3JARB

Cryo-em structure of gdp-microtubule co-polymerized with eb3
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
429
structure length
429
Chain Sequence
b'MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tubulin alpha-1B chain
publication title Mechanistic Origin of Microtubule Dynamic Instability and Its Modulation by EB Proteins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 151
structure length 429
sequence length 429
chains with identical sequence D, F, G, H, I
ec nomenclature
pdb deposition date 2015-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3jarB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 3jarB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 3jarB01
1W5FA 3RYCB 4ZOLB 5CA0A 2BTOA 1W5AA 3VPAA 4EI7A 3HKBA 2VAWA 3N2GB 3JALA 4FFBA 3RYHB 1W5BA 5J2TB 5MN5A 3E22B 4KWEA 3RB8A 5LYJB 4I50A 4O4HA 5EZYB 5CB4B 5JH7A 1JFFB 5LXTB 4EB6B 4X1IA 3HKEA 5IJ9B 4EI9A 4O2AA 1W5EA 4TV8A 5JVDA 2BTQB 5LP6B 4ZI7B 4O4IB 1Z5VA 4WBNB 4I4TB 5GONB 3RYFB 4DRXA 4M8IA 1RQ2A 4IHJA 3M8KA 3JATA 3ZBQA 5IJ0B 4B45A 4F6RB 4O2BA 5ITZB 4IIJA 5KX5B 3WGMA 5JCOA 4I55B 3JAKB 4X1KB 2XKBA 3RYCA 3N2KB 4X20B 5EYPB 5M7EA 2GVIA 4HNAB 4XCQA 1TUBB 2XKAA 3UT5B 1SA0B 3E22A 3JARB 4LNUB 2RHLA 3R4VA 5EIBD 5CA1B 5JCOC 3HKDB 5KMGA 1TVKA 3JAWB 5LOVB 4ZHQA 4X1YA 5FNVA 2RHOA 4U3JB 3RYIA 2VXYA 4YJ3A 5CA0B 4O4LA 5MN4A 3WGKA 4FFBB 3JALB 4WBNA 5BMVA 5EIBC 2R6R1 3HKCA 4TUYA 4O4JA 5C8YB 4I50B 4O4HB 5JH7B 5JQGA 3JASB 1FFXA 3WGLA 1RQ7A 3HKEB 5ITZA 4O2AB 4ZOLA 5JVDB 4TV9B 4I55A 4X1KA 4EI8A 3N2GA 3RYHA 1FSZA 4E6EA 3WGJA 5J2TA 5J2UB 4DRXB 4IHJB 3JATB 5LYJA 5EZYA 2VAPA 5CB4A 5IYZB 1RLUA 3VO9A 1JFFA 5LXTA 5LA6B 4EB6A 3VOBA 4YJ2B 4O2BB 5IJ9A 5LP6A 3WGNA 2BTQA 3HKBB 4ZI7A 4O4IA 2Q1XA 4I4TA 5GONA 3RYFA 1W59A 2Q1YA 2R751 4B46A 2RHJA 3V3TA 3ZIDA 3C8LA 5IJ0A 5LP6C 1W581 5C8YA 4F6RA 4X1IB 5KMGB 3VOAA 3JASA 1TVKB 3M89A 4ZHQB 5KX5A 4TV8B 4X1YB 5FNVB 3CB2A 3JAKA 5MN6A 3RYIB 4YJ3B 3N2KA 4X20A 5EYPA 4O4LB 4TV9A 4HNAA 1TUBA 5BMVB 3UT5A 4DXDA 4U39A 3HKCB 4TUYB 1SA0A 3JARA 4LNUA 5J2UA 2VAMA 5CA1A 3HKDA 4O4JB 5JQGB 3VO8A 5IYZA 1OFUA 3ZBPA 3JAWA 4IIJB 5LOVA 5LA6A 2RHHA 1FFXB 4YJ2A 1Z5WA 4U3JA
chains in the Genus database with same CATH superfamily
4YRZA 5CBGA 1GRNA 1F23A 4FGWA 1GLVA 1KMHB 4A9AA 1Y3BE 5K0CA 1NASA 1CEYA 4DV5B 4YP1A 3OLXA 5IUNC 4RSGA 3DOHA 1J20A 2P91A 4MYCA 4ZAVA 4DE5A 2QLTA 4I2VA 2B7BA 3WQQA 1KDZA 4YR7A 3TSAA 5IM4A 4CE6A 2WAMA 3WIBA 5CEEA 3SVZA 1P8JA 2JGUA 1R0YA 1LTHR 2O2DA 1T9KA 2H51A 2N04A 4JSTA 1NBMD 2RDCA 2YHUA 3G1UA 1XZBA 4FT2A 3SU8A 3K0KA 2O2ZA 4DANA 2DHEA 2ANCA 2BGNA 3S2SA 4O3FA 2BEUB 4C0KA 3O94A 5F7JA 3PGJA 4R8VA 2DJIA 4C7XA 1NXWA 4UATA 1H7MA 3QENA 4C7VA 3K0FA 4B85A 1IMOA 2ZPAA 4HFMA 1FFSA 1NUUA 2L26A 3KR0A 4K81B 3U3JA 4MSUA 1HZJA 3GP3A 3Q8WA 2JGIA 3GFPA 2P4HX 4HN9A 4DUZO 2DFDA 4KIJA 3LWBA 1C30B 4CLHA 3FKSG 1ADFA 2YXNA 4OGKA 3KOXA 3CF2A 5DM1A 1R00A 3LX5A 4QOHA 5JH7B 4BV8A 1OAOA 4HTAA 3IMFA 4XD2A 5K8VA 3V1YA 2CUKA 1FA9A 3FTEA 5CFRA 2QQ0A 3AM3A 2HRQA 3P0JA 3DEYX 4DLXA 3VH2A 4C78A 1TEVA 4Z49A 5JJBA 2BDEA 1ZXLA 3DTVA 2ORIA 1PJ8A 1V0JA 5TGDA 3LPNA 2VQDA 3IDFA 1B8OA 1NKVA 1P5ZB 3OFNG 3PUIA 2J9GA 5CVEA 2DT8A 5D7NA 2BN4A 2K2WA 1AE1A 1RI5A 5EJ6A 1Z45A 1YAJA 3GPIA 2XLBA 1XQ1A 2PPLA 4K05A 1NNSA 3OPYA 5FUVA 4YC7A 4MDHA 2CSLA 4ZQBA 4RPLA 2X6AA 4V38A 1PCXA 4R3WA 1UADA 3AINA 4BMYA 3HKCA 4N03A 4H18A 2QNIA 2I4OA 3IQZA 4PELA 1SC3A 1TKCA 1VKNA 4P8RA 5KU1A 1PNLA 4REQA 1XN1A 2CJWA 1Y76A 3I2HA 3PIDA 4FUQA 2P9QA 4JUFA 1X1AA 2J85A 2GPYA 1PYGA 1IDN1 2RSLA 5JAZA 3WRXA 2XMPA 1P39A 4OHUA 1AK9A 4FC7A 2RHHA 4NMHA 3GO4A 4BC1A 4EFKA 4WAUA 4LJAA 4O0LA 3AKEA 4C87A 4AJJA 1W76A 2OYCA 2HNKA 4JU8A 1DC3A 4D3YA 3V42A 4B47A 1XA4A 1PFUA 3IAS1 5DI3B 4ENWA 3E8XA 1Z4IA 3T4UA 4NYIQ 4Z9XA 2MMCA 4QYMA 5JS7A 3M3HA 4KYVA 1T0IA 3WB1A 5LIPA 2MINA 2JEUA 5G3YA 4TZZA 5K3FA 4QD3A 4RF5A 1M5TA 4LE1A 1F8GA 3VU3A 3SZLA 1TMGE 4F38A 3V2UA 3B1VA 2IOFK 3GUZA 4GPD1 2GASA 1JHMA 3RFRA 1H2HA 4MQ6A 2GF0A 1AKWA 2EERA 4D9IA 1XRGA 4XAQA 3LCJA 3IUYA 5BNFA 4ZVNA 3OEEG 1GM8A 4OQFA 2Q0HA 1U2RA 4RBNA 4UAUA 4JROA 1DFHA 2IUYA 4NE7A 1U4OA 3SQMA 4F2DA 1EP1B 2IYTA 3DCJA 4MI9A 4PR0A 5H59A 3VAAA 3F0TA 3TIFA 1GFSA 4KWCA 5HKOA 1QO0A 1A9YA 1QKIA 4HDKA 5FAKA 3KCQA 2G25A 4S1TA 1R6NA 3ZU2A 1K7CA 1NY6A 4TYPA 1NQAO 2V7TA 3AR9A 3FFQA 4MO9A 2IBTA 3EOBI 1EH5A 4KPEC 1CUCA 3WWYA 5AUOB 2OSBA 2D8MA 4HV4A 2VAXA 4WXYB 2JL1A 3GL9A 3ZCXA 1PP9H 4AZ3B 1T6BY 2GEJA 3NVAA 1L7EA 4KXFB 2RKWA 2EVWX 4DNPA 4XLTA 1G63A 1YV9A 3KR2A 4LDRA 3SYPA 1HURA 4J9YB 4OJYA 1KQPA 5DTRA 2FPPA 3K9FC 4H7IA 2O20A 1TNDA 2FVYA 1F6WA 4FEGA 1QH1B 1OBVA 3QFTA 4R7TA 2FFQA 1SXJE 2O6HA 2A59A 1Z5GA 1ACMA 3P9RA 3DMTC 3RV3A 1HT2E 4U8GA 4OK3A 1OI3A 3S70A 1JDZA 1Q8IA 1W4BA 3B2NA 3QU9A 1DADA 2Y71A 3T7SA 3DFZA 4JI6B 1YIAA 5TARA 4J2OA 1QTNA 4MCAA 4BVGA 4H1VA 4XOIA 4IIUA 4B33A 4XBFA 2BO1A 3BMCA 3ZWDA 5ICEA 2BEVA 3MTIA 4KQ9A 3S3TA 4X1YA 2DFTA 1JEAA 3EIXA 1Z34A 2MDTA 4G24A 4L08A 3P27A 2ERXA 1FFAA 4DCOA 3ANLA 3Q3IA 4H59A 2EKDA 2OESA 2NVBA 1JI3A 3SYLA 2WU8A 5KYWA 1CIJA 2Y76A 2FOXA 5ALPA 1WULS 4MVJP 2QV7A 4DYDA 3OIYA 1EVKA 4G26A 5DBIA 2D00A 2FQWA 3GJ8A 1W4LA 4U7HA 1YF3A 4U2BA 4Y30A 4ONEA 1K9MH 1T6ZA 4AY2A 4K9PA 5JLAA 1Q3KA 3NHPA 1TKBA 1QGAA 1RT9A 1GNQA 3CG6A 4O2BA 4C43A 5EIHA 2HWYA 4Z0PA 1M8KA 3EGXB 4ZTUB 8LDHA 4WA8A 3Q1LA 1TT5B 2QL6A 1Y3FE 3GJYA 3W7VA 1RZUA 1M73E 3TXAA 3D54D 4DT1B 4IZOA 2Y1XA 3QNMA 4B6RA 1NVPB 4MS4B 3L7YA 4TS1A 3B82A 1VL0A 4PO9A 5MGNA 4XDGA 3ELBA 1E1DA 2OZKA 3SNKA 3OH8A 1M90W 2ORVA 2P40A 4Y2JA 2WWXA 1R0BA 5I7OA 2I87A 4XB1A 1O96B 1XMXA 3KFVA 1G4YB 2BCEA 3BQMB 3STYA 2Y2VA 4JLMA 4Q4CA 1JFRA 3C8DA 1S3FA 3UMFA 5MFZA 4Z51A 2JG3A 2BPOA 1BQEA 2ODQA 4ZQCB 1W2BU 3UV3A 2DUUA 2OT5A 3BIWA 4XD7A 3VHRA 3ADKA 5A7GA 1JHXA 1TMYA 1HNWO 2G8LA 4JLAA 3ETQA 4ZIBA 4MMXB 3CX4A 4RV9A 2BR5A 2WU4A 1ZWIC 3OETA 3E9YA 1FMFA 5KDDA 1JBQA 3K1JA 4RKFA 4HJXA 2WSSA 3N6XA 3AVQA 2VA9A 3WA6A 4N5NA 4AVYA 3MGAA 1FIUA 3D2CA 5CA0B 2Y69B 3N8GA 1VQ1A 3O4FA 3KPYA 4N48A 2HK8A 1T1JA 5BYAA 3ZWWA 3N87A 4FHCA 4L5AA 1V8FA 2PKQO 4FLTA 1MMFB 2QENA 4S0ZA 4NQRA 1YOVA 1NL3A 3B6MA 1H22A 2D1YA 2Z56A 4IH4A 2WFLA 5BUZA 3RA6A 2BUBA 3GMTA 1BX3A 4EEXA 5EE1A 3EEBA 3KZIZ 1A95A 3NVDA 2N0SA 1ECLA 3SXJA 1FDVA 2ZUUA 1U3DA 1FTSA 5AHOA 4GNKA 2PR7A 1AP6A 2P6UA 3NHUA 2YXDA 4BMSA 5HP7A 3FWPA 4OKNA 1JHZA 2B92A 3DZGA 5AG2A 2PGIA 4QIHA 3SC4A 1Q2XA 2OV8A 4WOCA 1R0SA 2MSWA 5E9QA 4UE6A 2VL7A 1YZFA 1VA4A 2OBMA 2XSZD 3N2KB 4R98A 4YR9A 4TWJA 2DMXA 2QR4A 3QVNA 4HVCA 3SIVA 4YRPA 1EGQA 4UVCA 2BFEA 1QHEA 4C2TA 1IB0A 3FB8C 4FTWA 4KITB 3CEIA 1E4EA 4A3SA 3OD4A 3D4PA 5CJ2A 2XT6A 1QB7A 2OKCA 1LGYA 4D0GA 4MTOA 2ZSEA 2YL2A 2QLNA 1CY2A 3WHIA 2A7QA 2F1MA 2FMXA 1QFJA 2Y1DA 4KL8S 1UP6A 3VGPA 3A1TA 4PCVA 2ZREA 1FRZA 3NDIA 2XTAA 4Z4IA 1SBNE 3M6VA 4JBLA 3K5NA 3W9BA 4R9VA 2CHTA 5GIOE 4QWMA 4HN2A 5LNK1 1IVNA 3JZIA 3MWYW 5A0VA 3U81A 2FJPA 2XD4A 2JFWA 5EP1A 1VQ6V 2QZSA 3NBFA 3DKVA 1M8FA 1OC4A 2P11A 1K86A 2EJWA 3BSWA 5CM2Z 2ZFUA 2MCFA 1L7XA 5BQ5A 4XI9A 3DEJA 2RGGA 4D0LB 5DP2A 3L74H 1RLTA 1DTSA 3NNSA 4M88A 2C3YA 2WSIA 3ZCRA 1JU4A 1QV7A 1MIHA 4JJAA 3L3BA 3L4BA 4WGGA 1VHLA 1SR8A 3NYIA 5BVGA 1M2EA 2VTKA 2HK7A 4O63O 2HB6A 3PVSA 1SEVA 2QN3A 4C7JA 3GEEA 2GM9A 1WBDA 3GJ4A 4MS3A 1GG8A 4JLUA 4QPCA 4JP8A 5EL0A 3R77A 3LX6A 5JG7A 4XIYA 3SJAA 4NU8X 4A2QA 3PK0A 1SUCA 3CTMA 3H2GA 3IIKA 5IY5B 4YRIA 4HH1A 3RS9A 3WL8A 1XDSA 2H31A 5HRUA 2W70A 1VJGA 5BXQC 4TROA 5TPWB 3TW8A 5HUQA 1FXWA 2IYYA 1JR3E 1DAMA 3P96A 2V7VA 3R6DA 4DFDA 1F2UA 2ZTMA 2FR0A 1Q0RA 1MC8A 4AMZA 5HIMA 5B2FA 4FC6A 1T0AA 5B7GA 1RC8A 2OK8A 2N46A 3P4EA 2DBYA 5JAHA 3AVVA 3TLEA 1XHEA 2H18A 4DWOA 3GDHA 1QFMA 1G0NA 2WM8A 4DDMA 3BGSA 4NDAA 3TJRA 2QGZA 3D36C 3W8DA 1FUYB 1IEQA 3VOAA 1G3IA 2ZT9B 3KYIB 1WHTA 1I6KA 3K1ZA 2AGVA 1VF7A 3T34A 5CA1F 3BZUA 3OF2A 3HPLC 2P8JA 2XAJA 2V7QA 4Z7QB 3EDQA 1IZZA 4N21A 3JAMA 4DR2B 2JJ2D 1GTG1 1GOTA 4F46A 4FIZA 4F84A 4PAWA 1T3HA 3SG0A 4N82A 4OGFA 3PEFA 3M49A 2QVBA 3CLSC 1A27A 4KQ1A 4LVNA 1Q19A 4RYLA 1KAGA 4HYYA 4RK1A 5M7EA 1OLUB 1PW5A 5FOXA 3P30A 4N4AA 1WA8A 2RQ6A 1P4SA 4W5JA 5D3MB 3F8TA 4DV5O 3GTZA 1OI2A 1RD4A 2OCYC 1E96A 3CNBA 1GFZA 3FOWA 2OB2A 1Z75A 3VVMA 4JS0A 2JDIA 1T25A 4XJSA 5A9RA 5EJ5A 2W2LD 1V1RA 5BVHA 4QEZA 2QX7A 1T5BA 3CT6A 1KO1A 4LRTB 2Y4UA 1IJFA 5A4DA 4FB5A 4UMVA 1OKKA 1YZNA 3TQRA 4BNHA 4X61A 5B3AA 5THKA 3A3NA 4Z2AA 2QS9A 4NOMA 2C2BA 2FW1A 1WJZA 3EDCA 1B00A 3MF4A 1XAIA 3USZA 4XQ9A 2H4WA 3TD6A 3UT0A 2Y0CA 5AKEA 1J42A 2C4KA 4GDMA 3A9VA 4CODB 1Y1KE 3AKDA 4HY3A 4QBKA 1F0NA 3EC1A 2V54A 1OX6A 1OD6A 4QKQA 3I9MA 4WLFA 1NR1A 3CWBH 2FCAA 3AJEA 1WN7A 5DM6V 1HYGA 3GHHA 3CZRA 2H92A 1M76A 1QKKA 2QTVB 3FIUA 1F6DA 5C4MA 5IEJA 1RWOA 5F1KA 3C16C 4IWYA 4BP3A 5JZSA 4D5EA 3M4JA 2DQZA 3C41J 5ESWA 3BMXA 3DV0A 4QT4A 3LQ4A 1PZXA 1ADBA 1I80A 1Q83A 2QGFA 2XEDA 3B9PA 4PRLA 2NO6A 4P4UA 2FWBA 1IE3A 1L1FA 1K7YA 2F7SA 2H7YA 3L7DA 1QNFA 4QUDA 1ZO8A 1E1QD 1P7CA 5LCXA 3IP8A 1G2QA 3M0EA 1WTCA 2YHIA 1E1YA 3G82C 2QDXA 3HSSA 3V1MA 4EG5A 2IHTA 4PZDA 5GJVC 2XTNA 1P45A 4MJ3A 2VDRB 2E1RA 5DYTA 1P2TA 3CX8A 4YHHB 3HM9A 1V37A 1JFFB 2WYHA 2ZUDA 4MYHA 2NUTA 2DKFA 3F4BA 3WZMA 3HO1A 4ITUA 4IJQA 2PBFA 4DJEC 5HUJA 4F72A 5ADWA 4RTOA 1ID8A 2VUHB 3HWUA 3HVUA 3LDGA 1YJ9V 2VRCD 1E9AA 1LLDA 4S05A 1HYEA 3N59A 1XHZA 3WOHA 1EVQA 3ZXIA 5EHQA 2BEWB 1FBTA 2OBBA 2FQ1A 1JLKA 2VHTA 3CINA 3CWZA 3DBRA 3N6RA 3K5MA 4YJ2B 3KB8A 1OILA 1UFIA 4WK4B 1Y6GA 2AJ8A 1Q81W 1ZDMA 3WC4A 1NLYA 4DR5B 3FYIB 2OILA 1J1ZA 3GQBA 5DJ5A 2QA4V 1VKRA 1R3LC 3WS7A 4ZCRA 3PNKA 5CDFE 4G2TA 4AO8A 1AH2A 1RBYA 1PNTA 2XUMA 5FLXA 2EP5A 3SCZA 2D0PB 1JJBA 3EDOA 3AXSA 3UMBA 1JEYA 2F9MA 3AIOA 2BMWA 1D2RA 3SC3A 3M6LA 1R9GA 4MW6A 1N2IA 3SEQA 2IUFA 3NAZA 1TL7C 3PRKE 2XE4A 4JGSA 2XKAA 2H2HA 2AUTA 2BM1A 4AW9A 3V2IA 2X0FA 3MZ0A 1WB8A 4MUFA 1NGSA 2VDWA 2HSDA 4ZFNA 2H8PC 1USKA 3FLAA 4DXAA 4ZC8A 2NG1A 3DXXA 4Q05A 4C0BA 4E12A 4EI8A 1JEDA 2A35A 5C7IO 3MUEA 1QU3A 1G38A 4CMCA 4IEEA 1K4CC 5DW3A 2Z2IA 3FF1A 1VG1A 3PN1A 3IQXA 1KDTA 2YV4A 3RT7A 3WDKA 1URPA 1IQUA 3EVEA 5JSKA 2Z8ZA 5K4AA 2BHNA 2YOFA 4M46A 2KQUA 4KXVA 5KPDA 2VNJA 1P7YA 1MA1A 2JZOA 3FYDA 5LA6F 2I80A 1GZ3A 3WGHA 3ON5A 1B43A 4HUJA 1PYDA 3GB7C 4DWWA 4QO8A 5AKYA 3UVEA 1OWNA 5BSKA 4HAYA 4JXJA 3R8XA 3U7QB 1P2VA 2RBGA 5FV7A 2C00A 5JBNA 3AY3A 4CMEC 2JAHA 1GGHA 5KQLA 4HNQA 1VMKA 5COBA 4H16A 4D3XA 1N5DA 3RJMA 4HMOA 5FTKA 1TM5E 3CZCA 1ILEA 3CCRV 1T4MA 1SELA 4JUCA 4OLFA 1M5UA 4AUNA 1MRNA 5DCLA 4KP4A 3QW2A 1G9XA 3L1IA 3P2MA 3DXRA 1WIWA 1AZSC 1GQQA 4YCDA 3GRRA 1KC8H 4CV3A 4UC0A 1LD3A 5DOZA 2V6MA 4YJ3B 1P1RA 3CCEF 2DFPA 2I0FA 5LQSA 1ADYA 2FMFA 5B3SC 1OIWA 1NYQA 3F2IA 1MFZA 4U7PB 3WMEA 3PQDA 1VFPA 2YI8A 2Q28A 4UXHA 1AO0A 1SQPH 1C4KA 3O6VA 5IN4A 4O4IB 2BR4A 1GN6A 3UATA 4G0WA 4OHZA 3MGBA 4PHHA 4XIGS 4OJMX 3GOHA 3VFDA 3S8YA 1XEQA 3HS3A 4JI6O 2AEJA 4TN5A 3ABLB 3GLFB 4EECA 5TB5A 2EIMB 1D2GA 4J1SA 3UK1A 3G67A 4EHIA 1V11B 2QT1A 3T8YA 2EDCA 2QTGA 3R1IA 3PD7A 3FDZB 4UUQA 1WW8A 1DO2A 4OBEA 5L3EA 2QLFA 3A27A 3V2GA 3WZLA 2DUMA 2AHYA 3MPUA 3K96A 3AYXB 3M6AA 2QTHA 2VYNA 4FW8A 3OR7C 3FPBA 1N9GB 1COWG 1JRLA 4IXTA 1N75A 4FHEA 3PL1A 3SPCA 1T5TA 3ZVMA 4F8YA 2SKCA 3UUEA 4RE5A 4U8HA 5IUKC 1C1YA 4RHFA 3GV0A 3ZJTA 4FIDA 3N53A 1YVEI 1QO7A 3UQZA 5JVDA 4REMA 1FVHA 4XVQA 2CVFA 3TIGA 2X8BA 3DS8A 4QTXA 4V1CA 4KAXA 4A0HA 2NYVA 2DWEC 1UJ4A 1NUPA 4QJFB 4BRSA 5EB1B 4QYSA 2IV2X 2GILA 2P75A 1J8FA 1ZGGA 4MMZB 5CNJA 1ZP6A 1SUIA 5IASA 5AVRA 1J1IA 3E15A 3QRWA 3RUHA 1R4MB 3HMKA 1EG7A 3FGOA 3DAFA 3VBCA 1UXIA 3DWIA 3UQ8A 3IEMA 1IN1A 3GBVA 3VSCA 1VCOA 3UGJA 2XIQA 1ISSA 3U1BA 5JYEA 5HIKA 5LM3A 1QDLB 1BVUA 1QGUA 1WG8A 4E1AA 3LDTA 1J00A 1HQDA 5HRCA 2BFFA 3EVDA 5J2UA 3LA8A 4GNRA 1W34A 4S1PA 2CV0A 1ZJZA 2VRZA 3ML1A 3DLBA 3UK7A 2IG8A 2XDWA 2ZUFA 2LDXA 2A0LA 4ECAA 4HOYA 3O4HA 5F5NA 3BWMA 4HRAA 2JLSA 1DWPA 4HAVA 1H1TA 3QJYA 2ISCA 4WJKB 3KB2A 1JU3A 1HTBA 4RY8A 5A1TA 2ZJYA 4KBFA 3RSZA 2V55B 2JFBA 3GEHA 3IPCA 3G4SF 3HBNA 3RJTA 4WNCA 4FCVA 4KGVA 3HL4A 4CLOB 1NTRA 2QUHA 3INYA 1OLSA 1T5SA 1KI8A 5AESA 1K3TA 5AKZA 1YC5A 3I1IA 1ZM7A 1Z2GA 2HU2A 4REOA 4R2MA 5CYPA 3ZVRA 1YZYA 2RB4A 5KREA 4G4GA 3OGCC 2IE8A 2A9VA 2VYFA 2YRFA 3NDPA 1AKEA 3ABMB 3G1WA 3R6LA 4R05A 5EQTA 2CN1A 1LQUA 1AC5A 3KYDB 2A1TS 1J2JA 4GMDA 2WG0A 4KN5A 1VC2A 1S2NA 4P81A 4KLCA 4FGJA 4MAMA 4OI4A 4JGGA 4DW1A 4Q3KA 2WFZA 2QBYB 2NTEA 4QTZA 1WBBA 4KMOA 2AMYA 4ZQGA 2XYVA 1NYTA 5J5AA 4GP9A 4LBWA 4ZYZA 2PMCA 3N28A 4WN9A 2JBAA 4OHPA 1J5XA 3CB4A 1UK6A 3ZYZA 4RVCA 3MCAB 3AIMA 1E5TA 1U0LA 2G4VA 2X8AA 2FFBA 3VHQA 2DN9A 1DDOA 3W5VA 5K4GA 1L5QA 3HCWA 3EBLA 2HPVA 4KVZA 1DVRA 1BX0A 2AI2A 4FBMA 3AG3C 4XB2A 1NPYA 4RKWA 1B3RA 1L5RA 2FSVC 2LGJA 1DUSA 3CZ5A 4EGCB 3A9UA 1WCYA 2R4TA 1U0EA 5DGTA 4CC6A 1VBKA 3L4EA 1KYZA 3BBLA 3S3XA 5JSQA 1OOEA 4G0PA 3QSGA 2TS1A 2WTMA 5B7NA 3EPHA 1VXOA 2P78A 4KFTA 3KAQA 4A4DA 3ZV6A 2R6FA 1VQLV 1QGYA 2HNAA 3T52A 1FTYA 3I8XA 1GDHA 1LUWA 1P7VA 3IEPA 3ZKWB 5CDSA 3TVDA 4IIXA 3OT1A 4AIIA 5HJEA 2ACVA 1LRLA 4AC9A 2OV2A 3AP2A 3RYCA 3MB8A 3HU2A 4U7GA 2C95A 2IXTA 5JIBA 1J2UA 2ZYSA 3O9OA 1HQKA 1QGZA 2VCYA 3WMRA 2AFVA 2R2AA 1T34A 5M2QA 1K6MA 3KQTA 4KGDA 2HIMA 3UKOA 5CB4A 3CSXA 3FNHA 4AP9A 3E9MA 5J9PC 3ZIDA 4E31A 4J10A 2WI8A 4M83A 3VYSC 2L18A 3JQQA 3EFEA 1FFGA 4X6LA 4BXOA 1K5GA 4NYMR 3T1HB 3MTEA 4D6TH 5FL7A 2IP1A 2DFVA 3JQ7A 5IKEA 4XCXA 3HO6A 1SBIA 2LBXA 3LBNA 4XFKA 5EZYB 3DBLB 2ZJ0A 3PDIA 4J49A 1OYYA 3WFVA 2OXTA 3MTQA 4OA8A 5DKFA 5DHSA 1U9CA 4F6RB 1LBIA 4HP8A 4W8GA 3PNMA 1E60A 1PDVA 1UPXA 3CRRA 2ID9A 4FK5C 1WNFA 2AFHA 5I4IA 5GM2A 2P4VA 5KUMA 2DTXA 4WFJA 2IQQA 5GIPE 4INAA 1UM9B 1MZEA 4RFVA 4ICGA 5FQOA 4EJFA 3M5CA 3ZV3A 1QR6A 5A3SA 4PYKA 3ZNPA 3OZDA 3ZWAA 3D6NB 2SNIE 2Y6VA 3TTWA 5EHIA 2VT6A 1K4MA 3GUYA 2DFLA 2R751 1F2TA 2PLWA 4QJ3A 3N0VA 3PXGA 4KO2S 1CY4A 4FPPA 2ZYWX 4ZV9A 3D6MA 3RC7A 3R7SA 4QQFA 3MT9A 2BGLA 1XZJA 3OLQA 5DX1A 4Q1CA 4XTRA 2KE5A 2TSYB 4URWR 3DAPA 1RLJA 3VX3A 3EIQA 4UAGA 3ENWA 4KAFA 4KREA 3U4QB 3A06A 1X1EA 1CUIA 4UQOA 1SH7A 1RQGA 2IIVA 3W1VA 4DR2O 3I3FA 4Z4CA 3VGJA 2D2FA 1G55A 3QKUA 3VHXB 1VF6C 3ZPXA 2IM9A 4CF4A 3OU6A 4CEHB 2G67A 2IZOA 2JD1A 2ZJ2A 1DV1A 5AOBA 3I55V 4B6PA 1KZ4A 3F5WC 1UWKA 1TTPB 3T7CA 3VO1A 3K9WA 1Q1GA 2PV0A 2Z2YA 1GP2A 3TRFA 1SHKA 1Z0ZA 2P2SA 2BMVA 1E66A 4NOKA 1R8SA 4YPFA 2FG6C 3Q8HA 5B4VA 3U5ZB 1S89A 4TRNA 1QR9A 1RS0A 3D81A 3GVXA 1F0KA 4PN3A 1M93A 3ZH2A 2V4UA 5EE0A 1MCZA 3MRXA 3ZIAG 2X6TA 5KZMB 1II9A 1VLMA 3DQPA 4CM7A 2FSHA 1UC9A 3VPAA 1RZVA 1E1RG 3DZFA 4I1OA 2P9YA 5CFOA 1Y3HA 2JLVA 3L9DA 3ICOA 1LA2A 3T1NA 1JMYA 1YQUA 5CCEA 2QVYX 5FHQA 2QAJA 4G5QA 3JQCA 3OCCA 3NVMB 3WBKA 4CBVA 3ROGA 3IJ4A 3SYOA 3U10A 3HB1A 2FG7C 4EZEA 2ONCA 2WYVA 2MSDB 1QHYA 1Y8CA 3EWIA 1WV1A 3RU3A 3E3OA 2W2QA 1ONPA 1RJ9A 1MORA 3KKLA 1Z4QA 4FLYA 3DTYA 2ODPA 4OQYA 2B69A 1RRCA 3L73H 3E7WA 4GRIA 4EJSA 2QX4A 4FCWA 3NVKI 4IEIA 5TQ0B 2IYEA 4B3MB 4BT6A 1RJEA 2R6DA 1YL7A 1SCJA 3EZNA 3LBYA 1ZJWA 4YP6A 2IBMA 1SPBS 2XRZA 3U48A 1ZBDA 3W8FA 2ILMA 5CAEB 1Y1PA 2PX0A 2VC2B 4KO1S 1U99A 4IRMA 1ZXBA 3JQ8B 2AH5A 1Q0QA 1A5ZA 2QY6A 5L3SA 1OH5A 3SYKA 4YHHO 1TCCA 1I7DA 5TQVA 5H5JA 3UCXA 4DHWA 2AKYA 3IVGA 4BB6A 1NDQA 2OPHA 3WYCA 1UBMS 3BEHA 5BOSA 1NP6A 4GOOD 4UVIA 1NS1A 5ALJA 1KBHA 2Q2NA 5FLYA 2UZ0A 3ONDA 1M56C 2HH9A 2HQBA 2Y92A 1GGNA 4CF6A 2B82A 1MV5A 2GK3A 5EIOA 3E9DA 3WLJA 4RETA 4HZUB 5CEJA 5DIZA 4K6CA 5IP5A 2Q6KA 3JQPA 2I6XA 3WIUA 1E8NA 2OHGA 1MUUA 1KY4A 4LOIA 5EA2A 4UM9B 5K3DA 1OHHD 4DR5O 2ZRMA 1KSJA 1DCMA 3LVBA 1JIXA 5AHXA 4FBGA 3GRAA 1SBHA 4RVFA 3Q0EA 3A1CA 4GZ5A 2VKTA 3L7NA 4JBWA 1V6SA 2HDOA 3IV9A 5CK5A 2V59A 1W46A 4NZPA 1BRMA 3L84A 2FQXA 3O8QA 4P3YA 2V9YA 4XSVA 1F2VA 3FF4A 4EY4A 4Z86A 4G67A 4R9NA 3AERB 4PVCA 3AW9A 4XWKA 4HGQA 1C1DB 4I50B 1ZGCA 1UZMA 1OWPA 2ZVZA 2CXSA 5T67A 3H16A 4GCZA 1UBSB 1M2NA 2AJLI 1KSFX 2R00A 2IXBA 3U9LA 1R10A 4NYIR 4ND1A 2JAQA 3BAZA 1UXGA 1FC0A 5AQ1A 5BWBA 4BW0B 3JWIA 3NFYA 4B5LA 2P2CA 4KBYA 5IT9N 2JFGA 3TLBA 1GNSA 4XUCA 1PKEA 1W57A 3DF7A 5BYBA 2V9CA 3D8SA 2Y1LA 2OD7A 3DLPX 4ND3A 4LXQA 3OE5A 4MYTA 1X1TA 1GTMA 3QKSB 3Q6MA 3AG2C 1P91A 1SZTA 3AW8A 3MCVA 3SYMA 1L6IA 1OYWA 5DECA 3BEOA 4GI5A 3BOSA 4B5KA 2ZRHA 2GBFA 1AHNA 4D6YA 2DY1A 1AZTA 4OO3A 1E8MA 3IVRA 5FBVB 2WP0A 2NSDA 3F6SA 1XTIA 2G71A 3GEBA 4E3WA 1GH6A 1J7KA 1Y33E 4B4VA 5HCIA 2ZT5A 4KR2A 2BGKA 3K15A 4LF9B 1KQFA 3I39X 1ZH4A 3COYA 2EARA 5CD9A 2ZP1A 3R3YA 2QMHA 4DA7A 5GJWC 4UB6Z 3TLGB 1GUAA 1PF5A 1W88B 2G0NA 1YQXA 2ACKA 3SHVA 2GZLA 3IBCA 2GPTA 4KNYA 1I4TD 1L5VA 1V16B 3P0RA 2A14A 2DQ4A 3OTOB 2Y1EA 4IJ5A 1U90A 5KKNB 1QO9A 5J40A 4OAOA 3C4VA 3TLCA 1G7RA 3PBKA 4PLFA 3W2IA 4UVEA 1D1SA 4M2LA 3E3LA 1L4KA 5IKXA 2RCVA 3GLHE 3THSA 4H7KA 4IYRA 3RRZA 4TTSA 2DFKB 5K0EA 4JI4B 5L3VA 1IY8A 4YFYA 2VP9A 1PTJA 3WGYA 4BX2A 1L7NA 1YIJV 2CWWA 2PLAA 3B8EA 4OOFA 4RZSA 1VE3A 1PQYA 4HDQB 1P1IA 1UFYA 4Y2SA 3B6ZA 1EAMA 3AY6A 5IJAA 3VM6A 2JGNA 4BUZA 3BFRA 2P9EA 3QVKA 2PMWB 1RI1A 3JD0A 4C1NA 1XTJA 2HRRA 1A9RA 3V9PA 4RWUA 3GRKA 4G4JA 4XVRA 2G77B 3TZQA 3OQ6A 2A9KA 1GKKA 2Q1UA 2F1OA 1WKCA 2D6FA 3CLHA 2QTSA 4K9DA 3B3JA 2W5UA 3RC9A 4AZWA 2D06A 1GUZA 2VQ6A 3WISA 1FRVA 4DLVA 1FNNA 1YB1A 4PIPA 4HX2A 1Q5PA 1M1NB 4DIBA 1KYYA 2G9NA 2LFRA 4G5HA 2EJTA 4RWZA 4O4HB 2DE0X 2WYUA 2A1IA 2GZHA 3TM5A 1P7PA 4F4UA 5K1ZA 1H3FA 4C4TA 1JDUA 1DKOA 2QF7A 3GEMA 3INNA 1VQ4V 4H0LB 5BR8B 2C07A 1QRRA 4BVSA 3TM4A 1XF9A 4CV0A 2E74B 4TVOA 3FBTA 1W25A 3UUGA 4UCUA 1IHOA 2HX0A 3PSAA 1WZ2A 4DGSA 2ZCUA 4MVJH 3T1TA 2MHCA 3CUKA 3PGLA 4WJZA 4QFDA 4OP1A 4K87A 1JR6A 2OHVA 4L4SA 4ESOA 3JALA 3FBGA 4TXHA 2ITCC 1H2MA 2PMBA 3ANMA 3S2GA 3CLUC 5JSZA 4CFZA 4WQMA 1VQ7V 2WIFA 4RVSA 3W5AA 4IV5A 3O47A 5BY1A 4UXJA 3OICA 3JXEA 1A82A 1PBTA 3ILXA 3SF8B 2E18A 3IMCA 5AT1A 1H6AA 2YFYA 3M9XA 5KJCA 1RRPA 2JCVA 2WLMA 5FDFA 2VDPB 5KNBD 2BSQA 2YYSA 3AQ4A 1SKBA 2Z2XA 3V80A 3N07A 5B3JA 1KI6B 3PWKA 5BYJA 1NJ8A 4QUIA 1E2QA 2IS1A 4YXFA 1YR7A 4RJJA 3BQ9A 1SUSA 3O2QB 1M1YA 5A5DA 2GWHA 4ZT5A 1NSYA 4J6FA 4QQ8A 3M7MX 2IEBA 1EGMB 1QPBA 4UBNA 1QLWA 1L7QA 2WA3A 5LZ5A 1SD5A 1VL6A 3A6JA 1JJOA 1C7RA 2FR8C 4JP3A 4I4TB 3I1YA 1RPRA 2ZBVA 3BMNB 2GN4A 5F2VO 3LDHA 3OAAA 3WBJA 5JC1A 4OGQB 2OGUA 3R4VA 2IL1A 1DDIA 3W2GA 5HY2A 3QWAA 5K3CA 5HZGA 3DVLA 2V6BA 4R41A 1YR2A 2H8KA 5I7RA 1NR5A 1XR3A 2D1SA 2WLLA 5IS2A 2AW9A 2FZGA 1AQIA 1GGEA 2YMQA 2ZIGA 4HNVA 4L5BA 1R15A 2DH6A 1NW6A 4Z0HO 2XVAA 4ZI7F 1I51A 3UPUA 2ZJ5A 2Z8YA 2O7RA 1R2QA 2FW6A 2QMEA 4QOGA 1HXHA 4LDAA 3I6ZA 2A9QA 1VSVA 5IWAB 1WQ3A 4ZHYB 3WFIA 4X1IB 3JASA 3K0BA 2X6RA 1AGNA 1KO4A 3D6HA 1P2FA 4V2IA 2GMWA 4FJ1A 1I6LA 4WT7A 5AVKA 4KACA 1NI4B 2OK7A 2DYSC 3MJCA 3SOZA 2E3CA 4H7JA 1OCZC 1RABA 3UJBA 3VVCA 4MP3A 2E49A 1OWLA 1CTQA 3EQ6A 2QI9C 1H8HG 4P82A 3G7NA 4KJXA 2QROA 1YHQV 2Y77A 2B8TA 5JAPA 2FMKA 3TF5A 3DE2X 2PJZA 2XUFA 2YWEA 3PXBA 3QMVA 2H4JA 1VHJA 1M4UA 4WFGA 1V54B 3CJRA 4IOMA 4P7FA 1NG9A 1QVRA 1JYSA 4GBJA 3N2LA 4Q7EA 5IYCO 2VF5X 4G37A 1PG5A 2IJGX 3LSTA 2ZR7A 2GCIA 2RC5A 4TXNA 4J91A 2HO4A 3AG5A 4FZ0A 1IEXA 3NTQA 3FSJX 2A2ZA 3TLYA 1YUMA 4WX2B 4WCEV 1E3SA 3QKIA 4MUIA 2ECFA 4Y9SA 3K2IA 4K26A 1XOIA 2OCGA 2VF4X 4M49A 1GPJA 1QNMA 1QIFA 2Z3ZA 3ECSA 4G5SA 2VK2A 2P6NA 3D02A 4O2LA 3FD9A 1R6XA 3T1HO 4WOPA 2ZUSA 3TW4A 5C5EA 4GX5A 3A31A 1G66A 1NULA 4FINA 4IDDA 2X4GA 5DXJA 5EWJA 5B12A 3GPCA 2QTZA 1YR8A 5KWVA 5FNVA 1SBTA 3NASA 2H1HA 5I9NA 4TSRA 1M8PA 2CVLA 1KOJA 4KE6A 4M87A 5LD2C 4BQNA 2WHPB 4JXKA 1INLA 2WWTA 4NCKA 1UZUA 4LWOA 3L41A 2PWPA 2BI4A 3AG7A 2Q67A 1RKUA 1DIOB 4TUYF 3RAFC 3KVRA 1ZL8A 1R6VA 4ARSA 4OLHA 5DHFA 1RWPA 4BMDA 1UFQA 3IEQA 4OHVA 3UK0A 1WF3A 3DO6A 3EX7C 3REGA 4Y6OA 3C3YA 4N7MA 4TZ0A 3G9TA 4NE9A 2CNBA 3KJKA 1AVTA 1ADGA 1V41E 4DDTA 1BKDR 3C39A 1LLQA 4BVEA 2QR5A 4DXWA 3B9BA 3TG8A 4DF3A 5KYYA 3FNFA 3ZXYA 2G7ZA 3VNSA 5KTYA 1TYCA 1RXWA 4NR0A 4NDNE 1VL2A 2C99A 5JZ9A 3PKIA 3NJ8A 2QPOA 3Q9SA 3NJ4A 2C2HA 3F5FA 2R7AA 1CZHA 3ZHCA 2A78A 4N6GA 5HILA 1D3AA 2X2OA 2B4YA 5JJ5A 2J3MA 3KAJA 2YEVB 1RKBA 4M76B 3E6AA 4LSZA 3JZFA 2UYQA 3J81N 1B8NA 5AM5A 1RXSA 5CH8A 4XRGA 5LP6C 5ILOA 5E7QA 7REQA 3KDPA 4CS4A 2Y4NA 1FXHA 1IN8A 4D96A 3VR5A 5AP9A 4ALNA 2QWOB 1FXVA 1ZUNB 1H38A 5E6RB 1VJ5A 2HO5A 4TSFG 2BBTA 5JS2A 1G8HA 2ZI7A 2VZLA 3BVOA 3WAJA 4GKVA 4HNTA 4DMCA 3ZK7A 1L7OA 2WC1A 4YYEA 4PPFA 4Y98A 4FFDA 1PO7A 4UTNA 4P3OA 2IU6A 3M34A 1XRSB 1X94A 4XLZA 2MSNA 2J9FA 1YSCA 4QBIA 5EUCA 2ZRNA 2IKSA 4U4AA 4C5BA 3RPEA 4RHAA 1FFCA 4RO0A 4BQOA 1CR0A 4KN9S 4QHSA 4MUEA 1Z82A 2F3SA 3PR3A 3IPXA 4H1HA 3PJSK 1Y42X 3WWDA 3HB0A 1O5TA 2QY9A 3L0IB 4K88A 1P1JA 3EK2A 1R50A 3LVQE 4DYVA 3IA7A 2RHGB 9ATCA 5IJZA 1CETA 4B3MO 2R4UA 4R2IA 1GO0A 3BAAA 4ZYUA 1Y67A 4MRMA 3EARA 3OQIA 4Q1VA 1RM1B 4PYQA 1M7BA 4JGIA 3A11A 2VXCA 4PXAA 4EW1A 2SKEA 1RQNA 3SGIA 4S1VA 3NV7A 1Y66A 4Q9IA 2A8YA 4MV4A 2R6ZA 1CZUA 3BL8A 1V71A 3LT0A 4B7XA 3IUJA 2TMYA 3ZWBA 1N2JA 2F3PA 2X1LA 3U4MA 3SM3A 3ZWMA 1YB5A 5TY0A 1KDRA 4DRXB 1YZLA 2FUG6 3NDRA 2XAHA 2IWRA 1RRMA 5EHNA 4E0BA 4QM6A 4G1FA 5HCUA 1U4SA 1H8EG 3B1XA 3BFJA 3ASUA 1RYYA 4IHAA 3RSLA 4WPGA 5KAIZ 4Y18A 3BJEA 1SCIA 1LK7A 2W9XA 3B1WA 1HF3A 1WSWA 1XI1A 4JOQA 2AYXA 4ZAXA 1S8NA 2EEZA 4MS1B 3PUHA 3P2JA 3FD6A 4RYDA 3CCSV 3KL4A 4YJGB 3STXA 1V6AA 3VQVA 3IX7A 2BIFA 3MCUA 4D8YA 1IH8A 4IHQA 4AHCA 2A9OA 3DMYA 2H1IA 1KZ1A 3WE7A 1BHO1 1I1NA 2V6GA 3EGCA 1CUUA 5HKKA 3NWJA 3AC0A 1UM8A 2PGDA 1ELOA 5ALGA 3F9CA 5B57C 5ENDA 4PRKA 3C3DA 1XHXA 4QUJA 4B71A 5KSYA 3CVVA 3H1BA 3MRSA 3L7OA 3E35A 4AS1A 3QELB 2ZYTX 1A97A 1J0AA 3UCSC 1NN5A 2PHZA 1JY8A 5JZVA 1EVLA 4QYIA 3RC2A 3U13A 3TKAA 2WVGA 1FX0B 2OBLA 3CTPA 5EXSA 3DMTA 1NBOA 4GUDA 2Y4OA 4EM6A 5AKGA 4BR6A 5BQPA 3UBTA 1Z2OX 4H33A 3OZTA 4HQLA 1AP5A 1H0SA 4P0PB 3NK7A 5DHAA 3J80M 2PSJA 1IQRA 5TS3A 1SJ9A 2O6LA 4RTNA 5LYYA 1F0YA 3L1JA 5IMBA 3BHMA 4E4RA 5C34B 2JLZA 4CKEB 1DI0A 4FFKA 2YMMA 1LWOA 2LVBA 3T5GA 1H9AA 5AI8A 5CJJA 2QR3A 3UKDA 2AZMA 5CPBA 3I01M 2AX4A 2A9HA 1AF7A 2X6CA 2HIHA 5GVSA 5MHTA 5A5GA 2PO7A 5E0OA 3ER6A 4WW0A 2JARA 3I9V6 4TKUB 4EF5A 2JK1A 2E1PA 3ZZNA 4NICA 1MO2A 1OAPA 2NVUB 3PIIA 4JAVC 3NVKE 3A1FA 3STTA 4GSLA 4I8XA 3O9ZA 3HVJA 4RVGA 2OFFA 3FFXA 4IDHA 3M1YA 1R1DA 1R73A 2UUAB 3FCCA 3F5TA 1C3OA 5AYVA 3V4VB 1E7QA 1Z5UA 5L7YA 1ZIDA 5SY4A 4LF9O 3NGLA 1QU2A 4U5QA 4HBZA 3WZ2A 3O4RA 4TRMA 3M5WA 5JALA 1EXWA 3L43A 4Q82A 1U3PA 4UM8B 5KWEA 1TJNA 1QYDA 4CEJB 4KXWA 4MW3A 2ZCVA 1J0BA 4GX0A 3OTOO 1I1OA 2WRZA 3JYHA 4TS4A 5I7EA 1NUTA 3FUTA 1KHHA 5LQNA 2W2KA 5AW2A 3N0WA 3LLVA 4LOAA 3NM6B 5HE9A 1R0WA 2ZUBA 1JEJA 2AZDA 3SJBC 5CU7A 2X1VA 1R6BX 3H3FA 5ALDA 4JI4O 5B2EA 5KB3A 1PNMA 3NJRA 2IF2A 2W6PA 4DLPA 1DXQA 2ZRJA 5A62A 2JJ8A 4OHOA 3NHBA 1K5HA 4OQDA 4KG7A 4J7XA 2BTOA 1CQZA 3ZD6A 2ZI9A 2OP0A 2VHQA 4CR8A 3UOWA 1EDDA 2FHSA 1YL5A 2PGLA 2H5JA 1E6KA 2EKLA 4JA2A 3QFSA 1HI9A 1IX9A 1SIBE 4MOWA 3F0FA 5IH3A 3LUTB 4YP0A 1KEUA 4I0XB 4CT0A 2PZJA 2O07A 3TLXA 3TPCA 4OXNA 3GDGA 121PA 3NHRA 4IHJF 4YAWA 2DXIA 4QDUA 4R2KA 1RSZA 4FFBB 4PG5A 4JWKA 1FUUA 3THYA 3CVWA 4XWWA 4DB4A 2GUZA 1EJ0A 3SFTA 2VOEA 3AIIA 3K03A 1K73W 4WBNF 4Q7JB 3P9NA 1R5BA 3GJ7A 4LXTA 2L2QA 2VP2A 1K7SN 4ZEMA 3WRVA 1M6NA 4ARAA 4MKGA 1QLJA 3OQBA 1P29A 1KJWA 1ZPDA 1JYFA 5BR8O 4FM1A 5A9GA 4I9NA 1P2DA 1U1FA 3O8NA 1QMGA 1I2BA 4W5NA 1DXOA 3RB8A 3W7SA 1YCFA 2G70A 1DU4A 1JP7A 3GDOA 1JN1A 4B34A 3JAKB 3ZWXA 1XTSA 2DUWA 1O4WA 4GPZA 4HQFA 3W5HA 4PQEA 4X24A 4L6CA 3I52A 1MAUA 1UMDB 4YAGA 4B6SA 2QPLA 3AL2A 2IZ6A 3C6MA 4QXQA 3I6IA 2FEKA 4EFEA 2ZWOA 3GJXC 1VE9A 2HXYA 3WPXA 2F93B 4G86A 1A71A 3SKYA 9ABPA 5CX1A 5HYVA 1C8BA 4N12A 1JG6A 1TI7A 2HWUA 4I6JA 5FJJA 2WBLC 4DA6A 3CYFA 4OY3A 2CMFA 2PMFA 2IH1C 2WLIB 3OUFA 3FPAA 3IQGX 3COPA 4IIDA 1Y82A 1IAVA 2PZ8A 2Z3VA 2E75B 1NF8A 2P3LA 4L27A 1ZSPA 2OUIA 2ZDIC 1FP7A 1V1JA 4L74A 5CCBA 1H9CA 5FF9A 2XMCA 3G02A 1YQQA 1GEGA 5LOVF 2CE4A 3ZRWB 1AQ6A 3PDUA 4NZYA 4M9ZA 2FZVA 2AEEA 4FHFA 4KX5A 5L3ZA 3PJGA 3VH4A 3U7JA 3ZZ1A 4N6NA 5DX8A 1UXHA 5I7WA 4BNXA 1N36B 1C5KA 2NR5A 4NFSA 4BO7A 3WHPA 2GN6A 4M6WB 5BMVF 5JBIA 2V4DA 3GUHA 1KUQA 3SK0A 2FPGA 5BSHA 4PAQA 2ORED 4UDYX 2W22A 1L4EA 2UVPA 2ZRFA 2J3LA 1FDWA 3H18A 1LW7A 4GX2A 3LT4A 1TK9A 2PRSA 4R1OA 4V0OA 2AWNA 2AC4A 4CL2A 4EA8A 2QTMA 2FUCA 1JKXA 5C32A 3G80A 4BCBA 5PGMA 4A8PA 1PTKA 3K94A 3EAGA 3LL7A 4KLRA 3A3KA 4LV8B 3TTUA 3HEAA 5IWAO 3OQJA 3WWZA 1CW2B 3WGVA 1J4AA 1NBHA 3L7AA 3CRAA 1Z9BA 2V8OA 3AG4B 2ZSBA 1U9IA 4FNAA 4IVPA 3FYUC 3H1KH 1K7FB 1S2LA 4YI5A 1OUMA 4P08A 4MRNA 1M6YA 4G0ZA 4R16A 3V7NA 3FN4A 3RNLA 4KPUB 1A9QA 3W7XA 4G1BA 3Q41A 1M1KW 3W05A 1PWYE 3VQYA 2NYAA 2D1FA 3UMYA 4CQMB 1JPJA 1QU7A 3DAOA 3OFVA 1VJCA 1LU9A 1GTVA 4WZBA 4XKJA 2NXWA 4ZO8A 3KYJB 3D36A 2EF0A 5IE9A 1R16A 3SXUB 2Q0SA 4KLNA 2WB4A 2WJJA 1SIUA 5B5EZ 2ZYRA 1Q95A 3ECAA 1M7HA 5FL3A 2EATA 2B35A 2CD7A 4N3NA 2GPNA 5LXTF 3IAUA 1IHYA 1RRKA 2QZZA 4PAMA 1M2VB 2HLDG 3UXEA 3OLZA 1TLTA 5AXDA 3GK3A 4MZDA 4JKIA 1XMSA 2XXBA 4IF6A 4ZRDA 4LWZA 3Q8XB 2HGSA 1NV8A 4LQDA 3GJ3A 3M3DA 2Y6UA 5TPZA 4ZCSA 4OHXA 4IAOA 2B4QA 4IX9A 4P38A 5FTNA 1VG8A 5E1BA 1ADCA 1CUAA 3X1XA 1RKXA 4RQUA 3ZNQA 4MS2A 1TA8A 4HPXB 1S2MA 4N47A 2Q3HA 3C3EA 4LTDA 5H9VA 1I1HA 2QXUA 4KTTE 4QLOA 1OX4A 3F47A 3GLIB 2QQGA 1TIPA 3F5SA 4E2XA 5TE9A 2WB2A 5IVHA 4BQPA 1OZAA 3ROMA 3P0IA 1B16A 2GRAA 3BB4A 3TJMA 4UUAA 3AHFA 4MKFA 4M38A 4Z4QA 2GTHA 2JIZD 4Y0VA 1N9ZA 4HB4A 1IUNA 1Y7TA 4DILA 1WY5A 1BMFD 1NP7A 4W9RA 4IMRA 4KOEC 2ORYA 3OC0A 3WKEA 4QPDA 1H2LA 3IUSA 4OKIA 5JY1A 1EFRG 1DKRA 221PA 3OX4A 2JI6A 3RREA 1VKOA 3UJHA 5G3ZA 1EP9A 4OM8A 2R86A 2I1WA 4Z7JA 1KK3A 1TAHA 2AG0A 1HW7A 4MRSA 4FONA 4DY6A 5FJIA 3AHIA 1DB3A 1U0SY 1N9KA 4KFRA 2H5IA 4PG4A 3HU1A 4AL4A 3ZY4A 1Z0FA 1Q6YA 1SOUA 1DBFA 1GQYA 2Y2UA 1OIVA 4Q16A 4EW3A 1KI1A 4N0DA 3EVTA 3BSFA 2JBWA 5IKOA 5FHRA 6ADHA 1DOAA 3M4NA 1BHJA 4C03A 1VQ5V 2HREA 2XZPA 2J0SA 5H3CA 1FRQA 2YHSA 1ZKDA 3ON1A 5I4KA 1XOUA 2IUUA 1GL6A 3EVFA 2Z57A 1YKGA 3A3PA 2B8WA 3EHDA 3U0OA 3PT5A 1MR3F 3R0IA 4DJ5X 3I76A 4I3GA 4XUDA 3E9ZA 3T3GA 2E4AA 1G8SA 3QI2A 4AJ2A 4CLRA 2R8YA 5KJFA 3RU9A 4ALJA 3N2EA 2M6KA 5EUQB 3ZJZA 1BD3A 2TYSB 3WQSB 4IIJF 3CZ9A 1VE5A 1QLNA 2C5EA 4CVNA 2EINB 4AMBA 4UDXX 4DMKA 4KDRA 3IILA 4DM7A 5C7OO 2OHWA 1BEUB 4AKSA 4EJMA 3EPLA 4DV4B 2B5VA 4XPIB 3LSSA 1S1CA 2CL0X 1R9NA 4MTLA 2HBQA 5KNCD 1ZD1A 2VUUA 1EJ2A 3DM9B 1GN2A 3NX4A 1P49A 4DMGA 2RGUA 4WEOA 3S2UA 3BL5A 1ONSA 1N0HA 5JRZA 1JLHA 4Z7OB 5FYQA 2WA1A 4H4DA 3W1EA 1Z2CA 3AWDA 2XW6A 4K46A 1YDGA 3I9FA 1T43A 4UREA 4CM5A 3HNOA 4TZKA 4B81A 4FPXA 1HLFA 3JVHA 1JHVA 3ZZ0A 2O2YA 2SCUB 2BZ0A 2D74A 4PNZA 1DLBA 4CH3A 2J07A 3QYJA 1N4DA 2ZWPA 5DX0A 1OXVA 1M2KA 5CFLA 3P7MA 5K99A 2NSJA 1YB4A 3WFJA 2LP4Y 1XV2A 3TRKA 1CEQA 1E89A 1M2GA 1GTZA 3OTGA 5IJ9A 3OE4A 3TTXA 3V55A 1KB9F 4MLPA 2YV1A 1DKNA 4PA4A 2RNBA 4WIAA 3AB8A 3JQEA 4L28A 3SZOA 3IC9A 1K63A 2J0UA 4TV9A 3KKZA 1FTNA 2MSEB 4FFVA 2J09A 1IZ9A 3SE7A 1A1SA 1THTA 2IHNA 3DEHA 4Y2TA 2CAZC 3NT4A 4CBCA 1USUA 3I37X 2R6CA 5EFZA 3U7FB 3S1SA 5CXXA 2H7CA 3I04M 3DWGA 2VEDA 4LJ6A 2FXVA 4MUMA 3TWOA 3PF8A 5KAFZ 4TV8F 4TN1A 3OZXA 5B3LA 3PB3A 1E32A 4FIPC 4XVUA 1KDYA 1JS1X 5AW9A 2NPFA 2OWEA 4KJZA 1XG5A 1LR1A 2WZBA 1KQSF 1RLUA 3CE9A 3W8EA 2LCIA 1FZTA 2VBCA 3SJ7A 5SYAA 1NWHA 4TTVA 3IR6A 4DY4A 4OATA 3RFCA 3CUYA 1MX3A 1ZSVA 4EY6A 4I66A 2NN4A 5G1NA 3PXUA 3TINA 2ECOA 3KBOA 4KN8A 1DAKA 1Y9EA 1G60A 4QQNA 3SJQC 4ZZ3A 3DYBA 3KHKA 1OLOA 1RACA 4Y7DA 4D8WA 2QE6A 1H6CA 1J5PA 4M8IA 2APJA 3UHPA 4G85A 4FOLA 1JD1A 4LY6A 1SBCA 3OQOA 4XQEA 3WDLA 1RHKA 7GPBA 3NANA 3WVNA 3NWEA 1KI9A 1KSHA 1KARA 5E6UA 2DYRC 2DWPA 3C3XA 5FUBA 1QYXA 1JSRA 2FN4A 4M8SA 4OGLA 4MJXA 4TMVA 5HZKA 1XCOA 5FQNA 3C4JA 1QE3A 1QIEA 3EHEA 1NX9A 5CW2A 4MKIA 5P8WA 1VQKV 1YR9A 3S1LA 3R7NA 2JLQA 4KLAA 3ORHA 5JANA 1ODTC 1CKEA 4E5VA 2J3QA 2WU0A 1TZCA 4AMYA 5DLEA 2FPMA 1H66A 5FR1A 4R5HA 5B1BC 5DNYB 4N7BA 3CRQA 1HO3A 2UUAO 5IC5A 3ZCVA 1F4LA 5DK4A 5EIFA 4P54A 1DBIA 4YAKA 3QX3A 5HFJA 4RQTA 4YP7A 3RIYA 2FYUH 1VDZA 4YS6A 3IEXA 3TR0A 1BVRA 1ST3A 4XIFA 4N3GA 3ESBA 1GGVA 3KJNA 2PZAA 2LGWA 1Q0UA 4BGEA 1X38A 2ST1A 3KYCB 4J7AA 4RJIA 3AMVA 2VUTA 1NSTA 3LWNA 2JIMA 4UM5A 1AROP 2D5CA 2JGRA 1FYXA 3O8OB 3LY9A 2CE2X 1CWUA 1V45E 2WHEA 4E51A 2QV0A 3A14A 3RG8A 5CBPB 3PQ7A 4ZZ0A 1PFQA 3EPPA 1TFRA 2UYNA 4P34A 1PP4A 4RH0A 3M1IA 1EUYA 3R09A 5DRYA 4OL0A 2QIOA 3HO8A 3KEOA 1KI2A 4MR9B 5JZMA 4ER6A 5JEEA 3KU4A 4YEDA 1PR5A 1N6HA 4B84A 3TOVA 1CBUA 4GEGA 5EAIA 4LNUB 1ENVA 1L4NA 1Q6HA 3TNYA 2CB0A 2JH8A 3AOEC 3RSSA 4HEA6 1VQ9F 1ZU4A 2B4RO 2NSYA 9LDTA 2PAAA 3IERA 3ZTTA 3E2PA 2G9IA 2V45A 2WJVA 4MYDA 2D0OB 3OZSA 3L7BA 4R1QA 4LZLA 4RTSA 3JSLA 3ZGXA 2ZRGA 1BO6A 2XV1A 4N8EA 1I0ZA 2QK4A 4E07A 1DTWA 4LYYA 5FUQA 1LV7A 5FPYA 4PLTA 4RY2A 4CKYA 4UFZA 1OGJA 4ZO7A 4DBLE 2ONKA 1XD2B 1NKSA 5KVVA 5JRDS 3BJZA 2WUVA 4JDPA 3E1SA 3OEHG 2GN2A 1N3IA 4L9WA 3RBAA 2WALA 1GN9A 3ZHSA 4UUBA 4U0JA 2XAAA 3PEWA 4B3GA 3PZBA 4I6GA 4R01A 5IYZF 4UV8A 3ISVA 3EVNA 3NZEA 3S0WA 4RFSA 3L82B 5DN6D 1EZVH 3DT9A 1HETA 1X8LA 4URXR 1L5WA 1E20A 4CKCB 2ZAIA 5JNRA 1VYHA 4D0NA 3PXEA 4ZT4A 1T6YA 2F3TA 4IZIA 3IAM6 2BL4A 4ZDWA 2RGRA 3D3EA 2FPPB 3UJ6A 1OC2A 2VO1A 1IXBA 1XQWA 2PU5A 4ZAYA 4ZGWA 2FSVA 1B42A 2N05A 1EIWA 4E6PA 3SLGA 1WBJB 1G5TA 5JY6A 4BGUA 4F2WA 4GPIB 2ZOSA 4PYIA 1GLGA 1X3LA 3ABKB 4PO8A 3AF3A 3PFHA 5JHGB 2XWPA 4DDHA 1R0XA 3K9LA 3K70D 5C80A 4BDTA 2BONA 1XJ5A 3EHBB 1RWNA 5ITVA 5J1SB 3K8QA 1X39A 5ALRA 3OPNA 3L1VA 1U9JA 2P1DA 3QGMA 3ER8A 1FSSA 2AUMA 2WF9A 5BMOA 3QPUA 2BR3A 2JJQA 3R7WB 3WSVA 1DFGA 2VYQA 3T3IA 1GAEO 3RVPA 4NOLA 4MAAA 1U2QA 2CXNA 5KYWB 4N0EA 3CUUA 2CGNA 1R12A 2D1QA 5E4YA 1CVLA 5DSZA 3GLGB 1U8ZA 2QU7A 3HN2A 2RH9B 4LRQA 4B83A 1VJDA 4WACA 1EG2A 3FBAA 4A0RA 5G0VA 1G20A 1N36O 2Q5ZA 2ZB4A 1KVSA 2IWHA 3GN1A 1FJXA 1TLLA 2ZVPX 3H1HH 3IODA 1Z4MA 3BB3A 2RC6A 4BVHA 3K2QA 3THWA 2ZWIA 5MGBA 4LF7B 2C7QA 1PQUA 5K3BA 3AP3A 3KDAA 1S2IA 2IP2A 1BN7A 1IUKA 4L7VA 4I1RA 4HNUA 1JA0A 5GONF 1Z0UA 2P69A 1XHLA 1SEPA 4CDGA 4WOJA 4KMSA 4G89A 4NBNA 1N6IA 3GYQA 1Z26A 3WKBA 3Q3GE 3L0YA 4MYRA 1COMA 1QYRA 1Q7YW 2ZOVA 3L04A 3GFOA 1HBJA 1QVWA 3HP1A 4QOSA 3LW7A 1A98A 4NV1A 4GOLD 4KKVA 2HVJC 1MB3A 3GPBA 5MFPA 2JFYA 1ECGA 4KE9A 1H5QA 4XX0A 3MWLA 2B21A 3BFVA 2X19A 2DTDA 3LNCA 3GFBA 4ZVTA 2ZSUA 5LDGA 5SZHB 4UHHA 3CH6A 2YXLA 3I64A 4ALLA 1XTVA 1QP0A 5L3RA 3V9AA 4PDVA 2GS9A 4NABA 2I29A 2XNDG 3CEAA 1U5BB 1RXUA 3MT8A 1U2ZA 2PGOA 4KIGA 2OCLA 2CXHA 1KGDA 5HQ3A 2YCBA 2OAEA 5JJCA 1ETHA 1WCWA 4BAYA 3E9CA 1YITF 5KYKA 5EJ8A 4MYUA 1CDEA 3H87A 3FB1A 4ROTA 4NECA 2MSCB 4BMVA 2G08A 4BRWA 2HT6A 2PZSA 2QAGC 3ANXA 4BT4A 3WLLA 5KX5B 3OE7D 3E86A 2P06A 3D31A 5DU2A 1EZ4A 3PD0A 4EGJA 3HABA 2WPDD 4HWKA 1S7GA 1T2UA 3PNPA 5FD8A 1E6MA 3PC4A 1B3BA 5CHYA 4DXHA 3LG2A 2XYPA 2G9UA 1QBGA 1Y1RA 1ODIA 3FGPA 4N23A 1UP4A 4I81A 4OX9B 3TOSA 1UINA 4FKZA 3MOGA 3M84A 3P9YA 4ZI2A 3NXSA 1SN7A 1GNTA 4I1UA 2AMFA 1HY3A 5LMCA 3SQWA 1GADO 1WTAA 2QG4A 4LISA 4Y6PA 1I9CA 4D7SA 2QJOA 2QAIA 3HXPA 3HMQA 3FAVB 1IHXA 2IYNA 1T8PA 3U3ZA 4ZV4A 1W5TA 2A7WA 2Q73A 3JAWB 2NZYA 5BN3B 1SVWA 1UL1X 3NR2A 4HWPA 3F1LA 1TGYA 3JR3A 4CUKA 4H1TA 4HZIA 1CUFA 3KHNA 5KU7A 2EBOA 4Q03A 4MUJA 5LYJF 4DG9A 4N01A 4C3ZA 5JSUA 1PGOA 4Q3OA 1ZGAA 3QUQA 4LXGA 1S4QA 1JAYA 3QTYA 4NCAA 1SOMA 4NK5A 1V9SA 3BCCH 3P1JA 3GLRA 2EZPA 2FE4A 1S3IA 3EOAI 3VPDA 3GCZA 4EY3A 1LBSA 5GQSA 5AI5A 4KXQA 3QKTA 4RLQA 4OAPA 5TSDA 3U4HA 3PTZA 1WHSB 3HADA 3L0DA 3D6AA 4Q4DA 3ENZA 4MVZA 1XZLA 4QGHA 4ANFA 5KLVH 2XBLA 4FOOA 1Y37A 3LC0A 4YVFA 2CBGA 1U7PA 1SBQA 4GP6A 2QW1A 1AI7A 4XDYA 1NVAA 3IMGA 1AV6A 3DOIA 2ZIWB 3KJGA 2GA8A 2ET6A 3LAWA 3R66A 3LV8A 2Z9DA 3B2EE 5LKAA 2F1RA 4NFYA 5EKXA 3GIDA 3OMLA 1MSDA 2E4ZA 2PBLA 3RAPR 2C88A 2VHJA 5KNBH 3BHPA 1K3UB 1XL6A 4NEQA 2WF5A 5KINB 1N3BA 1WXHA 1WP4A 4CIWA 3LWZA 1AA6A 3O2SB 2DBRA 2GN9A 1RLGA 5E79Z 3ZHVA 4DV4O 1YI1A 2FFJA 3FUXA 3D4OA 1F2UB 3S8EA 2HJWA 3UM7A 5C2JB 1AZWA 4LP8A 4HRXA 3PFWO 3W2FA 2XGGA 1NBIA 3KNZA 1X1RA 2WVAA 1KK2A 2GXQA 1MOSA 2COKA 3BA9A 2B83A 2QVXX 3LW8A 2AIZP 4C08A 1YJAA 2X3UA 3TD4A 5DBFA 1A9XB 3EQ9A 3ESYA 4QU9A 4W5OA 2IAFA 3D4IA 1DMRA 4LFBB 4B7KA 3FAZA 2ON6A 1YEWA 5CT8A 5IXYA 2O1SA 3L6EA 1WPQA 3P94A 3TXSA 4L3WA 3D1JA 1VQ8V 4A15A 3RJ5A 1HC7A 2P5SA 1GD1O 1SQXH 2GXUA 4DSZA 1E79D 3LCMA 1ZVJA 3B8MA 3AVWA 4FX5A 4XR9A 2JH9A 1TYAE 5FI5A 5EKUA 3RIHA 2ASEA 1Q91A 2BP7B 1CR1A 4FNOA 4RMJA 5CTAA 4D99A 2F3QA 1XXHA 2A9PA 2WD9A 2FYTA 3SR4A 1IBKB 4RUEA 3E7DA 1ZX3A 3A6PC 4L2IA 1I01A 2V7PA 2GBPA 4EIWA 3SSOA 3TSZA 3PHJA 1D07A 1Z63A 4A0SA 3E61A 3KQLA 1XTUA 2CNWD 2DTEA 1J8YF 2C0CA 2YBDA 1RXVA 5BVHB 2Z95A 1P7BA 3JRXA 2XVZA 1XHOA 2Q1TA 4WNAB 2OGZA 3D8TA 4WV3A 2CDCA 5KJ6A 5C51B 5LZ2A 4MB2A 1E2JA 4RKQA 3MEQA 2JLUA 4FYMA 1E2HA 4FI3F 4D02A 1JDBB 4CLDA 2OOSA 2DETA 5JD3A 3TUZC 1T0BA 1XAGA 2OBFA 2Y0BA 2D2VA 2XCUA 1OLXA 3JVVA 2KB0A 3AZOA 1BU5A 4ZEXA 1PVVA 1CRPA 2KMLA 2UZAA 3BABA 2ZSFA 4RGYA 3WL5A 3A9SA 2M6YA 2ZPTX 1PBNA 2BE3A 3DV0B 3SMQA 4DCCA 4WESA 4UU7A 3ECCA 2X6QA 5IJ0B 4NHEA 1U1IA 4C3OB 3FA2A 2P5UA 2WWGA 1QV6A 3TAXA 1QF7A 1MH9A 2A5JA 1R3DA 4LEIA 3ZHTA 1BE6A 1P62B 3HR7A 5HTKA 4BCDA 4HI0E 5A9SA 3K6SA 3HY3A 3PJDA 1QYVA 3L1KA 3BDAA 3FX2A 1UPBA 3O74A 1WZEA 2JI8A 1T0UA 1FOEB 4WK0B 2C3OA 3TN7A 3GGGA 2WSSG 2COUA 2WJ3A 3ELDA 4IYJA 2HQ1A 1GG5A 2GAOA 4Y67A 4F9GA 2J9YB 2YN4A 2YY6A 2G28A 4J1QA 4MWCA 2WWVD 1NKDA 2Q7DA 5AKKA 1RLMA 2NUTB 1SBZA 2EHJA 2H0QA 1PJBA 2HEPA 3TQCA 4DC0A 2FZEA 2CLMB 3NS7A 2P41A 4J0QA 3ETLA 3LX8A 1IIRA 2VP6A 1OMOA 4CV2A 5B1AC 3K8ZA 1LPNA 2QWQB 4QSMA 1Z5VA 2WJZB 2I3DA 3PUVA 5CH5A 2Z58A 2E0IA 4GM0A 1X7GA 3MNFA 4EA9A 3FFBA 1NW8A 3KOZA 2HJFC 3QXGA 1H2WA 4P5DA 5JTTA 3OMWA 4EG6A 5KNDD 2O50A 5FWYB 1EM6A 3EEIA 4R68A 3KZCA 2CUNA 1W2HA 4E4EA 3CS5A 1A9ZA 4J29A 5DLYA 1KP2A 1QIKA 3X2QB 2OB1A 4ND6A 2LIVA 1SZQA 2OZEA 2WSYB 3LP5A 5CB8A 4KHZA 2XB6A 5C8DA 4LJ5A 3RIMA 4HAWA 2PS9A 4CMIA 3KPWA 4XW2A 4TLDA 2IS4A 4FLWA 1GO3F 1ABEA 1EBFA 4WFHA 3Q5GA 4L8LA 4YT8A 3ML0A 1EFHA 3TQQA 3V7FA 3GLFE 2GZ1A 5C1OA 5BQOA 3HC7A 5CYGA 3ABOB 4E30A 1I4OA 2DH5A 5L7WA 5H8WA 4J0DA 2D7JA 2ADMA 1NZ6A 4FVMA 4PLGA 1TZMA 2GAFA 2RMKB 5FPQA 4BVFA 2JAWA 2VZ9A 3QLJA 2VDWB 2Z0MA 1L0NH 4GD3Q 4H3HB 3JATA 1O0CA 1LJ8A 3ICEA 1WXEA 3L6BA 1K8ZB 1MC4A 1YZ3A 3LNTA 3H9BA 1GAQA 4FDVA 3GLIE 1ECPA 4ZDKA 1GPAA 3T54A 1KZ9A 1GWNA 4V0ME 5KWSA 1PWZA 2NN3C 1KBQA 2BH2A 4XWOA 1IUPA 5E95A 1W93A 4W4TA 2FF7A 5HWEA 2PUSA 2WAAA 1E0AA 1U7XA 3B6IA 5L3FA 5C8YA 2Y1CA 3PUZA 3QSYA 2XIJA 4O5AA 2JIRA 3OQHA 2UXCB 1SQSA 2ZI3A 3PNYA 4M9XA 3HBFA 2OXIA 4GXNA 4I4NA 2ZJ6A 4ZOLB 2UYHA 1NPDA 4KQ2A 4OSOA 4JI8B 3P9IA 3RS5A 3N8IA 1E2GA 1JU9A 4BNWA 5HKAA 1FXKB 2W37A 2VSYA 1CFZA 2Q4OA 4DSOA 1SUFA 2ZRBA 1SFRA 4OG2A 1K5PA 4BLSA 1WZCA 2W2MA 4Y2VA 1QM5A 3QK7A 5HGXA 1LI7A 5JH7F 3QVGA 1I13A 3WK7A 4NRDA 3ONNA 5I8WA 2JIQA 2G4LA 2X4IA 3EH2A 3LHKA 2EX0A 3I6BA 2CF5A 2UXBB 2R5NA 3RUEA 2Y1OA 3LTEA 4HMQA 4G0OA 2M2IA 2JASA 4HD8A 5BURA 3KWJA 5ECDA 2N75A 4YALA 4HLNA 4JJ8A 4RM3A 1ZW1A 2GEFA 1XTKA 3FHTA 1JQ0A 1N8NA 5JAIA 1PL6A 5HEKA 4JNKA 2W4IA 1AK1A 2XMGA 3PRYA 4JJ4A 1W55A 1RSOB 4J11A 1PJLA 2Q21A 3C8MA 3RD5A 2YQ4A 1RZRA 1XTBA 3WOVA 3BF8A 1P2BA 4R6WA 4FM2A 1PEYA 1US8A 4Q37A 3AT1A 4L9SA 2IV3A 3U49A 3GWKC 4AJ1A 4OHKA 4E5UA 1U80A 3WGMA 1JG7A 3WTCA 2GBGA 1XQYA 3SYRA 3CPSA 3VRHA 5FFMA 5DWQA 3CLRD 4FYVA 4GGPA 4ZHQA 3TKYA 1T36A 4J3FA 4UBKA 4IMIB 1NTKH 1P0FA 4CG2A 3CCLV 2IHJA 4N6OA 1YRLA 1RJGA 1E4YA 2C1XA 4K8ZA 3D3NA 2JEXA 3N2GA 2G04A 3ONVA 5ELLA 5E2BA 4RMGA 1K9MW 3TG2A 3E3NA 4M0KA 3WHLA 4MVOA 3W9UA 1QH0A 2XUJA 2X23A 2A3RA 2QJFA 3PGXA 3QLUC 4RWEA 4N7RA 4X8AA 4ETMA 1LUVA 4PZLA 2WMOB 4L5CA 1XGKA 2LFSA 2YN2A 4OQNA 5CCXA 3QO8A 3RQIA 1O5IA 2FPSA 2BBWA 4I4CA 4V1CB 4K3VA 2XUZA 3B38A 4IP0A 3GY0A 4ZTBA 4EYSA 1O54A 4D9KA 4NYKA 3SIRA 3G5TA 2ZRKA 4KPGA 4LF7O 3DM5A 3U19A 1RTKA 2NXJA 4RVNA 1WW3A 1P6QA 1UANA 3ROXA 4AKHA 4LYAA 2HP0A 1Z3CA 3M8AA 1P4AA 4IUDS 1XEFA 3QWBA 3KPVA 4EUHA 3GAZA 3K79A 4N9WA 2B9ZA 4ZU1X 4JUDX 2GBCA 2UYPA 1L5KA 421PA 1RPAA 2CT8A 2IUTA 3P4YA 5ADVA 1FQOA 2YIBA 3JQFC 5DYYA 3K16A 5IFLA 3WDSA 1A5TA 4WXPA 3U4CA 3RM3A 1L7MA 2HV8A 2NZ8A 5J2UB 4ESVA 2PAFA 3BXZA 2IBSA 4IV8A 2RAUA 4KFSA 2WSMA 1E59A 4AWXA 2YX1A 1XU9A 2RCYA 5JNVA 2PV7A 2CYAA 2WM9B 2V6IA 1UOQA 1MJFA 4GPTA 5AUNB 1SERA 4Y2RA 3T4XA 3TI9A 4C89A 4BBZA 2QLMA 4HH0A 4LRWA 4RA6B 3BN3A 2NU9B 1CEXA 3KSZO 4QOJA 2KKWA 4IJUA 1G3QA 2F2TA 4L6IA 2OCPA 5JATA 2C78A 3R3SA 5DMXA 3N8HA 2H3HA 3W3AD 2EZOA 4X3OA 4M9SA 5UKDA 3VXKA 5DP1A 1OY1A 3GHZA 2REQB 2HCFA 3K7EA 2FOLA 3L06A 5B7PA 2O19A 3ZMZA 2W8ZA 3E5RA 3VJKA 3APOA 4Q9NA 1I7LA 1F20A 3DVAA 3TE6A 3OOEA 2YIVX 2E7ZA 4EKNB 3OJXA 2Q62A 1OR8A 4MW9A 3CMAF 3HJCA 3AESB 4NE2A 5K0GA 3HK2A 3QPAA 1SRQA 1Y7LA 4B2YA 5LP6A 1Y4AE 4B80A 1HM5A 1W581 4DPLA 2CMDA 1W41A 1CX9B 1CUBA 2RARA 3FNEA 1G6UA 4XCVA 4OX9O 2ZTVA 5ALYA 2ATKC 4TXJA 1ZUQA 2ZE7A 1H93A 2D2XA 3KE9A 1HDGO 2BAGA 2PKYX 5AW4A 5M04A 2R4QA 3QXJA 3P0ZA 5BUCA 1I8TA 2ZXFA 4A10A 3KALA 1G21B 1OJLA 1D4AA 3ZBQA 2WKQA 3NTVA 2ATEA 3AK3A 2F3UA 2VT2A 1SZDA 5B2ZA 4MJ7A 2AN1A 4DJFC 1RE1A 3I5UA 5I5EA 1W94A 1E7YA 4I55A 5K51A 3CC2V 3WAKA 4QEDA 4P30A 2PS1A 1NNI1 4E5YA 1X1CA 3DUWA 1JIIA 4C0XA 2WQ6A 4OHBA 4Q4AB 3OU2A 1JR2A 4EGQA 4Q9HA 2OBYA 5A2QM 2WD7B 4PINA 3CB2A 4IUCS 2GVNA 5JJLA 4F5ZA 5AJVB 5JU6A 5TGTA 2YXPX 2J7PD 3KCXA 4JL8A 1JWAB 2WKWA 4TMWA 1PD3A 3RYCB 2W7TA 1TA4A 4U6QA 2V7BA 2R8RA 2CTPA 2F4NA 5F23A 3WICA 3A32A 3WJ1A 1YVRA 1GPH1 4W5TA 3I1FA 4LRUA 3BQNB 1BWQA 3TZBA 3L8DA 2IGTA 4NMLA 1AS2A 2WWHA 4FE3A 2A0FA 3GJ5A 3L5OA 3RS8A 3AR8A 5AVYA 2WMNB 2YRWA 2B3TA 1SF9A 3G9UA 4IBOA 5FTMA 1WU8A 2PH3A 1KERA 1NZJA 2J0VA 4B76A 2EYUA 2J59A 1FXUA 5D51S 4FR5A 3GT4A 1CRWG 2WTBA 5J58A 1JSXA 3SPGA 3DC5A 1X8KA 2BLLA 5IHXA 4NEHB 4ZMRA 4H37A 4FJCC 4Z1MD 2I4TA 4ASUD 3P10A 3UAVA 2NO5A 3S7TA 2JK0A 2GN0A 5C93A 2XWSA 1LSJA 3TB4A 4NG5A 4XOUA 2OSVA 1CUHA 4W63A 2DKOA 1SC5B 4A36A 3RN4A 2AFHB 4A2WA 1YKFA 2CFSA 5B66Z 3QEMB 1VHAA 1KNXA 1DAGA 4P92A 5JW6A 3ZY2A 5ALSA 3UFXA 3S55A 2UYKA 5FIUA 1X7YA 1HORA 2HF2A 3W5BA 4CTJA 3LHDA 2QUKA 1NXVA 3TBHA 2QUIA 2J4CA 2MIIA 4HC4A 3DB1A 1TZKA 1UMCB 1JFVA 4OXKA 3UV6A 1F2TB 1A50B 3X1MA 2MK3A 1TVEA 4LI0A 3ZKAA 2ZT7A 1GA1A 2XKKA 3ZWOA 2H1OA 1KEVA 2HWWA 3NHKA 1ZZGA 4BAUA 3AF4A 3EIFA 5L3DA 4P58A 2XOEA 4LFBO 4U9IS 1FNJA 2Q3FA 4X7BA 3BGWA 1QP8A 1RMTA 3NIDB 2H3OA 1QJ4A 3AVPA 4YXWA 1QHHA 3ITDA 4D74A 2BFBA 2WINI 3N2YA 1WRBA 3S29A 1E9RA 2M6RA 5BSVA 1PE0A 3C3AA 2VHVA 3AHJA 1SC6A 1S8OA 4BO8A 4XFDA 3RFUA 2IKQA 2OGWA 2ISQA 4AZ0A 5AOAA 1VGVA 2H2AA 1CUYA 3ICQB 3T1OA 2XB2A 1T0PA 3F4KA 4LGVA 1IBKO 3ADCA 4DA0A 4FGZA 1K4YA 2WW8A 1ZK0A 5KO2A 4RY0A 1ESCA 3UIEA 5CDTA 2GXAA 2OXRA 3H0EA 3E7XA 4Q1FA 1VGRA 3AVUA 5DB4A 3EWNA 1KMQA 2ZUCA 4DCJA 2ZIAA 2PWAA 1JCHA 5HK9A 3VZDA 4P7JA 1NBMA 2CJXA 3S8MA 1N1MA 4PZCA 3H05A 1M10A 4BJHB 1E94E 3IALA 4WOKA 3LUCA 4JAVA 4DUGA 5BWMA 5DCVA 3RYFA 1WO8A 3QWIA 4UEKA 5BV8A 3LD9A 1AB3A 1XQ6A 2IVZA 2V7WA 3D8UA 2YWCA 3AVTA 4EUKA 3MDOA 2AZ0A 1G4HA 1GUDA 5IXJA 5H1YA 4PPGA 3PCRB 2EKPA 2R2GA 1SUPA 2VNAA 1HMPA 2H48A 5BZBA 1K5DA 1EDZA 3ZE1B 3MWDA 3NIBA 3GLGE 1Y8RA 2GJ9A 3M70A 3MTDA 2I4LA 3RANA 1FFDA 3L75H 3VH1A 3H65A 1EFAA 5LKRA 3T3DA 3L8GA 1E2IA 1KVRA 1ZRHA 1BS9A 4O29A 2XCQA 1T4GA 3AJRA 3PE3A 1F4VA 1WPXA 2ES4A 2ZBGA 1M1UA 7MDHA 4MGZR 3OOYA 3T5BA 3CRMA 1RPTA 1XZNA 3NRBA 3L9WA 3FGZA 1MG1A 4ER5A 1NC3A 4NS1A 1RADA 2XUOA 1DXYA 3H11B 3SJBA 4YT5A 1O89A 3AHGA 1KNKA 4MVJA 2QGNA 3N0RA 3SYCA 4V3CA 3R7BA 2B1QA 5DISB 4UFOA 1BU8A 3AF6A 3H17A 2HK9A 2ZETA 1UZNA 3MFQA 5BY2A 4RANA 2FN7A 4JLNA 1REQB 2VTEA 3GNQA 1ISJA 2EU8A 2GB4A 3H1GA 3EVBA 1RHJA 2WIAA 2FRDC 1JTVA 5I9IA 4LMAA 4HTFB 5D1NA 1FS6A 3I6YA 5ICCA 3AYZB 4EP1A 2IELA 3NAQA 4LZJA 5DYNA 4LN1A 5BOSB 1U5CA 4FLFA 1C14A 2FKNA 5INTA 5E0KB 4YRRA 4FYIA 4DVJA 1MB9A 4KI7A 3B1JA 1Z5ZA 3LC2O 3EXEA 3UAGA 3F3KA 2Q2WA 3K30A 4A0FA 4CT4B 3SKXA 2ZWAA 3RYHA 3H6KA 2AEFA 2Y0EA 4JN6B 2RH8A 3H5WA 1Z08A 3NKFA 1X77A 2HHCA 1XTQA 1UWVA 4JCCA 3WQHA 1DBRA 1GX1A 3VAZA 4HDAA 4GZ6A 3OOHA 3QUBA 5IEBA 3WWEA 5BORA 3W5JA 4MCIA 3ODPA 2IIQA 3F97A 3T6KA 1PW7A 1ND6A 5IKMA 4XJVA 1K8YB 1C1HA 3PS9A 1F3OA 3OECA 5L3GA 4F4LA 1NBAA 2B1GA 3KLNA 3RTBA 4HDRA 2Q8NA 2YICA 2FEOA 3HYRA 3NT2A 4A91A 3UGKA 1XDZA 3ETGA 3PUWA 1N1EA 5FORA 3S40A 3QF7A 5KWJA 3QXCA 4GC9A 4QE3A 3OT7A 3U0VA 4ZVLA 2ZU0C 4L3VA 1F9AA 1RYHA 1MO4A 3RS3A 1JQEA 2GSDA 5AVQA 1L3IA 1U40A 4RA9B 1OF1A 4F3NA 2CDRA 5ITWA 1JLLB 1QFSA 1XKXA 1I3KA 1DTEA 2B34A 5FR2A 2AX3A 4FVTA 1E1MA 4P5PA 3RRXA 2UXXA 4IJKA 3G9QA 3VYUB 3ODGA 1TF2A 1PZFA 2H1CA 4AKGA 4OD0A 3AJAA 4YMSA 2B7CA 4OGGA 1GAJA 2ZDIA 1KYIA 1T0JB 4RQOA 3UJNA 4ND8B 4EHFA 4X7MA 1TVCA 2JLRA 1FYEA 3HKEA 2OM2A 1H2YA 2UXCO 3U61B 4II3A 4OUKX 2XJ9A 5F3DA 4CC5A 2AZ4A 5JUWA 3PVCA 4OMUA 3ZS9A 3HVIA 4B2LA 2OZBA 4JI8O 1KC8W 1TD1A 4FW9A 5FL7G 1WS6A 1R6DA 3CC7F 1S76D 4QUBA 4TLAA 3UAWA 4E32A 1BG6A 1QV9A 4UTRA 2B2XA 4DLAA 4JJ7A 2B25A 3UJDA 4ZXPA 2XUPA 3PQ6A 2A5LA 2HQRA 4B0PA 1XL4A 1ZMTA 2UXBO 1IM2A 5IT0A 1YK0A 1BCSA 2FR1A 2B33A 1NIJA 1DT9A 1DGQA 2O2XA 4FOSA 3VNUA 5CDHA 1VLVA 1Q1NA 1I7SB 1LQTA 2VSNA 3I0NA 1KY5A 4B7UA 3EXHC 1U1CA 3N39C 1SXJD 4ENQA 4CMEA 1H5NA 1UIMA 2GUGA 1MQ9A 2W93A 5FLEX 3H4MA 4PC2A 4DVGA 3FYUA 4GBED 5J4LA 3FPCA 1TXGA 1XFDA 2X77A 2QRUA 4F60A 2QLBA 3UN1A 3FOFC 2OCXA 4UHKA 3MILA 3K0FB 3H5OA 2IEZA 3R24A 3DOOA 3LF2A 2HEIA 4ZKDA 3ZJVA 4DSUA 3KRTA 4MXDA 3MWJA 2LCFA 1BMTA 4MT8A 1XA0A 4KUMA 3LCVB 1EHYA 1T5EA 1IVSA 3W6OA 5DM2A 3HDTA 3GT3A 4H4CA 1SESA 1PDOA 4X9XA 5CTJA 3S1AA 4R9RA 1XJ0A 1E3IA 1YH3A 1T2NA 2JFZA 3E0QA