3JARB

Cryo-em structure of gdp-microtubule co-polymerized with eb3
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
429
structure length
429
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanistic Origin of Microtubule Dynamic Instability and Its Modulation by EB Proteins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
molecule keywords Tubulin alpha-1B chain
total genus 151
structure length 429
sequence length 429
chains with identical sequence D, F, G, H, I
ec nomenclature
pdb deposition date 2015-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3jarB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 3jarB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 3jarB01
1RLUA 1TVKA 1TVKB 3M8KA 3VPAA 3HKCA 4YJ2A 3JAKA 4EI8A 4U3JA 4I50B 1W5AA 4FFBA 4O4JB 4X1YA 3HKEA 4B45A 5EZYA 3UT5B 3JALA 3HKBA 3HKBB 4O2BB 5LYJA 2XKBA 5CA1A 4LNUA 5BMVB 4O4HA 4O4HB 4U3JB 5JCOA 5IJ9B 5KMGA 3CB2A 5KMGB 4YJ2B 2Q1YA 3VOAA 4ZHQA 3V3TA 3HKEB 4EI9A 5J2TA 4F6RB 4KWEA 5J2TB 4X1IA 3ZBPA 2RHHA 5JQGB 4TUYB 3VO8A 4I4TB 5JVDB 5JH7A 5LA6B 1W59A 4DXDA 5KX5B 4LNUB 1SA0B 5IJ0A 5CA1B 5LXTB 3N2GA 2RHJA 4O2AB 3RYIA 5LOVB 4B46A 5IYZA 5LXTA 3JATA 4WBNB 4X1YB 3ZBQA 4TV9B 4I50A 3ZIDA 4YJ3B 4IIJA 3WGMA 5GONA 3WGJA 1W5FA 3RYCB 3M89A 5J2UB 4X1IB 4IHJB 4O4IA 3RYHA 4HNAB 2VXYA 1FFXB 4TV8B 5LP6B 5IJ0B 3WGNA 5FNVB 3JARB 5BMVA 4TV9A 1W581 3R4VA 1Z5VA 3JATB 4WBNA 5JH7B 5C8YB 5JVDA 4DRXB 3N2KA 4EB6B 3JALB 3UT5A 5MN6A 4XCQA 2R751 4O4IB 3RYHB 5CA0A 5J2UA 5ITZB 2R6R1 4I4TA 1RQ7A 5M7EA 2RHLA 5ITZA 3HKDB 3VOBA 1FSZA 5EIBD 2XKAA 5IYZB 2BTOA 1OFUA 1W5BA 1Z5WA 4O4JA 1SA0A 1W5EA 3JASA 3JASB 5LA6A 2GVIA 5LP6C 4O4LA 3RYFB 4ZI7B 1JFFA 3JAWA 3E22A 4I55A 4FFBB 3WGKA 1RQ2A 5CB4B 4F6RA 3HKDA 4X20A 3N2KB 5GONB 4O4LB 3RYFA 4ZI7A 5IJ9A 5EIBC 3WGLA 3JARA 5EYPB 2BTQA 2VAWA 4DRXA 1FFXA 4TV8A 5EZYB 3N2GB 2BTQB 4EB6A 4ZOLA 5LP6A 5MN5A 4E6EA 5FNVA 3JAKB 2Q1XA 3RB8A 4X20B 5JQGA 4HNAA 1TUBA 3VO9A 5CA0B 4X1KB 4X1KA 2VAMA 4IHJA 4ZOLB 3E22B 4I55B 3RYCA 4EI7A 1JFFB 3JAWB 4O2AA 5C8YA 3RYIB 4ZHQB 5LOVA 5EYPA 4IIJB 4YJ3A 2RHOA 4O2BA 5LYJB 4TUYA 3C8LA 5JCOC 4M8IA 5MN4A 5CB4A 2VAPA 5KX5A 1TUBB 3HKCB 4U39A
chains in the Genus database with same CATH superfamily
4HWKA 2ZI7A 5K3FB 5SYAA 4AJHA 1C8LA 1L7NA 1J97A 3DWEX 3VPAA 3W2HA 4UTPA 2B7BA 2RH9B 2GYYA 3CKKA 4LE0A 1E7KA 1ZHHA 4LRQA 3VC3A 2B7LA 3W5HA 1M2NA 3HKBA 4UC0A 1V16A 4CCWA 3KOOA 1G19A 1N25A 1HO3A 2PGDA 2ZWOA 4HTFB 3UHFA 5CXQA 2P06A 4JI3O 3L8GA 1UK7A 3HPQA 5KSOA 3HC7A 2FP4B 1FTGA 3ZS8A 2GJAA 4RTOA 2D4AA 4TKMA 4LF7O 1UCFA 3RVZA 1VPDA 3CWZA 3MTJA 4DLUA 2CE7A 3FA2A 4P32A 1L6RA 3BAFA 4WKPA 3VYVA 1H0SA 1UBUS 1EG7A 3IULA 4S1PA 1UMBB 2UUOA 3C6YA 3K9LA 2FZKA 4NBWA 2WYIA 4LGYA 3ZWAA 3W7BA 3QW4B 4DAOA 3O8LA 1D09A 1XOIA 1BOFA 4C4AA 5KNCD 5AI9A 3V6MA 4MRSA 4IINA 1UXIA 4PSCA 3DL7A 2ZDIC 4V1CB 3IMFA 3OEHD 5G4VC 3HP7A 3PX2A 4NV0A 2XT0A 4HMQA 5KOIA 2G09A 3VNVA 1EUZA 1N9GB 4NZOA 1ZI9A 2JIZA 1U0BB 4UHKA 1W35A 3KTOA 3M89A 1CEZA 1PZEA 3ZE2B 2ZRMA 1IN4A 1AX9A 3EXEA 1KQGA 1QRUA 4XPZA 4KL8S 4ZV7A 4YCNA 4MVCA 3RYHA 3JQRA 3EQZA 4DIFA 5B66Z 1N8TA 1VG1A 3P26A 4HF7A 2W6OA 4MV3A 4BBJA 2IXTA 3QUCA 3IT3A 2IS6A 1XQYA 2AD1A 3ENWA 4UBJA 1ORVA 3OQJA 3D43A 4DV6B 2BSAA 4FX2A 1O6ZA 4KVZA 2JF0A 4GBED 3K70D 1T6ZA 4FJ1A 1L7XA 2PFSA 4X85A 3K5HA 3JQGB 3QWFA 1ONPA 4U2GA 4WMLA 4LF5B 1D8TA 2GFQA 3H11B 3CMAF 4PNHA 2P67A 1HNWB 2RHGB 3LRTA 2FEKA 3AIKA 3VR4A 2EJBA 4QJIA 4B3MB 4QUAA 5I9IA 4JV5O 1EQ2A 4IOLA 4MDYA 4O2RA 1KI6A 2LPMA 5FPRA 2PJZA 5FTWA 2Y69B 1Z5WA 3H5RA 2IIVA 1N33B 2UXCO 2B8TA 5A71A 3V2GA 4RMNA 4B74A 5IKEA 4BQIA 1GR1A 3ZDXB 2PBLA 3RGBA 2WD9A 3DLIA 1FFSA 2CL0X 3AR7A 1T36B 3M1YA 3JQ7B 2EERA 4GO1A 1UBOS 5DMHA 3S29A 1RKUA 4KQ9A 3U6BA 2FKAA 4YV0A 2B82A 2JFUA 2OLKA 3ZDQA 1WCIA 2H4JA 3L1HA 1IXYA 4JQCA 2QV0A 4JB2A 3RWOA 2X0NA 2H6EA 4TQGA 3W6PA 2QTMA 3AFNA 1C1HA 4A2PA 1W40A 2FMIA 3COSA 3IQFA 1K88A 1VZ3A 4QQNA 2ZIUB 4E5MA 1SQ5A 2RB4A 4ND4A 2QWPB 3JQ6A 1Q6HA 1T0HB 4L72A 5CURA 1G6UA 1Y3BE 1ZTEA 4GWLA 1TM3E 4Z0PA 4EKIA 4N5LA 4EY5A 5I4CA 4TXMA 1H4SA 4QFDA 4LF8O 2CDAA 4N3BA 5G4KB 4RKYA 2MK3A 4BJ5A 4WFHA 3H1KH 3S28A 4W5RA 5BW8A 1I5OA 2D7CA 3G2NA 3DWFA 3BEHA 2ZJAA 1XRSB 4C7UA 4GRIA 1TGYA 2PAFA 4ABTA 4DV5O 1BEZA 4CUJA 4PM4A 2L18A 1M5RA 1KMCA 3BXOA 1ECPA 2HJHA 2WWXA 3HKCB 1DDGA 5E6UA 3OQ1A 1MN6A 2Y48A 5EA2A 2OHVA 4TLCA 4EFBA 3G2HA 3MZ0A 1DKLA 1SQFA 3IE0A 4FZ5A 3T7DA 4P7BA 3W2IA 1HE2A 5G0VA 3EJWA 3EGVA 3OKFA 1BQEA 1YZYA 2YBEA 3A1DA 4MB2A 4ECEA 1PSWA 3MWDB 2ZIAA 4JI1B 4G4XA 1NR7A 2NN4A 4P3YA 3AOGA 3VOAA 3FXAA 3IKJA 5A1JA 2FRDC 2JHFA 3IKEA 2B1IA 1RLJA 1K73H 2P1DA 4RS3A 4QXQA 4W6QA 4XWGA 3E7FA 1Z6AA 3GRPA 4XIIA 2JLVA 1VSQA 2YY7A 4MGHA 4RS4A 1SZQA 2I65A 2FR0A 2ZYVX 3BICA 3SZLA 3T6KA 5K9ZA 4UD2A 5CHYA 3BA8A 5ER9A 1UBRS 4J3FA 1MJFA 3NBAA 5CLIA 4AJKA 4PFQA 1YJWV 3H1TA 2HH9A 2I80A 4YXWD 3FRIA 1W0CA 4MGKR 2H0QA 3UFBA 2O8DB 3EHEA 5FO1A 1D2NA 2UZ1B 1N8SA 4GLLA 2P6NA 1Q84A 3LGAA 4XD2A 4OQXA 1JFSA 2V0GA 4QLBA 1JAHA 2KQXA 4IL5A 4KQJA 3R8CA 4OJQA 4RA9B 1BQ3A 2E4UA 3ZOZA 4DV0B 2JS3A 1N78A 1KO8A 1P0MA 2KE5A 2V7GA 1YZUA 2BJHA 3SYKA 4V03A 3TSOA 1HMYA 1OT5A 4Q4JB 2EW1A 4L5YA 4TV8B 1GYQA 1Y6ZA 2EX4A 4GOOD 4YMSA 4JVLA 1TTHA 1PJBA 1UXKA 1R5BA 2WAXA 2ZDQA 3CU5A 1ATZA 1XKXA 3IEIA 4HWTA 4TV9F 5BQOA 3QUTA 2PHNA 2EFYA 2Q5FA 4MVZA 3LWZA 1LS1A 5T4HA 2GCNA 2CHSA 1H9AA 1GSAA 2VWGA 2C4KA 3PUXA 1IN7A 4D3SA 2HHHB 1Q5PA 1ATIA 1VMKA 4HDMA 1P62B 3MGKA 5DV9A 1UPFA 1E9SA 4CIBA 3T1YO 3CMEF 3HO1A 3Q9LA 4HX5A 5A2QN 2QIOA 3EXHB 4PX9A 3CH7A 2EFDB 4HTFA 3KQLA 3LYHA 5HF6A 3ETEA 1N6RA 2YW2A 4YN3A 4O4JA 2GLTA 2VTKA 3PNOA 4DQUA 3PDIB 3L1VA 1NG9A 4MSWC 5IC4A 1QLHA 2RGGA 4HAYA 3KTFA 2OKGA 2ZYDA 3WGTA 2M7WA 2V7QG 1S8NA 5KOJA 2QPAA 5IJZA 2O5CA 2O8VA 2VA9A 5AOAA 4GL4A 3AERB 4LC9A 1OCZB 3GVMA 3IB6A 4M7WA 4U6SA 5AVTA 4PSVA 1NJIH 4JSTA 2DT4A 1G7RA 4KDRA 2ZUVA 2RBEA 1PVDA 5F2OA 5BV0A 3F46A 3MN1A 3CCLV 4ACAA 3MS2A 2OG1A 4RHEA 4B33A 2QWNB 5I9MA 1TEZA 6YASA 1ZO8A 4FYKA 1U4SA 1Z6QA 3R7FA 2QV7A 3KHKA 4K6KA 5JU6A 1SPXA 2YJ6A 3F2VA 4RIGA 5CVUA 4MI1A 1AQIA 4F9GA 1SR8A 2HO5A 1SXJA 4WXMA 4IGGA 1H8EA 2PM8A 2VJMA 2H5LA 2YWFA 4MEBA 1CEEA 4FFPA 1BA2A 5CXXA 3OPVA 5A5DA 4BO0A 4QJFB 1A8QA 4PIPA 4TXJA 1N32O 1QIJA 2WFAA 5EFOA 5FADA 3C3SA 1H2RS 1YR7A 5B1OA 3VPXA 3HR0A 5FBLB 3TZCA 1SKMA 2Q0XA 4M4SA 4EHHA 3VR6H 1HY3A 1CQIA 3ILVA 5AKZA 3DMDA 3EMVA 1XUQA 3HZZA 3JD2A 4K9NA 1ZL8A 2GM5A 4UUPA 4DC1A 4YYZA 5KX5A 5GV7A 2Q50A 3SZ3A 4C20A 3WLEA 1XTIA 3IAM1 4UZFA 3AW8A 1J22A 1TVKA 2DU8A 2ZNIA 1HTBA 1LLDA 1UDCA 2HA0A 2QY6A 3NR2A 4LFBB 5GVSA 2D4HA 3IAFA 3LFUA 4RY0A 1ZVKA 3PQ3A 3LWQC 2PH7A 1T3GA 1WQ1R 1YUNA 3KXDA 1C3LA 3L9WA 4O8ZA 4EUEA 1O0SA 3P4YA 4D4JA 5HUQA 4PXYA 2Q2NA 2XF2A 2Q1YA 1ZISA 2X22A 1VMEA 4BT5A 1E32A 2EJWA 3E84A 5CM9C 3IIMA 1NLFA 1Q7TA 2QVBA 3ZHYA 3G2IA 3I01A 3EJ6A 3FPEA 3GG9A 1ZAUA 2BEVB 3HR8A 4Q3CA 3EK2A 3RT9A 2EKZA 3RVMA 1SC5B 5KU7A 1PV4A 1ZLYA 1ISPA 4MMZB 3VO8A 4JMLA 4P22A 2VK1A 1JTVA 5M3BA 3STWA 4EUFA 1GJRA 4DMLA 4WJLA 1BW9B 1HYEA 2AT1A 2X6TA 4TSFD 1U4OA 1W6RA 2GXAA 4YV2A 1PNLA 1CY0A 3BVOA 5ECDA 3L0ZA 1NJ2A 1LTHR 5JJNB 1I94B 2LW1A 2X1HA 3WRYA 4IRUB 5D01A 4EO9A 1QO0D 4F3KA 4M86A 3ROZA 4WLEA 1N1GA 1JQ0A 1YE8A 2HNBA 2JKYA 4RHAA 5FNZA 5F5NA 2DFLA 2GSWA 3TI9A 5D3KA 1KJ8A 1M8JA 1PT7A 1ECJA 1F6DA 3FBTA 5DYWA 4XJXA 3NX4A 3OR6C 3I45A 3CCSF 4KPEC 4HAWA 2ID4A 2IEBA 2W2KB 3W04A 1AV7A 3GRZA 3O2JA 4BLUA 1A95A 5MN6A 1ML3A 1L5RA 5C35A 3H6HA 3DVAB 4LCKA 2DFNA 4TQDA 4WCFB 3F0FA 1N2GA 2G28A 2V65A 3CF0A 4GZLA 4RA6B 3CO5A 3VJLA 3SDSA 5COAA 4BXOA 4J42A 2W90A 1Y42X 3ROEA 2RKBA 3BMXA 4DL9A 3W9YA 4NBSA 3O84A 1GGJA 3I05A 3CLKA 2ZD9A 3CPSA 1QGOA 1V96A 1VJTA 4GD3Q 6PFKA 1T4GA 3PC8A 3FF4A 3FDJA 1GZ6A 2YC2C 3PFNA 5EMMA 1Z45A 1JKJB 2L82A 4G0MA 4I5DA 2PZSA 1U3FA 1XXHE 1YD7A 2ECKA 1KAMA 1T4CA 1RLIA 1IQRA 3IPLA 2A0XA 4E33A 3EMBA 3SWWA 4HP8A 1DPGA 4UTZA 1PXWA 4IEIA 3ABZA 3FOEC 2WIFA 3GBPA 1U7WA 3LOPA 4CUZA 5KC9A 1G5HA 1NBHA 2ES4A 1SZDA 4J3JA 1E1LA 2A9QA 2CW5A 4MUNA 4X6UA 1YJNV 2L42A 4NPCA 1QF6A 3KQQA 1OCEA 1R6AA 3GJTA 1KDOA 5K8JB 4HNVA 4BB6A 3GJ8A 4UM9D 4Y2JA 1N5OX 4EEKA 2LRHA 3JRWA 1S02A 1CP9A 4FLWA 1PGNA 3VMFA 5A05A 4MVUA 4U3FH 1BXRA 2VZEA 3E9CA 3F78A 1J8DA 4DV3O 5FBHA 1KOLA 1D07A 1NV9A 1Y67A 2CNLA 3B1VA 2H16A 4P82A 4R41A 1VBKA 4NG4A 1P18A 2OAQ1 4DYVA 2R85A 4HUQA 4ZKIA 5GGXA 4ER5A 4N03A 2NO7A 3ISTA 1S4MA 3OTHA 1NE2A 4EAAA 3MCWA 4B87A 2B4KA 1E3MA 5AXDA 4R1MA 4YJGB 2HHCA 1Y8ZA 1O9BA 3DKPA 3UAVA 4B4VA 2LO1A 4DDHA 4OYLA 1XZNA 2P90A 2JVIA 2VPWA 3QU2A 3CEIA 3H17A 3ICPA 1XBLA 3DD5A 4RUFA 2YHBA 3HADA 3ND6A 5CFOA 1MAWA 2H7CA 3KDAA 1V7ZA 2AEFA 4UQLA 4D6TH 4Q05A 4ZRDA 3C3MA 3G2LA 2YZ2A 4KB5A 3GH1A 4QIWF 1I0IA 3EE6A 4QPNA 2X3UA 2JASA 1DI0A 2PUTA 1MJNA 1GR0A 3CMAV 1I13A 3MILA 2NMVA 5TNXA 3CUUA 3R9IA 3PHJA 5JCOA 1RPJA 4F06A 1WVIA 1XD2B 8MHTA 3LKVA 2XDQB 4EY4A 1RBZA 2A57A 1N0WA 2ZRKA 1VQ7F 3CZPA 4L4SA 4TV8F 1CIVA 5DX8A 4AG3A 1JR4A 2IZ0A 4BIUA 3VHRA 3VU1A 1LSOA 4PSKA 3T1VA 1AXGA 1D5AA 3KJXA 4TXLA 4YXFA 4AWBA 5AKKA 5AESA 2HEPA 4X3LA 3ETDA 2JFYA 3HABA 4QOFA 3SYPA 1LA2A 2AJCA 5SZKB 3H2IA 3UV6A 3SN6A 4M1KA 4UM7A 1P1HA 4WRRA 3HDVA 2GVDC 3D36A 1DCFA 2PR2A 2DMRA 3GMTA 3HZRA 2JJYA 5KJCA 3HBMA 4IT5A 1T26A 1MAVA 1H8HA 3BE5A 3CT4A 5JWRA 5FJ4C 3GOQA 4FDAA 1BDMA 3V1UA 3VNRA 3W05A 3C3CA 3ZIAA 2KTVA 4W7IA 5KAIZ 2Z8YA 3IMKA 3L8DA 4DMRA 3C5CA 1O96A 4HKTA 4ZOEA 3B6EA 3T4DA 4UDOA 5FQNA 1O57A 3EQ2A 3IT1A 5DJ5A 3TQCA 3U17A 4CEJA 3C87A 3PEWA 4CH4A 3RANA 1QDLB 2X1MA 3DJYA 3OCWA 4WWHA 4XUCA 1SKYB 2PPLA 1JEEA 5CJJA 5IKMA 2VBFA 2BEJA 2IP4A 1MJGM 1E9VA 1K6MA 1X9GA 1GTMA 3CLTC 3HACA 2C8LA 3IDQA 1EFRD 3KSZO 1CRQA 4OMUA 4PBSA 2CJPA 5ESDA 1QE5A 4C14A 1T91A 1AI6A 4OAPA 1PW5A 3Q41A 4JGBA 4AZWA 2Y0EA 4XCVA 3OBYA 1Z56C 1UIRA 3B1FA 3WGVA 2ZWPA 3TOSA 3EFHA 2FCAA 3EEOA 2ZS8A 3GEPA 1JBKA 3HE3A 2Y1DA 4AJ1A 1AZSC 4DXHA 2QU7A 3FB5C 4C0XA 2OENG 2B98A 2L0XA 4YJ2F 1ZIYA 4D82A 1KK2A 2A1UA 4L4ZA 1YVUA 5DNYB 3I9FA 4NR0A 4LX8A 2PBFA 1MXFA 1T3ZA 2SHKA 5C1IA 1D5NA 3OU6A 5KZMB 1DUIA 3A3NA 3W5VA 1GA4A 2AZTA 1WPBA 3R66A 2LIPA 2Q49A 2XTMA 4FHGA 2YYEA 1Z5OA 3OKCA 3PC6A 4URHA 1HETA 4MEJA 3P5BA 4GGPA 1RI2A 4NU0A 3VHQA 2YKGA 4Y6GB 1RPOA 3IOEA 1VTKA 2HFKA 3AEYA 2I6RA 1FLAA 5BNIA 1I4EB 2HZBA 4WASA 3WAJA 3GYGA 3JAKB 1V8DA 3DS8A 4MYUA 1DHTA 4D9GA 3I04M 4C4XA 2GYVA 3HXTA 2UUCO 1B0ZA 3LDAA 1M54A 5BR8O 3PXGA 1ODJA 1N36B 1HTWA 4EYOA 3AL2A 1KIMA 4DR6B 3COPA 5TS3A 3NAQA 1M33A 4MXDA 3ZWCA 5BXYA 2BGTA 1E0JA 4HN9A 2MINB 1HNZO 5ES4B 5L3RA 3KVNA 4XIGS 5SY4A 4QT0A 4MV8A 2FOLA 3ZZTA 5B5SA 3QWAA 3HDTA 3MMNA 5DNDA 4CT4B 5JVDF 2YJNA 5BSVA 1IWOA 4DWOA 3SF0A 2P5YA 2E48A 2PKYX 4M76B 3SYRA 4DJAA 2BSKB 2XTAA 3H86A 2ECFA 4C3ZA 1K7EB 3QLVA 4J0QA 2OC4A 2YVUA 4IBOA 2JW5A 2ZYSA 4P4NA 1XE3A 3G2KA 3OIDA 1LF0A 1XLUA 2CMGA 1VLMA 2MDTA 2V6BA 4LTMA 3VHXA 4EKEA 5EBMC 1ESNA 2YZNA 4JB8A 4N5MA 3UG7A 5KYYA 2JGMA 1T1SA 3FCAA 3PDUA 1B41A 4C7OA 2AV6A 3SMVA 3FB8C 1GFZA 4N7RA 3RO7A 2JFWA 3RFVA 2OK8A 3S2IA 1J8YF 1N8NA 5IF3A 2JK5C 1ZRSA 4IOKA 2C3YA 3A1WA 4P84A 3UJDA 1UF9A 5IDJA 2F9ZC 2Q5CA 3CLRD 3QV1A 3B6ZA 4K46A 5FP0A 2ZULA 1T9ZA 4G1MB 2QQ0A 1I33A 5TQ0B 4J1SA 1Q3KA 3EG9A 4LOIA 4LNUB 1GV0A 4CQLA 3DBLB 5D1NA 2XZOA 2JGRA 5FEUA 1VQMF 1XV5A 2RI1A 4KSCA 1Q91A 5C7YA 1F06A 1G8SA 1OMOA 2DYRC 2DQZA 3QMVA 1AR5A 1D2MA 1DEKA 4OQLA 1C7EA 2IYAA 1ZC3A 1KYVA 2YNMD 4KXFB 4AMZA 4DLPA 2ZYAA 2X7JA 3FOBA 3VU0A 4FM1A 5BOSB 3WA7A 3BCUA 4HZIA 4NK4A 1K4DC 4P1ZA 4G4YA 3GGOA 1QYXA 2QQEA 2A92A 1CY2A 1PQUA 3L7QA 2GAOA 2H4WA 2YJGA 4YY3B 3I01M 4XDHA 3UO2A 2JAUA 3JZIA 4K8XA 1T9CA 4JLAA 4IX1A 1QUEA 4MRVA 4A73A 4BQNA 5B3JC 1G2OA 2N1MA 4GT1A 2P4UA 2ZKIA 3GAAA 3IHTA 3PFBA 3K5NA 1ZD8A 2OHJA 3RUHA 3GLFA 1UZMA 2WILA 3MFQA 1GL6A 4RPKA 2FW7A 4FGUA 4G0VA 2VL7A 4JU8A 1ZAYA 4PLFA 3NBKA 3RSZA 2NT4A 2Z5FA 1PF5A 1JB1A 2WIGA 3QEJA 4OL9A 1XELA 1RM1B 2JATA 1EJBA 2PZLA 2NU7A 3D2CA 3K03A 4PD4F 3QUWA 5B7GA 5L53A 1RIFA 2ADMA 3ZCPA 2PRIA 3VZPA 1X77A 3UJAA 1Q8RA 1MLDA 3AZQA 3D7RA 3M2PA 5DIFA 2PRJA 3D8CA 1OZGA 4MUHA 4HQ6A 4JAUA 4CR8A 4D4LA 1WUKS 2F6RA 1NVVR 4TT3A 3WC4A 2MJLA 4P7GA 3SPIA 3ZO8A 3DUFA 1QPZA 1I3NA 1WD5A 3LCJA 3PFGA 2ZAUA 1KK3A 4IUCS 5CFLA 1K63A 3CJRA 2IX3A 2O1XA 3KOWA 3RRJA 1EYZA 4PNZA 1EQUA 1LDMA 2HLHA 1CJTC 3KAJA 4NBVA 3P30A 1F20A 3HJFA 1MO2A 1Q1ZA 2G70A 2AI1A 2Y76A 1NF2A 3P3PA 4I9FA 3EA5A 5F77A 4NDNE 1LVHA 1YZNA 3WL7A 4RH1A 4L8FA 3AINA 3EY9A 4V3CA 2LCQA 4TWJA 1K8AW 4C06A 3T5DA 2QN1A 3JVDA 1SXGA 4FJ2A 2QRVB 4P36A 4QDKA 3T1YB 5F1OA 2IGBA 1KYOF 4FGZA 5G53C 4BN5A 4C43A 1DKQA 1EP3B 5KWEA 2VLBA 5F7JA 2PX6A 3ZI4A 2OB1A 1ZJJA 3NC0C 3KKEA 3WIEA 3UH1A 1C50A 1KB9F 3SLKA 1N9KA 5HZKA 2Q0AA 3D8SA 1IQ0A 2GHIA 4GKKB 4TS4A 4W8HA 3L8MA 3I30X 3OD5A 4JFRA 1Q1GA 2OD7A 5H3HA 4KSBA 4KP7A 4W8GA 3WX0A 1IXZA 3LDUA 3AKYA 4I08A 4R1TA 2EDCA 4AF6A 3EPRA 2PK3A 3DE2X 2IXFA 4DGQA 2PQ2A 4MW0A 3CVOA 2XCTB 4CF6A 4PAGA 4LRXA 5JC1A 5HMLA 2ZIVB 3M83A 4Z0NA 4BS9A 4FEYA 1Z2EA 3R74A 3ROMA 2BPOA 2V3WA 3WNQA 1VIVA 3JYNA 5I47A 4PZPA 1FRFS 2GGSA 1UWCA 1MEEA 2HWYA 3SSAA 1OBCA 2F1IA 3H9VA 4NJMA 3OAAD 1SIWA 3LOQA 3RI3A 5I7UA 1W4LA 3O95A 4H1HA 2Z08A 2IZ5A 2KPOA 3ZVLA 1JR6A 1GT6A 4RPHA 3RRXA 4EJ6A 3RBZA 4ANFA 3QFHA 4YP9A 1THGA 2XCQA 3R3YA 4ZI2A 4KNYA 1WAMA 1S2LA 2JHAA 4LJ4A 2GEKA 4DR4O 2ZUDA 1ZW6A 5B1AB 4O8CA 3COVA 3W1EA 4I5EA 5LM3A 3OP4A 2P6MA 3ZTTA 3D00A 1PL6A 3AP2A 3BILA 4LI3X 1P1BA 2W0XA 1K4MA 3HZHA 4F71A 3KQKA 2EFHB 1WZIA 2VSXA 3KK0A 4PE5B 1JI3A 3NTVA 5H3LA 4Q6GA 1KAQA 1E64A 3A32A 1Q2XA 1Q0HA 2QMOA 1US8B 4IXTA 5F3RA 1DBVO 4GYJA 2GCIA 4A5SA 4EMSA 2F67A 4QEZA 4ZJZA 5JXWA 2OUIA 4I9UA 1LSJA 4MUEA 3LT1A 3PNLA 1V71A 4LC0A 1KEEB 4AO7A 4RKWA 3VO2A 2HY7A 3TWOA 2ZR2A 3W2FA 3WL8A 4CTJA 2C2OA 1POXA 2WTBA 1NLZA 1KSFX 1QYCA 3VYRB 2YXYA 1YONA 3JALB 1GHTA 4XCQA 3GHYA 1C3EA 1YV9A 1M2WA 2HRQA 4HG2A 2VNKA 4OFZA 4X8LA 5T4BA 4O4HF 2I3ZA 2ZDIA 1TZMA 5M7EA 3RLIA 4ZZ3A 5CRIA 3HA2A 2E0IA 4BR6A 2GLZA 1I6MA 1L4MA 2HLDA 1AKVA 1KS2A 2XLCA 3MUNA 4XGIA 2J9ZB 4G5RA 1OILA 3TLYA 3LIPA 1LNQA 3KZIZ 4JI4O 2W58A 1F6WA 4WSOA 1K7CA 4C3UA 1NOJA 2WZCA 3QU5A 4RYLA 3TMKA 3SK0A 2V8BA 1GL3A 3S4YA 2M6RA 4D4GA 1A9SA 1T3TA 4J6FA 1N1EA 5DXJA 5IC6A 3JS5A 1FP4B 4GOLD 3NBFA 4P34A 1OWPA 5EXTA 1C0EA 1PR0A 4D43A 2Y67A 3LWBA 5FTKA 4CM5A 1YR6A 1NSTA 3K06A 2MSCB 5KUKA 2POQX 1SBCA 3OI7A 1A0OA 1CUJA 5LQKA 1E2MA 1M0EA 3HUEA 4V0RA 2XE6A 3I8SA 3HRKA 2X8AA 3MCAB 2JNBA 1SHLA 3A31A 3D31A 2P9ZA 1JSXA 4HMPA 1PZMA 4NBTA 3K9BA 3X3HA 2HMVA 2Y1XA 2YXNA 2IWHA 1J7KA 3LT5A 1VQKF 2RG1A 4AX8A 2VF8A 4E3ZA 1C2TA 1X94A 1QZUA 3TTYA 3ZMVA 1M8GA 1IRIA 2VEOA 2ZIXB 4YMUA 2D59A 3A7EA 5IJXA 4F1KA 1D0VA 3BB3A 1VF6C 5TT1A 3U4CA 1ONNA 4MVOA 4DTCA 3P2KA 2VRZA 1ZN2A 4BNYA 4CBVA 3FR8A 2TRSB 3ML0A 3ESAA 3C7KA 5K03A 1XEWX 2ZR7A 1JR3A 1MIOA 5MN4A 3L6DA 4MVJI 2Z0AA 2FEPA 2HBYA 3BF8A 4LJSA 4C7MA 1BHBA 1U94A 2AFHB 3EVTA 3WJPA 1W0KA 3IILA 3GJ0A 1YJ9F 2AJ8A 2AYYA 2XIQA 4L9WA 2IS1A 4GUDA 4DG8A 2V7WA 4BNXA 2DWCA 4W1SA 1SXIA 1KQNA 4Z9BA 3E3NA 3KTDA 5EZYA 4JBXA 5A0TA 4O2BB 1KEVA 1T10A 2NV0A 1C2YA 4UB8Z 1EK0A 1WR8A 2BT4A 2CVZA 2XKBA 3D8UA 3K5IA 2E3CA 1ND5A 3PGVA 5H59A 5JXJA 3RWMB 3VU3A 2TMYA 1USKA 1XLVA 4HQ0A 5AM0A 4TS1A 3DXRA 3K1AA 3U7JA 3WFJA 4EG7A 3E4CA 2J6HA 2ZWMA 4DLWA 1UXJA 1L6IA 5IXYA 4LHSA 1I80A 3DOFA 1IIBA 1N5LA 3OMLA 5EKXA 2ZRHA 3VTZA 3QNEA 4A8JC 4G4WA 1XCJA 3SJUA 2O57A 2JFZA 5GW7A 3MMPA 3Q1KA 2O8BA 3OX4A 4L95C 5EJGA 1C3XA 1KO5A 1XA3A 1K06A 1RABA 2EJVA 3S68A 2W2LA 1J70A 1C7IA 1RRKA 1Z2PX 3AHIA 1W5FA 2J07A 3CSDA 4GRAA 1OYWA 3HZOA 4YASA 2IEGA 1L4UA 2QG4A 5C32A 4F4DA 4GP9A 1EU1A 4R1LA 1W2GA 2OCCC 1YJWF 1WY7A 2NO9A 3WE7A 2ZU0C 3OJWA 3C45A 4OP1A 4NCBA 2VC2B 1SVIA 4P2GA 1YCGA 4TYMA 3ETLA 1T25A 3L8EA 2JZNA 3NQ41 2J3KA 4U7NA 5HY2A 1JDSA 2AJDA 2GNAA 4IHQA 4JMPA 4Q66C 2GHQA 5KUTA 3ZMZA 2HR1A 2ITDC 3WG7C 3W7XA 1WB6A 5IPFA 4G5FA 5KINB 1E6CA 4DIBA 3AI7A 1LDNA 4QL3A 2XNDA 1DDIA 3KUCA 3V7QA 1OOEA 1ZR2A 2ZUTA 2J30A 2RGYA 4OQMA 4B6JA 4BN0A 4HTAA 5EB1B 1ISMA 2A5JA 4I9WA 1GN8A 2NADA 3MUFA 5E1OA 3BJMA 3EX7C 1FXUA 2I67A 3H3XA 4E5DA 3SPXA 4ZZ0A 2FCRA 1Z8HA 3Q0EA 3TJRA 2L17A 2Y9MB 1SKYE 4HDOB 1AA9A 5ETJA 5TB5A 3ANMA 1IWPB 1FJ2A 1KGDA 3CX8A 3LZCA 2Z2JA 4A6DA 1AO0A 4QOHA 5CBGA 4GPD1 3KQTA 3PXEA 4GE0A 3ECCA 1RHKA 4KKXB 3PKZA 4OMFG 2ARHA 2J5KA 5JJKA 4Y2HA 4EGFA 5EC2C 5A4FS 1H2FA 5JV5A 1N7JA 2J3IA 4LF9O 5DM6V 1G7SA 2WJ3A 4CTMA 1HF3A 3BF7A 3PSHA 1REQA 3E7XA 4J0DA 4UM5A 1AS2A 4TMWA 2P9QA 1VP3A 1IATA 1HEIA 1YZKA 3A3KA 3L72H 1IIRA 1C7JA 2AZ2A 3BFVA 1N3BA 2RH5A 2G07A 3KPYA 1Z2NX 1PR4A 3OX3A 2DHCA 4FGLA 4KCGA 3AI1A 3DHWC 1RJEA 2AMJA 3B52X 1OXMA 1I36A 4MT8A 1IY0A 4P9NA 5J58A 3ER8A 1E18A 2A3NA 3OLVA 3BZWA 1FJHA 3BGVA 5WRFA 4DCUA 3JWGA 1EA7A 5LLTA 2BI4A 1RYEA 3FYTA 4W9NA 5L7YA 2G5GX 1PD3A 1EZ4A 1O4WA 4EKNB 4N0MA 2HBRA 4Z86A 4NTWA 1CUVA 2ZRDA 1RLOA 4KWIA 3LDEA 2ZETA 4WN9B 5KIAA 5A4IS 4ZYLA 1RJ9A 4CEHB 2N42A 1MA1A 2LCIA 2WJHA 3LFHA 3PXDA 4LWQA 4I5IA 4OMCA 5EWJB 3WLJA 3T12A 4M8LA 5FL7A 1WJZA 1GNTA 3ELBA 4BFTA 2IU6A 5CU7A 2Q7DA 4KUMA 1HDJA 2RGDA 4JFAA 1AQJA 2OM2A 1QG4A 2ZIMA 4ZVSA 4EGSA 5IVHA 1M72A 3OC6A 1IUOA 3GD5A 4JJGA 1WY5A 2GESA 2R1TB 4LJYA 1VE3A 2GERA 2CNNA 4X62O 2UUAB 3E5NA 1W1UA 4F8YA 3QA3E 2X8JB 1T5DX 5LGUA 4HLCA 4CL3A 3BXXA 3IA2A 2WP0A 3ESRA 4ETWA 3BMCA 2WTEA 5DNWA 4Y6PA 1W88A 3UAXA 2ZXUA 1OA1A 2H8EA 2IBSA 3AWIA 1A9YA 5L4SA 1AI4A 3V48A 4J80A 4H9GA 3LSUA 4RXUA 1YZBA 1H2YA 3N0VA 3M8AA 5I9TA 3SU8A 4PDMA 4D6XA 2I78A 1T8TA 4HH4A 1QAOA 3V8RA 3D4BA 2ZI3A 2XQFA 5EI5A 5EJAA 4HVLA 4NBRA 4C78A 5EWRA 5C7LO 4PA6A 1PJAA 1BYUA 4RABA 4YQYA 4BNKA 4D9NA 2HZ7A 1R3KC 5KUMA 1TEXA 2OTCA 3IXQA 4B46A 2XHEA 3LX6A 5AVKA 3GIDA 3K6KA 4XJTA 1MB3A 2LDXA 4OJYA 4F60A 1G17A 3BWEA 4XD7A 2BLLA 1H22A 2YFKA 4K1LA 4F46A 2UYPA 4R31A 3G59A 3RT1A 1N32B 4YX9A 1M0WA 3U7HB 2BHRA 5A6SA 3DLPX 1VG8A 1HURA 3FPHA 4RLHA 2VXCA 4O0LA 4AI6A 1PI3A 1W0KD 2WFMA 1BKDR 4NYMQ 2I33A 2ZSDA 5J1SB 2BMWA 1FW6A 4BTEA 5CDGA 4PSAA 2G76A 2IS2A 1B6SA 1UJCA 1E2BA 4L57A 3DBHB 3K8ZA 2Q2VA 4AROA 3DEJA 2DQ3A 1EQAA 1LLFA 5EWMB 3ASNB 1BL8A 2XAQA 1N75A 2WIJA 1OCRC 4XB2A 1GQSA 4GC9A 1PNQA 5H70A 1HK7A 2RDMA 3WOHA 1EWVA 2C5BA 2B25A 4DIMA 2Z98A 3AX6A 4KXLA 4TTQA 2W2PA 4X7PA 4YPVA 3F47A 4K9KA 1R8SA 4R4JA 1ZA2A 4B34A 4L50A 2PT7A 1C30A 4B32A 1FSFA 1ZRMA 2ECOA 3PTZA 3ICWA 1K6JA 4RVCA 4XRRA 5E6SA 2FPGB 1Y7TA 5KJEA 1JSRA 4YRNA 2BFEA 1NR1A 5K3FA 3B9QA 1B6GA 5B2FA 3GVXA 4OPHA 2D2EA 2KG7A 3DCYA 3PXCX 2NYUA 3DUFB 4G5GA 4MVJA 1QZXA 4GUAA 4LKRA 1GSHA 2N05A 1FRQA 3MQ2A 1R10A 4MIKA 4UKDA 1GX1A 1U7XA 3KR9A 3ORSA 4MR7B 3C3PA 4RLSA 2Q41A 3HSYA 1VHTA 3MT9A 3OU2A 5DI3A 1H2KA 1Z08A 1LS6A 1MMFB 1F17A 5JMTA 4RQOA 2R4UA 4AXBA 1X1EA 4TKUA 1RXIA 5G4LA 3B3JA 5HXZA 2B92A 4MJXA 1OBFO 3KZXA 3M82A 1W4AA 3PUVA 2CVOA 4L6CA 1TW3A 1L5GB 4URXR 2BF4A 2C4TA 2Q9BA 3SF8B 4BCCA 1GPDG 1ISHA 1E1RA 1YS7A 1ZWZA 2CBZA 1O97D 3M1LA 2CL7X 3FFWA 4DHWA 2FUG1 3EDRA 3UPDA 2PUAA 1YZFA 2HJVA 2C04A 4FXOA 3TO5A 3ZXIA 2A0YA 1AQNA 3JAMM 2B8EA 1UFVA 3ZOPA 1JJ7A 1MEJA 1VE6A 1ZOLA 3BORA 3ELWA 1TA4A 1VJDA 3WB2A 4FMDF 4NOMA 2JGNA 1CVRA 3RU9A 2BGWA 4JLJA 4INZA 3S8MA 1LJUA 3T7EA 3GTZA 3R0ZA 1P7CA 3WGOA 2JIPA 3NYIA 2OECA 3NK7A 2Z43A 4UARA 3OAAG 2XBUA 4XWAA 2V6MA 5KI6A 2I71A 3LY8A 1R1MA 2CVLA 1XPOA 4ALLA 5F2EA 1V55B 2JARA 2QX6A 1EVYA 4IVNA 3Q7RA 5AI5A 4HEHA 3BWXA 2VJPA 4YMWA 1BMFG 5JJEB 3FKSA 2R6AA 3IUYA 4GPIB 2CFIA 2IIPA 4MV7A 4RW0A 4S3MA 4YRDA 3VDXA 2NU6B 3MGCA 4PYMA 4ZAFA 5GJVC 3IALA 3CCVF 3MJCA 4C4SA 4DYDA 3N05A 1P7GA 4QXRA 4YT8A 5A4AA 2VPYA 3DOOA 2B78A 2PVSA 1NUTA 4L3VA 3RIMA 5T64A 3ZHBA 5FT9A 1SZJG 1X25A 1UODA 1NVMB 2FX5A 3JQAD 3N8IA 4TT3D 2OYCA 5BT8A 3H1BA 4X44A 4E5SA 3DEKA 3H0KA 3C43A 5LOVB 2CV0A 2W6JA 3CCEV 2PA0A 1YUBA 3FVVA 4QJ5A 1K3UB 1RM3A 2C42A 2P9JA 5F2VO 1BCRB 4IWYA 4R0NA 2GDSA 3MBMA 3AHEA 1QVGU 4B8WA 4IZ6A 1J21A 3KEFA 1YCIA 2JEUA 1JU9A 2GCPA 1Z22A 4RSMA 2C7PA 5A2QM 1SDSA 4LQLA 4CLOA 3E81A 3JZDA 2NVOA 4LPKA 2IEZA 3ISVA 2PL9A 3J7AU 1ZI6A 4IXDA 1YGYA 4WNAA 4R5MA 5B1YA 2P2DA 4I99A 3LI2A 4HDAA 1XDBA 4LBVA 1DV1A 4RPCA 4QOIA 5TQ2B 4R8KA 3SQDA 4Z6KA 2G38A 3ZLUA 1V7QA 2PLNA 3CCLF 2Q4DA 3NHZA 1WW3A 1BTOA 2D13A 2HDWA 1ZOIA 4P33A 4DIEA 3C1UA 1QR8A 3FFMA 3GIWA 2HPHA 1W0JD 4MV4A 1VMGA 4DN6A 4RKQA 1JDBB 2ZFUA 3E15A 3HXPA 5L9AA 4GU5A 4QE3A 5EXDA 3HFGA 1KOGA 3IBTA 4G0NA 1YT5A 4ASUD 1OH8A 4KR7A 1J1UA 2AIFA 2G82A 3AUUA 1XA0A 3TDKA 4B4KA 1DX9A 3N7UA 2VUHB 5DCYA 5BVGA 3VJMA 4G8BA 3PC7A 3VR2D 2AK2A 5IBQA 1YFLA 3RYFB 5AK0A 1IV2A 1J90A 3R1IA 3E23A 3VJKA 3KKYA 1ENYA 3MINB 4I0XA 4I4LA 4EYKA 4GL2A 2ZKOA 4AUEA 1O9GA 4X41A 4UBMA 4ZTZB 3ORHA 5AVMA 3OEHA 3HYRA 3VNQA 1UAGA 2XOKA 2V6GA 1PK9A 4HFNA 4DJDC 1E1CA 1EM6A 3DVQX 4YAGA 2AA3A 3NHBA 2CZWA 5HNKA 3E20B 3QWHA 3D2AA 5TY0A 1NZFA 1LD3A 1AR4A 1U3PA 2UV8A 1OTHA 3IURA 4OBEA 4QU8A 4ZT7A 3TLAA 4E4RA 5JARA 2CD7A 3VQWA 4XGRA 4ABMA 3UENA 3HL0A 3VYSB 4A03A 4ZRMA 1WMSA 4IUYA 2W5UA 1TVEA 1XUOA 3OQ6A 2CXPA 2CKDA 2XE8A 2XYVA 3MG9A 4LEIA 4ITUA 4J0EA 2WSBA 1YAJA 4EMTA 2QW1A 3WIDA 4RE5A 1X8KA 1XL6A 2E7ZA 4WLNA 1GYPA 3MTGA 5DMXA 1NP6A 4BP9A 5ALGA 3AUKA 3JVIA 2FUG6 1MCZA 3F5SA 3N6VA 3MXTA 4XM1A 5DKFA 4LJ8A 3RK0A 2D3WA 3LW8A 3SLGA 3UMSA 1HUQA 3BFKA 3C3JA 3ZE9A 4CF4A 4YJ3A 4YUVA 5J47A 4F4JA 1P29A 1VP9A 3ENZA 2AFIB 4IFEA 3HA3A 3QRWA 4TKUB 2RK3A 3RADC 2Q8NA 1PR1A 3OLWA 3PGKA 2QB5A 4TT8A 3DYVA 4B3TO 4CF7A 4ZGWA 2ZBDA 3K20A 4FSDA 3E3OA 4H6WA 1XJ0A 5KYTA 4YHHB 1J0CA 2CHEA 3UA3A 2WHRA 3C9RA 4B3TB 1D1QA 3GJZA 3ONNA 1HQCA 1KJNA 3KQWA 3GXBA 1QQ6A 1BE0A 4TTPA 4DPLA 3K0TA 4EJFA 5A1TA 1V3QE 3PWSA 1XHXA 3Q11A 2C9DA 4Q9KA 1SKBA 4X9XA 3TRKA 3VBCA 4U7DA 1VQ8F 4RY8A 2PMPA 1S7GA 2WVJA 1I3OA 2ZSJA 13PKA 3S3WA 3UO3A 1TMKA 2DQ0A 5DRYA 2XUMA 5IJ9B 3BCSA 1QLWA 1U9IC 1VPVA 3O4IA 3INTA 2C2ZA 5BQ3A 1CBUA 1N2IA 2X3FA 5KYXB 2C5LA 5KA5A 1QGAA 1EFHA 4G1BA 3ZEDA 4JX8A 3AUFA 5DPMA 2OTLV 4N7MA 1J06A 2SNIE 2RH4A 1TU3A 4KQCA 3ZY3A 1P2VA 3FHCB 1GD1O 4R9VA 3QITA 3DP9A 1Z2DA 2OV2A 3L5OA 2EKPA 4FYYA 2YV1A 4NKGB 2FZVA 2MR6A 2UYYA 3CTPA 3GLKA 2CGEA 4NABA 1G59A 4BW0B 1DQPA 4FWTA 3MWLA 1MJ5A 2VJBA 5F78A 1IV3A 2QP3A 4NYIQ 5FULA 5IYZA 5TMBA 3UAZA 3FAVA 3CVUA 3DJFA 4OHVA 3FYCA 4M83A 2ANCA 4GSKA 1EGHA 4Q4AA 3DOHA 4BMSA 3D8TA 3LYLA 3CUKA 3T52A 3AJEA 1H93A 1S89A 2JJ1G 2AOUB 3DWIA 1X39A 2E18A 2JIQA 3QQPA 5BV2P 3RWBA 3OWOA 4RDCA 1YVEI 1UM9A 3BX1A 4EJ2A 5KDOA 1K3TA 4LRSB 4X6YA 4H6PA 2OD2A 3ZVMA 4R51A 5CNJA 3LWOC 1LC0A 2O6LA 6GPBA 1JVMA 4DRXB 3WNZA 1KAEA 1NQUA 3HCWA 4DA0A 5CDFE 5U9CA 4HN4B 1T5EA 2HF8A 4ESEA 2GEVA 5AXAA 1T2CA 2DWPA 3W7WA 3VTAA 5D86A 5FFFA 4IRMA 3C74A 2PBZA 3LVBA 2Z83A 2ZRAA 4UVHA 3UFXA 3ZYCA 1U3LA 1ORWA 4I1SA 4H3VA 1KU6A 3GJ5A 3ERCA 4FW9A 1H1DA 3HA7A 4BT6A 3LBNA 3DB2A 1E69A 4FK8A 5CT9A 1G64A 4A6PA 1N6OA 2Q1WA 4LWPA 1EFRG 1HDYA 4MYHA 1XTPA 2HBZA 3SS7X 1IY9A 3CS3A 3OKPA 1D5CA 4BMVA 4D25A 5GIPE 1VHDA 1R8JA 4DGSA 1XAGA 4CTOA 2CE2X 3G23A 4IJUA 3ASNC 1HM5A 2IYNA 2OCIA 4MGIR 4DIUA 5KQLA 2QTCA 1V5EA 4JX9A 4PCUA 2A9KA 3O5AA 1V9LA 1DIHA 2FHSA 4YFVA 3PDHA 4UNRA 1VKJA 4JLMA 1DX6A 1JFRA 5EESA 1G8YA 3SQLA 5JJ5A 4ZOLA 2NTNA 1Y4SA 2WK1A 4GOXA 1CUYA 4HFRA 3UJ3X 3OJLA 1TKBA 3KQOA 3JWJA 4FEEA 4OIFA 3KPVA 4LDRA 1LY1A 1FFCA 1MABA 2C5GA 3ZCUA 3CSSA 5K01A 1U65A 3ZY2A 4RGQA 3K73O 1TF7A 1VJ0A 3VYUC 2ODPA 3EVZA 2YHSA 1KQSU 2CZQA 3GPDG 3H8WA 3R75A 5FOUA 3VKUA 4CFZA 5JAOA 2AFVA 2GOYA 2PS0A 4JJ4A 4U1RA 4K0KO 3HPLC 1GZ0A 2F9LA 3AQIA 2WBLC 3K92A 2R5NA 4HX2A 4QXAA 4UB6Z 2PUVA 4ZO8A 3EDMA 4YCJA 1UMCA 1MQAA 3B2EE 4WV3A 3RFUA 2YI8A 1IU9A 1HOTA 1XTUA 1OIXA 4L5CA 1RTKA 1KVUA 1RWNA 3A1EA 4BKPA 2AKEA 1T2UA 5K6AC 2PKQO 4ND8B 4JENA 2YOGA 5JOQA 3UUEA 1XT6A 5J3JA 4LY3A 2P75A 5LZ8A 1JOYA 1TM2A 4EA9A 2CWWA 2HG5C 3JQFA 4HVTA 4M89A 3HVRA 2C5HA 1HPLA 2XEDA 5HJ5A 1BE6A 5LOVF 1DC4A 1IAQA 4YJ2B 1YFZA 2ZT5A 3A2MA 3GRYA 4DT1A 4MTGA 3PFWO 2W8BB 1T8SA 4O08A 3QO5A 3LT2A 3CVWA 3OONA 3F6PA 1W36D 4ENSA 5BN5A 2QS9A 4KW7A 4OQFA 3T06B 1FB5A 2BFFA 4ARZA 1H6BA 4O02B 4Z4QA 1LTKA 2GPSA 2LNDA 4IVRA 4JLKA 4CEHA 5K1XA 1M2VB 1V8OA 1Z4MA 1NZ6A 4LXQA 4DANA 2PI4A 3B09A 1UFQA 1XZMA 1W9MA 2EZ4A 2QWQB 3ZW9A 3BTVA 2IEDA 1HDIA 2VCYA 1OAOC 1ETUA 3DHVA 4ZVKA 3V7UA 4US2R 2H94A 5K05A 5HHTA 2YNMC 3ILHA 1UJNA 2WJZB 4H37A 1TB4A 3LUGA 3PNMA 1NFQA 2B2NA 2GAJA 3TW0A 2YXEA 1A8HA 1RNLA 3K35A 1VH8A 4JI7B 1C29B 5T3UA 2C4UA 3SR4A 4YY3O 3OPYB 1ZONA 1YJAA 3ZZ1A 1P8AA 4Y1EA 3TIVA 3ZHOA 5FH9A 3KL4A 1Z5VA 1X1QA 3PQ8A 4YP7A 1NVFA 5G1NA 2Z8XA 2DWDC 1CN7A 1XSEA 2H5JA 4ON9A 4P3OA 5LQJA 1VLVA 4HRVA 4E3WA 4KYUA 2QJTA 1JU3A 3KX2A 2JIBA 5ADUS 5GZ3A 3K1JA 1XHEA 3UJCA 3RHSA 3V9AA 1GVNB 3FRJA 2QE7G 3Q85A 4G81A 1G5IA 1U98A 2AF3C 2NTEA 3KVOA 4E5PA 3JU3A 1CR6A 1TKCA 4OUKX 3LS2A 3CRMA 2P6RA 3S0YA 3P0RA 4EOGA 2II6A 3LL7A 4XJVA 3V4PB 2EGUA 1G8JA 5AJXA 4LSWA 4MLPA 3CBQA 1CXZB 1II8B 4MINA 4FKMA 3JASA 2JGEA 4MS4B 4CM6A 4F04A 3GCWA 2VJOA 4ZI7B 1U0LA 4W6ZA 4Q82A 3VU8A 1XDCA 3ZIAG 4FFDA 4XIJA 1CVIA 4JVNA 5LZ5A 1JG6A 3V8NA 3AETA 1NTOA 2G6BA 3E2PA 3WRXA 3AK3A 4CM9A 4JJZA 2Q69A 4LJRA 3V4RA 1YJQA 5L6LB 5HY0A 3ANNA 1PR3A 3HU2A 3R0VA 4J76A 4LISA 1A9XB 2GVZC 2D2IA 4WCFA 3I6ZA 2ZANA 1WABA 1H66A 3RF6A 4UOZA 4H3HB 3AM1A 3KJKA 3JY6A 1NYRA 4C0WA 5ICCA 2FP3A 1DBFA 2WLJA 4UXHA 1NP7A 4A1FA 3LUFA 1VBMA 3TRIA 4EA7A 4ZQGA 2DUNA 2QN2A 1D6SA 1FYEA 3N4ZA 5DI9A 3E3AA 1H42A 4FWBA 5IASA 1PX2A 2OHOA 3FN4A 4RTMA 3AZOA 4C6RA 3DKKA 3QPVA 4I1UA 3WYAA 5CA1F 1I0LA 1Z7EA 6LDHA 5H9VA 1S2NA 1SUCA 1VP7A 2P91A 4O0MA 5DSZA 4EI7A 2HM7A 1P7WA 3HV2A 3I53A 5JJJB 3MD0A 2IYQA 3CNBA 3IQWA 4JI0O 1UBTS 4ZT6A 2N1BA 3RVDA 3TFWA 3ZJZA 1O54A 4MVJG 4XQ9A 1FTYA 1EN5A 2QLTA 1VLHA 4D42A 3DSQA 1PYGA 1XCBA 5EE1A 1XRQA 2FSSA 3O85A 5EFZA 3ASZA 4LF5O 1YKSA 1V1JA 3BJEA 4G89A 4XUGB 1A27A 4D92A 4BGDA 2ATCA 3CUSA 3GDHA 4J7CA 5DTJA 3RGGA 3DPUA 2HP0B 6Q21A 3ROPA 4CKYA 1CS0B 4UNQA 1VKRA 4TQFA 1I1QB 3D01A 4Q20A 2O7SA 2ZW9A 2CCGA 3A1VA 3NUQA 1C8BA 2ATEA 1U3TA 4HWSA 4NE7A 3UMMA 3G80A 4XH9B 3EZ7A 2HQRA 2EW2A 2ZIGA 3CT6A 3E2EA 4DUZO 5FRDA 1HR0O 1E99A 1AVMA 1ISRA 2B9VA 3CEAA 3ODPA 4EHAA 4MVJP 4TZKA 1BCCH 1U7HA 4FZ1A 2J5BA 2YCLA 1THTA 4FS3A 4AU1A 2BDEA 4B43A 4L16A 3ZHRA 2YQ4A 5HFNA 4O6VA 5DCWA 2HU5A 1RS0A 2UXNA 3EF0A 4RJIA 3RS4A 2IOQA 3X1ZA 1IDSA 2FUKA 2ZS7A 4X24A 3NTOA 3LHFA 4IIJA 4HWRA 2D1TA 4LRUA 4A91A 4BQRA 3ZCXA 4IVPA 1HLDA 4A6EA 4BWFB 3MWEB 5AHOA 3VUFA 4DUGA 3EWSA 5BMOA 4MR9B 3W78A 4K9QA 4F4IA 1JYFA 1QK3A 3CD6V 4PAQA 3TLBA 3HDYA 3VOTA 1CZKA 2BE3A 1JLLA 2GPBA 3DL4A 2ZIOA 4MWTA 4WKGA 3TSWA 2ZE6A 5CMLA 4UCVA 3MS4A 4F97A 3BBLA 3Q5EA 5KC8A 3S81A 1CR4A 1XLTA 3OZAA 4H3KB 2AMVA 3DDHA 1D1PA 1DNPA 1JKFA 4J75A 4D8WA 2XYPA 3CR3C 4FFNA 5L4NA 1NKSA 3CE6A 3M5DA 4FLFA 3FWKA 3TLMA 3BTOA 3ZGVA 4WUVA 4EY8A 3R8FA 4MHTA 4GCZA 1KY4A 2H92A 4Z1MG 3NAMA 1CUWA 1JIXA 3RVKA 3OEYA 4ZXPA 4XFKA 2EW8A 1S2DA 4RH0A 1B0UA 3FTPA 5TGZA 2JK0A 3TJMA 4BGVA 5ARCA 1UQTA 1YI1A 5A0FA 3TIFA 3CCMV 1PP9H 1IPEA 1I3MA 5E4YA 4DM4A 4DVJA 4EF6A 1MAUA 1KFEB 5IM4F 2IXEA 1RFGE 3TKYA 1HORA 3IC9A 2QT9A 4BGIA 1BJTA 5I9NA 4V02A 3V4ZA 4RU1A 2PRSA 3SBDA 1SCQA 4IP0A 3EORA 2FDCA 2X58A 1NV8A 2ZXWB 3GI1A 1N0IA 1AKEA 1V6SA 3ZRSA 1E8MA 5HQTA 3H19A 3N70A 2BMEA 5LDHA 2R8ZA 4JPRA 4XWTA 2VJNA 5KLVH 3DLAA 2HSDA 3M1XA 4HAMA 4KLCA 4EB8A 3M4SA 1TD1A 2IHKA 3VQTA 4BNVA 3T1HO 3C16C 1VQ5V 1IXKA 1DE0A 1DO8A 4RZ2A 5ER6A 5CIYA 4MDFA 1SK9A 1FF9A 1M90W 2YHIB 1O87A 5LR6A 3K70C 4ETNA 1QJ4A 2N04A 1RP7A 4BY9D 1D8AA 1W4ZA 2Z2KA 3LCUA 3I34X 3N3AC 1EJ6A 3PQDA 4JA0A 4KQIA 5IAEA 3UANA 2VWHA 1VL5A 3D8RA 4HCJA 1K7FB 2LUOA 4OL0A 3SS9X 4M36A 4Z7JA 4AMVA 5AUPB 1W41A 5B58C 2O7RA 5EBWC 4ZC8A 2VDKB 4E0BA 3QM1A 3VR4D 3F0TA 5EWLB 1JKIA 3WAKA 5KTNA 2ZAYA 5E3IA 2FPIB 1Q74A 3P4EA 3U9LA 3HBLA 4G0ZA 1N0HA 4P4TA 4CODB 1UPXA 1C0KA 3ZGOA 4F5ZA 3OBIA 1WB5A 1CQJA 2VSQA 4WESA 2HR3A 1H4VB 1XCLA 4A0RA 1HE5A 3PV0A 2Z9DA 1R7RA 3ZWDA 4WX2B 2ESRA 3C3BA 4F86A 1K98A 1BXGA 2ODBA 1PJSA 4HWPA 5ALJA 4UTRA 5CBPA 3E9EA 4H08A 4B31A 1JDVA 2CNBA 4Q6BA 4A4DA 1K7SN 2A0KA 2IKSA 4FE4A 1WSDA 3X43A 1BYIA 1CJSA 4UNSA 1NBMD 2R44A 5AQEA 3U16A 3AFMA 3ZMSA 3E2IA 3OFJA 2WV9A 4N8EA 3DONA 3FNGA 4J0FA 4DMFA 3L6CA 3MJSA 4MQUA 8OHMA 1T0KB 3MAAC 3CCQV 2PGOA 2BFDB 2IHZA 3PE4A 1HW7A 4QTUB 4WNAB 2FJPA 5LBQA 1U5AA 2HSWA 4Y9RA 3T9BA 2XF8A 2BGUA 3VYTB 4CXMA 3DE0X 5ITWA 4ND2A 1CEXA 1QRAA 2OGSA 2UAGA 1Z8DA 1GM7A 4OYHA 5FR1A 2OCXA 3W8DA 5CTAA 3K08A 5EMKA 5J5VA 4RZXA 2ADQB 3JD0A 1L8DA 3THOA 2YWJA 1DIBA 1Y1LA 2MIIA 4PGFA 2HL6A 2J7PD 2OXEA 3LH5A 5BR4A 4RX1A 2IXAA 3BVPA 3L93A 2ID9A 4KHPO 2J5RA 3O38A 1BHQ1 4UVEA 3WNCA 3WB0A 2X1VA 1FDRA 4TM8A 2FG6C 1QGUB 4GHWA 2HCBA 1BWSA 2I54A 4I4TF 1FTSA 1ITZA 3REQB 4W5NA 2HK7A 4D02A 1Z33A 4RKEA 3OOSA 5DYYA 3RAGA 1CTQA 3OIGA 1TMOA 3R44A 2HW8A 3GARA 3ZCQA 3I61A 3FZNA 3NGXA 3SXUA 3WL6A 3DE7X 3PITA 2ORYA 4TMXA 3QZUA 5DTQA 5DXAA 1H9CA 2EINC 2QKAA 2VJCA 2IAFA 3DBLA 3GYBA 3OOJA 4WGGA 4ZEOA 3B4SA 3UXEA 3UWKA 1Y4DE 3BZUA 4OXQA 3F7NA 1SHJA 2DQKA 3V4FA 3HCEA 4UUOA 5CW2A 2DHQA 3ZG6A 2DUUA 3LC0A 2PUWA 1SAYA 3PD1A 4XQGA 1R16A 2P22C 1K1EA 1FX0A 3ESYA 3QKSB 4IS3A 3ELUA 4UJ5A 5DOVA 1PUIA 1XMIA 1XREA 2HO4A 4AP9A 1JR2A 3SPCA 2ZYRA 3CX6A 5EIFA 1P0PA 3KS9A 3ZY5A 1JJBA 1FNBA 4BQFA 2O5RA 4TVOA 3RIHA 3DQPA 5IAGA 1CP3A 3QVOA 4L0QA 2O3TA 4DRYA 5LN1A 3C6QA 2BKAA 4D6YA 1JKXA 5AUNB 3U56A 1TT7A 4KPUB 4NBUA 2WFLA 3ZBHA 3V32A 4BLSA 2REXB 5DE3A 4P08A 5IJ9A 1A9ZA 2QXYA 4Z4EA 3F6BX 3NMUC 2XNDG 1Q1AA 3T1HB 2O9JA 2CD9A 1GKFA 1BROA 2H08A 3K8OE 4J1TC 5FLXN 2BUCA 2BTQB 4EUHA 1ND6A 4IGKA 4UHJA 5CIWA 1E3SA 1SZPA 5FNVA 4UULA 1X7YB 5HP8A 3CG4A 2R97A 4DR1B 2HU7A 3G5TA 1A69A 1VRCA 3HNRA 3AEUA 2DQ4A 3QV2A 3N7TA 3HDQA 4DM3A 5TPWB 4PBTA 3NETA 2F3TA 1XA4A 1XBIA 2QRGA 1OGJA 3KV1A 2ADFA 2WZQA 3MJVA 4X7RA 1XTZA 2YBDA 3H9UA 1AKUA 4GZ5A 3SJAA 4YCMA 2VDUE 4FMCB 2Q6IA 1KYYA 3KZ1E 2O07A 3LX8A 1XHOA 3Q4GA 1TJ5A 1VQ9V 3L70H 1VL1A 2X1LA 5EUBA 4TLDA 1XDSA 2FPRA 1EN6A 1Q90D 5B3AA 1O7JA 5JCOC 4QECA 1VBNA 2D5IA 5CM2Z 4IQ8A 1Z47A 1BA3A 1MOFA 2ARKA 2FHPA 3CF6R 5ICEA 1SBIA 1DEHA 4HNRA 1UWLA 3KDPA 1MZVA 4LKOA 2BEWB 3W4KA 2Q3MA 3D3JA 4N76A 3WJAA 1R5JA 2H2AA 3CVJA 5I7RA 3ELYA 4LQ4A 2IH2A 1L5MA 3FBGA 3UOGA 3KJEA 4CE6A 1ZL0A 4CIAA 4PXAA 1S2MA 2Z6AA 1Z0ZA 1K5QA 2F8MA 3U4HA 1Y9EA 2VSOA 4HI0E 1M6EX 3A4LA 3D36C 4BYMA 3P9RA 5EMHA 4D5EA 5J2TA 1C9NA 4BNJA 1C9DB 4G4IA 2ZQ5A 3REGA 4DV4O 1FDOA 3EFBA 4LYFA 1G0NA 1NRJB 2Y4TA 4X88A 1SD5A 1ZGJA 2VDMB 4CMKA 4IH4A 3HVIA 3U49A 1WUHS 5U4XA 3RU2A 1TAUA 4J7UA 5DVZA 3PA6A 1LV8A 5SY9A 3GZNA 4BE4A 1NH2B 1T34A 3PDWA 2DECA 2PSEA 3WWPA 4Q5IA 1XFDA 2BWJA 1EWRA 4H2DA 3NU1A 2IYLD 2ZYWX 2IYVA 4LY6A 1JALA 1QLNA 1MGPA 2VSFA 3HXLA 3MIZA 4PU0A 2PJDA 1VBFA 2RAPA 7GPBA 2M6YA 4NYMR 4NXNB 5EHQA 2ODNA 3L0YA 2PZKA 1XYYA 3EC1A 1MG0A 3EUAA 5G1OA 4C3VA 4X1IB 4HH3C 3FD6A 5LMCA 3ZE0B 4HZGA 4GFDA 2OXTA 3SYCA 3H1HH 3I23A 4I6EA 2H06A 3LBAA 2OZKA 5HBGA 3FFQA 1MDBA 3QFFA 3IHKA 4A27A 4EF4A 1YR3A 2XVMA 1FCJA 3AC0A 1Y63A 3B7PA 2WF6A 3CRZA 3K0CA 4IY1A 3UWMA 3J7TA 2YXBA 1BHSA 3BE8A 4GAEA 2AJTA 1VRVA 3KOYA 5JNLA 2CL5A 3MS7A 4B0PA 2EIMC 2ATVA 1AI5A 4BY9E 4BKRA 1ZM2A 3MW8A 3H0CA 3L46A 5DLEA 4DBZA 4HL6A 4WCEV 3NDRA 3D7MA 3BWDD 1YJBA 4DA8A 4LZJA 5E4TA 3WLOA 4JYYA 1C4WA 4G9GA 5CT6A 4NBNA 3IRVA 3O9VA 3ZWBA 3K9AA 4F1JA 4M55A 4DDVA 1ZGZA 4ZCIA 4LXYA 1MA0A 1V8BA 2GEDA 5J23A 3RHTA 2AUNA 1WHSB 2QTHA 4BZPA 2X9NA 1PTJA 3IQGX 3O4RA 3FH0A 3B2NA 3BERA 1GZDA 5BR8B 1EUCA 2IHBA 1GTG1 1MVNA 3PSAA 5F35A 4AJJA 4DCMA 3THRA 4QTTB 2J0QA 4PHFA 4G36A 4LJ6A 3K5PA 5LNK1 1QB7A 1JQDA 2G9RA 3OFKA 4LK3A 3A70A 4QPPA 4F45A 4KN9S 3AEUB 5AVJA 1Q19A 1NF8A 1SKUA 1MOSA 2FFJA 3AJDA 4PGAA 4DB4A 1FUKA 3DMRA 3HJNA 1HG0A 2HSGA 2OORC 4TRMA 3WHIA 5IS2A 3ADCA 1XZ8A 3W2EA 2BTQA 1IVSA 1G6Q1 4IILA 3AG4B 1YS1X 2WZBA 3BUSA 5FWNA 5ALRA 3B12A 4QPCA 2HIMA 1CLUA 4CLEA 2F1KA 3ONFA 4POOA 1MOQA 5E7QA 4X71A 4E1VA 1ISSA 3B9BA 3DVSX 3RB8A 2PMFA 2QM3A 4EX7A 3IBYA 4PPFA 1H4TA 1VL6A 1JG7A 4A5OA 3CJHA 3BD9A 3RVJA 1TE2A 4NNPA 3UVEA 3IQHX 1H6CA 4J94A 5F51A 1GILA 3ENVA 4C3OB 1Z34A 1TQHA 3GJ6A 4BO3A 1HQDA 2YN0A 4YBRA 1JX6A 2ECQA 2C88A 2E55A 1S8AA 5B3SC 3FOFC 3ERNA 4QGFA 2ODTX 2X6CA 3CWCA 1X19A 2UXDO 5LYJB 2CHVA 4TUYA 3AG1C 1UBJS 2XUQA 3AILA 2O3JA 1R12A 1B26A 2H48A 2QTGA 1BJKA 2ZU6A 3OPNA 4OGFA 4HBNA 4UVGA 4AP5A 3AVXA 1XVTA 5C4MA 5M2QA 1XMXA 2R7NA 3EPLA 2R66A 3DE1X 3I58A 1J4AA 2IPOA 3IJ5A 3N1UA 1B3QA 1FYFA 3L84A 1EGQA 2YVQA 4YAIA 1P17A 4RFLA 3W5CA 3T1CA 2EVWX 3APOA 4GMKA 3R23A 3OEHG 4NEHB 4R01A 3S8EA 3D4PA 4HDNB 3ZQJA 1BFDA 4KXRA 2HRRA 2Q9LA 2VT3A 5DDIP 3OJXA 4BO2A 1U8UA 1K6IA 4BFSA 5FWXB 1K33A 4B3DA 1NW3A 1L7AA 4KACA 5MFZA 4Y7CA 4R6XA 2JK1A 4MVJH 4KPUA 1TEHA 3ASOB 1FRNA 2FGKA 2FWAA 2QIPA 2W7TA 4IIUA 1NF9A 2FR8A 4LCUC 3R3ZA 4FZVA 4ONEA 3V1LA 1YU6A 1HZZA 3HSSA 2IH3C 4LMRA 5HX7A 1UT6A 5B1AC 2A9HA 3V1NA 1EUYA 3O65A 5GTHZ 5CM8B 2IU3A 1WMDA 4C4RA 3T3EA 5ERYA 3VAAA 1X15A 4RJJA 1PEKE 2CF6A 3DZHA 4OPMA 1IEQA 3L06A 2L26A 3CZRA 1E98A 2H4YA 2W9XA 2GAFA 4BL5A 1IBKO 1XTKA 2FEMA 5AOVA 1E3TA 4QVKA 4EJSA 2EQAA 3TNLA 3AESB 5LMNB 1K8XB 2VVTA 2ZBUA 2AJBA 3SEQA 2O8FA 3HDGA 3VYTC 4R1NA 5EP3A 1OZHA 2ZBVA 1ZRNA 2OV4A 5KKCA 3NB0A 2CVFA 3AVTA 3G4SF 5GJBA 2CWJA 4D3ZA 2WHXA 1Z3CA 2PT5A 3KCQA 3DCJA 5FJJA 4DLLA 3RU7A 5HIAA 2AW3A 5P21A 1WOMA 1YQTA 4XJSA 2DLDA 3GFRA 3ZE1B 2FPPB 3FIUA 1A2OA 4Z9XA 3LP8A 5FTLA 2F2TA 1QK4A 1ZCFA 2ZVQX 3DTYA 1Y8CA 3GLHB 5KOHB 2NLJC 4N8DA 3RC8A 2KHZA 3DVAA 6NULA 4RVOA 4OHPA 2IU4A 1Q3HA 2YV5A 1JVNA 5JCPA 1QK5A 3QMWA 3CY6A 1NC3A 4QATA 4E5YA 2IY9A 4C0LA 3FBAA 3TR0A 3GZTB 4BE7B 5JCZA 3I6IA 3LWDA 4XCXA 4EFNA 2Y1FA 3LDFA 3OCVA 3ND9A 4M1OA 4BRZA 2W2TA 3IJPA 2L69A 2QXUA 2ETNA 2ZBFA 2PVPA 4JI3B 4IIGA 4OV6B 3H9BA 2ISCA 5LNK6 2GJ9A 1PL4A 3R6GA 4PAOA 3GPCA 2PWYA 3TTTA 2F3QA 3H9JA 5FV7A 5EXSA 3T7JA 3O26A 3CP1A 4DCGA 4O4LB 6AT1A 4RZSA 2HQSA 1NOKA 2VYFA 2YWEA 2WKWA 2GUZA 3BMCB 4PINA 2C5EA 5CLLA 4WFGA 1GFWA 1WULS 3F6SA 1H2XA 2EQBA 4V1CI 2FKXA 4MTOA 5DNUA 1JQKA 2XMCA 3KEOA 4I1RA 2CTWA 3A9TA 4K3UA 5ESRA 2QNRA 1L4YA 3L7OA 1MFPA 5GMOA 3JWPA 4M9CA 2W42A 1DAGA 1ZKMA 1QYVA 2BEVA 1OZAA 4L75A 1E2IA 1EDZA 2VCEA 3A9SA 1U90A 4I55B 2YR0A 3F5DA 2RGEA 3HS3A 1Q0SA 3K2EA 5EWJA 2O06A 5F1KA 1BE1A 3S3XA 1Q1BA 1ACMA 2IL1A 2WJWA 3EZFA 3K05A 4M22A 1ZNXA 1XQ8A 1T6NA 1QXSA 3NHUA 4N8SA 1FTNA 4CIYA 1J0BA 1NSYA 3L8HA 5I7SA 3UKJA 4ND7A 3L1JA 4NWOB 3GGJA 4HQKA 2ONYA 1TIBA 3C4JA 1M1KH 1W2BU 1IPHA 3DMNA 1T2NA 3DVLA 3HV0A 2IODA 1S6YA 2J9FB 3C8DA 4X54A 4FPXA 1S0VA 1NVUQ 2HPVA 4G56A 4CCAA 2X2FA 5LQMA 2C4WA 3B82A 1OI3A 3K09A 5SZJA 3T35A 4Q00A 3FDZA 1V8ZA 4KQKA 1QYIA 1LQUA 3DMFA 4QUDA 3JALA 1RI4A 2J4FA 4J8PA 4CIDA 4P0QB 4AKIA 1RLMA 5HF9A 3IAYA 1CNEA 2P77A 2YXPX 1M1YE 4HHEA 3F0GA 5LQCA 1E4YA 1PK7A 4H16A 5KYNA 4EEQA 4LYGA 3TLXA 4CDMA 3UGJA 2PEYA 1NBAA 3UQ8A 4U8HA 4DADA 4MKIA 2H63A 2IUFA 4LF6O 4AF8A 4AY4A 4IDBA 3DNMA 4KLNA 4DLAA 1V35A 5EMLA 3I2KA 1E9AA 2GBPA 4RQUA 1NKDA 4DPKA 1YRWA 3PQ5A 3DBRA 4N5IX 5DBEX 2QRZA 2ZQYA 1LK0A 3BA6A 5K6AA 4FU0A 3FWPA 5FFNA 3UM7A 1JPXA 4UQPA 4UDYX 1Z0KA 1BE3H 1C7QA 1PJ2A 2GYUA 2OYSA 2ST1A 2PXXA 3AG6A 3U7QA 3W9UA 2AZDA 3WV4A 4NXMO 4TYNA 4MTXA 1G20B 4IHJB 1GGKA 2JEOA 1JSLA 4G5SA 2C3OA 4FT2A 3PEUA 1E3LA 3HR4A 4QDJA 2QROA 4MZXA 3WA6A 2BFEB 1N4CA 4AMBA 4Z54A 5FOQA 2JI7A 1YA4A 5IW8A 2XRZA 1BOOA 1EXNA 1Y66A 1V7CA 2QL9A 3R4VA 4GXRA 4J49A 1FNCA 1KQSF 2PLRA 3I4FA 1UINA 2GJKA 5EY5B 5JG7A 1MQ8B 4HGNA 4YALA 1PV1A 3G8BA 5JS2A 2PS9A 4JBYA 4NICA 4YMTA 3CX5F 1M6VB 1UMDA 3UQYS 2VYNA 1UC9A 3WKCA 2QM7A 3DXZA 3ASUA 3WTBA 2Y2VA 1SD2A 1T8YA 1JDBC 4NXNO 2TMKA 1DIAA 1OAOA 1ZG3A 4HDQB 2Z1TA 1YB2A 4B75A 4C0SA 4Z4FA 2W93A 5DNAA 5EO3A 2JL1A 1RWVA 3SQNA 5F5LA 4ZEWA 2QTTA 4D0NA 3RFRA 1RSOA 3EEYA 2P5OA 1IN5A 1SVOA 2DPHA 3L7DA 3V42A 1SQBH 4CTNA 4XDJA 1DQSA 2GO7A 3CSUA 5F9HA 3BAAA 2A1TR 2OHXA 4JT2A 1CY8A 3GCDA 1J0EA 4JI2O 3H4MA 5K8IA 5IAJA 1ECGA 2JGDA 3D3IA 3URKA 4NFYA 4N5DA 1AILA 1P9NA 2WSIA 3EXIA 4DOMA 3T7CA 4ETIA 2QPTA 1MZFA 3IDFA 2QZJA 1E2JA 1PGQA 3W5JA 1FXHA 4EB6A 4FWIB 4A6XA 2O8DA 4H77A 1ABEA 2RJNA 4Y1FA 2B0JA 3WB1A 3OLYA 3TEMA 2Q62A 3OCUA 4OGLA 4UUNA 4I9GA 3UCXA 5KPDA 3GGCA 2W6NA 2Z1EA 3DE6X 2Q1XA 1UFKA 2OCCB 3DL0A 4MVJF 4AIIA 4BFWA 4CMGA 3MDSA 5A7FA 2LBPA 3GUYA 3THWA 3VKHA 3PTLA 4D99A 4UEKA 4C82A 4PJ0Z 4ZOLB 1JAXA 1RQRA 3H8VA 3OM0A 4J91A 5AJUA 4H4EA 3KLNA 1JDTA 2ZRPA 4HDSB 4H1WA 3NK6A 1HDOA 4JUFA 4TGLA 4Y6SA 4HNSA 4BEJA 5FI3A 3O2SB 3HJHA 1F51A 1U99A 1VA5A 1KFCB 1GUYA 2Q0HA 4QRDA 3CRW1 3R8XA 2CFRA 4GKAA 3BWBA 1HFEL 2UXBB 4FFWA 5AKHA 4OQZA 4WY5A 3T4UA 4GBGA 1P7VA 1S1MA 1NRXA 621PA 2H11A 2VAXA 2VF2A 4RO0A 3HKCA 2A33A 4UNNA 2XLBA 3CNNA 4CG1A 5IJAA 5IMBA 3DMYA 4QGSA 2NN3C 2GYWA 1CFZA 3MPOA 1N2BA 1IV1A 1OWMA 1FU7A 1P44A 1UKZA 3KXPA 5KCMA 5HP4A 2RGRA 4HGYA 2V5AA 1IH8A 1YTUA 3EZNA 3DULA 2HYIC 2VFAA 5DHTA 1J5PA 3B8HA 3ZLVA 3H8JA 1LWOA 3JAMN 4ENVA 3GGDA 4OJKA 4ZYYA 4JDPA 2BCGY 1L1RA 3IJ4A 1MIOB 4IQFA 3CIOA 5EB0A 1F4MA 1VC2A 3V6LA 2XZDA 3WLQA 4BWAA 1S3JA 4YA6A 1N5RA 3IOYA 2I2XB 2WUDA 1TUEB 2LXNA 4ISCA 2HAEA 4OBWA 4U9UA 1T9AA 4D7AA 2ICAA 2GHTA 2FKNA 4R8MA 1MRZA 2ZM6O 1ORIA 3L7IA 4LF4B 1CQWA 1E2GA 2GRUA 3SIRA 5IK2D 3FAKA 1B76A 2HU2A 2PYDA 4Q7JB 2GRAA 3ZMUA 3ZIDA 4GMHA 4Y6QA 5JXGA 4JYAO 4IIVA 4EH1A 1REQB 3CF4A 4JOQA 3WP1B 2P3QA 4QYIB 2CK3D 3CLUD 7MHTA 1A2KC 4YAWA 1JBEA 1XTSA 5DM0A 1M5UA 1BQZA 4CQMD 4N3NA 3Q3CA 4H6VA 4P54A 4YIHA 4F4HA 4IFIA 4JOCA 3V55A 2AXNA 2H31A 5IX8A 5K4HA 2DWQA 2F55A 1IN1A 3M49A 4PN7A 1CUZA 1FTWA 4TOIA 4YP6A 5JD3A 4KPFC 3F3KA 3JATB 2F3PA 2O5VA 2QM8A 5C8YB 2YJ3A 1CLIA 5E0OA 2G9IA 1X1BA 5HIKA 4PTLA 4M87A 4V0SA 3MTIA 5HZGA 1SBZA 3PKIA 1M1UA 1LEHA 3TR5A 1EXDA 1CB7A 3HTXA 4CGZA 3NVAA 3CRNA 4JT4A 1E4VA 2X5JO 4HAXA 4X1OA 4Q9DA 3TTUA 3T0FA 3ED5A 3SHOA 4AYXA 5A9SB 5IU6A 3C7DB 3W7UA 2O1SA 3GLVA 4EKDA 5GJWC 2QG6A 4QBTA 3TK1A 3V2HA 4URVR 3B77A 2Y1KA 3WXMB 4AJEA 1B4DA 5BR1A 4Y30A 1D7AA 4LF8B 1I6KA 3HJUA 1AZTA 4IDGA 4OO3A 1KRXA 1UR5A 2COUA 5JZMA 3QBJA 4I55A 4ESVA 4ZT2A 5ARDA 1BZKA 3CZAA 4JBHA 4OHOA 3S2UA 4TS9A 1ZITA 1RQ2A 3EYAA 1ZK1A 2Q5JA 4JBGA 5K4AA 4BVEA 1AUOA 1NRIA 3LE8A 5J2TF 3WK7A 4W9NC 5KKNB 2AEJA 3MWGA 3OBWA 1THMA 2NTVA 1ZIXA 1JAIA 3D7KA 4JLDA 5ENZA 4DIDA 5FJIA 2WM9B 2X0KA 1UKAA 1GGHA 3SYMA 1Z29A 2D0DA 2GZLA 1QQTA 1R4MB 4BIZA 1V95A 4G65A 2P40A 4M37A 4JROA 1WTCA 3THYA 5C5DA 2OGZA 3EB9A 4GH5A 4QARA 4J7XA 1VM6A 3NIGB 1JZTA 3ESBA 1DOAA 4F96A 2EARA 1BVRA 3EGDB 4H15A 4HQFA 1F4VA 1FDIA 2CEAA 4QBHA 2EKBA 2ZJ1A 3BRSA 3J80N 2A9PA 4A8HA 4XGQA 4RO2A 4F92B 2ZNJA 4R9SA 4CCSA 1BDJA 4GQIA 3PLAE 1MUUA 1B15A 1U8FO 2IW5A 1ZIPA 1ZUIA 2IHTA 1KJWA 2ZI4A 3FJOA 3JW8A 1QNFA 2MYPA 4NAHA 3FGPA 2IV3A 3TZLA 1KL7A 3G79A 3NYQA 4H35A 4X6LA 3R7AA 2FWMX 4IGFA 2H2FA 4COOA 3UBTA 3PNBA 1K7XB 3QO7A 4LYYA 1RRCA 1MF7A 4TWAA 1KVRA 2XQJA 1AA6A 2NXWA 5DWDA 2E5WA 1W29A 3O2NA 2ALEA 1D5WA 1DTWA 3K9QO 4A2WA 5C8ZA 2BKEA 5MGNA 2N3ZA 1SKQA 5E95A 1XQ1A 2B34A 3KALA 4HS4A 1XB2A 4LZZA 1LR1A 3HKBB 1R0RE 5HZMA 4OEHA 8LDHA 1E77A 1CUIA 3R2JA 3RUDA 3X2SA 3QIAA 3AUXA 1WO8A 2QMEA 3INNA 4G8CA 4YUWA 1MP0A 4IMPA 3CINA 1A8SA 2BISA 1N1MA 1IXBA 1T5IA 4MO2A 3R6TA 3VV2A 4JJKA 4GS5A 3QLEA 4XGKA 3Q8XB 3H04A 4V38A 3OMWA 1T15A 1VPEA 3PICA 4ZQFA 2ZB7A 4E30A 3K6JA 5AK3A 3P9IA 4PDLA 2CUZA 1C7RA 1TKRA 4PY2A 1M7GA 2YINC 2B21A 4J0JA 4UCOA 4KGVA 3U2QA 4ARCA 1IK4A 1X59A 4MCIA 1FYXA 4TSFG 1TTPB 4N5HX 2C7GA 2ILMA 2J0SA 5FLEX 1NWHA 2I87A 2QSYA 4BEVA 1UI9A 1MC8A 3ZWOA 1YHZA 4L28A 4AJ9A 2GX6A 1BD3A 1U7OA 3TUJC 4RENA 1ULTA 2CDRA 2J9YB 1T4DA 4ZVMA 4LS3A 2H9AA 1K7DA 4ZHWA 1B14A 2V5UA 3ABIA 1I8TA 3AHJA 4OXYA 1F9EA 3FMOB 3AUAA 4NECA 1RWOA 1YJNF 1Z0JA 5EE0A 3X0DA 4ZEMA 1ZJWA 1SG9A 5FLKA 2R6FA 2ZUEA 3KVYA 1QH0A 2I2CA 3FPGA 3A1UA 2VJKA 4INPA 3LUPA 1K7YA 2ZUSA 4ENPA 2Q3DA 3B1KA 3BD8A 3QYFA 1HRKA 2OCDA 2QQ5A 4LWZA 4K40A 3TAUA 4TT3G 3SC2A 5K0SA 2IBZH 3AG2B 1OX6A 4ASUG 5JHGB 2ZI6A 2XKKA 1TVCA 2PH3A 1XQ6A 2QR5A 1YQQA 2I3BA 3UMBA 4YLYA 1JTFA 1LFAA 3WK4A 3FMIA 3HH8A 3BAZA 1GL7A 2FFHA 2MMCA 2ZINA 3CNLA 4FCVA 2LBTA 1W5BA 3GP5A 2XCLA 1SN7A 3SOZA 1ZMOA 4A0FA 1KZ4A 4WL0A 4OI0A 1IBSA 2JIOA 4AKTA 4XDYA 4N18A 1CG6A 1XEXA 1IPFA 3BIFA 4LSZA 5IKPA 3LQFA 5B12A 2G7ZA 4EBBA 2HP3A 1XNQO 1SUSA 1XRNA 1IN8A 1S3IA 4JP2A 1ZMTA 2QUZA 1GM8A 4PSDA 5AJZA 3W8EA 3WLAA 4JAVA 4DCCA 3LYUA 3CH4B 3STUA 4BP3A 2WDPA 4R0VA 1RWKA 3A9UA 4V0ME 1SEPA 4PA3A 1AQLA 1RYDA 3I1FA 3QXHA 4MQFB 1KMIZ 5FXMA 5JLJA 4A15A 4BZXA 2GT1A 4YUAA 1RQPA 1B43A 2CHQA 1AJNA 2E37A 4N12A 2B35A 3QU9A 5EKDA 3FWZA 1DT3A 1LQ2A 2ATIA 3F4KA 2HTEA 2C78A 1ECLA 5FFMA 4ER6A 5CDYA 1UKCA 3FI9A 4HAIA 4BDTA 5HJEA 1X4TA 4UCRA 2AMLA 2VYVA 1ZQ9A 3OF2A 3IT2A 3IDSA 3OOHA 1VF5B 1OY1A 1ZZEA 4HEJA 1G8GA 4NF2A 4D44A 2EOAA 3M6WA 3NOOA 3QMPA 1N5DA 4MWEA 2Q45A 3L4EA 3SXUB 2JBAB 1TMGE 2YMQA 2HRYA 3TZ6A 3VC2A 3WMFA 4BQOA 1Q16A 4C4PA 3BS4A 4YBZA 3P8ZA 5TEWA 4ZQBA 5B4TA 4EPRA 4BT3A 1WDMA 2GBGA 1H48A 1NVBA 3VOSA 4D6PA 5C37A 4DCJA 4HRAA 1GPBA 1XHLA 1TU4A 3JAKA 1GUZA 2NP6A 2FDRA 3KV3O 1AI7A 4QJ3A 3UIEA 3KKKA 2X2EA 4J9YB 1YZHA 2JS7A 3C6BA 2OBLA 2GJSA 3OQNA 4HGZA 2IZ7A 2F43A 4OX9B 3N28A 1D3AA 4HPJB 2IYFA 2DRIA 2JAPA 3SJAC 3KHNA 2V0NA 2JFQA 2VBGA 4QOGA 1I4TD 1E1RG 3NBZC 3PR1A 4IJ6A 1XP8A 3EGCA 3FIJA 2E4ZA 2IITA 2VYCA 5KQGA 1PSZA 1Z18A 2ODEA 2RK4A 3WK8A 4CFYA 2C4VA 3CURA 1D7OA 3IE2A 3KETA 3F5FA 1K9MW 4IMJB 2LP7A 4OFXA 4U2EA 1HC7A 1GKIA 3TSYA 2QA4V 2AGAA 4BFLA 4EX6A 1Y0BA 1OH7A 1DXHA 3RUPA 3O6VA 3GLGE 4PG4A 3DP7A 4R40A 2AMYA 3BFXA 1FUUA 4OQ4A 5EXXA 4NBKA 4BNHA 1MFZA 5K0EA 5ELXA </