1ELOA 3LYUA 1NAIA 5SY9A 3C97A 4MLPA 4YCCA 2C4NA 2V6IA 3CNOA 3PD1A 4FZ5A 2XYRA 3SICE 1N5RA 3CM0A 5DM4A 5LQNA 2LFSA 4REMA 1ZWZA 3RVKA 1NXOA 5J1TB 4YFVA 4I2VA 4CL0A 1SPXA 3FI9A 4Y0VA 5BQXA 3D3QA 4GW3A 1FYFA 1GZ0A 3NCHA 1U80A 3RK0A 5T67A 3QYPA 1LLQA 4LY6A 3TI9A 1H1DA 3PNKA 1E6LA 3D4LA 4YJFA 3UA3A 2YZNA 2XW6A 1T24A 1BKYA 1PR9A 1SBQA 1OY1A 2Z0AA 1LV7A 4J0IA 5SZHB 1QNMA 1E1QA 5TDHA 2YI9A 3Q7EA 1XRSB 4PZDA 1PJRA 1ZBQA 2OMEA 4JBGA 1CBUA 1P7VA 1PK8A 4G4WA 1IMOA 1E1DA 1ZL2A 2H17A 1QDLB 1E5XA 2WD8A 3FPBA 3LBIA 1Y5NA 3PQ6A 1X19A 4NZYA 4CI9A 1V3VA 1VC2A 2BJVA 4IEIA 4Y9RA 3T0GA 1LDBA 3DJYA 5EHXA 3LV8A 5IM5A 2C2WA 1I0LA 4CBVA 2Q7OE 1FLAA 3HCBA 3PGKA 3TIXB 4MUFA 2O20A 4XYMA 4ZJUA 4DOMA 4UJ3A 3OC0A 2XRZA 3K0HA 4FLYA 2GHTA 4ZK6A 4OYRA 2WFLB 1JHQA 1XTQA 2VUTA 4EO9A 1D2NA 1KBQA 1ZRMA 4RKQA 2X0FA 5CDHA 2P67A 3ASNC 1ZRHA 1J95A 2ZTUA 4JL6A 4O1MA 1DBPA 2BP7A 3FH0A 3ND8A 3CP1A 4MWTA 3KK0A 3K1AA 1GHTA 2I2CA 1ICEA 3I9MA 3K8OE 2RHRA 2ZSFA 3IEPA 1P1FA 3R3HA 5IYCO 2YCLA 3AJ9A 1LPNA 1N0VC 3FJ1A 1UAYA 2VPYA 4IL5A 4KGXA 4LCEA 3IIMA 3E35A 4QXQA 1AS3A 4RD0A 3Q4HB 1A7UA 4KR3A 1M0TA 3A9SA 2F6RA 1IJBA 1QU7A 4O4HF 2DECA 2KB1A 4G37A 2EYUA 3AFIA 1DPGA 2E49A 1WF6A 1BL8A 1IHYA 1PJBA 3OJXA 1I7DA 1CUYA 4ISCA 2A4MA 1XMQB 1PVDA 5DWQA 1NQTA 4MKIA 3U40A 2KG7B 1E69A 4G2TA 5LVAA 2A5FA 3PC8A 1FDRA 4MMXB 3D0QA 1V7ZA 1PFGA 4PGGA 4C2AA 2XE8A 5BORA 5A1TA 4X20A 1RYHA 5K0TA 2D2EA 2RB9A 3HVKA 4LECA 1GR1A 4KXNA 4MTFA 1Z6TA 4GZRB 4R40B 1UK6A 2CXTA 3B7WA 1KQNA 3NC1C 4BMOB 5TNXA 1K63A 1WZIA 4FTWA 5JSKA 5I8WA 2EG5A 2I80A 2WK1A 4NYMQ 1ODIA 1L4EA 5U1PA 4BBPA 3AKZA 2ZR8A 1E0KA 3QVSA 3VOSA 3S8MA 3U3KA 1KRWA 3RVJA 5MHTA 4DR1O 2WSSD 4URUR 4NENA 1LDMA 3WIOA 3C16C 2QI2A 1JIJA 4Z6KA 2QRKA 1E20A 5BXQC 1RI4A 1PD0A 3EOAI 4RQAA 4BNUA 2NZ2A 3MTAA 4QDZA 3ZV4A 2AW5A 3QF4A 2AR0A 3D2CA 4LYHA 4WX2B 3VNBA 2J9FA 5CVDA 3FPEA 3T5MA 1QGED 2OM2A 3CRQA 3K0GA 2WJAA 2P6RA 3LUKA 1Z08A 4PPNA 5AOVA 1XF9A 5GY7A 2G67A 4UEWA 4ZI7B 3AWIA 3HBJA 5AHWA 4LF7B 2M1XA 1X1DA 4BO9A 4C6SA 4EL5A 1SHJA 2GAAA 1A2QA 2AXNA 3GT7A 3OF2A 1Q1GA 3O3OB 5G4UC 3PXUA 4HYOA 3W7TA 5BV7A 1TA0A 3GAFA 2PUVA 1AROP 4O5AA 1T9HA 2WTXA 2PANA 1F2VA 3AM5A 3FYSA 3HB0A 2GVNA 2DYRC 4FGLA 3TUIC 2Q69A 2V5VA 3AG7A 3BXGA 2Q5CA 821PA 4PI0A 4TV9A 2VQEO 4LXUA 4W5JA 1XDSA 1MQAA 3BMOB 5T5QA 1YA6A 1GAWA 5BPFA 5L40A 4KJZA 4P0QB 3I42A 1R10A 5IJAA 2Q50A 3R9KA 4RUFA 3KCQA 4RBNA 1CD5A 4I7EA 5BYBA 2JEUA 4KDFA 2Q7EA 1KZ4A 3A9UA 4FFRA 2AOTA 4JL5A 1Z5NA 3I05A 3TZKA 3EYAA 3WDSA 3FMFA 1E2NA 2D5AA 5AW5A 4DILA 4E33A 1X1BA 5KTPA 1NZ6A 1HURA 2QR3A 4L6CA 3TRFA 4ATNA 3GCWA 4DQLA 1W42A 2ATKC 4NS1A 4GP6A 3WX0A 4C4SA 2QRVB 3B52X 4D0LB 1FJGO 2EWWA 1QR8A 1CDDA 1FDWA 5H6RA 4TTPA 5JH7F 1KAMA 4MS3A 1ZOLA 2ZB4A 1VE3A 4L2IA 4KIGA 3EEOA 3BXHA 2IHUA 3ZTYA 1V8BA 3NBYC 1K4YA 4P2BA 1NBIA 2GHIA 3VYTB 1WMEA 4P32A 4DCVA 3F5FA 4JFRA 3LX4A 3HXLA 1L9KA 4EHBA 2WB2A 2N75A 4TWKA 1ZJ6A 5IVPA 4BY9E 4GH5A 2ZPTX 3M6VA 5ELMA 5EUBA 5FUXA 1K0UA 1GXSA 1DSSG 2QN9A 3GC6A 2XSZA 4GVLA 5EIOA 3KJQA 2UYYA 5FPYA 3U7QB 4AG5A 4JASB 1VLLA 4HO1X 3T5GA 3BPZA 2VQSA 5FJJA 3FAZA 3TLGB 1CEZA 3MOSA 3F78A 2ZLBA 1Z6QA 4A9AA 2VHJA 3C8DA 4WV3A 4ZQBA 5IJ0A 1DQSA 3RT9A 5T3YA 3R7NA 2CHEA 2X6QA 1CY7A 2QTHA 4D8UA 2Q29A 3GGPA 5LM3A 1GM5A 2DWEC 1PR6A 1QG4A 1ZUHA 3HM2A 1XJ5A 2JEOA 3WGJA 3BF7A 4JR1A 7MDHA 5JANA 1M9NA 5A3VA 4LY0A 4RLSA 3R7WB 3S1LA 4ED9A 3BXPA 2YIAA 2O9JA 1M5TA 3BH6A 3DDCA 1BCRA 2OIGA 2ATVA 4QIHA 5BUZA 3FWNA 3L4BA 1V7QA 3PICA 1HR0B 4I1UA 3GLIB 4UPVA 3F6YA 4LIPD 2J59A 2R96A 1VXRA 4L72A 5SYNA 5BSHA 3ZWAA 2AW9A 3A2LA 4LBYA 3D8HA 4H2DA 1NVAA 4DDTA 1H05A 1L4FA 3BSYA 4O4JF 4RVGA 4M86A 3DP9A 1W2HA 3JPYA 4JOSA 4RF3A 3LFTA 1I7NA 1EZVH 2FEXA 2XB4A 3LQ2A 1ADBA 1HKUA 4G0PA 4GM0A 1CZHA 4IZ6A 4PZZA 4WFJA 1XPUA 4OGQB 2C9MA 1ZCAA 3R0ZA 1WDKA 4ID3A 3IERA 4BNJA 4DAOA 4MVJH 5JATA 4LC1A 2KHZA 2QIPA 4QGAA 1J33A 1SJ9A 3CBQA 3ABLB 1UFKA 3B9PA 4YJHA 2VQ3A 2I1WA 3VBEA 2HSDA 4ZT7A 5B7PA 1YOBA 1TJ4A 5CFNA 4JTCB 1AZLA 2A7WA 1CE8B 1WO8A 1RHQA 3ON5A 1WB5A 3D01A 4WN9B 4ZWNA 4Q9KA 1EM8B 1WN7A 4G0ZA 4L8VA 4RTKA 2HYDA 4ZTUB 2V6GA 5KVSA 4M21A 1XA4A 3AKEA 2DPYA 3ZYZA 4KIJA 1N2OA 4CV1A 4DWJA 1FUEA 1GSIA 3N9IA 3OBIA 4H4EA 3SD7A 2WM9B 2HC9A 1XTVA 2LNDA 1H48A 4IV5A 4OTZA 1BN6A 3PRJA 1NI3A 5LMCA 1Y8RB 4MW5A 1YJWF 2V4DA 3HKCA 3FDXA 1OOEA 3ZXYA 2UYHA 1ACLA 1EP3B 3G67A 4LBZA 4I1PA 2NO7A 4PFKA 2IS6A 1ILEA 1S7CA 4C2BA 5ESDA 4CDNA 4UPDA 1KKLA 3ESZA 2W4IA 2JFBA 4J0DA 2ZDIC 1VGQA 2Q7GA 2IX3A 4GYCB 4M54A 3QOWA 3FYEB 3DTYA 1NXQA 3H4MA 2AOWA 1VQ9V 1JHPA 4ALKA 4GWGA 1G55A 1RW4A 1TTTA 2WTMA 4OMCA 5CCBA 4NV1A 3Q8MA 1ZU4A 3WDLA 4A3SA 2HXSA 3QXXA 2UZ1A 3C5EA 4EUKA 3NOXA 4FMDF 1VQ1A 2O8FA 7REQB 3VYUC 1GU0A 5FB3A 2ONCA 2P9JA 4GNKA 3R7BA 3S0JA 1DJNA 2V7PA 1ZAKA 1JEJA 4QUGA 2BV3A 4B6RA 3RUCA 3QE0A 1SC5B 4K3AA 4L4ZA 1P4SA 3QJGA 4PANA 2J31A 5K2OA 3LMEA 2RCNA 2OG1A 3D54D 3BDVA 4JIMA 3KSUA 2HHJA 1WB6A 1R3IC 4IS2A 4D74A 1D5AA 1T2UA 2FJUA 2HQRA 3IB3A 4LSZA 3C14C 1A4XA 2Z98A 4JODA 2PYDA 4KVZA 4DRZA 2ORVA 4ZFNA 1AMUA 2PU5A 1V9SA 4KQIA 5DJ5A 4DYDA 1XMXA 4YAUA 4PIPA 4PX3A 2HZBA 4B33A 1WCIB 4M38A 1SG6A 1IBMB 4JUFA 2FE1A 4KYIB 3AB7A 1KFBB 2LGJA 1N7JA 1YRAA 2J45A 5KMGB 1F60A 4DNFA 2P90A 3FB1A 3OECA 4M87A 2WRZA 3K2BA 4E03A 3KU1A 3FDZA 4BKUA 3PEFA 1I0ZA 3M6XA 4AJKA 1DF4A 1VG9B 5F2KA 1MX9A 1UKZA 4LJ8A 2W43A 3KBOA 5EJ4A 2INGX 2VPTA 1NU8A 4E5PA 4JZYA 5F9FA 1VIAA 2CW5A 2X0KA 2YY7A 4BKOA 2F9MA 4U7JA 4FHZA 3C70A 5AW7A 1OX4B 3N6VA 1OV4A 5AD1A 5KTOA 2WM8A 2YWFA 3ZVRA 1D2DA 4G84A 1AO3A 4D0SA 3DD1A 1NLUA 3HP1A 2ADFA 4HDMA 2YIDA 5CHEA 3FPIA 1YC5A 5JD5A 3KJGA 3PPVA 3W7UA 1X42A 3TW0A 2IYQA 2WD9A 4ZQEA 5AO9A 3STWA 1K3EA 2PF4E 1TJNA 2GN6A 2GN9A 1WMSA 4INZA 4GKKO 1DEKA 1BVHA 4C4WC 3M6FA 3W4KA 1YVRA 2R7AA 2GEVA 4M1WA 1A97A 4GM1A 1OLOA 3SF8A 1EXVA 3OJ0A 1A72A 2B5UA 1Y7TA 2ZJ0A 3A3PA 4MTGA 3LSYA 3OT1A 3M3DA 5DNUA 5IFKA 3D36C 2VJPA 3OLCX 3LY9A 4KQFA 4MRNA 1UDCA 4OQNA 1XN1A 5BMVA 4KO8A 5TJ9A 4QEDA 1H9CA 1GA1A 3V4VB 2C3OA 4E13A 4A8HA 1Q7YW 1G2IA 1NLFA 2WSYB 3IVAA 3W77A 3VQXA 4MRMB 3HHPA 5GM1A 5CCEA 4K9LA 3B6EA 1JR6A 3EISA 3CF2A 5JDCA 5K09A 1K4CC 2W7TA 4UB8Z 1T0BA 2HCFA 3L92A 4J0QA 4W7HA 3SLRA 1JT2A 2QAGA 5GIPE 2O8BB 3K9GA 3BHNA 1W0KG 2IXTA 2A4KA 3EEQA 2UXNA 3L8MA 3LXMA 3NVDA 4PAMA 4D3DA 3ES9A 2H7YA 4C4YA 1T9CA 4DR5B 3DYBA 3KKNA 4LC9A 1I5XA 4N6NA 4IEEA 4X8MA 1M5IA 1C8BA 1OPXA 2BGUA 1TA8A 3DE5X 3EIOA 5HCUA 3R9IA 4KRGA 1YQTA 3S5JA 3QY9A 5EIXA 2UYPA 2ZB2A 2Q7XA 3WNVA 2C0CA 2UUBB 3I39X 3M89A 2ZANA 3W6NA 1R15A 2C77A 3RS0A 3ST7A 3ZE1B 1NY6A 1FP6A 1E1CA 5ALSA 1ECGA 3SIPA 3FTPA 3S8EA 4PD4F 2KG7A 3WGHA 3WNCA 2VWHA 4OI0A 1YK0A 2ZBRA 3QUTA 2PGGA 1Y1SA 1G2OA 4AQYO 1PR5A 1MN6A 1DLIA 2GZAA 1ESDA 2XMZA 3H5NA 1BW9B 3OP4A 1X77A 4ROSA 4G41A 3SCZA 2KJQA 3AGKA 3O93A 3KX2A 1GPNA 3DBHB 1S5LZ 4TV8F 1CUEA 1HV8A 2CHUA 2FZLA 3CLHA 1U63A 3FVVA 2O2HA 3TNYA 3SOPA 2EKDA 2WMYA 3KSRA 5EPEA 5YASA 2AVNA 4KDRA 3AF6A 3B9RA 3GL9A 5AK4A 4ENTA 1FRNA 1HDCA 1O58A 1S4MA 5JBNA 4Z0NA 1EHIA 3JZAA 4LFAB 1QCDA 4X64B 3OEHG 1PNTA 2JGFA 3D4OA 3FUVA 3LA8A 4UXHA 2RK3A 2X2FA 5DYIA 1ZEJA 5LWQA 3ZWNA 3KCXA 5B2FA 1PCXA 3M6AA 3VNAA 2XVAA 4UCTA 4AJ2A 2GVZC 2B30A 2HWXA 3GEPA 4HEA6 5JAPA 4TMZA 2ZUWA 4WLFA 4JAVC 3BK1A 4WOJA 4B3BA 3DUFB 3O95A 4XUEA 5EESA 3QLUA 1EZ1A 5B58C 2CFOA 2QG6A 2Q67A 3WAGA 2QUAA 2P9HA 5DI3B 4ZI7A 1TT5A 1YWGO 3IP1A 4OXRA 3TVDA 4PG6A 1OAKA 2G1AA 3L9DA 1UAGA 1GDHA 3H9BA 5AI5A 2GCOA 3GPBA 4P4LA 4DLTA 5I7RA 5F51A 1DDIA 2IH3C 5C7IO 4PLZA 1VHQA 4Y2XA 1XTIA 2H4FA 3A6ZA 1GNRA 2VT6A 3I8OA 2R5WA 4CTNA 2MR6A 4DRXA 4CQMB 3UH1A 3AM1A 2EHJA 4BOYA 5GZ3A 5JT1A 3EPLA 4ME6A 1PJLA 2DWDC 1FXKC 4WGGA 3H5VA 2KSQA 3ZIAA 4OFWA 3ZVLA 3D54A 1EJBA 2ATCA 4CMBA 5A71A 4E3ZA 2FEAA 3DPSA 1RYDA 5DHPA 4JI1O 3R23A 2P4QA 4JXJA 3SC6A 4DKXA 3OU7A 1WB9A 1WIWA 2WALA 4AYXA 2YSUB 2ALEA 2CDCA 1M1NB 2ZINA 1ZK0A 4FZ0A 1KTVA 1KYIA 1SURA 3OLVA 5E1OA 4POOA 2RN9A 3WHKA 5BSGA 4GGMX 3G6KA 2WJGA 4LH7A 4JA0A 3QX8A 1JF8A 1SVIA 4HGRA 4TYPA 3DEAA 1N5IA 1FVXA 2P2SA 4QU5A 4UEQA 3VGPA 4NWIA 4HSGA 5A04A 5AW2A 4LMPA 3DVAB 2Q4DA 1IJFA 2EWMA 3EXG2 4O4JA 1KI6A 2VP9A 4NIMA 3WNZA 1OB5A 5L7YA 1JQAA 2Q9CA 4MVYA 1E2DA 3R7LA 4B8WA 4E5NA 1MOPA 2DBRA 3E5MA 4RCZA 2GK7A 4BP3A 4RKRA 1J2RA 4WLEA 5L3SB 4DQUA 1NRIA 3RM3A 2NUBA 4A36A 1I01A 2FZKA 3H4VA 4LKOA 3WLJA 4MUHA 1XEXA 1RQNA 4EI8A 4FM0A 5JYCA 5DNDA 3MHSC 3L82B 1V35A 5C3MA 3IUBA 5K3BA 1RYBA 1KHTA 4C7XA 1YJQA 5DV9A 5L3BA 3CUEF 1K0FA 1NSTA 1XZQA 4QAQA 2LP4Y 5ES3A 2QVZX 2I3BA 4BGEA 1Z62A 1RFLA 4MUMA 4D97A 1CP2A 4UFNA 2E55A 1SG9A 1V8ZA 5DHQA 4D9BA 1Z5ZA 2M9MA 4B6FA 1P1CA 1TMKA 3EIHA 5DVZA 2I6RA 1Q1AA 5JXJA 1CB7A 3LOQA 4GR4A 4O4HA 1XI1A 1ISHA 1J0DA 3OVMA 1HSOA 3OW2U 3BXFA 3I45A 3ZIAD 2QXTA 5GOZA 3ZJ4A 3HDJA 2R87A 5JS6A 2IS4A 2GBGA 4JTAB 4FIDA 5EHIA 1WU8A 4EDFA 1FRFS 4EOGA 1IONA 1UDXA 4KAAA 3WLIA 3EDOA 2B7CA 4FEEA 4ZV4A 3J81N 3CLVA 1MG5A 2OYSA 3PNMA 2EF1A 4MUBA 2AZTA 2H0RA 2CD7A 2R6CA 4L7VA 4Q00A 2ZVJA 1CQWA 2F43B 4RHUA 1OZFA 3LHDA 2XUHA 2YIBA 2OPBA 4LTDA 2WMDA 2J3MA 3C74A 4Y2SA 3M8KA 3NHMA 4YUZA 1VLMA 3MD9A 3C3TA 1QRTA 3PWZA 3RARA 4EH1A 2CNKA 4ECAA 2AHZA 2MINA 1GG9A 2ZYHA 3H0KA 1BDIA 3ACCA 3FZEA 2PJZA 1MH1A 2G1JA 4RGVA 3ZOZA 3GLVA 3J7TA 1M5RA 2OD2A 2ZBDA 3SHWA 1EWKA 2ZIFA 3NUGA 2GJ4A 2G9RA 1Z5WA 1AX9A 2DWQA 3CONA 1SVNA 3E1KA 4WZAB 1M54A 1M93A 2NSYA 3N8NA 3B6NA 4KLNA 1GZDA 2EW2A 4PPYA 3DNPA 3THWA 3C9UA 4JCOA 1RAIA 1TYCA 2EJVA 4N7BA 3I34X 4RJJA 5ALUA 1K5SA 4D0NA 1F4NA 3I2YX 2JLRA 2DY1A 3JAWA 2VRCD 1NTRA 5A6VA 2WZQA 3J7AC 3WJRA 2GXSA 3AEUB 4ZV7A 3GJ6A 3ZMVA 1T8TA 2WJ3A 3H5LA 5LNK1 3KKQA 3VC2A 2PRZA 5F9HA 3EVNA 1RXYA 3M70A 3UUEA 4OHMA 1RQ7A 3REOA 1PGPA 3UXYA 3KKOA 2JRCA 1Y6FA 4J03A 4ZOBA 3JQ8B 4GQBA 3JX9A 1XR3A 3VMMA 2IEBA 2XVMA 3SDBA 4EPVA 1V5GA 4R68A 3TFWA 2YQ5A 1K5HA 4B6PA 4UE3S 1DKLA 3IR7A 4C03A 2II6A 1CS4C 5F2VO 1E0AA 2ZQYA 4BFXA 5J2UA 3ZJ5A 1WD5A 1ZGJA 3CG4A 5AVYA 4Y6SA 2Q46A 1SESA 4XBFA 2GMWA 2Q99A 1HSZA 3DHYA 2B4QA 4HWGA 4EARA 1OGYA 5KC8A 3NRBA 3LPMA 3NHLA 4DV0B 2HBYA 4G1BA 3A3NA 1AQLA 1H2AS 1QFYA 3CZ5A 3JQDA 4O33A 1G291 5THQA 4BLUA 5CEJA 5L6MB 1TA9A 1EKXA 4I4IA 1Z45A 4TS3A 1E1RA 1I80A 2CWDA 1UPTA 3QYAA 4F2GA 4UV9A 1V1JA 5KVAA 3EQ9A 1NDHA 3CURA 1H2WA 2X76A 3BQ9A 1A27A 1A7KA 1DO2A 1GCIA 2R8OA 1IK6A 1LX6A 3LPCA 5C5EA 1IHXA 2PMPA 2QI9C 1O6GA 221PA 3K1JA 4UZSA 3NTLA 4X5OA 1FX0A 4MR8A 3CXHF 3SJCC 4M1OA 2P75A 2PH3A 4ZJYA 4ZCLA 4RPHA 2JBAA 4GGOA 4Y6PA 3DHNA 4XOUA 5ARBA 4FYWA 5EZ6B 2CZQA 1VI6A 3H8VA 3NK6A 2B25A 2GZ3A 4LZPA 3NS7A 5DFAA 4G4JA 3KS9A 2OXTA 3BGIA 3O8OB 3ET4A 2QWXA 3UEOA 2JIRA 2X41A 3SR2C 1ORVA 1WXEA 4FILA 3L4KA 2BMEA 5EE3A 3H2JA 4XVRA 1WXWA 3HCEA 3OFSA 3RREA 1G8MA 1G3MA 3PKZA 1LVHA 1FUYB 2GNOA 4MMZB 2B8NA 2BFEB 2IRWA 3H1FA 4KFUA 4DVJA 4R3NA 2IYAA 2TRSB 3H2HA 4FLZA 2FWJA 4TMXA 1AJEA 5EWLA 1FFXA 5HKLA 2Z1DA 4HUJA 4BHTA 4MCAA 3VMFB 1LBQA 2D62A 1HYEA 2G7ZA 3FCXA 4J2OA 5FOSA 1QUEA 5KHHA 3EMKA 2A3QA 3X1KA 1XP8A 3FI0A 4BV2A 4ZT4A 1C2YA 1FFEA 2XMSA 4GF5A 4DIDA 3P9IA 3L7BA 1U4NA 2QRZA 1FTNA 2VTEA 3QVWA 3Q4HA 1NBMA 1ZK1A 2HWYA 1WTAA 1JSZA 1TA4A 2I2FA 3OPVA 1RAAA 1N7HA 4RA9B 4YS6A 4QYWA 3ZLTA 1ID8A 4BNXA 2VF4X 3KT0A 1UOEA 2RQ6A 2V9PA 2XI4A 4NEGA 4WACA 4ALIA 3F7YC 1L7XA 2FE4A 3LQFA 3J80M 3H5TA 4G5RA 3SF8B 1YTLA 2ESRA 3V4RA 2IA5A 2ZBPA 4K9KA 1HNXB 3E2PA 3GP5A 3P2IA 4KQMA 4RVSA 4UDXX 4BX2A 3IIKA 2G04A 5I7OA 3K30A 2XUAA 3C9SA 3QUSA 1A2BA 2Q5JA 4JD5A 2QL6A 1T36B 5EUCA 3PR1A 2IZ7A 1T29A 1KKCA 3ITNA 4OMDA 2Z08A 4U00A 5D6OA 2CSXA 2BFFB 3MLAA 3KZOA 1TAEA 1V54B 2CLIB 3P4XA 1NW8A 3SXJA 4AP5A 5DM70 1OI3A 2C9YA 3O2SB 1Z22A 4JCCA 4WBNB 2F4VO 1F8UA 4RH1A 2NU8B 2JRIA 4JI4O 1E6CA 2AHYA 1FBNA 2L42A 3KFVA 4OA8A 3RT1A 2FPMA 4JAAA 3CXCF 1E7QA 2OHJA 3Q5EA 3RUFA 3KHTA 3V8QA 4F86A 3CS5A 2LQTA 4HDOB 1L5VA 4MS2A 1G4HA 1YRHA 2FPRA 2QT1A 3LO8A 3OPYI 5D5QA 2FZ5A 1XZMA 2DU8A 3QKRA 4EKDA 1KMIZ 1ZAUA 3X2QC 1ATZA 2FWMX 2NPOA 1U5AA 3C3BA 3L71H 2O1XA 3EOZA 3OGIB 4GT1A 2E5WA 2I4OA 2JGDA 3L46A 4MVXA 4Z2WA 1X14A 1UWVA 2E5LB 3M81A 5CT6A 5KHIA 3TRKA 3BN3A 2W0FC 3CS3A 2C98A 3U0VA 3ZE7A 1HX7A 3EW9A 3KZCA 1P3JA 2H6LA 1NN5A 4MWOA 5FF9A 1KDTA 2JEZA 4MPPA 5T4BA 3GLHE 3GH3A 2NUPA 2PGIA 1KZHA 1AZSC 3G8YA 2Q27A 3E8HA 1V5FA 1EHCA 2JH9A 3BICA 4L85A 4RFSB 1EVLA 4PZLA 5EJMA 2H57A 2ASEA 1SCUA 3OZBA 4CG3A 4YLGA 4KITB 2CN1A 3E9YA 3RU7A 5DNYB 3QLTA 4LP8A 5KDDA 3RAEC 1D8AA 1JJ7A 2FN8A 3F6SA 3I4LA 4MZXA 3EMBA 2C5LA 1Y6RA 2H63A 2FMLA 3H17A 1ISIA 3G9UA 5DX0A 4X6UA 1L0NH 3H1JH 4TLBA 1QXSA 4K9SA 5D84A 2ZITA 1F20A 1NW4A 3H65A 1DG3A 2O59A 3VBCA 1RKQA 4WINA 3HE3A 4MTLA 4H7JA 2G82A 5LP6F 3PWSA 5AHOA 4WEOA 2BR5A 2H6EA 2FPLA 3EZFA 2B4TO 2NTEA 3E9EA 4U2GA 1VSQA 3QH4A 4WDQA 4RE6A 5JH7A 1VL0A 2EATA 4QPJC 4C0HA 1DWOA 5GTIZ 2XJ4A 3QNMA 5BSFA 1H65A 5K5EA 3D4IA 5K03A 1UT8A 3OICA 3GPDG 3Q3CA 4B32A 1Z2EA 4DCMA 3EJWA 4U2DA 1TU4A 1WU7A 1X7YA 1HEYA 4DANA 3R09A 1PFWA 1RYFA 4QPDA 1GVNB 1NLMA 3THYB 4CQMA 2IX9A 3R5XA 3FAKA 3LBFA 4DT1A 3FCYA 4JVNA 1Z36A 4DL9A 2P1RA 1AY0A 3M4XA 4A2PA 3AR6A 1RR6A 2J6BA 3CNLA 3MYYA 2I2BA 5F7XA 1Y9EA 1SXGA 1FVFA 1CTQA 3VOTA 1HWYA 3VVMA 5INTA 4CKCB 1HNNA 4RVFA 4XGQA 2HADA 3E8FA 1VARA 3BFVA 2OWOA 3VC3A 4EUSA 2R1TA 4F4UA 3S2FA 4A7PA 1U2ZA 5BVGB 2PG3A 1E2LA 3GO4A 1Q7YH 1TZKA 1MVOA 2O6LA 3A06A 5KJCA 1GTG1 2YH2A 4NQZA 3OWHA 2W22A 4MV9A 3FB8C 2GFIA 3PF9A 3DOHA 3GEIA 4RHYA 4UVDA 4P2ZA 3TZHA 3T0IA 4GI7A 2A84A 3Q9LA 4JXKA 3V9PA 4DPKA 3UM7A 2P4HX 1BCRB 2CDYA 5JWHA 4WQMA 3W4JA 2H0QA 3O1LA 5CFOA 5L3QB 1JH9A 3WLKX 1B3QA 3STUA 1K34A 1MA1A 1WKBA 4RJTA 5L3SA 3HVHA 4DR6B 3QYJA 2C94A 1PTJC 4OHBA 3WYGA 3QTYA 2VHYA 4X1YB 1TJPB 4EY3A 3D1JA 2WWWA 1QHXA 5K8LA 2PPLA 4L4RA 2ARHA 1V5IA 2BMDA 2IU4A 3LLCA 3A28A 4ZODA 1J8QA 1U9IC 2PFKA 2Q7DA 1RMQA 4N7JA 4OHPA 4WXHA 4YMLA 2BSXA 3UGJA 4CH5A 1M72A 4MVMA 2O2YA 5DTEA 3T4DA 4YH1A 3P3NA 3FB4A 3FVWA 2Z1FA 4F1KA 4CU5A 3QX3A 4FK5C 5EE9A 3E48A 2W6NA 2XH8A 1YQDA 3KR0A 4B3GA 5T64A 2IQIA 3I5XA 2PYZA 3PRHA 3L8GA 1K6IA 3PF8A 3RUHA 5AIBA 2VXYA 4KR6A 1KO7A 1Y63A 3ZXUB 2YY6A 1C1DB 1WA8B 3H9EO 2MDTA 4OBEA 1YOVA 2P1DA 1XFDA 3PFBA 2H16A 1F0PA 3IBGA 5LB2A 4QUHA 1GM8A 3GG9A 2F4NA 3AVXA 4BWYA 5JAUA 1EDDA 1LDNA 4FOTA 4WK2B 1RE1A 3CYOA 3I92A 3ZHSA 2J48A 3W2HA 2IEZA 1N77A 3NDBB 3GEEA 2R25B 2VAPA 1X8KA 3G9QA 4OK3A 3WRYC 2WV7A 4UULA 3WGMA 3U26A 4EYKA 4MV7A 2F2TA 4YRIA 3OPMA 1MO5A 1R12A 2CXQA 2VK8A 4LZAA 2JIBA 3DZHA 1DP4A 1Z6AA 1ZICA 1OCCB 5HEKA 4D6TH 2MINB 4I9GA 5HHTA 5JYEA 5FYQA 2IDZA 2HJVA 1EK2A 1QLHA 2QOEA 3AP3A 2XDQB 2BGIA 2NG1A 3G2MA 1QH8B 4OY3A 4EKGA 1IHUA 2ALJA 3K9SA 1PFUA 3AG5A 2IYOA 3I72A 5J5AA 5JSHA 4XDLA 1JXOA 1JQ5A 3LFOA 4ZEVA 2EILC 1YR3A 3ND9A 4AIRA 1HDIA 1I7LA 3RU2A 2P2GA 4CEIA 2PT5A 1FDSA 4DV5B 4RWUA 4N12A 2QLLA 1NBMG 3S3XA 4A5SA 4QE7A 1SY7A 2OUIA 3OFNG 4M9CA 4K2AA 4MP6A 4PLPA 3UJ3X 2V6BA 2XRMA 3H18A 2ZS8A 1FYDA 4BJ6A 3JAWB 3M0EA 2UZHA 2H9YA 1R4MB 3MTEA 4KZPA 3EORA 3WK8A 4AUMA 4BXOA 4ROTA 3EARA 4UJ5A 4DR3B 1I10A 4KDCA 4R1QA 2ZBUA 5DEIA 3W5BA 3U7GA 4IJMA 1GO1A 4TQFA 3EPPA 2ZUFA 1Z0FA 3G5LA 3R66A 4YAGA 3OE7G 5EE0A 5GAJA 4OHYA 4YY3B 4G8CA 2ZNIA 2WOOA 3CLSD 4IOMA 4L75A 4WN3A 2IV3A 4EKNB 3MAJA 4MT8A 1T3ZA 1P9NA 4RVUA 5I3ZA 1JLHA 2NQ8A 4I4CA 1NN1A 3I1JA 4KRYA 2HZ7A 4GKJB 3CFYA 4RV9A 1F51A 2BFDB 1PZEA 5JMPA 3CW2A 4Q4HA 1EBFA 4Q6WA 1VYVA 4QTZA 4EPTA 5JAHA 3GOQA 3RVRA 4RPGA 1Q6ZA 4HXGA 1W25A 1JU3A 1BG6A 1YZKA 3IDOA 2OP0A 4C06A 4EB8A 1NH2D 2CB9A 3PEUA 4ASUA 3OQBA 1LNZA 2UYGA 3HO8A 2ZODA 2XAFA 1N6RA 1UT5A 3AESB 4NE9A 3RABA 5FQOA 1XQ9A 3K9CA 3RSHA 5F12A 1JQ3A 2G6BA 1AJPA 3VPHA 1RLMA 2JJ1A 1ORWA 3GLIA 10MHA 3GBVA 3V7EA 4L78A 3T0FA 3QMVA 2BIFA 1D6NA 1W4BA 2HMUA 3ENKA 4HNAA 3LUFA 4O8ZA 4RCYA 2X3UA 4JI1B 3A9VA 4TVBA 4OBBA 5ICCA 1Z12A 5JBQA 3S40A 1SCQA 1E9SA 2BFWA 2C88A 3CCVV 1FJGB 4B08A 1SVLA 1NKVA 3CRVA 3DM5A 4PX5A 4ZQGA 5SYAA 2Y9PB 1M1YE 1UJ5A 3O8OA 4PY2A 3HJHA 2JANA 3FJOA 3CKMA 3OE7D 1GM7A 1VQ4V 1W36D 3JWJA 5IVHA 3SPJA 3CPWF 3HVUA 3TNDA 4BIUA 4ADSG 2WKPA 3ROXA 4DLZA 4H4DA 3SJBA 4EGFA 1K7XB 4JBIA 4MDYA 3R74A 4DA4A 4N21A 2BC9A 3UC5A 3DONA 3FPLA 5ALFA 4MQ6A 2PRSA 5GVRA 4ZXPA 4B85A 4ZCTA 1NMZA 5AWFC 5BVHA 1L7NA 3B82A 5KWIA 1C9KA 4GM4A 4I9WA 4K8ZA 1MRNA 3FNFA 3VMFA 2QDKA 3ZBHA 1CR2A 1KSFX 1L5MA 1U3GA 1VBKA 2IZ1A 1UZAA 2PGXA 4IH1A 2KTVA 1NVUQ 4IG4A 1RAHA 4L0MA 4MGHA 4CLDA 5CA1F 2WVGA 3K6RA 1E2QA 5C8XA 2GTIA 2JAHA 4WFFA 1PSWA 3VVCA 5JNLA 5GANK 1S6YA 4HPJB 2YWEA 2GK3A 2H2GA 2C0QA 5C1PA 4GL4A 1B4DA 1HE1C 1GRJA 1AS2A 2VRNA 3OOJA 4FCVA 2I7DA 2R11A 1D5WA 3AJRA 4P4TA 4V03A 3GMTA 4G0OA 2QSYA 3S0HA 2GV9A 4GZ3A 3VUEA 5A03A 4G65A 4EHKA 1RAFA 1R6AA 1SQ0A 3EDQA 4M9XA 3SPIA 2C96A 3C5CA 1IN1A 4HDCA 1KEKA 1EWYA 1YRQA 2QX9A 5TPZD 3WBBA 4BLPA 1QCZA 3F2VA 3DLHA 4IJ5A 4CMHA 1QIKA 1AB5A 3V1KA 2FUKA 3ZK8A 1P9OA 1S02A 1Z34A 1FMTA 2VPWA 3OW2F 3DBHA 1GGEA 1FZQA 3A4IA 4OQMA 4DG8A 5AUNB 3WDKA 5BW5A 2JJ2D 2DPGA 3WIDA 4BPRA 5EJEA 4QFMA 1S8NA 4QG3A 3NR7A 3PNPA 4DUZO 2VGMA 4Q4JA 3CRZA 4MI6A 4WY5A 4X00A 2ZE8A 5AVMA 4YIKA 5FBWB 5A7GA 3VR5D 4YUAA 2RBEA 3OT4A 1O2DA 3Q6NA 4ACAA 3SPCA 3GJRA 4PZCA 5I48A 4KUEA 1E8MA 3QOXA 4OX9O 1Y7LA 1XWIA 3WFVA 4GKJO 4HGZA 2ZS9A 4MQUA 2O7SA 1W5SA 3PLNA 2VYQA 4QDKA 5F35A 2BONA 3THRA 3CXRA 3UICA 1ADFA 5JO9A 4DYLA 3ZBTA 4HAOA 4CI0B 4EHIA 3I2HA 3DLCA 5EC8A 5BUSA </