3JARB

Cryo-em structure of gdp-microtubule co-polymerized with eb3
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
429
structure length
429
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanistic Origin of Microtubule Dynamic Instability and Its Modulation by EB Proteins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
molecule keywords Tubulin alpha-1B chain
total genus 151
structure length 429
sequence length 429
chains with identical sequence D, F, G, H, I
ec nomenclature
pdb deposition date 2015-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3jarB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 3jarB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 3jarB01
5EYPB 4B45A 4O2AA 4YJ2B 4X20A 4I55B 3ZIDA 3HKDB 4EI7A 3JALB 4M8IA 5LP6B 5J2UB 5EZYB 5IJ0B 5C8YB 4YJ3A 5LXTA 4LNUB 5CA1B 5JQGB 1RQ2A 2VAMA 3N2KA 5FNVB 3RYFA 4X1KB 1JFFA 2XKAA 4IIJB 4U3JA 3WGNA 4O4IB 2VAWA 2R751 4IHJB 5LYJA 4FFBB 5GONB 4ZOLA 5LP6C 5MN6A 4O4HB 2BTQB 2RHHA 3R4VA 3N2GA 3JARA 1RLUA 4F6RB 3HKBA 3VOAA 1OFUA 3JAKA 5BMVB 4X20B 4I55A 1SA0B 3JALA 5JH7B 5J2UA 4TUYB 1TUBA 5C8YA 4YJ3B 5LXTB 4EB6A 4ZI7B 2RHLA 4X1YA 1W5BA 3N2KB 3C8LA 3RYIB 4ZHQA 3RYFB 2GVIA 1JFFB 3VO9A 5IJ9A 2Q1XA 4X1IA 4IIJA 4TV8A 3WGKA 5IYZA 5MN4A 4O4IA 5J2TB 1Z5VA 5LA6B 4I50B 4IHJA 5JVDB 4DRXA 4WBNA 4ZOLB 1TVKB 1FFXB 4I4TB 2BTQA 4O4HA 3RYHB 5KMGA 4O2BB 4DXDA 3M89A 1W59A 3ZBQA 5LOVB 3HKBB 2RHOA 3JAKB 1W5FA 5BMVA 1RQ7A 4KWEA 1SA0A 5JCOA 3WGMA 5JH7A 3RYCB 3WGJA 4HNAA 1TUBB 4TUYA 3UT5B 3JASA 3HKEA 4EB6B 4O4JA 4ZI7A 3E22A 3JATB 2XKBA 4X1YB 5ITZA 3RYIA 4ZHQB 5IJ9B 4X1IB 5CB4B 4TV8B 5CA0B 5IYZB 4U39A 4O4LB 5J2TA 3JAWB 1W5AA 5KX5B 3VOBA 4TV9B 5LA6A 4EI8A 1W581 4I50A 4DRXB 4WBNB 3CB2A 5JVDA 5KMGB 1TVKA 1FFXA 4I4TA 3RYHA 3V3TA 3HKCA 4O2BA 2VAPA 5EYPA 5LOVA 3VO8A 4O2AB 4YJ2A 3HKDA 2BTOA 4E6EA 5LP6A 3RYCA 5EZYA 5IJ0A 4HNAB 3UT5A 3JASB 3HKEB 4LNUA 5CA1A 4O4JB 5JQGA 2R6R1 3E22B 3JATA 3RB8A 5ITZB 1W5EA 4B46A 5LYJB 5FNVA 5EIBD 5EIBC 3M8KA 3VPAA 4EI9A 4X1KA 5JCOC 2Q1YA 5CB4A 5CA0A 4U3JB 1FSZA 4O4LA 3JAWA 5KX5A 3WGLA 4TV9A 1Z5WA 3ZBPA 5MN5A 5M7EA 4XCQA 4FFBA 5GONA 2RHJA 2VXYA 3HKCB 3N2GB 3JARB 4F6RA
chains in the Genus database with same CATH superfamily
3E2PA 3H86A 5B3LA 3TGPA 4K6MA 1IN5A 3ED5A 1EBFA 4FOSA 3O75A 1P60A 4YJ2B 3AGPA 4KQCA 4IIDA 4V0QA 2MYPA 3WNDA 4QQKA 4R40A 4ZFNA 4KRXA 1EVZA 2F17A 3ZCQA 4XEHA 1JEYA 3QTLA 5JQGB 1U0LA 4NXMB 2DRIA 4FT2A 4MVJE 4R1UA 5J4VA 1K6JA 5E1MA 3GFVA 1BHJA 2JHPA 4XQCA 4ZQBA 4AJ4A 4J3NA 4HXFB 3DF7A 4FUTA 3KTAA 5F51A 3ZV5A 3L8CA 4X64B 1ZOLA 4YRTA 3NPAA 1G98A 3VAAA 5T7BA 3MBMA 3B2QA 3M6MD 5CT5A 3OTHA 3UJ8A 2P6UA 1UWKA 2YFYA 1M34E 5MN6A 3CXUA 1W19A 3VZDA 2FG6C 4RLQA 2ZIAA 1XZCA 3HJTA 3L82B 3Q3JB 3IDQA 2HPVA 3MJCA 4X62O 3E20B 2MK3A 1XEQA 4WFBV 1VPLA 2AYYA 2BC9A 2XUZA 2Y93A 4HH0A 5FNZA 3VI4B 2C5SA 1YZTA 4KRGA 4BNMA 4LCEA 3FVTA 2XYQA 3SPCA 2B5VA 5EGSA 5HG0A 4ZZ3A 5ED4A 2R66A 2GEUA 3HI4A 3ERNA 3FJOA 2D00A 2CDBA 1B14A 2A14A 2HJGA 5EXDA 4D4GA 1SHZA 4CR6A 1T6NA 1H9AA 3TFQA 4DGSA 3E70C 4E5MA 2Q7HA 3EQ9A 2FUG6 3DDCA 4K0KO 1RZUA 3W7SA 1V6AA 1XL6A 2F64A 1WUJS 2PD3A 5AICA 3SHWA 4A4DA 1X1DA 1XZFA 1DT5A 5IT0A 4I9HA 2H92A 3M5DA 3GVMA 3K2QA 4GXNA 2VHWA 1XOUA 1U0EA 1YA8A 2GN9A 1ECGA 4I3HA 3U3ZA 3VIUA 3K5LA 3G82C 3ZI0A 1AGYA 2EDAA 2ZJ5A 3FJYA 1C3XA 4PPNA 1SVUA 4MKFA 3E83A 2QQGA 2M6LA 1GD1O 1W29A 2QD2A 3C8ZA 2GO7A 2FQQA 1OXSC 1VFNA 3Q8LA 1DV2A 3WJ2A 3KHUA 3VSEA 2G40A 1IM5A 1P91A 2FFAA 2M1XA 2Y1KA 3UXYA 2QEQA 1NQWA 2ZVZA 2QWPB 2CDRA 2UVDA 4POAA 1YS6A 3BMNB 3V1LA 5KS2A 1PZGA 1CS0A 4JP1A 4BJ1A 3GJYA 4LG1A 3T7TA 1B4DA 4MGEA 1IN8A 1CQJA 4PYLA 1BZKA 4BJ6A 4CKEA 3CCEV 3KETA 2FTKA 4L76A 2KG4A 4O4JF 5T67A 4XGNA 1X92A 3JVIA 3T1CA 2HMTA 6LDHA 3MWKA 1THMA 5JVDA 1A2BA 1HMYA 1QHSA 2OBFA 3HCCA 1H2LA 3EPRA 3OJEA 3E8GA 4QDKA 4TWKA 4D42A 5I01A 4YC7A 3T7SA 3I4LA 2A1TR 1O08A 1G4UR 2YDXA 2GHYA 1PUIA 2HYDA 4ZAVA 1KYTA 1OWPA 3NBQA 3VTFA 3HCBA 5MHTA 3LT1A 4YCAA 1U40A 3MSCA 4B73A 1B3RA 2H8GA 1KJZA 3SJBC 5JD6A 1BHSA 4OHKA 4BV8A 2J59A 3NTVA 3OY7A 2Q1WA 4MS1B 1PGOA 4KMMA 1MVNA 4PTZA 4DCMA 4XGQA 3A9TA 1IUKA 3CLSD 3PC4A 1G19A 1HH4A 4ARSA 4BS9A 4C6SA 5E2BA 1FFAA 1J5EO 2JNBA 1CZUA 3RS3A 3ZC3A 4PU0A 5BT8A 1P3JA 2PANA 2RAVA 3NCTA 4JT9A 4U7WA 1EUZA 5SY9A 4UTXA 1E32A 4I1PA 2Y27A 2OCCB 1REQA 3SS8A 2WA2A 4FEAA 3F9CA 1JQBA 3FIJA 5GIOE 3GA5A 1F6WA 5AOAA 4Z49A 1G21E 2ZQMA 2DQKA 4YJDA 3SBOA 4MYTA 3BQ9A 2AQKA 1SC6A 3LUHA 4YO7A 5FDFA 1ZDMA 2SCUA 2QUJA 4FSDA 4HB4A 2FL4A 1T2NA 3D3JA 5DO9A 3LUPA 2GPSA 3GLSA 1E3JA 3CKYA 4Z3OA 1YE8A 1U28C 3H7IA 2VAMA 3A0RA 2PL3A 4JLOA 2X8JA 5D3MA 2XF8A 4M38A 1ZH8A 1EG7A 3S3TA 3BFKA 1SQQH 3N27A 3W6PA 5A4MS 5JYDA 4M1QA 1GRRA 1P29A 4F7DA 1J23A 1TUEA 1B15A 3D3KA 1WZNA 2E1RA 3HN2A 2CE7A 3IAM1 3OFJA 4NV1A 5BVHA 3HJGA 1E4EB 4BZZA 4N6OA 3WNCA 2GVZC 3OPQA 1P0QA 1MC5A 5DYTA 1GGNA 1K4DC 4R50A 4LDRA 5BURA 2NNUA 3OEED 4HDAA 4LFCO 4LSGA 2OP1A 1L7NA 4DS3A 3TG2A 3O65A 1ZX3A 4E08A 4KNVA 4Q34A 4ND5A 4CG0A 1QB8A 3V32A 3BVPA 4PSUA 4FWTA 2Z4RA 4OCZA 1PQYA 2WLSA 2XKJE 1ZL8A 4X1YA 1NUHA 2QMYA 2D5LA 3F98A 4D4HA 1EZVH 4FNAA 1N3IA 2RB4A 3E9YA 3JD2A 4WKBA 2XCLA 2HU2A 5C4GB 1ZIXA 4DLPA 3I61A 2VQSA 5FL3A 5KSYA 3B8NA 1J2EA 4FWBA 1QCZA 1FC0A 1E1YA 2VNAA 3HUUA 3LF1A 4HPXB 4IG4A 4ROTA 3AJRA 1J39A 3GMIA 4Z9YA 3EC1A 3A0BZ 3I9JA 4OU4A 4WN9B 2BLLA 3SZUA 3EULA 3KDPA 4YUZA 1SULA 2BTQA 3L4BA 3ZI4A 4H7KA 4GD3Q 3MJSA 1F60A 4KO8A 1G5PA 1WCWA 1EAMA 1GDHA 1GYQA 1QCYA 3V7WA 1U43A 2X42A 2HVYD 3RS7A 3RHSA 5KDLA 5JD3A 2ILMA 1K8XB 3C1AA 2Z56A 1PW5A 3GMDA 1KC8W 2H9AA 2RB5A 4FONA 1UBNA 3HKEA 4J16C 2OO7A 4PGGA 3QJGA 1RRKA 2XRMA 3I56F 2W2MA 4X8OA 4K8XA 2HS4A 3CCVF 3AVQA 4ZCTA 2A3RA 4GP9A 1A9XB 1WZCA 4RXUA 4UXHA 4AB1A 1XHZA 3L06A 2N3ZA 4GLBA 5I4KA 4QVKA 1M57C 4X91A 2PSFA 1WHTA 1VQ8V 4AKEA 1OLUA 2OFOA 5EHZA 1QPGA 1XALA 3C7AA 2BPOA 4YHHB 4NZYA 2HLNA 3HJRA 2VWKA 1T0BA 5SV2A 2DWQA 3BA1A 4B9AA 2VT6A 4WNYA 4I6GA 3BQMB 1YFKA 3B52X 2JIOA 4AWAA 10MHA 2Z5LA 2ZSDA 3L2OB 1TD9A 5F21A 3PWZA 1YI1A 3TZBA 2GSWA 3SD7A 4Z51A 4U4AA 5ITSA 1ZM3A 1A7KA 1MEJA 4CDGA 4M1EA 1ECLA 2YYYA 1Y89A 4MP6A 1TAQA 2QMEA 2C7RA 1G8MA 3PJRA 4YLYA 3ECSA 1OLSA 1YH3A 4M9UA 1M8FA 3HL4A 2I8CA 1T4GA 1FVXA 2OE2A 4LR3A 1ZNQO 3Q4HB 3ZHOA 4YT2A 1CQJB 4YDQA 1UOEA 3LRPA 4J7KA 5CLIA 4CBCA 2UXDO 1I2BA 3A9CA 4GOLD 5SZIA 3UBMA 2I4TA 3NATA 4RV9A 1JKIA 1K0UA 2P69A 3NDPA 5JJ5A 4UAVA 3CNQS 4L2IA 2ZM6O 2NNWB 1SIWA 2Y77A 2LIPA 1NXSA 1G0NA 1Q6HA 5JXGA 3JQAA 5ES4B 4Q9AA 5HIAA 1X2EA 2OGSA 3NOXA 3EOBI 2J8ZA 3CS3A 4HLNA 4QTTB 5I8ZA 3OPXA 4MS2A 4KI7A 4BNGA 1NM5C 1P72A 1BN6A 3EVZA 1FDWA 1OYVA 2WLKA 3NEAA 4EKYA 2W6ID 5LXTA 1JS1X 2ZB7A 3H1HH 4IDAA 5EJMA 5AOCA 3RVDA 3SJZA 4EWLA 4TSFG 4YASA 1R6XA 4ND7A 2YRWA 3MWEB 5CU7A 5ALRA 5ALXA 1AQLA 2A9QA 4AZ3B 1ORDA 3N59A 5KJ1A 1YQXA 4LNAA 1AP5A 1Z3IX 5HK9A 4YHHO 4LXYA 5IM4F 1CR0A 5ECYA 4AN0A 4AQYB 3FRHA 4TOIA 1E2EA 4PLCA 5BV7A 3S2EA 2P2LA 4AI8A 3LBFA 3R0QA 1JQJC 4M8NE 1S3JA 3MCTA 4MX8A 5KYXA 3ZVRA 1H2EA 1G8HA 4CKYA 1UK9A 2ESRA 3LLSA 1C50A 4I6JA 4DR6O 4J75A 4BFXA 4DTIA 3FFXA 5A04A 4XDGA 3HUEA 4DLXA 1EUDB 3GT3A 4PBTA 4CIYA 5JZOA 3IB3A 2I1QA 4HWRA 5BN5A 3ESDA 3I5YA 4YMTA 1HT1E 3RG8A 3BC1A 4MKGA 3FF1A 1ENVA 1RIFA 4BKMA 1SBNE 2FV8A 3V97A 1Y74B 4JYPA 3S06A 5BSRA 4P9OA 1OCZC 2WI8A 4TT8A 3A0RB 1WE2A 1Z0UA 4UQPA 5D3MB 3TKAA 2DPHA 1M57B 2UXDB 2IVZA 1NR1A 3G6EV 4M0CA 3RVSA 1US6A 3WGKA 1VDZA 4Y6SA 1G42A 4Z0HO 4QNRA 4I6EA 3E86A 3N4ZA 3UJPA 3BAAA 4L7VA 1UC9A 2EXXA 1SQXH 3BWBA 2CXNA 3A1VA 3GC6A 3I9NA 4OHPA 5HMLA 3R6GA 4IZOA 1Y9JA 2XXAB 5A3SA 4Q24A 3C24A 1MO2A 2V9PA 2R7AA 4CL3A 2JGNA 4CF6A 1PNTA 2CV0A 4BQFA 1J8MF 3HTXA 1E5XA 3RG2A 4XWOA 5EUBA 1EFHA 4HZUB 2YCBA 5BR7A 1N2SA 3NPMA 4FINA 1IZ9A 4KXUA 3TLGB 2DPLA 3TQHA 3B36A 3WGQA 2CWDA 3GELA 2VBFA 4BGDA 2HA7A 4I4CA 2GB4A 2PGAA 2Q07A 4IMPA 1XQ9A 2Y1OA 4TTPA 4F4LA 1N1MA 4BUJA 1RYEA 4YK7A 3N3BC 3LPLA 3R8XA 4RK6A 3AP3A 3NASA 5KNCH 4MRAA 2H18A 3EEBA 4PFKA 4WN9A 2VZLA 1E2GA 3CTMA 4KQKA 5KTYA 3CLUD 3AILA 3C0KA 1ID1A 3CYQA 4KV7A 3AV0B 2HXSA 2GCNA 5EJAA 4K9QA 4P7BA 5KUMA 3IP1A 5DP1A 5FWYB 2FFJA 4KPFC 3KUXA 4FMTA 1H42A 2H52A 1FFDA 2Q5HA 4I1RA 4P2BA 4XVQA 1WL8A 4YCMA 2WF5A 1FTGA 2PUVA 4KEAA 4BVFA 4B32A 3SICE 1XO1A 3CM0A 3ADCA 5EWJA 4RIGA 2PZEA 1Q3HA 3DTYA 3GWGA 2AHRA 3ABRB 5ADUS 2YWRA 1OV4A 1NC3A 1E1LA 2BEUA 3I9KA 1J0CA 3SYKA 2QVLA 4UM7A 3VQTA 3VSAA 5IKPA 3RCBA 3TQIA 1B8UA 2FYTA 3LSYA 1QDUA 2A06H 1Y9DA 3BCUA 3BWXA 1D2GA 2XSZA 2NVBA 1M5TA 2GAJA 2YIJA 3CEHA 1TW3A 4GEGA 1CD5A 4NTXA 1MO4A 1NL3A 3KOYA 1EX9A 2VUUA 4AM8A 3QXHA 5AJXA 1GU1A 2Z09A 4JOSA 1NRIA 4FC7A 4L8LA 2O52A 5EXSA 5L95A 1V9CA 3I7TA 3RVYA 5ALZA 2M6KA 5I7FA 3SKVA 2W4QA 3BY6A 1EXWA 4TZTA 5EC2C 4EPYA 3BDIA 3LHIA 2QJWA 2MINA 1ZICA 2GAIA 1XN1A 4OX9O 5FBLB 5JY6A 1X7GA 3QX7A 3KJQA 2FSUA 2I8LA 3AX6A 4BKQA 4D9IA 2BGRA 1NQ3A 3A8TA 5CA1B 2LGQA 2UZHA 2ZJ0A 3JYHA 4IZHA 5HW0A 3I4FA 2V0GA 1ZK0A 1P2SA 3CPEA 1ZISA 2G5PA 3EXIA 1KHHA 1VGQA 2XXJA 1LQTA 3M6XA 3ON5A 2ZWOA 4FEYA 4M46A 1ZUNA 1KDYA 3N0TA 4E14A 2BFCA 2E5LB 3GZNA 3IXLA 2OWOA 1G8AA 2J30A 4GGMX 3IX7A 1VE5A 3ZDYB 4LKRA 3GGOA 4K0RA 4R84A 3LDCA 4TMFA 1YRAA 3ROXA 1LPSA 1VHDA 3IDFA 1PKXA 5DT9A 1H9CA 1RD4A 2EAUA 4O8ZA 3GCWA 1AJEA 4HYEA 4J1QA 2X13A 5F2EA 5AI8A 2GRAA 1PV1A 2GM9A 2C95A 3TIFA 3CLTD 4MVJG 4X20B 1PJTA 2QL6A 4L7QA 3RU7A 5IKXA 4IDEA 4MDFA 2HU7A 1K63A 3GFRA 4FUQA 4QBKA 3ABKC 1LR1A 4DRYA 5HRUA 3UTDA 1W2HA 2X5XA 1QH8A 2QD4A 3VH1A 2H8CA 3UKMA 1Z0KA 2PKQP 3FBGA 4D9EA 1GTL1 4Z9FA 4G56A 3CN7A 3MWEA 8OHMA 2NPFA 1XTSA 4NBTA 4I08A 4AZ3A 1D2DA 1BWQA 4JBLA 1WULS 2WHPB 1P31A 1SIOA 1QR6A 4CTKA 1U2EA 2OHJA 1V8DA 4KCGA 3EARA 4F1WA 2WM8A 1O94D 1TK9A 4G2NA 1JCHA 3H2HA 1W59A 3HU3A 2QAGA 5CXSA 3DAGA 4MB0A 4LMBA 4Y2JA 1XTTA 2ZYDA 3MAGA 3HB9A 4RHYA 3PNMA 1DIGA 3ZCXA 3WGMA 1ZU4A 1QFXA 3HCNA 4WFJA 1JAYA 1SG9A 2W2XA 5COAA 4DNQA 4UAUA 5HVNA 4Z86A 3B3AA 2WQ7A 1XMOB 5F3WB 3B09A 1H47A 3GUCA 4B0OA 4G67A 4D3SA 2CL0X 3Q5GA 4JI6O 1IN1A 2AOVA 3RU3A 1SXJE 3ESJA 4ZK7A 1DL5A 1YZVA 2E5LO 2OCXA 3QKUA 5DZSA 1MBZA 1LI4A 1U0RA 4AC9A 1CRQA 3EEFA 1ZD9A 3TSZA 4ABYA 4MYRA 1JLKA 4V02A 5BY2A 4MYSA 3EQ7A 3D7NA 3V3TA 1JDBB 1KI3A 3O7WA 2OO3A 1NR5A 4ZD6A 3SHVA 5B64A 1L4NA 5BMVF 4BWAA 3EH2A 2FF5A 3BSFA 4ESHA 3AP1A 4WOKA 1IG0A 3VGPA 3M1LA 2AG0A 2I1VB 3NDIA 3RV4A 3NALA 1GAEO 3L7AA 4BV3A 2IH2A 5JJIA 3GRAA 2X0IA 4WZZA 3K31A 1AR4A 3WGTA 4M9CA 3OR6C 3IBYA 3PF9A 3QTCA 3SGIA 1Q1GA 1U3CA 2IW3A 1TQ2A 2ENUA 1WN7A 3LBAA 3Q9NA 2VPZA 5DECA 1MAAA 4GAEA 4LYJA 4A2CA 3FSGA 1K5PA 2IVFA 1VKOA 3N58A 2DYKA 4HRYA 5BRJA 5LR6A 2J85A 4EVRA 1NV9A 2ZE5A 2EZ9A 1Y8AA 1E79D 4UUAA 4PG8A 1NMEA 1NVKA 1JFRA 1Y5LA 5TF0A 1ORVA 3BD7A 4G1UC 3HAXD 1YXBA 4WUVA 2F8LA 1XV2A 1Y42X 1W34A 1L5WA 2PYIA 3IVCA 5GJWC 3UV7A 4NH4A 3WQHA 5JIBA 5AW9A 1XZJA 2C8KA 3L7LA 3G71F 2HMVA 3Q7QA 4MKXA 2ACWA 5HUQA 4F6RA 3KAJA 1Z0ZA 4MW3A 1KO7A 3OCYA 2WYOA 3ZIDA 4BZXA 3KJNA 1S2GA 4D45A 1UBSB 4L5IA 2TMGA 1U9ZA 3X44A 1XTVA 3DXRA 3AV3A 3OJ0A 4JTDB 5C93A 1Y8CA 5I5GA 2XBLA 1DUVG 1JDTA 3LTEA 3P45A 4PCAA 4RH1A 5F1PA 1EAYA 1LV7A 1MXHA 4YAOA 3X2SA 1Z4IA 5KPDA 1Z2GA 1IL0A 1V43A 2FAXA 3VYTB 4KRFA 4K8ZA 3GGDA 2ADQB 4FYMA 4TL7A 4TKUB 4LZZA 1W87A 4FFLA 2ADMA 1JFLA 2H0RA 3TTUA 2A67A 4D81A 2D4HA 4EPRA 2HRBA 4WCVA 4WZBB 3UJ3X 1LSSA 1O97C 4NHOA 1KNQA 3WLLA 1JHDA 5L7YA 3B78A 4RVOA 2EATA 2ZUBA 2GCEA 3EMBA 1ZUWA 1U4OA 2FW9A 1AZTA 3EPHA 2MOKA 3VOAA 1K73H 4UM9D 4J1NA 3HNRA 3EIWA 5DTMA 5AW3A 3I0NA 5NULA 4LCBA 4F11A 2ACEA 3RAJA 3E1YA 1J9ZA 2DUMA 1NWHA 4XZ3A 3RBVA 4B76A 5JH7B 5LQMA 1NGSA 2O8FA 4F4JA 3C39A 5I9LA 3HR0A 4L95C 1AJNA 1R10A 1YJAA 2I0FA 1CZHA 2JH8A 1TYDE 2DY1A 2G80A 3OETA 1G6Q1 3SQMA 3CJHB 2C57A 1TKCA 1U2QA 2X5KO 3AY0A 3NLLA 3CZ9A 3PQ5A 5FBWB 3F5WC 3KT8A 4ZDIA 4WOPA 2GMWA 1NONA 2YHSA 2QKCA 2VTDA 4GBGA 3WLTA 2VH2A 3R7WA 1UIRA 4EW6A 4F4DA 1IY8A 2JLBA 4B6JA 4EUNA 1JDBC 2XOKG 1NLFA 2YXEA 3AJAA 3OJWA 2G1JA 1VSVA 2HH9A 4MH0R 3SX2A 4C4YA 3D4PA 3LCCA 2AVNA 2OUKA 4QSMA 2JNWA 2ZR9A 3CZRA 4RHFA 3N7TA 2WSYB 5CFOA 2I2XB 3I04A 1M90W 2R5NA 3F7OA 3OUTA 2VO1A 4G97A 1D5CA 3C3PA 5JE8A 4BTLA 5A05A 2G72A 3Q7EA 5FBQB 1HEUA 1W40A 1JQ3A 1JR4A 2YIVX 3IPYA 4GQAA 3GDFA 2AZ4A 5E1DA 3UA3A 3CMEF 3AK3A 1HNNA 3HDHA 4JLWA 3OEHA 3M3DA 3PR1A 3AY7A 4HDRA 4WECA 1YA4A 4M76B 721PA 3F3YA 3M0EA 2ZT9B 2YXHA 1S2MA 5A9RA 2A5YB 5EE0A 5ELLA 2J3MA 1YVPA 2AH5A 2HX1A 2GUZA 2WUGA 4PGMA 4RQAA 4EQZA 2WWYA 1L7DA 3IA7A 2GI4A 4R4JA 3G89A 4DDUA 3UY4A 3WL3A 1ZNXA 5I4IA 2PQ6A 3T9CA 1IVNA 2CDNA 1GLGA 2XNCA 2XNDD 3EAQA 1P0FA 1RLOA 1RRFA 3H6GA 2AV6A 2VRCA 1IXRC 3IHLA 4MKHA 1YRHA 1N5JA 4QIWF 3X1XA 2UUBB 3NHWA 4RFSA 2NSLA 3H2YA 3K7EA 5C8YF 2DETA 1TRKA 2GEFA 1CZNA 4HFRA 1WB8A 5KUTA 3OU2A 5L8VA 1N5LA 2ZATA 3W9BA 1LPNA 1DEKA 1C2YA 2NT3A 2XE6A 2HN9A 1PZNA 2HPAA 3WFIA 3LC0A 1QRSA 3AUFA 2OCCC 2JL1A 5B36A 1MNGA 1YVRA 4RFLA 2ZWIA 1E6WA 3OZSA 2WOOA 3TB4A 3GT4A 1MLDA 2PSEA 5SZKB 4N21A 3FLBA 1GWNA 3OZCA 3QO5A 1YVWA 1QE5A 2HV9A 5H82A 3EZYA 2HRDA 3M4ZA 2HHJA 4FCWA 1ISSA 4WSOA 2GN2A 3C16C 3HDTA 5FTJA 4WLEA 3O4IA 4TT3A 2H8EA 1ZCZA 4W9RA 1S5LZ 4YRAA 3BL8A 1YJNF 5T6MA 3HWSA 4C0JA 1K75A 4EFLA 5HY2A 2WKRA 1I4OA 4IIXA 4RUKA 1J5EB 4DBLC 1UBOS 2YMMA 3ZIAA 4OHBA 4B4VA 3OQNA 2TMDA 1JJ2U 1K97A 3OOYA 3DYBA 2BY4A 4JI3B 1ZIPA 2DSNA 3GD7A 4H6PA 3W04A 4LF8O 4YCLA 1TMKA 2ZRHA 4U8GA 1KVRA 2ZDGA 4GKBA 5JDCA 4MW2A 1EUCB 2F43A 2JJMA 3TJZA 1SC3A 5H02A 2HQOA 5F7XA 2F93B 1XTBA 1YI2F 1A95A 3CV3A 3T4EA 4YV0A 4UC0A 3MLBA 2FE1A 1Q3EA 3UO8B 3WADA 3CIFA 2ALJA 1C8BA 4IW3B 2VJYA 4K40A 3RUCA 1FZTA 1L7VC 4MR8A 1K6XA 2OD2A 1QO7A 2XWSA 5A4IS 1O94C 3BGSA 5B1HA 5DW0A 2F4VB 1V1RA 2WYIA 5FP0A 3EF0A 4IHAA 3O8OA 4DGQA 3CCLF 5CT4A 3BIWA 1XL1A 3OUUA 3CC2F 3IR5A 2B9VA 1N2HA 5BOVA 1DJMA 1J97A 2P4HX 3DOJA 3HPQA 2PO7A 1E4OA 2ZGVA 3OY2A 3PX3A 3X43A 4E0BA 3OEHG 3N4YA 1XAHA 3F8TA 4WLOA 2HBZA 5KNBD 4XAQA 2Z6UA 2NXJA 3IC5A 1HXHA 1XAJA 1PP4A 1WQ1R 3L7BA 1PCXA 1BQ4A 5TVKA 3TINA 3MWFA 3NDJA 5C31A 1E61A 3IBCA 4NOKA 5I9MA 3NFRA 3IEVA 4DXDA 1TFUA 1XCBA 2K87A 2PHNA 2QTMA 3OO1A 3R74A 1KMNA 2QKYA 4NFSA 3NUQA 1VF6C 2AQ8A 1SVOA 2VSOA 3E1KA 3WGZA 4C4AA 4BVTA 1O96A 5GWXA 3ZLJA 2Z1MA 3L6BA 2C59A 3DB1A 4OXRA 2AOUA 4TRJA 2G25A 1CVLA 2IEAA 3MW8A 5E3JA 4NEHB 1NF8A 2Q6OA 1GVNB 4OXYA 2WIFA 2FEWB 1H2SB 3LK6A 3LY9A 2XZLA 4I9QA 1FSGA 3QXGA 5CH8A 1C1YA 2M9MA 4MMZB 5ALHA 1Q5PA 2R47A 2KBFA 1JJ2F 4HBGA 5IJ9B 1WHSB 3ZO8A 5EE5B 5BR4A 1OY1A 2CF6A 2EW8A 4Q9NA 3R7WB 4E4RA 4EP1A 1DKNA 2W5UA 3CE9A 5DNAA 4HEA6 2VJQA 2W70A 3CWZA 5F77A 3ANNA 2YJ5A 3H11A 2F59A 3W2FA 4B1FA 4C4ZA 5L3SA 4QVIA 4CMEA 5K2OA 3AF4A 1SGWA 4F4IA 5I7UA 2Q28A 2DFNA 4IUBS 3VU8A 4CU5A 1H23A 2OD9A 2FP3A 4O25A 1VKJA 3NORA 2NXCA 3WXMB 3I9MA 1X9GA 4LXIA 4I1IA 4MUIA 3ABIA 4TSRA 3UC5A 3FCXA 2XW6A 3VDNB 2I7VA 1N6KA 1YUBA 1FPOA 3L8EA 4QDTA 3N07A 3TM5A 3WK9A 5AD1A 4O4IF 2H2DA 2YJGA 3ZDRA 4NFHA 2AWOA 3BK7A 5DIFA 4HAUA 3AJDA 1TPZA 2HSEA 1QAHA 4ZVPA 5AXCA 2FPRA 5AVYA 4CXMA 1CP2A 1XTPA 2R6CA 4ZVOA 4HLCA 5JBNA 4CUZA 4H7IA 5EJ9A 2FN8A 3I05A 4H4CA 3G8AA 4RZXA 4JQZA 3VDXA 1IWOA 2I9PA 1YCHA 1H6AA 5TE9A 1N2GA 1NN5A 1IATA 2NYVA 3OFVA 2BI7A 4Y9DA 2I2AA 4DIKA 1H38A 4EA8A 2G28A 1UPFA 4O1HA 5H5NA 1E3QA 4IFTA 4M7WA 4ZRNA 2IV7A 3O1HB 3CCMV 2CMDA 2OORA 1WY5A 4NJMB 5AK5A 3ER8A 3TX2A 3T5BA 4MYCA 3WJPA 3LPCA 4KO2S 4AZTA 2CB0A 3CNHA 4XB6B 4L28A 5DNYB 3THYA 2OT5A 1H8HG 4ZCMA 1W4RA 3BVOA 4LJKA 2PLAA 4HUJA 1AP6A 4YMLA 1A32A 1U3GA 3FKSA 5IDWA 5GIPE 4ZCPA 2YR0A 3RRYA 3PLAC 2YTZA 4HI0E 3RIXA 2JFVA 2FZGA 1GPAA 3AHFA 3G7NA 3OHPA 2WWFA 4N7JA 3D6FA 4NDZA 3LGSA 4Q7EA 4OSOA 1EDOA 4II7A 3RRFA 2RBGA 4BCDA 4UOZA 3S2YA 3GXOA 4DZRA 4WZAB 3F97A 4N5LA 1AVMA 4RABA 4N40A 2C4MA 1HLDA 2QG4A 4ALKA 4C87A 3TAHA 2A78A 4KPYA 3FFMA 2PS9A 3AK4A 4LP8A 3EAGA 4M0DA 1PS9A 4OI2A 2JF0A 2ZSBA 3CF2A 3QI2A 5IAKA 1IBRA 1M2EA 1VQNV 1X19A 1FP4A 2AE2A 1NQOA 3AUUA 3BH0A 3DB2A 3EDYA 2WLLB 3IQXA 5I7AA 1XI2A 5JV5A 1VG9B 3BGWA 3JZFA 4H44B 1CJTC 2OC4A 1H1DA 2PU7A 2R6DA 3DT6A 3Q2IA 4NCXA 5JSKA 2VRWA 3FTPA 2WG0A 1UPGA 4PDVA 4GKKB 1JFFB 1FP2A 2CLKB 2F43B 2UYOA 3QOXA 4REMA 2GXUA 4ZTBA 4LWPA 1M76A 3ITKA 3X1DA 1W4LA 1N5DA 1PFYA 3T1OA 3RM3A 4BEBA 4Z1MG 5IHXA 3GGGA 3DW1X 4W7SA 2GAFA 4YDRA 5DHTA 4BV2A 2O3RA 4DA7A 2JGUA 4AY6A 1YQDA 1L9KA 2RMKA 3RTBA 4N3CA 4AYXA 4JJAA 1JZSA 4O4HA 4WZ6A 4O2BB 2EBWA 3ODGA 2CXUA 4D8TA 3K70D 2ERXA 3WSTA 3B6NA 5AJTA 3MUFA 2JD1A 4HUQA 4F5ZA 4K3UA 1G8SA 3BEDA 3DJYA 4FD2A 3CCRF 3L1UA 3E48A 1NSFA 3CBQA 4DWOA 3ICEA 2P9JA 4HLQB 5CVCA 1P45A 5EEHA 1GN3A 4ITRC 3B9RA 3F47A 2WSSG 3ZZNA 4EDFA 3WSVA 1M1UA 4B79A 4KAXA 4CKCA 1JLRA 3F6CA 2HPHA 2G07A 1DRUA 1RYDA 4JP3A 3FWHA 5U1PA 2B6NA 3BWEA 4FGWA 2PKCA 3VDQA 3WB1A 2HS0A 3MA0A 3QQ5A 2W8BC 3V7EA 3IBSA 3KDAA 5ALUA 5EWLB 3CNBA 3EC7A 4HQ0A 5BPFA 4P22A 2R1TA 4NCAA 5TPZA 3DC5A 1UADA 2IP4A 1FX1A 1COMA 1HLGA 4DLUA 2R4QA 4HEQA 4BWYA 4YYEA 4DMCA 3PGMA 4PCUA 5L3ZA 1SWVA 4YCSA 5CJPA 1Q5OA 1KYZA 4RKEA 2R8BA 3SSNA 4G65A 3PC3A 4EYSA 2IH1C 1NQVA 1TKAA 3PEFA 3EGXB 1QO9A 1Z4JA 3P2IA 4QHTA 5AO9A 2WYUA 2F23A 4LSZA 2VJCA 1VCHA 1ZGCA 2WKWA 2XECA 4OREX 1LVUA 3WYGA 2C2OA 3KQKA 1F7YA 1H93A 1RAEA 1V8BA 2O2XA 3CX5F 2OPBA 5F2OA 3ONWA 4MAMA 1KEEA 3IE1A 1S8NA 5FTKA 3UEOA 4HMOA 1SM4A 1IPFA 3ABMC 2P4KA 1Y3CE 2AG1A 3DA8A 4PYRA 1EK1A 2IUYA 4HWSA 4RA9B 2YUTA 5FWXB 3B1VA 4GCZA 1UZNA 1SXGA 3MUEA 4UDOA 1DDOA 4L4UA 1KEPA 4LF5B 3QOWA 4RHTA 4KI0A 1NTRA 3MS2A 3U3DA 5I47A 1TA9A 3IT1A 3FKSG 4MJLA 4HVTA 5I7EA 5JLJA 2PVSA 2C5HA 3EYAA 4MZDA 2JAHA 1VDMA 3EVKA 5GONA 1M6YA 1RWKA 1T8UA 4H4DA 4QEZA 4P1ZA 3FIUA 5BNFA 4MUHA 4XUCA 3RWBA 4F0JA 2X4LA 1RXCA 4XWWA 1NLYA 5DOZA 4LIPD 4DWWA 4Q3OA 5AW5A 1AK2A 5JZSA 4TMXA 3PNYA 3FDZA 3WMGA 5CDFA 5CN0A 1O95A 2NZWA 4HH4A 2HA4A 3K2IA 1X7WA 3K1ZA 4K8RB 4CLEA 3NV9A 1QU9A 1V41E 2GZ2A 1NXOA 2XUFA 3IUSA 2PN1A 3MTAA 2EZPA 3B1ZA 3MS7A 4GZ3A 4RX1A 1GL9B 5G0VA 3SOPA 5HXAA 5IAAA 1I3NA 1Z18A 3LKBA 3VYWA 5LMUB 1LJ8A 2H7XA 5C7OO 2IJHA 3TE7A 2RH8A 1KB9F 4X3LA 1FFWA 4PYKA 1U1EA 2FZWA 3AHCA 1M2FA 2Z0AA 4EGSA 4P7FA 1JG4A 1O2DA 2O2DA 4QARA 4R3UC 4LXGA 2GJ8A 1IEVA 4M22A 5DIZA 3UJNA 1YR9A 2AEJA 1GADO 2G1AA 1Y5MA 4G0QA 4DF3A 3SPIA 1JE0A 3JRXA 3JPYA 4GH5A 4NZZA 5CVTA 3QKRA 4JODA 1QRDA 1KKLA 2V9CA 4XD7A 1YU6A 2H2FA 5JC1A 4EPTA 1MSWD 3CYPB 2BMAA 3O5AA 4Y6QA 5EMHA 1KI6B 3REGA 4BO1A 2RHLA 4ABMA 2JARA 3FYHA 4RETA 3BJMA 4KLRA 4PHGA 3R0XA 1Z2AA 2IE0A 3HWX1 1UXJA 4PA6A 1R8QA 1PR9A 3HUDA 1MQ9A 5DKFA 2VYCA 5KJCA 4FJ2A 4LJAA 1ZH2A 3DAOA 1CY6A 3L84A 4N03A 4D0NA 3U3JA 4HGOA 3ES9A 1TU0A 3E3NA 3QE3A 4N0MA 4NAUA 1E3WA 2X22A 1SG0A 1FFXB 4FLUA 3LYBA 2VHUA 5BV2P 2VLIA 2XCSB 3GHZA 2QV0A 2I34A 1U65A 4PWZA 3TNYA 4AKIA 4V39A 4MVJH 4JCOA 1NW5A 1W5SA 1Z6XA 4LJLA 4LV8B 4OI1A 4P5PA 2ZR2A 2HHHO 1OCEA 3L8ZA 4YBRA 3V2GA 3QMVA 2M6SA 3W79A 4G5GA 2MWMA 2KS6A 2EWCA 2H1CA 4YAGA 2HMSA 2Q5FA 5KVCA 5FUMA 5BN4B 1L5MA 1SERA 3CURA 4QGGA 5EY5B 4DV2B 1T3GA 4BIUA 3K5OA 5B66Z 1PW7A 1CEXA 1WEKA 2NV0A 2XMZA 1TMGE 2BW0A 2OKGA 4FHDA 4XSVA 5KOHB 1PR6A 3RUFA 5E6RB 3PRKE 2O1EA 3ZE9A 4CKBB 5ERXA 4OP1A 1N9GA 1JB1A 2G67A 1J9GA 2OCBA 4DG5A 4TVBA 1GV1A 4PN7A 4DSUA 2ZJFA 1RPNA 4O2BA 1GNPA 3KV3O 4FOLA 1IVYA 2WP8J 4GQIA 4AI6A 4HUQB 4U7TB 4F56A 3NH9A 2B20A 5EK0A 4LBWA 2PH5A 1T1RA 4BNYA 1UM9B 3EVAA 3OZ7A 5G3YA 5KJ6A 5KHIA 1UBGA 4C29A 4CFSA 1Q1AA 4ODIA 2RGGA 5TT0A 1FXKA 3EZ7A 5ALFA 1B6GA 1U04A 1WVGA 4PW0A 5H81A 4AS3A 4Q3KA 2PLFA 3IP3A 4IEIA 4LDNA 5FTMA 4Q16A 4Z2WA 3GOQA 3IHKA 5CT6A 3W1EA 1JQDA 5AHOA 1YB5A 2WA1A 2YS8A 4JJ4A 2GS9A 4RIFA 1F1JA 1NVFA 5D3KA 5K8LA 3MCQA 3KBOA 3SWWA 4FGJA 2PGGA 4AF8A 3ODPA 4BQNA 4MVRA 1Z5WA 1Y7IA 3VC1A 1Z4OA 3AVPA 2EV9A 4IX1A 1KZ4A 3K05A 1AI7A 3ZQJA 5CA3A 1W96A 4CS4A 2WOJA 3DAFA 3GYGA 3LYLA 5TT1A 4FNGA 4ARVA 2G6BA 5F1KA 1KRXA 3QVLA 3VOSA 1VRCA 3SBDA 3CZMA 1K4KA 4LSWA 3QNUA 3I01M 5BSGA 1LVGA 2PRSA 2WTXA 3JYLA 3O6VA 5AJWA 1NVEA 1KOFA 3VA7A 5HDQA 1I0HA 2VG8A 3ZZTA 4AYTA 4JAAA 4IEEA 4DMMA 2VJBA 2A9FA 4WNIA 2O5EA 1OH8A 4QNMA 3T52A 4DARA 2Z5VA 3M3HA 1G6HA 4LA4A 2ONZA 3K1JA 3L6EA 1D5NA 5AVMA 1JI3A 2HQSA 2XCQA 4URFA 2PWYA 1VQ7F 1WJGA 1H3FA 3OPMA 3AUYA 3CCJF 1A8IA 2GLTA 3QFTA 5DX1A 4Y9UA 1THZA 5T6BA 3SAJA 5HRAA 3C6BA 1RXUA 4IJKA 5BQ5A 2B3DA 4YB8A 1RLUA 2EGGA 3RFVA 3TLYA 1JQ0A 2CBXA 4F9FA 5KWSA 1PWYE 1TO6A 4DUYB 1YACA 2UVPB 3HO6A 4AJPA 4TLEA 1EFRD 5T4BA 4XLLA 3B5EA 3URMA 3DMGA 1TA8A 3ABMB 2KTVA 1F3OA 1UK6A 4HBZA 2XTNA 3OD1A 5CVEA 3RIHA 4DG8A 5GADl 3DFZA 3RUDA 1G8JA 1NBWB 3T7KA 2DC1A 2ZPAA 3IR7A 4C3UA 3AM1A 4KHPB 4BJ5A 3TD6A 5KLVH 2VQFO 1Q3TA 3KKZA 2Z5GA 4F2PA 5C53B 3FG9A 3D8RA 4NABA 4X24A 4WW0A 4P6VF 3GDWA 4R5HA 4RLFA 3DOCA 3STVA 3T35A 3G5LA 5HZKA 1W55A 2H48A 4CEIA 2PT9A 4FMBB 5J43A 1PE0A 2QWNB 1W44A 3OPYA 2C8VA 2WWXA 2H1FA 2V1DA 1PI3A 4MO9A 1TEZA 1MB9A 1O5TA 4QTXA 4Z3DA 2Y6UA 1QF9A 2EKDA 3QLUC 3UMSA 4MUYA 3VCZA 4BUCA 3ZD6A 4K86A 3M4XA 4N41A 2W2LA 4KSCA 1KZGB 3W77A 4B4OA 1RQ7A 3CGGA 1XZDA 4TSKA 4NEGA 4ENTA 5AUNB 2LFSA 4JDUA 4DCPA 5FH9A 3VKVA 1E2HA 2ZIXA 2X23A 3U0OA 3WISA 5KYKA 1ZMBA 3E8SA 3KCNA 1NT2B 4RTNA 2ID8A 3INRA 2ATCA 2Q5LA 4MKIA 4RD2A 5LQRA 2HLDA 3LUFA 3UAXA 1G2QA 1K6IA 1IDSA 1T9GR 2D5BA 3PNVA 2ZR3A 4OB8A 4PR3A 3UA4A 2YQZA 5IYZF 3Q8MA 2PQMA 3K96A 2JBAA 4INAA 3THWB 1NV8A 1GT6A 3LQKA 1BSMA 3QVKA 4FYXA 4I5IA 4Q18A 2O2JA 3GFTA 1JKJB 3MTJA 4QOFA 1FFXA 1JJ7A 4JP2A 3H1BA 3D4BA 3PR2B 3T9EA 3WKBA 1WU8A 1I6WA 4UCFA 4IIUA 4A91A 1QZUA 4CIVA 4D5EA 1YB7A 4BEVA 1T1EA 2J46A 3WJ1A 3L40A 1JP7A 1C3JA 1NQUA 4FM9A 1FU4A 2J3DA 3G9TA 3EIOA 4BTEA 4B7AA 2GLZA 4FFMA 1KC8H 1Z36A 4S35A 1Y66A 4B74A 1FFEA 3RRZA 2YXYA 1QNFA 2B2NA 1N4DA 2ZLBA 3BMCB 3I4CA 3JWEA 3PGKA 1U63A 4EI9A 3EXEB 1JEJA 2Y68A 3ANXA 1U4NA 4RMJA 2PZMA 2ZZMA 5IM4A 3T12A 1RU3A 1NE2A 1G16A 3IHTA 1ZC3A 2W7TA 5E6RA 4CKBA 5K6AC 2OCLA 1UI9A 2HIGA 2BJWA 2ZKIA 5C8VA 2BHSA 4LYGA 1BMFA 1W30A 3BHNA 1DQSA 4BLRA 1B0UA 2CSLA 3B2EA 1F2VA 1S8OA 1S9HA 3SJBA 4DM3A 5GTDA 2FPSA 5J47A 2R48A 3QEMB 3VKHA 1JIUA 4QIHA 4WL0A 4BP8A 3LDDA 1E7KA 1PF7E 2H08A 2YXDA 4ICGA 4NIMA 1S72V 2QRUA 1RMYA 4NWIA 4DUZO 4ZJZA 4LHSA 3PA8A 3PQ2A 4MIKA 1R4NA 4WXPA 3V2IA 1BDHA 3GARA 3ZNPA 3GA7A 3RVNA 4NJEA 4D5GA 3VPFA 2KG7B 1V5FA 1XWWA 2BFOA 4GPTA 4AZ0B 2BBSA 2UKDA 3M34A 2QX8A 1N2JA 5DULA 1VJDA 3ASVA 3GP3A 3FN4A 4S1TA 1KQOA 2EZUA 2QYHA 5AWFC 2QVYX 4JP8A 4AY2A 2FJPA 1KDRA 2CDYA 1YA6A 4J1SA 4ND1A 4OKIA 1N36B 5I9BA 3C1OA 1YIJF 3BE6A 2F95B 1YL5A 3BTSA 1GTMA 1EI9A 3EX7C 3H5TA 4AJJA 2HRRA 5JAZA 4B6GA 4CFZA 3VZRA 5IU6A 2ZJZA 2RGNA 3EA5A 1C7JA 1GT91 4FNMA 1PAUA 3VHQA 4BFSA 4F46A 3Q8WA 1IQRA 5KVVA 2BGKA 5JYCA 2FMKA 2VDPB 5IVKA 4JGSA 1UKZA 1JHZA 4G28B 5C5IA 4RY0A 4B2IA 1DTWB 3VNRA 3EMDA 5FA6A 2P4UA 3QNEA 2AG6A 4AUNA 2CW5A 1BHO1 3O2QB 5CM2Z 4H4EA 1Y4UA 2K7FA 3MELA 1TEHA 4PC3A 4TKLA 4NNPA 2I99A 2IYLD 4GL4A 5K0FA 1T6YA 2WHXA 1Y3IA 1ZR4A 3TD3A 1C0EA 5ALEA 5CHEA 4Y6RA 3ROTA 3C3EA 2LGWA 4E07A 1GZ7A 3GUHA 5FOWA 2RH5A 1GMGA 1DBQA 4DQ0A 5AVZA 3HYTA 1TT5A 4CN8A 1LDYA 2BV3A 5TV2A 4UFNA 5ESRA 4OATA 1I5EA 1NX6A 1ZBQA 3ML1A 4UXIA 4CR8A 4X3CA 3W4KA 4N49A 1U7OA 4EGAA 1S1CA 3EVTA 3PQ4A 2O14A 3FR8A 1R16A 3KQVA 3HABA 3LDAA 4IPTA 3ZCSA 2GZDA 1E64A 2B1JA 3G5UA 2D2FA 3E0QA 1JHPA 3FCSB 3R7DA 3ZS8A 1OILA 2QTVB 1PFUA 2I5PO 1QH0A 3H4VA 4URYR 4D0SA 3FFAA 3WK5A 3FVRA 2VDJA 2RCNA 2EJ7A 3RJZA 3AKZA 3LVBA 4Q4AA 4DCJA 1IULA 1Z2DA 4JI4O 3BTVA 3EZLA 1EWQA 3STYA 3AG6A 2C97A 2DZDA 1YHNA 3W05A 2F48A 4AY5A 5JJCA 1ZIYA 2XYVA 1NW9B 2B8JA 1E3IA 1OWMA 4GLJA 5JCPA 3R24A 5IJ0A 2JKZA 5KNBH 1N0WA 1X7OA 4JUCA 1W0KG 1K4MA 1N2CE 3JATA 3IOYA 3RWOA 4LF6B 3K3PA 4X64O 2B4TO 3LSTA 2FPGB 5DB4A 3N39C 4HV4A 2AZ0A 4PQGA 3TCXB 3BRSA 1C0PA 2BBOA 4WERA 5CK4A 3D5QA 3UMMA 9MHTA 1FDVA 4TV9A 2DHDA 3RFRA 1PL0A 1OYYA 1T6ZA 2H07A 2PXAA 1DIBA 1Q6IA 3C6ZA 3EODA 3OZAA 1ZH0A 3LFTA 3RS4A 1CE8A 3ZXSA 4RGQA 1E2MA 3MDOA 5D87A 2EZOA 1PQUA 2CLHB 4CLOB 5EAZA 3OSZA 2D1FA 4BT2A 4L75A 1Q7TA 2HNKA 1R9NA 3EIFA 3V6MA 4ZAZA 2F3SA 3KEQA 5FV7A 4FLXA 1PP9H 4QJBA 1GM9A 4WASA 1XK6A 4MQ6A 3SVZA 3JZIA 1K3FA 3RRMA 4K0KB 3HP7A 5FX2A 2XUMA 1BW9A 2NUPB 3GX1A 2NYRA 3KLBA 4HAOA 4J6EA 4FFSA 5I7SA 2Q7GA 3E03A 5ULLA 1RZRD 1L7MA 1LNSA 1LVHA 3KCYA 1M7GA 4X3PA 4BU0A 1HFEL 3OPNA 1JIKA 2PLNA 3H3FA 4MI6A 1E3MA 2L35A 1CY0A 1QVVA 3I1IA 3GFSA 3JSAA 2HRYA 3ETEA 5HGXA 4KR9A 2BD0A 3IVRA 5IAOA 3FHCB 2CGNA 2Q5ZA 4IIVA 5DBFA 4G1EB 5FPTA 3D2BA 3PUWA 1QGZA 5ARBA 1K6EA 2OOKA 3KK0A 4PV1B 4KBYA 4UZFA 3W5HA 4XOIA 2X0FA 4A36A 2LE0A 2WFLA 2IH5A 3QUBA 5FCDA 2VSXA 1D4ZA 1KI4A 1WRBA 3GVHA 5DXJA 3TDNA 3TNJA 1Z6YA 1W47A 4CF3A 1L7EA 3JQFC 4P08A 4EG7A 1TIBA 3C8LA 2IPLA 3IESA 5FOSA 4BLVA 5HUJA 3BF8A 5FJJA 3OAAG 2AFIA 2Q1XA 2CUTA 3L1HA 4AZ0A 1OH5A 1VRVA 2WJ4A 2QK4A 2WTBA 3I5UA 3QUSA 2O0MA 4AMBA 4RDHA 1Z5NA 4YQEA 3NK7A 2B4KA 1DP4A 1JHOA 3FFTA 4X7RA 4BT4A 2ZYUX 3HB4X 2KI5A 1O6CA 3ZXYA 5DLDA 4DXHA 2E18A 1DT3A 1TVKB 1A77A 2ERCA 2ZIWB 4FPXA 4RJJA 3K5NA 1N6LA 4Y7DA 1ABEA 3PFNA 4ZV9A 1DWPA 1CY1A 1FYVA 1XZ8A 1Z7BA 1LJUA 2E7ZA 2QSYA 1YZHA 2QN3A 2BSKB 4GKKO 3B5IA 1FRNA 3ND7A 3O90A 3P9YA 3Q11A 2VHXA 1I8TA 1OSNA 3ESZA 3DHYA 2H2GA 4H3HB 5F7JA 4BFLA 1G4HA 2Z43A 4ZZIA 4YUAA 4Y0VA 1YJWF 3KT0A 3D1LA 4Q3DA 5TDHA 4BWFB 2PBFA 3VQXA 4KYVA 3H0CA 1F5SA 2BSAA 4E22A 4BT3A 1H6DA 2HEPA 1XU9A 4G4ZA 2P0EA 2QE6A 2QYSA 4KXXA 5ALGA 3NVKE 2X14A 1W0KA 5HF5A 3LO8A 2AXQA 5JU6A 1U0FA 1UMCB 4ATNA 4LS3A 5EFZA 1OXBB 1QYWA 4CZ2A 1HYHA 3IV6A 5LGNA 2QYTA 4JMLA 1H0KA 3BTUA 1XDCA 2GBCA 3A4VA 4IIJF 5E95A 1JJAA 1L5QA 1Z4MA 1N3LA 3N6XA 2AJBA 4EY3A 5KUKA 4WGGA 1U6IA 4PZPA 4Y6PA 2NU7A 4WKOA 4RTJA 1IHUA 2VJMA 4RD6A 4FMPA 5B30A 1TA4A 3TDMA 4OXIA 3GO4A 4M6WB 5D5PA 2JEXA 3LVFO 4WLVA 1H5QA 3WLFA 1HMPA 3DLBA 1NP6A 3OX4A 2YHAA 4QJ3A 3OJCA 2H1LA 2OM2A 4X93A 4JXXA 2YW2A 1HNZB 2C9DA 3MIIA 2JGRA 3CX4A 2QUZA 4RNCA 5IG2A 1TL7C 5H4GA 3F67A 3RABA 1FXSA 3BB4A 1XQ6A 5DSXA 2QUBA 1ODEA 1QQCA 3CSSA 3L6CA 3CKLA 1YZNA 3BRWD 4CUKA 2QG9A 4BKRA 2JVKA 4YJHB 4S12A 4YCNA 2PMCA 4LYEA 1C14A 3QU2A 4A6PA 2QXUA 2JI8A 1S2NA 1DKUA 3DMYA 1LX7A 4OQNA 4QFCA 1IZZA 4XM2A 7ADHA 2YOHA 5ICGA 2HNBA 4HVLA 4NS1A 2NVUB 4OJQA 4XUEA 3RA6A 3QBTA 1UKBA 2XVXA 3ABOB 1T9BA 1EIZA 1D2MA 4LZWA 5AKLA 4PQRA 4M0LA 4FYYA 1ESEA 3ZJ4A 4W5QA 1N1GA 2XHZA 1SD5A 2EGUA 5C8YB 4YJ3A 2B6HA 1EGQA 1YOVB 2TECE 3M5WA 4K81B 4EYQA 1UJCA 2XYGA 4ZVUA 2GBIA 5FF9A 4P58A 2VTEA 2R1VB 1NYLA 3N75A 1U7PA 3PITA 5CT9A 1M75A 2X1VA 1LLCA 2VKQA 5FB3A 1ZHFA 4MO2A 4WOCA 2AJ8A 3EDQA 3A6GA 3MS4A 4MWSA 1M5IA 1EB9A 4G26A 3EH1A 4UBNA 5L3BA 1T5DX 4ZOLA 3R75A 5B4TA 1XQVA 5TNXA 3IOMA 3AM3A 2H65A 1JRLA 1O6BA 1ZRNA 3F6SA 4DMKA 2J3KA 3DDSA 1KAOA 5FHQA 3WRXC 4A03A 3LRTA 1K7XB 1E99A 5H68A 5AW7A 2OGWA 1GSAA 4KQXA 2UZ0A 2XAAA 1DPFA 1J2YA 2X40A 4K6KA 4GEKA 4KFMA 3FBTA 1RWMA 3RAEC 4J90A 1GDDA 4LTNA 5TR9A 4EI2A 3QFCA 3FNBA 1ULSA 2Y1FA 5EIWA 2LCAA 1YMVA 4ZVVA 2FWPA 2IL1A 1XI1A 4K2AA 1T9DA 3VH3A 5B7NA 3LC1O 1Y4ZA 2WM9B 3RVBA 1QU3A 3A4TA 2UUOA 2ZUUA 3CBGA 4IDHA 1RBYA 1AN0A 3V7NA 1Q6UA 3G71V 1P39A 1ZVQA 4DDVA 1ZWKA 3EGWA 2VFAA 2BMEA 3L05A 4GPZA 3CCSV 1LPBB 1GRVA 4NQZA 5G4KA 1H5NA 3C14C 1XYVA 3KX2A 1HYBA 2XRFA 2V7EA 4HN4B 1JN1A 1GRQA 1ZMTA 1X2BA 3GEIA 2W2LD 3NJ8A 2PKWA 3ROFA 3F3KA 3JTMA 5IHPA 1L4KA 2R8OA 3ASYA 3KJHA 5LDHA 5HZHA 1UXHA 4ZIBA 2HTFA 1KO8A 1SKYE 3FAVA 3UT5B 2GA9A 3KJIA 4NLLA 2QM8A 3O26A 3W5DA 1Q7GA 4G5RA 3BE5A 3Q87B 1FTQA 4N3BA 3T7RA 1O0SA 1RPRA 1QLHA 4IP0A 4QUEA 4FYVA 4YAJA 4S24A 4GOMD 4AG5A 5BV1A 5FPOA 2IDKA 2Z2JA 4PG5A 5BWNA 2JD2A 1BMFG 1Y48E 2L18A 4TXMA 2GXQA 2WJYA 3INYA 5LA6A 4FQ7A 2DYRB 3MBOA 4RY2A 5L4SA 3THXA 1NRWA 4O6VA 4B3CA 1FL9A 4LVNA 1CUBA 2ZYTX 1T5IA 3LUJA 4XR9A 3NOQA 3W3AA 4Z7NB 4DPMA 4NENA 3CFYA 3GZ4A 4HK4A 3GGCA 2QQFA 1BO6A 5IAGA 3N2EA 2N42A 3WV4A 4W1RA 1WVIA 1X3LA 2FTKE 2V6MA 4V0RA 4E32A 2Q7EA 2BHLA 3PFBA 1JA8A 2QUKA 4C8IA 4QRDA 1PT8A 5CNMA 2FGJA 3SS9X 5JI2E 5HY4A 3DTVA 1GTG1 1R8XA 2BVNA 2VTVA 3G0DA 1ODLA 3BFJA 3PUZA 4AQYO 4OGGA 4RLSA 3SF8A 2PCLA 2TRSB 1CQWA 1XGKA 2PL1A 3HCPA 3D6MA 4B34A 2VCYA 5GJBA 2W93A 2CZQA 3QUAA 3RVLA 2GN4A 1WBJB 1DG1G 3DL0A 4DHWA 4F06A 1ZM2A 1EX1A 1C1XB 1I6KA 1WVMA 4LCUC 4JYAB 3GVPA 2IHVA 3M9XA 4BN0A 3Q98A 3EHDA 2YI9A 3C3XA 3HXLA 1QGAA 5LBTA 1DUIA 1P77A 1Q83A 3F0TA 5HGJA 2YJ6A 16PKA 1GZ5A 4BLWA 3NEJA 4AMVA 2BO1A 1JBQA 2ZTSA 5HCUA 3TK1A 1DJLA 4ZAXA 3NRCA 4WK6A 2XNJA 4ZBMA 1RM3A 2JH9A 1IPHA 2EG9A 2ZI7A 5FNVB 2QBYA 2CLOB 2WE8A 4TTVA 5KQSA 1NKSA 1H65A 3OOWA 4DR3B 1WKBA 5J3JA 2RD2A 1RXYA 1RNLA 4NYMR 3BERA 5FOUA 4MEAA 4RVDA 5GP1A 2AOXA 5KTRA 2BMWA 1BFKA 4RXTA 4YRSA 2Z9DA 1M34B 4NMLA 1R0WA 3T3PB 1CQIA 9GPBA 3QPUA 1M33A 4BVHA 4FDLA 1DRVA 4NTYA 1ODFA 2RHHA 2WMOB 3B82A 1S5JA 4GKJB 1ZK4A 1D7AA 4KIJA 1JLHA 5DSZA 3UWMA 2NVUA 3VO2A 2FGKA 1XEXA 3PLNA 2W6JD 1LSOA 2FUCA 1Q77A 3AEIA 1OBOA 2HOQA 3GPIA 3LQ1A 3GJ6A 4JLPA 4MB6A 4UW9A 1AQ6A 1QWOA 4BYGA 2IZZA 2XUKA 3ZDDA 3H9VA 1GO3F 5F12A 3BCRA 3TOZA 4K88A 1ZIOA 3JQGB 3DVRX 2PH7A 3O31A 2PRIA 3NHRA 2QEXF 4YQZA 2OP0A 3CD6V 4DLYA 3MJTA 4BIZA 4K9OA 3OX2A 3JQ7B 4XWAA 3UIEA 4B2LA 2DXIA 5GY7A 3ZD9A 3IDZA 5BSWA 4MUMA 1T9AA 4Z4QA 2R8XA 4TS3A 1F2TB 2XA2A 1GZVA 3TO5A 3ZLBA 3E35A 1L1RA 1QSGA 1YB6A 2DCUA 1XL4A 3G8CA 5I3CA 4TYWA 1QYCA 1Z8NA 2Z04A 4PFQA 3I1YA 2V9ZA 1J0EA 1HE8B 1P7PA 2JIDA 1JHRA 3RIYA 5ER6A 2REQB 2B92A 1WP9A 2PS1A 1H22A 3PYMA 2VJPA 1F5NA 5ESDA 4EY6A 1T2FA 2O1SA 2PUEA 1VYVA 1F06A 4FIPC 1ZI6A 2H5LA 1XKTA 1GIAA 2FOXA 4ZCSA 1ANKA 3EW7A 4JUIA 1YVEI 5DU2A 4E5YA 3WRYA 4PCVA 1TD1A 5DJ5A 4JV5O 4UBIA 3G2OA 2EP5A 3LLVA 4INPA 1EVKA 1H0RA 5KJEA 4MVQA 2H31A 1NUTA 5G4KB 2OBNA 1W5TA 5K45A 3L75H 2ABWA 5K7SA 1Q14A 2WSIA 4PZ9A 4JI5O 4Q7QA 5TF4A 2JLZA 1ZZGA 2PZJA 3G2PA 4JJKA 4PAGA 1SF9A 5JDCC 5HIMA 4XQEA 3SHFA 5CURA 5K01A 3U1VA 1SQBH 5E9WA 5BWCA 2CYCA 1IDOA 1EESA 4HZ3A 3UT5A 2FWNA 1VIBA 1OAPA 4UULA 4E11A 2W6MA 4F38A 1XCJA 1QVFU 1SXJB 1UFKA 1XP5A 4I5DA 2HQ1A 1L4BA 4LYFA 1NMYA 5F5NA 4CCWA 5F2VO 2AX3A 2PD4A 4N3AA 4YAWA 5AI0A 4EF5A 2DQSA 3CMAF 2EC5A 2VRNA 4HXEB 2C94A 4EYGA 4C0WA 1FRQA 5J4KA 3ZHUA 3A7DA 5IWAO 2FCAA 3GY0A 3WK4A 5FBZA 1KEWA 1N2EA 1YI8A 5DM70 1KMIY 1ULZA 3N8IA 3SP1A 3KQLA 4E33A 3L41A 3RLFA 2WG2A 1D2NA 5F64A 4W4KA 4OQLA 3EDCA 3KPWA 1DQPA 3KOMA 4KV9A 5J2UB 3I3FA 3DWFA 1WPXA 1OXVA 4NZNA 4WUTA 1Q20A 1FVHA 4RKFA 1WB6A 1ZITA 3IE0A 2DYSC 4F1KA 1FUYB 3NB0A 4IDFA 2UUAB 3DS8A 1U9YA 4JV5B 5AOBA 4A8JC 5CG2A 4ZQIA 5J1SB 1Z39A 3KAPA 1FDSA 1GFWA 2ODWA 2EG5A 3D54D 3NIDB 3NXSA 4PVDA 1KQFA 4OLFA 1UFRA 2Q68A 4IHJB 1U3VA 2I62A 4GLXA 4OUDA 4EHKA 3ADPA 4JI8B 1EVYA 3UWOA 1E1CB 3SLKA 2WF6A 4YI3A 4YP6A 3N7UA 1CVIA 3HKBA 1ISIA 1V8OA 2GHTA 3QNWA 4QOSA 2X2OA 3DFKA 1O95D 4QPDA 3O21A 1N4CA 1AK1A 2BBTA 4JBNA 2OBLA 5D2CA 1EBBA 3PHLA 3U56A 3PDIB 1QAOA 3T4ZA 3AB8A 3WMWA 1ZUIA 2GZSA 2HA3A 3EVDA 1MOZA 1MX9A 2X4IA 4HADA 4UE2A 1SWWA 1YUMA 2GZRA 5JTTA 4FEGA 2BH2A 4GMFA 1UL1X 1G7CA 1UOOA 2AFHE 2G17A 2X86A 1UP6A 3L0CA 3PNKA 2OCPA 2QLBA 3JQ9C 5GZ6A 1U0BB 3CVOA 2ET6A 5C34B 8LDHA 4HQFA 1W9MA 2AK2A 1RHRA 5H0IA 1G3IA 2LXNA 2P75A 3LQ4A 3EPLA 1RC0A 3CUEF 2JGDB 1J90A 4D8WA 1CQIB 3FZGA 3OLZA 5EZYF 2WG1A 1HG0A 1Y6XA 1YAJA 2G0AA 1EQ2A 4J3FA 3T0GA 2XAJA 3DQPA 4AP6A 3DT9A 1HLFA 3IIIA 5K8TA 1W5FA 3T9DA 4H37A 4LH7A 3EFOB 5HQJA 4L85A 5IUJC 4MRMB 3DOFA 2GK7A 3CC7F 1MT0A 3JYQA 1I4TD 1NQAO 4HS9A 3ZWDA 5GTIZ 1DIOB 5EP4A 1RRGA 5K0CA 3NBXX 3FSEA 4P98A 3FOEC 2FZ4A 3COJA 3OM0A 2QA5A 4E7OA 3D7RA 1GM5A 1S3SA 3V4DA 4TV8B 1W7AA 2XA9A 1RTKA 3EQ8A 2WWVD 1U7XA 2P6OA 2XA1A 4X44A 4NQRA 1OT3A 2AFHB 4H17A 3O47A 1ONBA 2HJ9A 2XB9A 4LRWA 5LU8A 4P0QB 1XXLA 2Z8ZA 3H9UA 1GSOA 4Y18A 3JQ9A 4C8EA 2IU0A 1B3QA 4CF7A 1F2TA 2MR6A 2XUIA 4JLBA 4KE7A 3RE1A 5TGZA 4N5NA 2B83A 2CCKA 3D1JA 3LXRA 1AS3A 1KRHA 3LUBA 4XKJA 1U80A 3FTEA 1MO3A 3RH0A 1WOYA 3LLMA 4JUFA 5IKOA 2ZB3A 4U7NA 3ZBUA 3X2QC 5GW7A 3LBYA 4G8BA 4AICA 3B20A 5DK4A 4BGEA 4EZEA 3FNRA 4YREA 1U2GC 4JI2O 3IGFA 4XIGS 3K1TA 4U7HA 4LBEC 2XT9A 1Q21A 5B5EZ 2EKZA 4MR9B 2J7KA 4R2JA 5IDQA 1I14A 2VT7A 5D3ZA 4R8MA 2O07A 5ENDA 1U8AA 3CW8X 3JAWA 3HGQA 1KDOA 2R79A 3NHUA 2GHIA 3V34A 3V4OA 4XIIA 1X1SA 4E5KA 1DWQA 3WC4A 3WFZA 3DZ8A 3IO5A 4II3A 4M0EA 2HHAA 3P32A 5JECA 4KXFB 3FUVA 2ZYWX 5DTIA 2J6HA 4PNHA 3FYUC 2OAGA 4GXTA 4QBIA 1BEUB 4LGCA 2OAEA 1F3LA 2H1IA 2Q5IA 2WJAA 1EN5A 1YRWA 3P5BA 1UT8A 2ROQA 2VGMA 3NHYA 2GETA 4PBRA 2WFZA 4ETWA 4QGPA 4MJXA 3E81A 3P96A 4EFNA 4C2TA 5F2KA 3PX2A 2FK7A 3QM1A 2YY6A 2A94A 1V37A 3FXAA 1Z83A 5EN4A 2F8MA 5LZ9A 5ADWA 2G5GX 3NDBB 3D8BA 5KHAA 4ARBA 1N6OA 1H2WA 1CJCA 1P9OA 1XAGA 2OORC 2FRDC 2R751 2MSDB 2QROA 1IV3A 2OV1A 4NFYA 2CHGA 3QMMA 3WJQA 2BUCA 1ULHA 3DNFA 2A84A 1SHUX 3DKIA 2HVJC 3HHPA 4KOAA 4B6RA 1IZ8A 1XYGA 4PA3A 2ASEA 3M6IA 1VF5B 1KY5A 1LZKA 1VMIA 5KQMA 2VAXA 4M36A 3GLFA 3UMYA 2YWGA 5DM6V 3AMVA 3Q3CA 4WFQA 2FQYA 3E8HA 4EQ6B 4CTJA 1U7ZA 3GP8A 1T1GA 1WG8A 4KH0A 1TVMA 4ZHQA 3SDBA 3SSMA 1AQNA 1BU8A 1NM5A 4PO3X 3I45A 1MP0A 4DLWA 1BDIA 3G0HA 3VMFB 1E9VA 2VR1A 5TPWA 3HBMA 5J2TB 3LP5A 3S5UA 4H16A 2B9ZA 1BROA 1X8JA 2O2HA 3F7NA 1AIPA 3N9IA 4A3SA 2QOEA 3NJRA 1A27A 1MB2A 1I7NA 3RVPA 1TPYA 4OQZA 1FFCA 5DYNA 3LYAA 3HKBB 4RZIA 4AIIA 1I2ZA 3CJTA 2JK0A 4HGZA 4F4HA 1XMXA 3NTOA 2BFBA 4G23A 5FL7G 1G1XB 4BECA 4GX5A 3E7PA 3CVWA 3WGJA 1F8GA 1OJLA 3PDIA 2X7XA 3PT9A 4QX6A 1QLWA 4G9BA 4UM8B 2ZIGA 1X9IA 2RGNC 3AF3A 2VVTA 4ASUG 2NIPA 1ZL8B 4X1YB 3E5RA 4B8YA 4WESA 1YIAA 3BILA 3GVIA 2Q69A 3I23A 2Z2ZA 3NHLA 1IE3A 3LAWA 2NNLD 4IGEA 1CP9A 2UXBO 1QIDA 4LHYA 4TWZA 3T95A 5JJBA 2FZ5A 4U39A 1M6WA 2YKGA 1DNPA 3SCZA 3W90A 1H9BA 2D54A 4P3OA 1KDPA 4QA9A 3KIZA 1QTRA 4RGBA 3S28A 5KYUB 4TTQA 3BYZA 1O6FA 1P6XA 1NRJB 3SNHA 4H2DA 4W5NA 3WGHA 3V8EA 5J9PC 3KQYA 1QBKC 2E87A 3LYHA 2WAYA 4GICA 3HGTA 2WMNB 1NW7A 4I5EA 2XDYA 2ZRMA 3PB3A 2E37A 1AVTA 1ACMA 3ZMTA 3GNQA 4FDTA 3FSGD 4QOHA 4D9GA 4JI3O 2FSGA 1E6LA 5GIPC 1Q1BA 1P4GA 1VE3A 1ZMOA 4JI4B 3ZH9B 1KRWA 3DEHA 3ADOA 2C54A 3JQQA 1IN4A 1S5HC 3TJMA 5EIOA 5DWQA 2AYXA 3D0OA 1SCUA 3OEYA 5DMXA 5C9ZA 5AHWA 2O06A 3U6BA 4J0JA 5AR1A 3FWNA 1ZRSA 1KJWA 2HK7A 2P4SA 3HRIA 3NBMA 3H42B 1TCUA 1KEUA 4YMWA 3ZOZA 3MCAA 1J1UA 1JDZA 1E77A 1PGPA 1OIVA 2RKWA 3SZOA 5A5GA 5KHOC 4J8PA 2UXCO 4FFBA 3C9SA 1KEVA 2JH3A 4N23A 2Q6IA 3CE2A 3IQZA 4ZMBA 4FJ0A 2IQIA 5JS8A 2QSAA 2GA8A 3JQPA 4ZQEA 2G9VA 4Z4EA 2B4AA 3HLYA 4D7AA 4L5JA 2D0PB 2RB9A 2M6YA 3F6BX 1PS0A 2IDMA 3NGMA 1GQRA 1U9IA 5FPQA 2ORYA 5ALQA 5AESA 4UJ5A 3KKLA 4K6CA 3GJQA 3M83A 3QHQA 2OB2A 4D4MA 1F4MA 1E2IA 4RMGA 2VH1A 5AW4A 3D8SA 1OLSB 1YUNA 2WQ6A 2WUFA 3C4QA 3SIPA 1IBLB 5FPRA 2FG7C 2JLRA 3LA6A 3ONEA 2XPCA 1Y8QB 4BX9A 4JK3A 1GCIA 3TX6A 1JN0A 3C6XA 2PY5A 3KV1A 3R7SA 3TUIC 3VUEA 2DWPA 4B2YA 3KB6A 1GNRA 1D4FA 4QFDA 5H5JA 1DIHA 1W0JD 4JR0A 4YJGB 1HZZA 4ARAA 3ZW9A 2I4RA 4DEVA 4E09A 5LNK6 3GGPA 2Q2WA 5HOEA 3QE9Y 3R9XB 4OUKX 5BMOA 3IBGA 3KIPA 4DWJA 1E4YA 1HDEA 1Y63A 1BS2A 2XGJA 1II8B 1NVUQ 2PI5A 1Y1SA 2JAUA 4RD1A 4U9UA 5AI5A 4Z6KA 3M6LA 2GKGA 4CLHA 5LXTB 3ZIUA 1ZL0A 4OXSA 3DFUA 5EB0A 3NONA 1X7PA 5E4TA 4D4KA 1NMUB 1KZ6A 3UUFA 4WHMA 4E7PA 5CLJA 3DGEC 4KJXA 5IXSA 3EMVA 4C22A 1OFIA 4TMKA 3PFWO 4IXWA 4CT4B 1WETA 4FXOA 4IX9A 4A0HA 4UPDA 5ALVA 5B5SA 3LHKA 1HDXA 1KORA 3MJ4A 4EHHA 1JR2A 3TQFA 1NMZA 1RI1A 5L9AA 3D0QA 4OHZA 1G17A 4C4OA 4E1AA 3RADC 3U6KA 1H69A 4QG7A 1U81A 4YP0A 1Q0UA 4E12A 5EJ2A 1YDGA 1DQYA 3P9IA 4F2WA 4AILC 1SVSA 1GG5A 1NW4A 1SBQA 3OQ6A 4JGIA 3VNQA 3EBOA 4UUMA 2JKVA 4QAJA 2JAQA 2P4VA 3VNAA 3VPBA 3IAFA 1T0AA 4B48A 3BF7A 4FSHA 2EWMA 3UB3A 4P92A 2PUDA 2FKXA 4TWAA 4WXEA 1E0SA 5JS6A 1U02A 2JI6A 3OZVA 4HDMB 4UAGA 5TPWB 1KP3A 4DV7B 1DUSA 2VH5R 4LH6A 3MINB 1WD7A 2O6HA 4AXXA 3SKYA 3DSRA 4Q6WA 5KYVA 1QF6A 5FUVA 1R0SA 3BS4A 4D9HA 2XXAA 4I9WA 4K3AA 3GUZA 4X8HA 3GYQA 1V25A 1RKQA 1Q2UA 3G85A 1J00A 3QH4A 2FETA 4O2AB 1L7BA 2Q50A 4Q9LA 4C0AC 5A1TA 3VNUA 4LHZA 3ONDA 1WP8A 3MWJA 3W6NA 1YJ8A 3ZE0B 2JDID 4P81A 4A82A 1U2DC 5MFPA 1SY7A 3L8YA 4FCVA 4CIXA 1QLNA 4L57A 5K1ZA 3CLRD 4AMZA 4BNNA 5C3MA 2OG2A 2ZIVB 3HEAA 2NN4A 3PC2A 4QDUA 3M8KA 4RH3A 4KK4A 2V98A 3OE7G 2WMYA 1BWRA 2L42A 3A31A 1V95A 1JTFA 3RS0A 5H8WA 4O4LA 4FGLA 2HNAA 1I3KA 5FI0B 1Q44A 4D7SA 5KYUA 1DZ3A 1IHOA 4DHEA 2P5SA 3LP8A 2H3EA 3BIJA 1KC1A 1QYVA 2QVCA 2XB4A 4G01B 1KVTA 4QUHA 4J9UE 4XJVA 3UHPA 5JQWA 2CY0A 1J2RA 3RVZA 4Q21A 1ZIDA 4RKYA 1T8WA 5IDJA 2GUGA 4FD3A 4L4RA 5FWYA 1NBIA 4AKSA 4QQRA 4FHFA 4CGYA 4Z4IA 3U1BA 2FCRA 2ARKA 2HFKA 3IL2A 4MV3A 4PX3A 1Z34A 3F5SA 4C0BA 3D64A 1Q8IA 2EJRA 1TCVA 2P65A 2ZD9A 3SN6A 3F5TA 3TN7A 1BXGB 4UVBA 4C7UA 2PGNA 3OIWA 1M8KA 3KALA 3PWTA 4K28A 1LDGA 4GVPA 3D6AA 1DQNA 2MMCA 3ELDA 4J94A 4UTPA 1IBMO 1LW6E 2C5LA 3WIEA 3AF1A 1UP4A 2WC1A 1G60A 1L4MA 4JA0A 4PE5B 5AK3A 2Q3BA 2MTBA 3Q8XB 2HCTA 3MB5A 3R20A 3ZWOA 3MCAB 4LX8A 4NE2A 5KHGA 4KFRA 4RMIA 5JNLA 3JSLA 3DMHA 3IB6A 5AVRA 5E79Z 3HE3A 3ZDEA 2K6GA 4RELA 3VPDA 2O0LA 4LRUA 3ZIAG 2R1ZA 1NVWQ 1P7VA 1GSIA 1RLMA 2AQHA 2Q3HA 2P68A 3Q6MA 5BYKA 1WSWA 1K2WA 3N76A 3CR8A 3IT0A 3STWA 1XTQA 4OK3A 4QU0A 3JAMN 4UUQA 4WACA 4NR0A 3S3WA 4E5VA 3AC0A 2IHTA 3PE4A 2B98A 1JECA 3MC1A 4JB0A 5HCNA 2DP4E 4TZ0A 1PO7A 2Y1EA 3CC7V 4OJNA 1I94B 5DLYA 5I3ZA 5I7OA 4GKJO 3GMTA 2Y66A 3A6FA 1Z12A 3A9UA 1Z13A 1KIMA 2QIOA 4G4SO 4EEZA 4TKMA 2BGNA 4WN3A 1F12A 3G9XA 3MGBA 4MV0A 4QGFA 4IIFA 4WLFA 3U19A 2HXYA 4AS2A 4CM5A 4EFEA 4HDCA 1H8EG 4C4WC 4PSKA 3VJLA 3F3MA 4QEKA 4ZPXA 2AW5A 1IK6A 1SU6A 3F4LA 3FCUB 3W6OA 4ZYTA 3R9XA 3R7AA 4RL6A 3GVXA 3K6RA 4BRSA 1DOAA 2OFWA 4REQB 1W0CA 2D7JA 4NZOA 1UJMA 2W2PA 3Q1KA 5CVDA 2BFEA 4H0NA 1Y34E 2UYYA 4GKVA 4JC0A 1QHEA 5LDDC 4ES6A 2C7GA 2IHNA 3HHEA 5FR1A 3AWIA 3TSYA 1U5BA 5FORA 1VKHA 1T2UA 2WDPA 4HLDA 3Q4GA 5T4HA 4F3TA 1TJ3A 3VPHA 2IPOA 3DP7A 5SY4A 1Z07A 4D4LA 4UE6A 1GPUA 5JLAA 3R9WA 1ZD1A 2FY8A 2NO9A 2IELA 3CF4A 4JVSB 4QGHA 1YRQA 3W5SA 1SELA 1B00A 4JZYA 4FLWA 4UTZA 3VI3B 4B8ZA 3SXPA 3S0HA 1N3YA 1RXSA 3QY9A 1FXUA 2HSZA 3D54A 2OGUA 1VBKA 4B7XA 1MABB 2QPAA 2Q9LA 3LXUX 3MJVA 2UV8A 5LZ4A 4DW0A 1B16A 2XAHA 5THQA 1UFVA 3OUFA 2ZCUA 5FLEX 2AXEA 4DNXA 1WX1A 2OWDA 2IU3A 1JPVA 1KKUA 3OZWA 4NE9A 4QZVA 1XPUA 3CWCA 2YUAA 1CQPA 2QMUA 1PEAA 1QZZA 1L0NH 2VP6A 4JFAA 2A9PA 1E6MA 1OZAA 4PI0A 1DXQA 2RN9A 3RJTA 3V33A 4KH1A 1BGVA 5EBLC 4RLHA 1CUDA 2VBCA 3ECAA 1GCGA 4MW7A 1EFVB 5BVHB 4J7ZA 1XXHE 4TQAA 2JB9A 3MINA 4JYBA 2IW1A 3BXGA 4WX2B 1TYZA 2UYHA 5K9ZA 3H9EO 1EVQA 2P27A 5CCDA 5DN6G 1ACLA 3QMWA 1SPBS 2XT0A 4EVQA 1DC4A 3MPOA 4UM9B 4XVUA 3CMAV 3NHKA 2F3TA 1MJNA 4LOIA 4MVWA 4TYNA 1FPMA 4NXNO 5LM3A 2JG3A 1YZFA 2IOFA 4GI7A 3WLPA 4B3IA 2FDRA 2NZ2A 2CFCA 3B9QA 4H3VA 4N7MA 2QGNA 4DV1B 1WB5A 1XJQA 2VIIA 3B8EA 3SVLA 4A7PA 4CC6A 3FJ1A 1PV0A 3HB5X 2B8WA 2R25B 3IILA 4N39A 4YRRA 3UN1A 4E51A 2EBOA 1BJTA 1OAOA 1A71A 3WQSB 2X0LA 1ZWZA 2Q8QA 1O0BA 3BM5A 3FTNA 5LZ7A 3TTYA 5CB4F 5LQNA 3B1JA 2ZAYA 3RSLA 1G8YA 1XK7A 2NTJA 3QBJA 4DYHA 5C5DA 4LZPA 2ZJ6A 3T41A 1YS2X 3QKSB 2BTQB 2PUTA 2XQFA 2HXGA 5FD8A 3TXAA 3HNOA 3H1JH 3E7XA 4UAJA 2ZT6A 1KH3A 2E4YA 1S1MA 3ZCCA 5ALNA 2QUHA 3X1WA 1Z33A 3HY3A 3UNXA 4ZYLA 4ABTA 2LZ0A 2ISSD 4C89A 1QOQB 2X5OA 4TQ9A 1KWGA 4I8IA 1K68A 3L8GA 4B71A 4XBFA 2RGBA 3IPLA 4OHRA 1TZMA 4Y9TA 4BE7B 5AP9A 3PCTA 1SCBA 1MJGA 3D01A 4KR0A 3A4LA 1NUPA 3VYUC 1A9XA 3CZ4A 5C7YA 1XJ0A 1XAIA 5LLSA 1V8PA 4TKUA 2A58A 3JR3A 3I09A 1BHBA 1KJNA 2FK8A 1J06A 2BZ0A 1K8ZB 2HJSA 1W2WB 3EGDB 3K06A 1VJTA 2P8SA 4UCXA 3ZS8C 5G40A 5IN4A 5LYJB 3VVBA 1W4CA 1NVVR 1U8FO 2CHVA 5BUQA 1U3UA 4QUDA 2IV2X 2JDIA 3RC7A 1GL6A 2KB1A 1T91A 4RCVA 1RP7A 1G8KA 3CD6F 1R5OA 2W2QA 5DI3A 1P73A 2QEXV 3UCSC 3K0BA 5EJEA 3HJFA 2QTNA 4G81A 4RQFA 2I6DA 5AVWA 2O8FB 4MVJP 4HX5A 5L7TA 1BE3H 1HURA 1P49A 3MOSA 1L5FA 4UHFA 4BN5A 3QMPA 1QBGA 1Z6AA 4IOLA 1N92A 4OLJA 4XIFA 2JLVA 2ZINA 4A27A 3Q4HA 3AHGA 1PDWA 1XCLA 2HKIA 3BKXA 1CRWG 3UTCA 1G5FA 2WV7A 5CB0A 1AI5A 4RESA 2ZTMA 3PV0A 1SQ0A 5AHRA 5EKTA 4C4RA 2XRZA 3LNTA 2JIQA 1ORQC 4L2IB 3E0XA 8GPBA 5F98A 3IC7A 5A2GA 5JWHA 1EN4A 3EGIA 3RQSA 1SOUA 4UM5A 1W6UA 3X3HA 4I0XB 3ZWPA 3P9NA 3HKCA 2W90A 3IVXA 4L0QA 4MVJM 2IWHA 5IZCA 2H2AA 2OD7A 3HBJA 2VATA 3DWGA 1TM4E 4H1WA 5CX1A 2AN3A 3W5VA 2ZXFA 4P32A 2EFJA 4WE3A 1PJ8A 2HSJA 4ZT2A 1IOWA 3P2MA 4HDRB 3AIKA 4IL5A 3DE1X 4K7JA 3NV7A 1FP1D 2CNNA 4UUBA 3RFFA 4E2YA 2IJIA 1ZUD1 5DISB 2PT5A 1JL3A 5SY6A 1U5BB 1ICEA 2IYUA 2VNHA 3S8EA 5AIBA 5E7JA 3FNGA 4BLUA 1HZZC 5JSZB 1WQ3A 1XD8A 4KXQA 4UKDA 2OV8A 1I5RA 2XOKD 2P30A 3WDMA 4GP6A 3KEFA 3LM8A 1UT5A 3NWBA 3DLIA 2PSJA 3FTQA 1WOMA 2RAFA 2IEYA 1EE9A 3ISVA 4I4NA 1QTIA 2J07A 3IPCA 3QX9A 3EXHC 1JG7A 1F1BA 2L17A 3EZXA 4R7CA 2IH4A 3G4SF 1WR8A 4A8TA 3QU7A 1JUDA 1ND6A 1E9CA 4X9QA 1FLVA 2WKQA 4Q9JA 3N5KA 3BMQB 3PHBE 5BN5B 1FQJA 1FMJA 2I87A 1ZN8A 2R1UA 4C7BA 1WUTA 1VYUA 1Y74A 4C0QC 4PRKA 1VP9A 2WU3A 2AHOA 4J7CA 1LI7A 1SHLA 3CC2V 1NOKA 1SKUA 3H9CA 2HWXA 1YRYE 3OE4A 4E2FA 5HUHA 5BP7A 2L2QA 3FDJA 5KWVA 1ISPA 1DLBA 2IYNA 1ADFA 1QIJA 4LKOA 3AR6A 2VOJA 3GJ7A 4U0JA 4RJTA 3QEAZ 1JG2A 3TRDA 1XMVA 2AKAB 2BDUA 2H4FA 5JI3E 3UOWA 2ZIEA 1NUAA 3KFLA 2OENG 5KYYB 1GZ4A 4Z0PA 1KZ1A 4IIHA 3DOHA 3UJ7A 1SU8A 1TYBE 4I46A 4F9EA 1IEXA 3GCXA 3FPBA 4EKNB 3OGCC 1NG1A 4JI8O 2VHVA 4GE0A 4HZUA 2CC2A 2FMIA 3M8AA 2J9ZB 1X8KA 5K4HA 1IMJA 4DSTA 1VP3A 1LDBA 4RHUA 5CDUA 3AYZB 4JOQA 2BFDA 1PL4A 2QZPA 2WPDA 1NU1H 1ZJZA 1EFPB 1WS6A 3WYCA 4MA4A 4MMXB 4B3TB 5JH7F 3VM6A 4C82A 2V55B 3MMXA 5KVQA 1E59A 5WRFA 1EWTA 3DTNA 4MCAA 1GPLA 1C8KA 2Q3EA 4R9SA 3MRSA 1VHTA 3ITDA 3GUUA 1KAEA 2NU8A 3ZXIA 4GNKA 4D44A 3QIAA 1NUQA 4RJKA 4Z7OB 4NDNE 3AEKA 4GI2A 1F51A 3I5MA 5JXHA 5KAPA 1M3SA 4GOOD 2LDBA 3BICA 3HV0A 4Q15A 3DZKA 2V3VA 1TADA 2GSDA 2ZRQA 2VYNA 3NCHA </