3JARB

Cryo-em structure of gdp-microtubule co-polymerized with eb3
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
429
structure length
429
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tubulin alpha-1B chain
publication title Mechanistic Origin of Microtubule Dynamic Instability and Its Modulation by EB Proteins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 151
structure length 429
sequence length 429
chains with identical sequence D, F, G, H, I
ec nomenclature
pdb deposition date 2015-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3jarB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 3jarB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 3jarB01
2R6R1 1W59A 4O2BB 2VXYA 1RLUA 3JAKA 5LP6A 3RYIA 4KWEA 5IJ9B 5JCOC 5C8YB 4ZI7B 3HKDB 3RYFB 5LA6A 4X1KA 5J2UB 3RYIB 5EYPB 4DRXA 2BTQB 3V3TA 1JFFB 5IJ0A 3JATB 5IYZA 4M8IA 4O4HA 4XCQA 2R751 4E6EA 3C8LA 4DRXB 4EB6B 2BTOA 4TV8A 5M7EA 3JAWB 4O4IA 3WGNA 5IJ0B 1RQ7A 4ZOLB 5CA0B 5LOVA 5IJ9A 4I50A 4ZI7A 3HKDA 1W5BA 3VOBA 5JQGA 2Q1YA 3RYFA 4TUYB 4O4LB 5LP6C 5LOVB 4U39A 5J2UA 5EYPA 4I50B 5JH7B 2BTQA 5JQGB 5KMGA 1JFFA 1TVKB 3JATA 4EI9A 5ITZA 5GONB 4LNUA 3CB2A 4EB6A 5LYJB 5KMGB 3JAWA 1FFXA 5MN4A 5LXTA 3ZBPA 3RYHA 5CB4B 2XKAA 4ZOLA 1SA0B 5CA0A 5ITZB 1W5EA 3ZIDA 4LNUB 4WBNA 2VAWA 3WGJA 2RHOA 4X20A 1FFXB 4FFBB 5LXTB 4HNAB 3RYHB 4TUYA 4ZHQB 4IHJB 4O4LA 3HKEB 1TUBB 4WBNB 4YJ2B 5JH7A 3HKBB 2Q1XA 2RHJA 4X20B 5J2TB 4EI7A 3JALA 3RB8A 3M89A 3R4VA 1Z5VA 1TVKA 5CA1A 5EIBD 3HKCB 5GONA 3N2KB 4U3JA 5LYJA 3JALB 5MN5A 4YJ3B 5JVDB 4F6RB 3JASB 3WGKA 5MN6A 3ZBQA 4X1YB 5CB4A 5CA1B 1SA0A 5EIBC 3RYCB 4I55B 3N2GB 1Z5WA 4U3JB 5FNVA 1W5AA 2RHHA 3UT5A 3WGLA 4B45A 4FFBA 4I4TA 2VAPA 4HNAA 4O2AB 4ZHQA 4IHJA 5KX5A 1TUBA 3HKEA 4IIJB 5FNVB 4YJ2A 3HKBA 3UT5B 5J2TA 4O4JB 4I4TB 2GVIA 5KX5B 3JARB 3HKCA 3N2KA 5EZYB 4X1IA 5JCOA 3VO8A 4YJ3A 4F6RA 5BMVA 3JASA 5JVDA 3VOAA 4X1YA 1W5FA 4EI8A 3JAKB 3RYCA 1W581 4I55A 1FSZA 3VPAA 5LP6B 3N2GA 4X1IB 3WGMA 4TV9A 5BMVB 4O2AA 5LA6B 4X1KB 2VAMA 2XKBA 4IIJA 3M8KA 3E22A 4TV9B 4O4JA 4O2BA 3JARA 5IYZB 1OFUA 4B46A 4O4HB 3VO9A 5EZYA 2RHLA 5C8YA 4DXDA 3E22B 4TV8B 1RQ2A 4O4IB
chains in the Genus database with same CATH superfamily
2YCLA 5IBCA 2V9YA 3T6KA 3TL6A 2OR3A 1L9KA 3FI9A 3IV6A 1R37A 5A7FA 3VISA 4B4OA 3GVCA 4JLWA 2JB9A 5JY1A 5CD9A 3B9BA 4NICA 5I6DA 1RWOA 3ZIAA 1HNWO 5FYQA 2ZSDA 3GLKA 4U9UA 2ZJOA 1NXQA 3CP1A 2O5RA 2I7XA 3K7EA 4MWOA 3DVQX 2MYNA 1R88A 5KOIA 3RRXA 5JJCA 2J85A 5ICEA 3C43A 2Y1OA 4RUFA 4NJEA 2WI8A 3IJEB 3T06B 1VF5B 1KI6B 2I4MA 4FGSA 4N12A 1R8XA 5D51S 3LKDA 3NG1A 3NTXA 3PR1A 5GY7A 1XT6A 4QPJA 1S72V 2R11A 1PFKA 3L93A 3E5HA 2VPPA 2CXXA 3DD5A 2VATA 3OQVA 4UASA 1UK6A 3NMUC 4A5UB 5E6SB 2ZJ4A 2B5WA 2JGEA 1R6BX 3AYZB 3W9YA 5AKGA 2HO5A 1M73E 2E4AA 5C93A 1PNLA 2WWXA 2PU7A 3H1FA 1VCIA 1P5JA 1JPXA 1U9IA 5FL7D 1HYEA 1C0LA 4G4VA 2YFHA 5IHXA 2GPTA 2UUPA 221PA 4WW0A 3EARA 4DV7B 1QHGA 3STYA 4BS9A 2P90A 2BKVA 4YO7A 1V4NA 4BMNA 2BFFA 1HP8A 1GL9B 3AIIA 1I32A 3NRCA 2J59A 3A4IA 1VSTA 2NVOA 4W4LA 1OC4A 2JFOA 4NTYA 2BEWA 1IG0A 2XE8A 4EJSC 1U97A 1Y33E 5CCBA 4MQEA 4JVLA 2C4NA 3H18A 3L5OA 1GADO 4KEAA 3CF6R 2QY6A 2DMRA 3SF8B 1AR4A 5JFGA 1CBUA 3WYNA 4P4GA 2O8BB 3IJRA 3H2BA 3HR0A 4AKEA 2VP9A 3T9BA 2AT1A 3X43A 1EX1A 3B6JA 4XEUA 5I4BA 1G3RA 4EQ6A 3MK31 2RI1A 2VDUE 3TXXA 3QG5A 2P5YA 5KWEA 2CDBA 4BQQA 5ETJA 4Q3NA 1VQ9V 5LGNA 3JD2A 4JC5A 1W48A 4FEYA 4C8GA 1CHNA 3A4VA 3TSOA 4PONA 4H1WA 4YV1A 3UAXA 1YQTA 4DCTA 2G08A 5IWAB 3DL4A 3I12A 4MKIA 4NH4A 1WQ3A 1OKKD 1USGA 4HQFA 4ZQBA 3CX3A 5LP6B 1U9JA 3PCTA 2W4MA 4IFEA 4TL8A 2R7NA 1Q1QA 1TM4E 4MUAA 4WN9A 3L7LA 3JQGA 4AXBA 3H9BA 5DNUA 1N4CA 5A2QN 2PZAA 1AKQA 3BMOB 3T9EA 1QG0A 5J4VA 5IASA 3L8HA 1IG3A 3C9RA 3YASA 4FK5C 1UT6A 5LDGA 3ZQJA 4EEXA 1THTA 4M46A 2C2BA 5AHXA 4HL6A 2WOOA 5H5NA 4YUWA 1YAJA 5AKJA 2P7TC 2FZ5A 2FZWA 3VR4A 1AA6A 4F4IA 3KJXA 4IDHA 1IRXA 3GGGA 2AJDA 1AE1A 1W0KA 3BZBA 2VK1A 2YFYA 2QRJA 3ZE9A 1I6LA 1Z28A 1HZZA 3GFVA 1TADA 1XI1A 1PZEA 5EE5B 5DPMA 1NJ5A 4PCLA 4CKBB 2W7TA 5KNBA 4F6EA 3F0FA 1HYHA 4KP4A 3ZWCA 5LP6F 3QJ5A 1QX4A 3F1KA 4RK6A 2CL6X 4J1SA 1VQOF 3ZWBA 2XECA 4FONA 1Z7BA 4OG2A 3LUPA 3KT3A 2WUGA 2OZLA 4ESOA 1YS1X 1EG7A 3ISVA 3WWPA 4IRXA 5H16A 3BRQA 3WLKX 5B3KA 5CH8A 5KA6A 4ZI7A 2WYHA 1JAIA 4N8EA 1NU8A 1BO6A 2HOQA 2QN8A 3R7WA 2WLJA 2AZXA 1E0DA 1JDZA 2UYJA 5TRTA 2DQYA 1ZIYA 2FC3A 4UCQA 2G9ZA 3VPHA 3BSSA 2P35A 1E1RD 4Q0MA 1JA9A 4FQ5A 2B4KA 1PGJA 2IOYA 3CS3A 3HBNA 2ONKA 4P53A 2RONA 1BE8A 1KO7A 1Q7RA 3CG6A 3E7DA 3CD6V 4PPYA 3IQGX 1FXHA 3BTSA 2ZYAA 2PAFA 4C04A 3D7RA 3L18A 4DA4A 4P3YA 4HY3A 6Q21A 2MW2B 4LBYA 3WLNA 3OCUA 1IXZA 3O3MB 1NZDA 1TJ5A 3H2GA 4FFPA 3M5PA 1KERA 1PWYE 3G2JA 4DLYA 1LPSA 3MTGA 5D3QA 2GHYA 1YQ9A 1QU3A 4FILA 4YPOA 3ER8A 3LDUA 5D3MB 2MHCA 1NG1A 1HLGA 2ODQA 1GPMA 3W6ZA 2JS3A 5E95A 1PLJA 2SBTA 5DI9A 1D6NA 1VOTA 1W94A 2HHJA 3W7AA 4EUSA 2BHTA 2W2KA 1V5WA 4I1VA 1SBHA 2OCYC 2VK4A 3TSAA 5TQ2A 3SJZA 4DDKA 4L6IA 3EIQA 4L28A 1CB0A 2W0SA 3TW8A 1GAWA 1XROA 3OX1A 1II8B 2EJ7A 5BQPA 2IP4A 1QIIA 4EY8A 4OI1A 3UT5B 3GAFA 4DC0A 4RD1A 1NJ2A 4FYXA 3AUXA 3OEYA 1H2WA 4X1IB 4CT5A 1LW7A 2OXFA 1QCCA 5FFFA 2AK3A 4MR9A 2HYDA 5J4YA 1LPMA 1E6WA 3HEAA 4WZAE 3CPEA 1CY1A 5EIAA 1PQ4A 5K3BA 2AC4A 1JDTA 1YSCA 2OV1A 3W2HA 2DG2A 2HVKC 3L6BA 4G27B 1Q86W 2HGZA 1G9SA 2YVKA 1C7QA 3I2FA 3ZVNA 1PX0A 1UBFA 4XSVA 1UBRS 3VYSC 3QFCA 4L8YA 3KEQA 2QG4A 1M9NA 5K01A 3EFOA 4XWTA 2QTCA 3AEUA 4B7UA 4KG7A 4LJLA 4YUYA 1G1MA 1F4NA 1BMQA 3ZV4A 1SIBE 2LD4A 4DWWA 1P2BA 3M4NA 1H8ED 3T5MA 1Z35A 2UXCB 4NUTA 3O0DA 1QRDA 2ISQA 2ZIXA 1O6GA 3F4BA 4EPWA 3I6YA 2WFMA 1XYGA 1K3TA 1MZPA 4X1YA 2QMOA 4DBLC 1OSNA 2YYSA 3L2OB 2QVCA 4RS3A 4KODA 3CWBH 4IJMA 3DEKA 1XXHE 1OILA 2YWDA 3WG7B 2BUAA 4ZAYA 5DNWA 4ZVPA 3IIEA 1OTXA 4NATA 4K2HA 3QEBZ 3LDDA 2OLEA 4DMGA 2GRAA 3E58A 2ZS8A 2N1MA 4DJEC 5KI6A 1O94D 1YR1A 2ZJ6A 5DYGA 5DN9A 1P7BA 1KRXA 2RI6A 2Q1YA 3K94A 5HK9A 1MX5A 4OMUA 2HT6A 4J7JA 1NUPA 3SYPA 1I6KA 2SNIE 4MWTA 5IAGA 1KYZA 3JSAA 4IP0A 2ODAA 1AP6A 1ZBQA 4YAGA 4UOEA 4TMFA 3FDZB 1AJNA 4Q1VA 1C9MA 3GLFB 1WUJS 3RFRA 1WP7A 1KQSU 4YCSA 3OU6A 3VH3A 3S8YA 4E12A 2CDCA 2F4VB 1HE4A 1GGKA 2YWXA 3IFSA 4CM6A 5BW4A 1RP3B 3ZK7A 1MQAA 3KWLA 2GF9A 2I6SA 3OJXA 3A70A 1IL0A 1U3TA 1OJ7A 1A9SA 4BKMA 3OCJA 2G6BA 2KKWA 5C53B 3IAM6 1HNXO 2VYFA 2VT3A 4C2TA 4PR0A 1S8AA 5ESRA 1U28C 5HFJA 1AY0A 3DXRB 4U2FA 2QRNA 2I7DA 3IIKA 3SJAC 3NT2A 4CEJA 3KSBC 4F3YA 3BJIC 5AXBA 2PUGA 4WLUA 3E27A 4YLYA 3QKUA 3AF0A 5EWMB 5KNLA 2F1KA 3QVLA 3FMPB 5KTRA 3RBAA 1ZLXA 3HB7A 4EGFA 1G3QA 2WYOA 3L06A 1J21A 1PR9A 1RRVA 3SEFA 1SFRA 2V7QG 1CU1A 4DO2A 4J0QA 4AJEA 3Q7EA 3RH0A 3ER9A 3LC2O 1YI2F 4IDAA 4NPHA 3OURA 4OL9A 4BIZA 1FXKC 4Z2WA 4CWAA 3DB2A 4O2AA 1S77D 2AMLA 3MPUA 2PI5A 3I1JA 4C14A 1UH5A 4QA9A 2WPDG 3KYIB 1IEWA 2JJQA 1YBMA 4TYPA 1ATIA 4RHTA 2BR4A 3CXCU 3I09A 2PTMA 3NWPA 4WDQA 4MVMA 2LXNA 1FL9A 4KR3A 5I4CA 1KDOA 1UXHA 2UUAO 1QFYA 4LJ6A 4EL5A 1RZRD 2DQSA 2X2EA 1USIA 3DUFB 1J07A 1YVRA 3K53A 2M6YA 5KOHB 4NYMR 4QYIA 3B4SA 1Z0IA 2ZYWX 1TU4A 1FQWA 5JZSA 4NYMQ 4YQFA 1OH6A 2BFOA 2GN4A 4KRYA 2I22A 4H08A 2ATIA 5HKKD 3SY8A 1DLIA 1T9ZA 1PVVA 1EEHA 1GAJA 3VPCA 2BBWA 2CZGA 1X86B 4OQYA 3SSOA 4FHCA 4CPDA 3NBUA 2A0UA 2V6JA 3O95A 2KLHA 3EUAA 4GDMA 3LUHA 1XZJA 3DBRA 4J1TC 5DT2A 5L4LA 3SMVA 3LTEA 3RE3A 5J3JA 4P6VF 5FFMA 1JPJA 2PKQO 2C9CA 3LDTA 4LOAA 3C8LA 2XCRB 3WLRA 3D6FA 4QTUB 2JAXA 4MV3A 2I80A 2XVAA 1LXCA 1YIAA 4RIEA 1SVMA 2YHAA 3WWOA 3ODPA 1FFGA 1Q6HA 1XTRA 2OBYA 3QWAA 3Q87B 1OYYA 3MFQA 3RO7A 4P30A 1CTQA 3ZHOA 2UXBO 1Q3HA 4LDRA 1OCRB 3L0YA 4BIMA 1ZG3A 2BFFB 2J6CA 3RYCB 4IICA 2EIKB 4PGAA 4CS4A 2FQQA 3CPSA 4QJIA 4IIJB 1G3UA 1EM8B 5LWHA 4V03A 2PS9A 2E5LO 3FPLA 621PA 1PW7A 3V80A 4F2DA 3L0DA 1OY1A 2PZGA 1WLEA 2HSEA 2CHSA 2R9AA 3MCUA 1XEWX 3GMIA 3DWFA 1YJXA 2PHNA 1RWPA 3H7AA 4N54A 4E5NA 2J9GA 2QLNA 5CMLA 3PEUA 4OLAA 3DKPA 3R6DA 4QC2A 4WI1A 1E1CB 2VP0A 2EFYA 4TUYB 3C15C 4WY2A 4EQ6B 2IYOA 4LDNA 5BSTA 3L43A 1V11A 2O8FA 1YCHA 3D0KA 1K34A 1M57B 4N0DA 2HSDA 4QDUA 3KQNA 4DSUA 4ZQIA 2N05A 2IP2A 2CY0A 1C9KA 1P1JA 2CEKA 2C4UA 4M0PA 2Y0PA 3EVAA 1FP2A 4OI4A 4RMJA 3TL2A 4BQEA 3KYJB 3DD1A 4DV1B 4OQMA 3KQMA 3C5VA 2WLHA 5BQ3A 2Q6IA 2V0NA 4IIJF 3A8TA 4MW3A 5DV9A 2BOBC 1H6AA 3OOEA 1R8JA 5L3RA 3B9PA 4Z1MG 5F2OA 2CMHA 1Q19A 4WN9B 3STXA 1DKUA 4RMHA 2XUIA 7GPBA 1S96A 1JILA 4YRFA 2VG8A 2RK6A 4P08A 2R72A 1NSYA 4CTOA 1RWNA 2Z3ZA 3MTQA 1E3MA 3MTBA 1U3PA 3S81A 4E4RA 4TUYF 4HN2A 3CH6A 2KX7A 4OSOA 4TQDA 2EQBA 4KO4S 3TEJA 2HFJA 1UBEA 2X1MA 1VSUA 3UMMA 2OCKA 1I1NA 4AJLA 5KINB 1PF7E 4BWVA 2R7KA 2YW9A 5G40A 2HFEC 4ZRMA 4P35A 3DC2A 3CJHB 4U7WA 2GFQA 1M5UA 4E33A 1XRRA 4LMBA 1L8AA 1SWWA 2R25B 4LWZA 4M7PA 3LGSA 4D5GA 1VG9B 4K6MA 1NKDA 1AJQA 1W41A 2HLNA 1N5MA 4ND8A 4G0NA 4MVJD 1JHDA 4TMVA 2E1PA 3E82A 1NJ6A 2EHDA 3NLLA 4QBTA 5LJLA 3CSXA 3QOFA 5I8ZA 3MC1A 1ZITA 4X89A 1ULZA 4TLAA 3UTCA 1U31A 3A9VA 2XW6A 4K9OA 9LDTA 3B8NA 3DNFA 1SY7A 1P29A 2H52A 3GRPA 3WMEA 1YB6A 3PLAC 4FMPA 4DLSA 3LY8A 3UMRA 3H1BA 5HF6A 4IRMA 3OFND 1Y34E 3CPWU 4CKCA 1RSZA 1M8PA 4N6NA 2WHPA 2JAQA 4KTVE 5HZMA 2XNSA 3BKXA 2CJPA 3WGZA 3PTZA 3H3FA 5K3FA 3FZGA 1E7RA 3PFNA 5K8CA 2C31A 4INAA 5KHKA 1G0OA 1SF9A 4B45A 2HRCA 3F5QA 4U9HS 3K0AA 4N3NA 1XILA 4NS4A 3CCUF 4ZRNA 2PPLA 1Y4ZA 4KMSA 1DQYA 3T0FA 5EWLA 3G02A 2EKZA 3OE4A 3TS1A 1U40A 3I72A 5HTOA 3T2MA 3TJRA 4O4JA 2F9FA 3DDSA 2OFOA 4YMUA 4DV4B 3NK6A 4FEEA 2HMTA 1E3SA 3O4RA 3W2IA 4KAAA 4I4NA 1K1EA 1OYVA 2J3HA 3C3SA 5CT6A 2D0IA 1JR9A 4NFSA 1AKNA 3CLTD 5CIYA 1UBLS 1P7VA 2QR4A 3VSAA 3FPGA 4G56A 1FFWA 3C1AA 5FUMA 4PA6A 3BS4A 1UKAA 4CKYA 5E6RB 2W2KB 3IP9A 2BGKA 3T7KA 3HKBB 4EB0A 4C0HA 2VNAA 3GLIE 1U7HA 2OYQA 5KHAA 2H57A 3WGHA 4A2CA 2XUOA 4H6VA 5K4HA 1Q0QA 2NVWA 4NZPA 4AWBA 2EYQA 2YXYA 3K2XA 3PX7A 3LLUA 2WLIA 4DADA 4B73A 2C4MA 3JQDA 4CFYA 4J9UE 4MR9B 5LP1A 2PMCA 2Q41A 4QE7A 3ICXA 1OZ0A 2HHHB 4WD3A 2DQ0A 3N4ZA 1FX1A 3CEMA 3B2EA 2H08A 3CFYA 4W1SA 1J99A 3N8KA 1HLPA 1DAKA 1JDUA 1HQCA 3Q8KA 2WTBA 2RGWA 2QX7A 2VH2A 4OU5A 3L41A 3KBOA 5CB0A 2V3WA 1VQPF 2C0PA 1B0AA 1A04A 2JLCA 4NWOB 3EFOB 1VRVA 3H2JA 4C6RA 2O2HA 1OIVA 3D3KA 4HNAB 4ZEXA 4HNRA 3D6HA 1N57A 3L8CA 2IEYA 5A9GA 3F0TA 3D8NA 3B8EA 3TSWA 4OQZA 2PZSA 4P4LA 3GARA 3B36A 5CH5A 2ZJFA 3HL4A 1AQNA 2FCRA 2P91A 4F72A 4Y98A 2NPOA 4NU6A 4UB6Z 4GX0A 3R66A 1M1YB 2C03A 1GH6A 4MLPA 1JH8A 1SIUA 2FWIA 1XJ5A 3OCYA 2WJIA 1I2DA 2QTFA 4OJTA 4AJJA 3GYGA 5C7LO 2FMXA 1J42A 4HGQA 5DNYB 2ZUEA 4ZDWA 4WHMA 1JZTA 4J0HA 4N7JA 2Q8PA 3IP8A 3WNVA 4YCNA 4BE7B 4PFJA 4ZO7A 4OO3A 4QRDA 1KP9A 3DC5A 2FB9A 3FF1A 4RVDA 3HVJA 4JUAA 2NTYC 3Q5GA 4IUBS 3OUTA 2DHRA 3ME5A 3MTJA 5IAEA 1JR2A 1OLSA 2FV8A 4PYNA 5DM1A 4XI9A 3PRKE 2PVSA 4ZKEA 3LY7A 3N6RA 1T4CA 4GI3A 2O3TA 2UYNA 1KQSF 3DYVA 2VHWA 4LYJA 5GP1A 3JQFC 1ZGAA 3RS7A 3KEGA 3V7QA 5E8JA 2DWQA 3G2IA 2Q3LA 4L5AA 4UVGA 5E7QA 3MD0A 2RK4A 1I4EB 2HC9A 1U0GA 4I0XA 1AMOA 2V1UA 3ZUPA 4X1KB 3ABIA 4YB8A 2HDWA 3H0EA 2ESRA 1W88A 5F2KA 2WNHA 1JU4A 2VPTA 5HJ2A 3HM2A 2EEPA 3LC0A 5IJXA 3AUTA 3R9XB 2X23A 1KARA 3TTYA 1WB9A 2AKAB 4AUEA 2EJBA 2CXRA 5AOVA 4D8UA 4A9AA 4OYLA 1G6Q1 2H0AA 1M1YE 1S9DA 1A9TA 2RH5A 3IUYA 2YZNA 1GM7A 1LBSA 2OCBA 2FPIA 2XMQA 4B3TO 4BVSA 2WQZA 3IT1A 1BJRE 1JQ0A 3MELA 4OOEA 1XR3A 1USVA 3IJPA 3PQ5A 4QEDA 3GGCA 2G25A 2Q0HA 3LKVA 4G5RA 5ENDA 4ZIRB 5K0EA 3F73A 4D79A 1KBQA 1QSGA 1NQWA 2IOFK 2CZQA 4CIDA 3UXMA 3SZRA 1DJMA 2CHVA 1IDN1 3QNMA 3PXAA 1T9GR 4CG1A 2YS7A 821PA 2YXLA 1AUQA 1TK3A 5E0KB 4XBFA 5HQTA 1YB7A 2VPXA 1N0JA 4TMZA 3FDIA 1P75A 1P5FA 5BXZA 4MKRA 1T5DX 1U1FA 3RYIA 2QE7D 3CXCF 4ERHA 1YJBA 3EXG1 1ESCA 1A7KA 4NDNE 1T29A 1T0AA 1AQLA 1KAOA 5TMEA 4EGCB 4EFBA 1AHNA 1T9HA 5LQJA 5AJYA 3E3NA 7MHTA 1ZO8A 3UOAB 2J9XB 4AW9A 3TIXB 4HUJA 4LS3A 1LJUA 2QROA 2K7FA 1AXEA 5FUQA 3SEAA 2CUTA 1CY6A 3FD9A 1NJIW 2O20A 3C4QA 1QONA 3KJEA 2C8VA 3DWGA 3VR3A 3ORRA 1TT5B 2ZYHA 4JL8A 5KTTA 2HHCA 2OBBA 1XTJA 2GBIA 4U5QA 2QGNA 3NOXA 3K6RA 5JS8A 4TLMB 3QBEA 1E6EA 4MV0A 2RHCA 1KOFA 5EJMA 5FP0A 3FOWA 1B41A 4HHEA 4RZHA 1H0KA 4IEIA 2VAXA 3KXLA 4A82A 2OZKA 2YY7A 4LF9O 2HGSA 4BPRA 2HJRA 1E60A 4B5LA 1Z0SA 3RSOA 3O4HA 4QBKA 3EF0A 4C22A 2B8WA 5IANA 3MJSA 4IT5A 4AS2A 2QLJA 3ITDA 3KPVA 3IOCA 4MS4A 3CKYA 3M49A 3A1NA 2C9MA 4DLUA 4MPTA 3CRQA 1FFXA 1GO0A 2Y1KA 3Q3HA 2XHBA 3FZYA 4CZ2A 5JISA 4K46A 2NIPA 4A2PA 3FBAA 1RRKA 1DO8A 1RYYA 4Q3AA 5CM2Z 3WK5A 4FFBA 5K8TA 4KQ9A 4EKGA 4RK4A 5GVRA 3OT1A 2CFCA 4UEOA 1GOTA 3HFSA 1M10A 4GKJO 3DF7A 1W5FA 1O95A 1V55B 4PGMA 2G5TA 3BGSA 4DR2B 3C5HA 4TVSA 3TSCA 1JVBA 3MILA 1D2RA 1A69A 4C7VA 2A4MA 3KOYA 2AFHB 2R6R1 1MJHA 1J5EB 1F1BA 2XQFA 4D0GA 4LAFA 1M6VB 3A0RB 4MKGA 4F92B 1PHPA 5EUQB 2FEMA 5KVVA 1AZLA 2H1FA 4MJLA 4DEVA 4QYMA 3FSEA 2JFNA 4KI0A 1JHVA 3C8DA 2O8FB 3DO8A 4FFKA 3ZV5A 3OOSA 2XWQA 2NYUA 1VH8A 1U4NA 1A8IA 3FAKA 4D4MA 1DIAA 3KB1A 1QZZA 3ZIAG 1EFPB 1KJ9A 1Q22A 2EFGA 4FYIA 1TUGA 4AROA 5AH0A 5ALRA 2E49A 2IDZA 1RD4A 3KAQA 4PZPA 3HBJA 4C8IA 4N0QA 3G85A 121PA 2F95B 2O3QA 3CH5A 2RGCA 4U8HA 1O9HA 1CR6A 4RKRA 3QUSA 1EH5A 1JQLB 4IXMA 2AB0A 3B7WA 4QLOA 2X7JA 1ARZA 5KU1A 5ALDA 3SQMA 4BGUA 1SHZA 2AQIA 4KUHA 5AG2A 4P81A 5LSAA 4ZVMA 2XX3A 3I9JA 2Q3JA 3G6BA 4HRYA 4G36A 2YTZA 4K9DA 4G09A 3M7MX 3SQLA 4FWBA 4ILEA 3CEPB 1IM5A 3FNRA 1YNSA 3ITEA 5DIZA 1IBLO 4TVKA 2EWCA 5AJHA 4CR6A 4BW0B 1XQ9A 4JVOA 4LMAA 3SGLA 3QLVC 3CXRA 1JQJC 4XPIB 2UYYA 3HVKA 1SCUA 1L8LA 3GPDG 4Q1DA 2FSGA 2JLUA 2M6RA 3MJDA 4XDHA 1Z6ZA 3WJ2A 5TQ0A 5DLPA 2ORVA 2E48A 1LI4A 1GFWA 3T1CA 4OK6A 1PG2A 1LA2A 3G0OA 1R3JC 3AGPA 4CKWA 3V7FA 4C08A 2AIFA 1UZUA 1X87A 3F5DA 4R1OA 1V5GA 3CRAA 3AIMA 3KYDA 2D2IA 3SOPA 3LRXA 6AT1A 1WB7A 3EGEA 3DF9A 1O96B 1QAHA 1U2SA 3WLAA 1VCNA 2X1VA 4AY6A 1IEVA 1BEUB 4Q4DA 4ZYZA 1TDJA 4NJMB 1DPGA 3IAXA 3CPWF 3BK7A 4E3WA 4NV0A 3PWZA 4URHA 3EOBI 4CKCB 4CL8A 4IAOA 1N6IA 3TGUH 2WHPB 5J5CA 2OHFA 5LMNO 2W6IA 1CUCA 3AEZA 2G17A 1UPCA 2O5CA 2G9IA 2V7BA 1ZQ9A 1N6NA 3LX6A 1Z16A 1IY1A 4WKBA 1ZH8A 1NYQA 4YJFB 3QTBA 3HEBA 3H83A 1A97A 3A1WA 1UOOA 3LI2A 3BSFA 3N0RA 1XF1A 4B81A 1I10A 2IHKA 3DTYA 3A4YA 5EWLB 3CTMA 1L2TA 4NCAA 2H1SA 1BROA 5L45A 2ZCUA 4EA9A 2IA5A 1Q82H 1GL3A 2H2WA 2NXNA 2EIMB 5DTIA 5I9BA 1DV1A 2PIDA 4HWKA 1WSBA 3UHOA 2XCLA 4QEKA 5FAKA 4M1WA 1AXRA 2BD0A 4PAMA 4ZU1X 4FCTA 4JI1B 3E0XA 2F8LA 1JBQA 2GJ8A 3H99A 4UMEA 3V00A 1YRYE 3K5IA 1LRKA 1O58A 1U6IA 3ZY5A 3RLIA 3S3TA 2QTVA 4X3OA 1IC6A 3D2BA 1MX1A 2CFTA 7YASA 3HP7A 4QOGA 4BNKA 2X77A 1QXSA 2FFJA 3NBXX 4IGGA 3OTQA 1SKBA 3ZU6A 4D9KA 3WHLA 4A23A 3OZBA 4HFMA 4F4HA 2YX1A 5HIAA 4E5KA 3GZTB 2J4FA 3HB5X 5D3ZA 1ZVVA 4KL1A 4XSGA 3JX9A 5EP2A 2DE0X 3VR5A 3FW1A 3NVDA 4LX0A 4N5DA 3HY4A 5I9TA 3OZEA 3BFXA 5E7JA 2Q4PA 4KVZA 1W0KG 1SQQH 1UOEA 1XKLA 1DRKA 5I5GA 1GDDA 1UMDB 3HMKA 5JASA 4DLRA 3EPHA 4CEIB 2P2CA 3H5LA 1AGNA 1P4JA 3DM9B 2HX1A 3NCTA 3T35A 4FYJA 3RRYA 3ZW7A 1SZCA 4BLWA 1WBBA 5AOAA 3BHMA 5BN1A 1VGRA 5KWSA 3SM9A 3ZBPA 2TMYA 1EFKA 1ZMOA 2P69A 1KYOF 1D8TA 2O14A 2ZUBA 4ZXPA 3DMTC 4RA9A 3ZCRA 5DNEA 3AOEA 5FHQA 3URKA 4IMPA 5KZMB 1GCIA 3AKDA 4DBVO 4R2MA 5CRIA 2Z2XA 4GKBA 2R4UA 1VQ6F 5DOVA 2FR8A 3FFAA 3CNHA 3BUSA 3DLAA 5HW0A 2ZRPA 4XGNA 4QTYA 2BOVA 2EWVA 3Q3JB 2Y9MB 3RA5A 3EXHC 3W7BA 4B6PA 3KLOA 4Q9IA 4ZTBA 1DIOB 4MQBA 1FFHA 3FKSA 1CV2A 1NONA 1U99A 2Z5GA 5B6IA 4WLVA 4AMUA 1JEAA 5KHIA 1U2PA 4PZEA 1YU6A 4BNZA 3JAWB 2ERYA 4OBWA 1VQMV 2BGRA 2PX8A 1J0CA 4MTGA 1CEZA 4PTZA 5HFMA 5FPOA 4JXZA 4OP1A 5ICGA 3ICWA 1Z2AA 4NMXB 1VQMF 1IUOA 2FX2A 3L79A 1LLQA 5B7PA 4YWJA 2C4TA 4B48A 5HCIA 2V4ZA 3B70A 1YQWA 2FMFA 4G0OA 5CB4A 4NZMA 3LWRC 2IGTA 4YPFA 1KI7A 2UZIR 1VHAA 1KR2A 2Z2KA 3HABA 4FB4A 2C29D 3PGMA 1H2YA 5FTWA 4MRRA 1OCOC 4RXMA 4JAAA 4H33A 2WP0A 2IZ6A 1F51A 1EZ4A 2BE3A 4YRQA 3K05A 4L73A 1W88B 4UM7A 1XMIA 5BVGB 2D5AA 2BY4A 1JYFA 4ZT3A 3RFVA 2V7XA 4JBGA 2UZAA 5EZ5A 1NL3A 1H0SA 2LRHA 4MW6A 4X85A 1BFKA 5DM60 1QOQB 1G8AA 4DCGA 4AICA 5ALPA 4Z0HO 5CA0A 1PSZA 4QNNA 2D8MA 1CR1A 5JEEA 4GX1A 2GLZA 3QMPA 4MRMA 1RM5A 2QN2A 4D92A 1S2NA 5EWJB 2BFEA 4Q4AB 4W8OA 3WAKA 4MUHA 1ICIA 3TZQA 3J80A 3COVA 2ADFA 1ZA2A 3LDAA 1AXGA 4WJZA 4EM6A 4FVMA 3GYBA 1NGSA 2A5FA 3E61A 2M9MA 2Q7HA 4G9BA 4PAGA 2VF4X 2O6LA 1B6RA 2Z8YA 3USES 2VJPA 3RYIB 1U0RA 3ZY3A 3M8AA 3IAS6 3ADBA 4YCAA 1MF7A 2N46A 3ASYA 1PM9A 2HF8A 4WGFA 3WZLA 2R5WA 5FIUA 3JZAA 2FSSA 4N5MA 3DE3X 1JLLB 4H7IA 4I36A 4J6FA 1BKYA 5EE9A 3LHDA 1A32A 2GJSA 5UKDA 4HAOA 4C7MA 2IHTA 3OC0A 4DWJA 3OLYA 4H77A 1SEPA 5DX8A 4CM7A 4JI0B 3K2BA 4ZZ1A 2HNBA 1MQ9A 4KFRA 2O1EA 1S72F 2ECKA 1NXXA 1OAKA 4WZ6A 2NU8A 1U0OC 1T9GS 5K6TA 2NPFA 4YHBA 4I0WB 2MOKA 5BNWA 1KYYA 3LUFA 4WFBV 2EIXA 5B1DA 4F84A 4GPTA 4L15A 4Z7NB 1FXWF 5JSUA 3IQZA 1X7YA 4LZAA 3OCXA 3UUWA 5JAOA 3JAKA 1F2TB 2ZVDA 2IYUA 1GG2A 1QGYA 1L4NA 4KDCA 4LYHA 3IALA 1A82A 1P0CA 2QS9A 4I5FA 1TZKA 1N7IA 2DR3A 4OHUA 3CE2A 3UW1A 4TLCA 1OAPA 3H65A 3GLRA 4U7PB 3GA5A 1SXJC 5B30A 2HI0A 4GSYA 4DMKA 1V54C 3DP9A 4DLVA 3IPLA 3TKYA 4INOA 1JA8A 1HE2A 1JQEA 4MS4B 2H1IA 3LBHA 3RVDA 5KYXB 2JEOA 1VJ0A 5B3SC 4KSBA 2IUSA 2ZG6A 2DYSB 1FFXB 3NVKI 2J0VA 3HDYA 3QO7A 5IXJA 2SCUB 1MH1A 1A98A 3PGLA 4GUAA 1HG0A 4EECA 2B2XA 2QT0A 1BD3A 3H11A 2Q0XA 4CCYB 3UOWA 1KPHA 3PGJA 3U0ZA 4QIWF 4PV7A 2PNFA 4FIPC 3HKCA 4Q39A 3D0OA 3OT1B 3R7FA 2QP4A 3I45A 4F97A 3NDIA 3HK2A 2QI9C 3U0BA 2P75A 1CRWG 3UXYA 4H59A 3KKZA 3PIIA 3T3NA 3T3IA 3WOHA 3DONA 4TT3A 1T15A 4F8JA 2ADOA 4B3DA 4C6TA 1E6KA 3DE6X 2IQIA 4EA6A 4R1MA 2IYEA 3ANMA 3RCBA 2P6OA 1QIEA 2EIJB 1NVAA 1YF3A 5F7JA 4A0FA 3PHGA 3I04M 4GRIA 5T41A 1SUAA 5AVSA 5HMLA 1JFVA 1VQ9F 4Y9DA 4N7BA 2CJYA 1F7UA 4HZ3A 1EGAA 1V7QA 1XEXA 2QMUA 4YIOA 3BT7A 3ZOKA 1F60A 3A9RA 4Q4JB 4F96A 3GD7A 1RAHA 2L82A 2GJ9A 2YJ4A 5FPPA 1VHWA 1UBNA 3ORHA 4HDAA 1Z0ZA 4QFMA 1NDUA 2JIOA 2VWGA 3OA0A 1N2SA 4QFDA 3A1CA 1OCCB 3KE9A 4NDZA 1I5XA 4C05A 3NT4A 4JI6B 5GV7A 4EO7A 4TGLA 4DDUA 3LSYA 3BDIA 3PYMA 2J9ZB 4XX0B 3K72B 2G4LA 4Z1VA 5ADUS 2UXXA 1Y1PA 3LUKA 1D0VA 2F93B 4C30A 1Z18A 3WICA 8GPBA 2WFZA 5L9AA 3BGVA 3AEKB 2VUTA 1HQYE 1HMYA 4M60A 2E82A 5AW0A 3GLUA 4XWKA 5MFZA 3I42A 4DARA 2O48X 4K3AA 1UQTA 4AFNA 2HN9A 2HSZA 4BVBA 1GNQA 1GR1A 4XDLA 5AVTA 1TVEA 2FPGA 1YE3A 2VUSA 2I7VA 5MF6A 1A9RA 1J09A 1TEVA 2QWRB 1OJLA 1ACMA 3N8NA 4IIGA 5K8UA 4R4JA 4MNTA 3WKAA 1NZ6A 3M3PA 1BG6A 2VDWA 1W2WB 4CNBA 4QUGA 1WUTA 3AF3A 4K8RB 3F2IA 1U2DC 3NONA 1GPBA 4Z0NA 3PX3A 1KBHA 3O8NA 5TQ0B 4HQRA 3NKLA 2HMVA 3GEBA 4NBLA 4OAPA 2SKCA 2P11A 3RS4A 3TIFA 4NF2A 1HV8A 5ICCA 3QO5A 3GEHA 4PWYA 2XAUA 4CIYA 3KYDB 4UFPA 5CPFA 3I5UA 3TNYA 3ICVA 3AVYA 2C0QA 4BN5A 1XFDA 3D6VA 3SSNA 3OEED 4P8RA 4ZCSA 1EM1A 3R9KA 1XLVA 4NK4A 2PAAA 1F9EA 2C00A 2JA1A 2OWEA 3V1YA 3EEOA 1PQPA 4F21A 1TZ2A 4X66B 2ZRLA 4JXJA 2VDMB 1RSOA 1QGOA 1KWGA 1W9HA 2ZAUA 1GGMA 3MDOA 3AEYA 1Y1QA 1KMCA 4RA6B 1PYGA 3WNQA 4UDNA 4GR5A 3MQFA 3CD6F 3IEXA 2IHBA 3TR5A 4JB2A 2BSKB 3QXXA 4LHXA 4O3MA 3ZNOA 5C18A 2HM7A 4CFSA 4B8ZA 1GHTA 3RI3A 2GCEA 1ZNZA 2I5PO 2C61A 2BF4A 1MNGA 3T80A 2OECA 1XCMA 1ZONA 4TSRA 4YRNA 5CBPB 2P6MA 2XUQA 1ZI8A 4GGPA 3KUUA 1PRYA 4FZ0A 1K0UA 4U2GA 2GM5A 4TV8A 3MAGA 3B40A 2VRCD 2C5EA 1YIJV 3C7CB 1JL3A 2IODA 3V1NA 1T2UA 1WXWA 4UHHA 3TR6A 1Z38A 2KG7B 1WXXA 1UDRA 2UAGA 1PGQA 1DKOA 5BN3B 1KDPA 2QHXA 2OQ2A 3HJNA 2A92A 4MWCA 1XPOA 4FCWA 5B1OA 2CUNA 3D8BA 1VLQA 3JCMM 4JEUA 4I7ZB 5IH3A 2FMHA 3DT9A 3CG4A 4GP9A 3WLTA 4NMLA 5C1IA 3TI7A 3ZWPA 4FJ2A 1CUVA 2ZYVX 4Y2QA 3WK6A 2I8AA 3D3WA 4I8DA 3RTGA 3BPZA 3WRYA 1G55A 2OTJV 1ZY2A 4KRXA 3A4NA 2WAMA 3BWVA 2RH9B 3ZHVA 2QNRA 4LZJA 2Z0AA 1MOFA 5BVHB 4JQOA 4WLOA 2OTJF 3D54A 4GMHA 1KNXA 2QPLA 1ZR2A 2BF7A 3QELB 3QU4A 1ZD3A 4AF7A 1R4NA 3IPAA 1OGJA 5FLXM 4JC0A 3DOUA 2CHQA 2WIKA 3N2YA 1JT2A 2Z4SA 1S1MA 4PVCA 2PMWB 1XZCA 2VAWA 2XAJA 1NW9B 1JDPA 2P30A 1WTAA 2XODA 4FXPA 5HX7A 2PUTA 3RIEA 1TXGA 4F4UA 3IOYA 2L0XA 1OU0A 1EBBA 3DL0A 5GMOA 3E48A 1C9YA 2AOTA 4LGYA 4BBPA 1Y7TA 4E13A 2MT9A 3MT9A 2VUUA 3BGOS 4ZCPA 3MCAB 4BTLA 2UU9O 2MJLA 4X6LA 2OT3B 1ISHA 1JR3A 4HSGA 4NJOA 2Q9AA 3BD7A 5SZHB 2R6HA 4H7KA 3O75A 1R8YA 1GZ5A 4UHDA 1YUMA 2R1ZA 2CNBA 5P21A 4TS4A 4ZAWA 1I0IA 1GDTA 3EXEA 2FLWA 1ONNA 1FXVA 3G2NA 3UAVA 2HS0A 3IUQA 3QXCA 1PX2A 4RANA 2VNKA 1NNI1 1G60A 2LPMA 4HQ6A 3RSGA 1E64A 1VDZA 5T5QA 3ZEDA 5HBRA 1XDSA 3HJGA 2VI5A 1KZ9A 1Z0FA 4HDOB 1MG1A 1XVTA 1KY2A 3C90A 1CF2O 2AHOA 3OX3A 3JALA 4XM0A 1ONPA 2V7EA 5DW3A 1IAVA 2WSSD 1ACLA 1XTBA 2H9AA 3MBIA 4ZT7A 3F6EX 3HU3A 4ZFNA 3LBIA 1MXFA 3CKLA 2W90A 2XUDA 2VSQA 1ZW1A 5IY5B 1IUNA 1VHQA 1XQ1A 1KKMA 4RGQA 2Z98A 4XM1A 2CLOB 3TBKA 3JWIA 1YASA 3PQ7A 2Q3HA 1NRJB 4ZAXA 5ILQA 1L7RA 2I3GA 3KXIA 5G0UA 4DVGA 3ER6A 1NTOA 3EG9A 3GEMA 4C81A 1UZLA 5CCEA 2V8BA 2W11A 5EJ2A 1HDYA 1V35A 2UXDB 2K87A 3FPAA 1F0PA 3DTNA 5L3ZA 2NT4A 2DH6A 1ZCAA 4I5SA 4KR2A 3EVKA 2FHPA 3KHNA 3G2QA 2B9EA 5LHIA 1QZXA 3BEDA 3NJ4A 1VBMA 4JSRA 5CVDA 4YRPA 2H5LA 1I4DD 3BCUA 3KS9A 1Q0ZA 1VP7A 1NM5A 1MTOA 3CSDA 2R5NA 1YF2A 4MV6A 3GLFE 4B4DA 2DWDC 1YJQA 3K0DA 3PPVA 1CQWA 4FS8A 2XQIA 1IVNA 4GE0A 3FCAA 1ROPA 2F1MA 2EYUA 1M7HA 5ERYA 1VP3A 2QZ4A 2ZI4A 1G9TA 1QGZA 2F66C 1HTBA 3LJKA 3FH0A 1XG5A 3WDSA 2I6QA 2JG3A 3R5JA 1JEYA 4BKPA 4NZ9A 4ZOAA 3MS4A 4FD2A 3IH5A 3B78A 3VSEA 4YRAA 4CKEA 2YBDA 4ENWA 4FMTA 1YONA 4NJEB 2C7GA 2L26A 4UTZA 2WSLA 3CQ9A 4JLJA 4B3JA 4G26A 2ADPA 4RMGA 2M7WA 3CCFA 3BXHA 2ZULA 2QR3A 5HQ3A 4PCVA 3BMQA 1FSFA 1U8TA 1IXMA 4OXSA 3R7DA 4AKIA 1DV2A 4AMVA 2G06A 5EXPA 1A8HA 3BFJA 4DL9A 2I8CA 5BSEA 3CLHA 1IK4A 1E2QA 3VR6H 2LW1A 2GCGA 3U7RA 2GTAA 1M7BA 3D02A 5D01A 1YWGO 4LCEA 4GPZA 1F5NA 1X8KA 3ZHBA 1B73A 1U7UA 3IBFA 1Q91A 3VC7A 1GY8A 4E15A 1FQJA 3EOAI 4E4TA 3CIFA 1PV1A 3KJGA 3OAAA 5BXYA 1UMCA 3INRA 1BN6A 1ZOPA 4B5CA 2BKXA 3F78A 1KYIA 1T8YA 5L7YA 5C32A 3RTBA 1PWHA 3CUVA 4O4IA 4B08A 4CMEC 2OHVA 1Q6UA 3JVHA 3FWPA 1PL6A 4XSHA 4ND6A 3THOA 3DFIA 3NDRA 2GTPA 2X4GA 3IAYA 3LA6A 3HJCA 2PGXA 3TCUA 5JV5A 3CRNA 2WZBA 2ODBA 1GQSA 1IPAA 2BEWB 2V8OA 4A1FA 3O4JA 3OD1A 3ZJZA 3LHFA 4PD4F 1K8YB 4C4RA 1Q44A 4MQEB 4R71A 1W5AA 2Z3VA 4OHFA 1R0ZA 4EG5A 5JDIC 1KC3A 3VNBA 1R6AA 2PGLA 2X4IA 4BFCA 2EGHA 2QJWA 3RV4A 1ND6A 4MEAA 1DHTA 3SBXA 1L3BA 4OHKA 3UJDA 3ZJ5A 3V4ZA 1Q2XA 4LFCO 4K26A 4NG5A 3WLJA 1A8PA 1Y7LA 2FX3A 5KJCA 2DUJA 4XJVA 2O19A 3QU7A 4HXGA 1ATZA 5JT1A 1DBIA 1RJWA 3NHJA 1OVGA 1UXGA 1TPZA 1N3LA 3R3XA 4EUHA 4ZYWA 5SV2A 1U3LA 5U4QA 1A96A 1MVOA 4GDFA 1XNQO 3BB3A 4MULA 1IJKA 1XEXB 3NGMA 4MVJM 5LL6Y 1QAOA 4LNHA 2A1UA 3B48A 1LNQA 4QRIA 4IDGA 2I6RA 1P4HA 5EIBC 3IEQA 1MJGA 2ZBGA 1N5OX 1EZZA 2HDNB 2WHXA 3UMVA 3COJA 1F6WA 3VC2A 5DHRA 4RCYA 3HADA 1W2BU 1NWHA 3JQGB 4R8CA 5EXSA 5K6AA 2VQFB 1Z2CA 4IGKA 1EE1A 1PTKA 3V8NA 2GPYA 3F4LA 4QGFA 1NU1H 1FS6A 1Z5PA 3GLQA 3JARA 4MOWA 4FCCA 3VQTA 1N32O 1NXVA 4ME6A 3ETNA 1V16A 4TQ9A 4E51A 1KY4A 1PR3A 1TECE 4GKVA 5SZJA 5F9FA 4B7ZA 5JALA 4KLAA 4PG8A 4BFWA 1P81A 2EWMA 1QKJA 1GPAA 1L5ZA 3KWMA 2Q4BA 3LUBA 2P9FA 2ONYA 4WVLA 3D0QA 3UUFA 3VH4A 4OXIA 3L7NA 5ELXA 2AIZP 4YCLA 3LF1A 3TL3A 1RMYA 3D4IA 5BQFA 4RDIA 1UZNA 4U7FA 3D4OA 1XCJA 2JGJA 4MW9A 3WTCA 3ZKAA 2JAHA 1A7JA 4RJLA 3RVRA 3AKYA 3WIEA 1HE8B 2GKSA 3FPJA 1GYQA 3JRWA 1H38A 4ER6A 3M4XA 3G4SV 2VAPA 1EFHA 2ZK7A 1X8LA 2WTNA 1PWZA 3H0CA 4LF8O 4PYQA 2HS3A 1RFLA 1T8TA 3U17A 3ESQA 3G4SF 2OZLB 1BN7A 1DDOA 5DN6A 1BRTA 3MRXA 2VAMA 5K99A 4ARAA 4RVNA 1JJIA 1BVUA 2ZBUA 3V2IA 4HADA 3RODA 4OUDA 1N8RW 4ENUA 4BGVA 2BIFA 4ZI7B 4MUNA 2WKSA 1SS3A 2X7HA 3DZHA 1OW3B 3R7WB 3R5TA 3RU2A 3HG7A 4BP1A 4TL7A 2OAGA 3RG8A 3BGWA 1BH2A 2G83A 4B3MB 3T4XA 4J2HA 4WV3A 3VQVA 4XWOA 1XQWA 3BL5A 2ORWA 2WV9A 3KSMA 3NKVA 3ZZUA 2P4VA 4B3SB 3IR5A 3WLOA 3DV0A 3JWEA 4J16C 4PYIA 3PFFA 4DV5O 2P3SA 5DM0A 2FP3A 2HQSA 4UE2A 4HYOA 1L4BA 1KAHA 2R79A 3QA3E 1RSOB 3THRA 3AEXA 3GMTA 3WNBA 4IH4A 1DF4A 2HX0A 1DBQA 1KGSA 2JEYA 2Z1DA 1BZYA 1GKKA 1OCZC 2JAOA 4EW3A 2WWWA 2FSHA 2AYXA 2HSWA 1LSUA 4UEJA 3MOGA 3LP5A 5JJKA 5I5EA 4R54A 1EE2A 1WXDA 4ZI7F 4IO0A 1GKLA 2JC3A 4XCVA 4BMZA 2MSLA 4KIFA 1GT6A 3NWBA 4GM4A 5JAUA 1U8EA 1KR5A 1CDOA 1WO8A 5GM2A 1VL5A 1K2WA 4HWRA 3L6EA 4XVRA 1TMKA 2QA5A 5TQ2B 1J2YA 3HMQA 1GL6A 2NU9A 3A1DA 4EI9A 1HDJA 4YMLA 1MR3F 3TW8B 4BEBA 1MX3A 5AIAA 4WXYB 2B4QA 4AO6A 2QJFA 3W7UA 3VBCA 4QE9A 1C3JA 2KG4A 4BAGA 4UZFA 3DBHA 1ZMXA 2IIBA 3COPA 3LT0A 2QY9A 4ND2A 4TN5A 3V8RA 3EASA 3I3SR 4JI4B 4KXLA 1F0YA 4ZAGA 2OCCB 5FNZA 4KLZA 1RZ3A 1YZTA 1VFPA 4EY6A 2Q3FA 4XW2A 3ZVMA 3DDUA 3LQ1A 1EK5A 2FQ1A 2P9HA 5EB0A 1GU1A 1B1CA 4IIVA 5IZ4A 1VK3A 3KR2A 1VL0A 1NSFA 4WEOA 4DRYA 3TZHA 1YCGA 4PSAA 1CR4A 3A6FA 5IJ0A 2G40A 3TBFA 3I01M 2OFXA 3AEUB 3TLMA 4S12A 1R73A 3SIWA 3LDEA 3ZHUA 1L5NA 3TLCA 4RM2A 1VQ1A 3MMZA 4Q9AA 3KPWA 1I1QB 1C14A 2KS6A 4MMZB 1R4NB 3OESA 3SIRA 4AQYB 4U4AA 2MTBA 4IGFA 3QKTA 3PEVA 4O4LA 2JHCA 4JT2A 2ZIXB 2WIAA 1VYUA 1L6IA 4AQDA 5TEWA 3AJEA 4X1YB 4HX2A 4S24A 3R75A 3OLVA 5LKRA 1X80A 3RTDA 2OV8A 3UBMA 4MGYR 2ZXWB 1PL8A 2AOTB 1E89A 3QPVA 1L4MA 3WHPA 5H5JA 1FLAA 2EJUA 3NBQA 4PBRA 1EM6A 2W6IG 1PNVA 5GGXA 1YO6A 2JDIA 3E22A 2X0DA 3ERNA 1KFCB 3LUDA 4XJTA 2VLIA 1LEHA 1J0BA 1P61B 1CUZA 3VR2A 3KQHA 4MDHA 1ZNQO 4EHAA 1DTWA 2ZDIA 3HNRA 2O52A 4URUR 1NUUA 3HXPA 2DWOA 1KYXA 1T3GA 1KA9H 3ZH2A 3CVJA 5JTUA 1RACA 1B2LA 1OA1A 4MWGA 4YJHA 2YRFA 3LWQC 4X20A 3AF6A 2OFPA 3A3NA 3IVRA 1HW7A 3E35A 3L1KA 3PQ8A 3JALB 5CFNA 3AJDA 1AN9A 2ID7A 3ZWYA 1A9ZA 2YWRA 4URXR 3KXKA 1FY2A 1W0CA 2YS8A 3BRWD 2B34A 2HLDD 1H0RA 5DO9A 3SYOA 2ALJA 4A6XA 5K4GA 3STTA 2YOGA 5JVDA 3HXLA 1QIJA 4G88A 1RCTE 1RYBA 4YECA 5L4SA 3CLUC 4L08A 2P2GA 2GI4A 3VO9A 2JL1A 5CGZA 4W5TA 1E7SA 3AKCA 2XYHA 4CHTA 1PJSA 5A5GA 4B3XA 4CEJB 2C3PA 3OZCA 2PG3A 1BH6A 2IUTA 5IT0A 2HIAA 3LQKA 4QQ8A 1NP6A 3E2IA 2PU5A 3EG9B 3DGEA 4M0CA 4GP7A 3TINA 3KCXA 4V0NA 3EDQA 1RU3A 1AKVA 2NM0A 1WU7A 2P6YA 2NYRA 5JADA 1KY3A 3IL2A 2G1PA 3L3BA 2YI8A 1SZQA 2LGWA 1URFA 1Y4MA 2YHSA 3NIFB 2IYAA 4PRLA 4GICA 5KYGA 4BV9A 1RYFA 2BGLA 1B0PA 1GPUA 1QM5A 3D5TA 1J39A 3FFBA 5H83A 2JD2A 3L4EA 4U5XA 3WB9A 3IQWA 4XIGS 3KTOA 4O2AB 3PWKA 1K6XA 1J2RA 3RTAA 1G4YB 2BFWA 2HMAA 1HL3A 2OD7A 2GVIA 3CLRD 3SS7X 3CRZA 3K96A 2J0SA 3VO8A 1Q6IA 1EUYA 3NETA 4Q9LA 1WSDA 2RD2A 1M54A 4RPKA 1DS6A 1DKMA 4WA7A 4TLLB 3E6AA 4DR3O 5JG7A 3EY4A 2ZR0A 2YH2A 3H5OA 3TLZA 4BXOA 5I9LA 3TPFA 1H2MA 5E79Z 3NRJA 5THXA 4DLXA 1RE0A 3TD9A 4QYIB 4ZEMA 2G1KA 2REQA 3IO5A 3LW7A 4Y6QA 2XBUA 3C5WP 3AJ9A 1ZN9A 3M6VA 1GKFA 4CKEB 1WUIS 3ABMC 5FJIA 3S0WA 1F48A 2PGDA 3R5HA 3W0LB 1EDZA 1JIVA 1RWXA 3FKSG 2QTWB 3PNMA 4TTVA 5FTKA 2QEXV 4JXKA 4C0JA 4KRFA 3ZJ4A 2J3EA 4KHPO 2IYSA 4O2AF 3I61A 5JWRA 5F3DA 2IYTA 4UTPA 1MZVA 3DBRB 1P6UA 3NIBA 1P0FA 2HS4A 1SWVA 1H9BA 4G4YA 3EVEA 1XRNA 1HDCA 5FULA 4BQIA 1RWBA 1ZN7A 4CQMD 4P7FA 4AIIA 1F8XA 5E2AA 3VTFA 1A27A 2HZ7A 3QVXA 1UMCB 4V0KA 4ZICA 4DG8A 1KJIA 2AX3A 2CC2A 1NXWA 4QPNA 4D42A 4JLDA 1NE7A 3UHPA 3M6IA 3ERCA 5CBKA 2H07A 5K03A 3UC5A 5INTA 4R1SA 2FW8A 1RBMA 1Z2GA 1WJZA 5TQJA 1NC3A 3ZX6A 2ZWAA 4DF3A 4EELA 3GJ3A 3IC7A 3UA3A 1V6CA 4H44B 3DE1X 1Z34A 4OPHA 1NKSA 5IVIA 3A11A 4GC9A 1H4TA 4JV5O 3LNMB 3KALA 2WMDA 4IYIA 3F2VA 1S0VA 1D1TA 1SULA 3MBKA 1XMOB 3LPAA 2YHBA 5CX4A 4R9VA 3N39C 4ZVUA 4L3WA 2Z1MA 1XP8A 2GNOA 5LR6A 3GPIA 3L7BA 1JAHA 2KE5A 3HCAA 4F85A 4ALMA 4ALJA 4UHFA 3TFWA 4LOIA 2ZI6A 3MVEA 2Q5FA 4BGIA 2VL7A 1V11B 1ABFA 5ICSA 2WIGA 2ZANA 1BX1A 4QG3A 1RI1A 2C42A 2A33A 4C4PA 2I6FA 1E6CA 3L04A 3W6OA 1SQ0A 3THXA 2IPMA 3EEQA 2IZ1A 3H5WA 3QJGA 2WUVA 3A6LA 3PNBA 4PGGA 3IAHA 3G5TA 4E21A 1OUMA 3P7MA 1WY7A 1W7AA 1KECA 1UXOA 5I7AA 2WF5A 1W2BF 1NLUA 2QWQB 2D54A 3A9WA 1ZIDA 1YDGA 2CMDA 3MT8A 4OBBA 4BKQA 3IV7A 3JW8A 3RVLA 5AKLA 4H1HA 3ADCA 2XNDA 3DL2A 4HQ0A 1WXEA 1ZL8A 4PF1A 1R0KA 2QD2A 2AFHE 3EMDA 3WLHA 2Q27A 2UUOA 4V0QA 3D31A 1CZKA 4LBZA 3SLGA 2H18A 1DRWA 4TLBA 3A2KA 2PGIA 1GTG1 4IIFA 3HO8A 3REQA 3UFBA 4W8GA 16PKA 1H2HA 3U60B 3F3YA 4WLNA 1XRMA 1SG6A 4N21A 2DJIA 5EE1A 2O3RA 1IN8A 3OOJA 1Z45A 4JYAB 2RHJA 4HAVA 4HXYA 3DE2X 1AF7A 1EX9A 4ZAVA 2A06H 4XLTA 4ND8B 3CCJV 4XEHA 1FYFA 4Q37A 3ZU5A 3H5NA 1HEUA 3PD1A 2Z5UA 4MVWA 4HH0A 5BPFA 3K32A 2CHTA 4XUGB 4LI0A 5FAXA 3KO8A 1QB7A 2EWWA 3AVWA 4BB5A 3CXHF 2WALA 1PQWA 2I67A 5EZYA 4WT7A 3E7XA 5CFOA 4GP6A 5A71A 2DR0A 1FFAA 3KKPA 3RARA 4D96A 4D0NA 5DCVA 4LYYA 3R4CA 1BEZA 3LE8A 3RPEA 2HYIC 2HA7A 3T7RA 3RT3C 3CF2A 4DAEA 4MLDA 4Y67A 1N0HA 4EZEA 2XOKA 5E9WA 1P2DA 1ZOSA 4CKZA 5K3FB 2XHEA 5BORA 1M2KA 4UUQA 1DQZA 1SUIA 1EGMB 3D9QX 2XAFA 4ZK7A 3HVRA 3TIIA 5MN4A 4TT3G 3V42A 3PLNA 3Q1KA 3CNEA 1S9HA 5SY9A 3K0AB 2IEDA 5AW7A 2HT1A 1WZNA 2R70A 1RTKA 1QJ4A 3ZBQA 5TGTA 4WDRA 3AK1A 2VGMA 4R50A 2R44A 4EFNA 3EOZA 2A6PA 4IHJA 3MCQA 3JQ9A 2HCRA 4O4JB 1SQFA 4JHLA 5KYWA 3R3YA 1EE9A 4QDJA 3RFUA 4JOQA 4K9PA 1Q7YW 1RM1B 3I83A 4FKBA 1ZR4A 4WFAV 1JKIA 3EH2A 2X2FA 1V5EA 4AJ9A 2ZCVA 4X3CA 2LIVA 5BUQA 3ONEA 3A0HZ 2ILMA 5D85A 2C59A 4J0EA 5DGCA 3DTUB 1OYOA 1Z8HA 5A6VA 1M2WA 3IP5A 4DUPA 2W5UA 1G19A 4NXNB 1AURA 5HKBA 3PEFA 5FYDA 1SVKA 5JD3A 2DQ4A 3ZS8A 4FE7A 3L71H 1Q3EA 3H1TA 1FS5A 2Y68A 1R0SA 4FX2A 4RCZA 5TS3A 3TSZA 1GILA 1ZM2A 5BQOA 4S0ZA 4B0OA 4CDMA 1I7NA 5HCUA 4V1CI 2VJQA 4B1FA 4GVPA 4BAYA 4N9WA 3DKVA 1M6HA 1MSWD 1TGYA 2V4DA 2BM1A 2CW4A 5A7GA 1RWVA 1R3DA 5DFAA 3ENKA 2WLIB 1APBA 2LTAA 1P9RA 4HRVA 3X0DA 4CH4A 5JI3E 1NRXA 4GR9A 1W36C 2I6XA 5B6JA 1AGRA 2IH4A 1CZNA 3ZN2A 1DG9A 4O4JF 3W2FA 1H23A 4ATNA 1NV9A 1IXYA 2ZPUA 1SEVA 5BV2P 2BEUA 5FOWA 3B12A 3F3MA 2A78A 2HIGA 4ZCRA 3ASVA 4DNQA 1RQ2A 4HNSA 1FFTB 2EJVA 4DNPA 4JF3A 3ZLVA 2XH8A 4OAQA 2ZIOA 1OHHG 3U11A 1ODKA 1I8TA 3D2LA 5JATA 3RRMA 1WCYA 2JJ2D 4QNMA 4EVSA 3N2NA 3OZRA 1N5LA 5IJ0B 5JSHA 1A5TA 1W5BA 4UJ5A 2C2ZA 3BA8A 1HDZA 3PNVA 4L3VA 5AVWA 3L9DA 4UOQA 3PP8A 1IN1A 4HNGA 3TN7A 3W2EA 2VHXA 1CP2A 1GUBA 1R6KA 5I01A 5G02A 1F0KA 4HVLA 2JLSA 1Y3AA 5KVCA 2QVYX 1VE1A 4MVJI 3VU8A 4BX2A 2IAFA 3FHLA 2WF7A 3WL3A 1LPPA 2BMJA 5FWAA 4R68A 3F5TA 4KU4A 5AVKA 1L5OA 2GESA 1RC1A 5DLEA 3FWNA 1QHYA 1GAEO 1FIUA 2YJNA 3BABA 1MC8A 2A9RA 5CYPA 1NQTA 4DUZB 3UJAA 1EESA 1U0LA 2YQ4A 1UBOS 4D82A 3A9CA 3WB1A 4EG8A 1U4SA 4GXRA 5C46F 1BWSA 1LQ2A 5E9JA 3OCVA 1JR6A 4RVSA 2G9RA 4K35A 5B1NA 3WGUA 2VF2A 4EG1A 3E22B 2ODWA 1E96A 4J76A 1C2TA 4J75A 3HZRA 4G2NA 2BVNA 3E3LA 4JI7O 3CRRA 3N3AC 4DA0A 2FPMA 4PHGA 3SYLA 4JROA 1G8FA 4UHKA 1Y5IA 3NP9A 4LQCA 1SXJD 1PPJH 3B7GA 1IXKA 3VI4B 3B2EE 1OLSB 2C5AA 3M1XA 4MS1A 4C0BA 1FJGO 3AYXB 1QIHA 3D7LA 4IY1A 1T4CB 3PE4A 2UYNB 5KJ6A 2W70A 5LB2A 4YJHB 4O63O 4X20B 5FL3A 1QO0D 2BJHA 4MDEA 4BVKA 4LXHA 1SCQA 1VECA 3GOQA 2B36A 4DNFA 4I0XB 3S3XA 3PT9A 4PX9A 5KAIZ 3SPGA 2AJCA 3OGCC 1Z4KA 2ZW9A 1RXVA 2DJVA 1A9OA 3F97A 1ZW6A 1HBJA 4MVOA 1KKUA 2VZ8A 5DGXA 3GEGA 3DHEA 2OBLA 2VRWA 5EJFA 4D6XA 5HRCA 3U4HA 5HRAA 1Q1EA 1XAHA 2YZGA 3VKHA 1EKXA 2ZETA 2X0FA 2R1VA 1PGNA 3BAFA 1MO6A 2WWGA 2XCUA 1XEQA 2FPIB 1SUEA 4JLKA 3L1UA 3KZMA 3TPZA 2LDXA 3BIXA 4XH9B 4Q02A 3EUWA 2G9NA 4MB0A 4WLEA 2BR3A 5IXSA 3AR7A 3ED5A 3KELA 3OI7A 3M1IA 5L3SA 2J3IA 4QDXA 1A50B 1Q7TA 2XCQA 3IIJA 3CWQA 1GQFA 5JC1A 3PTLA 2AYZA 4Y6LA 5BR1A 4MXDA 2CDNA 1B06A 5F9MA 2FW7A 3T1QA 1HNZO 4LJKA 1NVVR 3PC8C 3X1DA 3K1TA 3UJ8A 1U5CA 1DAMA 3OBWA 2D13A 2Q7GA 5KBYA 1O0CA 4RPLA 1KIAA 4NNPA 2FFAA 1NVVQ 3MF4A 1J06A 3VHRA 1V8DA 1MHPA 1B8UA 5IULC 3J7TA 1Q14A 4MUYA 5E9AA 4OM8A 3ZCPA 1SJ9A 3T1NA 4A03A 1SXHA 2BMEA 1EPUA 1HK7A 2PS0A 4JLBA 4LUCA 3WY9A 4QL3A 4AJPA 3R5FA 5T3YA 2C4VA 1COWD 3MJ4A 1Z12A 1PR6A 4ZANA 4FK8A 4KSCA 3RAJA 4PRKA 4B4KA 1DAOA 4MJ3A 2BBSA 3I37X 1YTFD 2E4VA 3ZCTA 2RB9A 3NCHA 1XWWA 1SCDA 2CXOA 1X7DA 3CG0A 3I2IA 4N7MA 2V6BA 3KWJA 1TFUA 4LRQA 4RPJA 2BSXA 3A6JA 4TWAA 1DAHA 1S2GA 3EZ9A 1MB2A 2B4YA 3CHYA 2AN5A 3K5WA 1FS0G 2RHLA 3K15A 4TWBA 4EHHA 1I7PA 2GCPA 2PJZA 4X8MA 3LQ2A 3FHOA 2OQRA 4N6OA 2ZTHA 5E8RA 2Y2UA 1NYRA 2W93A 4FLTA 3DEAA 4YYZA 1GNVA 2FWNA 1BCRA 5IBPA 3SZUA 4RKFA 1M1KW 2BW0A 5FPRA 2Q3MA 2IW5A 4N18A 3NTUA 3WGJA 2FZEA 1II0A 4FFBB 3K79A 2HHAA 4H7EA 2VDVE 1FBNA 4OKNA 1OTHA 2R1UA 3O1JC 4D45A 4HS4A 3SBEA 4GKAA 2PBLA 1HLDA 1YEWA 4NFLA 1VMKA 3A05A 2H4ZA 1MA1A 1ZX1A 5KA5A 3HLTA 2Q21A 4YTEA 1KI8A 3V4RA 1LRJA 1TTHA 1FTYA 4F91B 3QWFA 4JC8A 4F3CA 3EIUA 2AZ0A 5BWBA 4R69A 4P84A 5EJ6A 1CY8A 2AHRA 5EJ5A 3E1GA 1I1HA 2HCFA 3C41J 4KNYA 4OGKA 1VE5A 1K6MA 2HZBA 2IBTA 2G80A 4MB2A 5F12A 3V2HA 3MGGA 3THXB 4EW1A 1SVOA 4RGYA 2OIGA 5GAJA 4AP6A 3AHGA 2YC0A 2X1HA 1TYEB 4DDWA 3DDZX 3ESCA 2O1WA 1BXZA 1LBTA 1PR0A 1NN1A 4JJKA 3QKIA 2Q5OA 3ZV7A 4EB3A 1LV7A 3BAAA 1T35A 1H9CA 1MW9X 2B30A 4ZYVA 2F8SA 4YCCA 4RTRA 1HT3A 2QTRA 1TK2A 3ZQ6A 3PDJA 2R4QA 4ML3A 4ZDKA 1CYEA 3AR9A 1XZPA 4U7OA 4II2A 5JYCA 2V7VA 1MMMA 2YW2A 4EO9A 2JAUA 2CSUA 1UKVY 3INTA 2HY7A 4LRXA 3OZDA 4Q3KA 4DSAA 1NJFA 2AJLI 1L0BA 4Q3LA 2RH8A 1JZQA 3LGXA 4OBEA 4JTDB 4BFXA 1I36A 1OHHA 3OAAG 2H2AA 4I9GA 1SCUB 4NCIA 3Q9UA 1NRIA 4FC6A 1UPAA 3EAFA 1UFVA 5CM9C 4F6LA 3VC3A 2KI5A 3M5WA 3L7QA 2CF6A 1YMVA 4G5GA 3JAMN 3OPYI 2AD1A 5KLVH 4CKWB 1WXIA 1WD7A 3L0BA 3L0SA 3HE3A 1XD2A 1TQ4A 2SECE 2FUCA 1XEAA 4F5ZA 4LF7O 4EGSA 4BNIA 2HU7A 4BNJA 4BNLA 3QFTA 2W6OA 1QCDA 1TUIA 7AT1A 1E5XA 2JGKA 1Q81H 3UXEA 5IPFA 2WE7A 4JBXA 2RCVA 2JIZA 1C0EA 1M76A 1UJ5A 1VSVA 2I6GA 1N1MA 4BNFA 2H85A 1YK1A 5IJ9A 4LECA 2R6ZA 4E5VA 2AG0A 4YFVA 3LF2A 1O7JA 4WMLA 4ZYXA 5A5VA 4DE5A 3OKFA 1MXHA 1YL7A 3URMA 1L7EA 1YR6A 3ANYB 5I3CA 4M1QA 4RELA 3ZI0A 1V6AA 1ZOIA 3K0BA 4DG9A 1WBJB 3MEQA 3VJMA 3TK1A 2UYHA 3KKYA 5CCDA 1H8HD 4GLJA 1NXOA 3QMVA 4TMWA 3AY0A 2GTSA 1NOIA 3B6EA 1P9WA 1FTNA 2GEBA 1Y48E 1YHQV 3UK0A 3JRNA 2JZNA 3BY6A 4TXHA 4FFRA 3CRCA 4AUMA 4Y6SA 3FY4A 2TMDA 3QSYA 3NTRA 2IUUA 3WK9A 2B4AA 3T5TA 2HXYA 1F9AA 2PUSA 1ZZEA 5K0ZA 1N2ZA 5IG2A 2DWPA 1CJCA 3WGTA 2QB5A 3OM3B 2GZ1A 4F7WA 1YIJF 4RZXA 2YXPX 2QTVB 2HAEA 1T9BA 4Q6BA 2VJAA 4ALIA 5D5QA 4NOKA 2P2YA 4O1HA 5F51A 5AK3A 3F6CA 3CC2V 4QFBA 2H3HA 5IT9M 2ZIZA 2H1CA 1S7CA 4TMTA 2POCA 3I9MA 2ZM5A 3ZN1A 1KAQA 4GR4A 2V0GA 4LBWA 1Z63A 1SXGA 4RZ2A 4Z5XA 1L7DA 1V43A 5A4AA 4UM9B 3ULKA 1J23A 4EYOA 2HA4A 2J09A 3PJDA 3RQSA 1EVEA 1KTVA 3NHFA 4KR7A 2DETA 5CLFA 3DFZA 3DZIA 1FP7A 4LXIA 2OB1A 2IHNA 1M2EA 4Q24A 2HXSA 4X90A 3UCEA 4NYKA 1EFVA 1U0FA 1NVFA 2ZE7A 1CUHA 3D7SA 4UUOA 3K09C 2JRCA 5K2OA 2J5KA 2XUMA 2VZ9A 2I1QA 3VVLA 1Z4IA 5DN6G 4QUAA 4U9IS 1L1FA 3CTPA 3MBOA 3MMNA 5H81A 2CHFA 4NCJA 4Y9UA 2MSEB 3PXDA 4RA9B 3T7JA 3OFNA 1V47A 3H0KA 4W5RA 5BV0A 4HC4A 3CBGA 1GN8A 3QW2A 3ILYA 4MTLA 3IVGA 1DAGA 3K9WA 3TSYA 1JEQA 5FBHA 1LPBB 2NO4A 3PRYA 4UNQA 4GCZA 1SC1A 4ER0A 2OXEA 4YIPA 3DAOA 4BMPB 3ZG6A 1FDVA 3T54A 4AZTA 1J7HA 1VQKV 3QKRA 3QEMA 4L95C 1B1AA 3ZK9A 2NO1A 3REGA 4Q9JA 5AHKA 2EZ4A 3IYLW 3UW3A 2I8LA 3ZE2B 3K0CA 1VQKF 1AK1A 3CNLA 1QE0A 3UUEA 3M6FA 3QPBA 5CLHA 2QZJA 4Z3OA 4DW0A 4OB7A 1D4OA 4ZVOA 5LOVA 1BA3A 5JQGA 3U31A 1HF3A 2WKQA 4AN4A 5C3MA 5IUJC 3LHIA 5HIMA 1XOUA 1NURA 1BW9A 2ALEA 4V39A 1T5OA 5CB4B 2RGRA 2PHZA 1SZJG 2W6CX 3FSGA 4J7KA 4YUZA 1RYMA 2P6UA 5CA1A 1N1DA 4DTCA 2IXGA 2DGDA 1XE3A 1ZOOA 2MR5A 1VIBA 4DA6A 4HGPA 3I4CA 4TSFD 5LD2C 1Y74A 4BHTA 4DBZA 2DUMA 4ABMA 2M1XA 2A79B 1X92A 3RADC 2PMBA 2HP0A 4BYMA 2Y4UA 4QE3A 5BXQC 3AZPA 4IHQA 3OT5A 1GRQA 3RAPR 3X1JA 4X45A 1KDRA 3WXBA 1ZHFA 4LWQA 4PWZA 3I9V1 3RUAA 3DOFA 1G6UA 1K4MA 2H1RA 5CA0B 4DR6O 3VHLB 2FE4A 1NSTA 1UJBA 3PG5A 2DC1A 1L5MA 4R05A 1YUBA 4B3HA 4QUJA 4G0MA 1UBHS 2CH7A 1D03A 1HSZA 3C6BA 2ZUSA 5TJ9A 4MRMB 2GEJA 2WHYA 1ST3A 5CB4F 4HXFB 2OTCA 1X8XA 2PLNA 5FUXA 2BFEB 1UIRA 2PJDA 4QJ5A 1WP8A 3KLMX 4MK4A 1GEEA 5EIBD 5L3SB 4PA3A 1E59A 2QL7A 1VSQA 1AROP 4QXMA 1XYYA 4DCMA 3CV3A 1Y37A 2IUYA 4I66A 4YJ2A 3V9PA 4OJNA 4ZQGA 4R8VA 4JZGA 1EDBA 1OFGA 4MLCA 1CLIA 4OH7A 1I80A 2F7SA 4Q82A 5J1SB 3VGJA 5K0SA 4MT8A 5DMHA 2RC6A 3W2GA 4Y2TA 2Y99A 5I51A 3RANA 1RQXA 5G1NA 1IQPA 5LQCA 4N40A 1Z6GA 1J1UA 4R7GA 4QPKA 4J7UA 1DKPA 3K1JA 2VQEO 4D9BA 1SU7A 1QCEA 1ZUNA 1CRPA 5LZ5A 2ZQMA 4Q3BA 3HZZA 1R9GA 3OPVA 5ABPA 2J7KA 5CA0F 3A58B 2PM8A 3O31A 2PZ8A 5LMCA 4MR8A 3PJGA 4DJAA 2JDIG 1FUYB 1UWLA 4Y0VA 1XI2A 2WSYB 2A0FA 1JAZA 4EUNA 4PSDA 2VYND 2G0TA 2JGRA 4O6VA 2NU8B 4MIEA 2JVKA 5AJTA 2C9ZA 4PDLA 1WPRA 3T5GA 2P9EA 1TQ8A 3AR5A 1IVSA 3OVMA 13PKA 1OPXA 2C7QA 3ZE0B 5AVVA 2E37A 4BLVA 1X7YB 1K9MW 1ODFA 1VMIA 3TZLA 5IDXA 3JAKB 4HV4A 5F77A 4ITUA 3LUJA 4BO8A 3NEJA 1Q16A 2P65A 1RBZA 3ED1A 1JWBB 2ZI9A 3C5EA 3S8MA 4NE2A 3MERA 1X0XA 2J33A 1G8GA 2PFKA 3EXAA 4YMHA 2YN2A 5BV1A 3O74A 1XHXA 4H4CA 4R9NA 1X9IA 4LRYA 3GPLA 2JD1A 2QKCA 4PA9A 4LWPA 3OGIB 2Q8NA 4HAXA 2Y93A 4ZTUB 1Y1TA 4GKKO 1C3XA 1A71A 1BCRB 3QVVA 3BK2A 3OA2A 4ZV9A 3S2GA 4WESA 3L8YA 1DIBA 3AG2B 3H11B 5EKUA 1OLXA 3CNOA 2D1YA 1VC2A 2ZSHA 2ECFA 2M98A 3IQHX 3LRTA 1L5LA 3HKCB 3ETHA 1DRUA 2OCGA 4K6OA 2E1RA 4J42A 4LRTB 3G6WA 3LPLA 2A0LA 1NC1A 2AGVA 4A8JA 2XLBA 4KGVA 3V8EA 5K5EA 3V46A 4X8LA 2C07A 4IOJA 2C7PA 5T6MA 4C6TB 3CC8A 2PD3A 1M66A 2IE0A 1KJJA 2Q6KA 1QHHA 5DOZA 1D3AA 3DCNA 4D4IA 5KTPA 2HDHA 2I4RA 2QSYA 1MCZA 4UPEA 3TPCA 2PGOA 2GK6A 2A88A 2QE7A 1I0LA 4FS3A 3T8YA 4PS0A 4YRMA 4X3PA 3ZTTA 2VDLB 2I87A 5D6OA 4P86A 1QIKA 2Y6UA 4YHHO 1CRZA 2JLYA 1S0UA 3SI7A 3LWDA 2J9YB 1IHYA 1NJSA 2F55A 5C8DA 3E3AA 3WU2Z 4WFJA 3ZNNA 4D8YA 5FPYA 4MA4A 3CINA 3IAEA 1RS0A 4M98A 2B8TA 5EMLA 2GM9A 4I4TA 2BMAA 2AG1A 4B3RO 4RTNA 2W6JD 1U96A 1ECBA 4H0NA 3ND5A 1PP4A 4M8KA 3WLIA 4ZVKA 3NYQA 2AOXA 3TLYA 1F8GA 3ZTYA 3WKEA 3EEFA 2FOXA 4BZPA 1TLLA 1C7ZA 1YKSA 3LHKA 4P3OA 4GI7A 3TRJA 2EINC 1K2VN 2DYYA 4E3ZA 1MB3A 2XYRA 3DLPX 1O5IA 3M82A 2B2NA 4JUBA 4C5CA 1G5FA 2VT2A 1VF6C 3EF3A 1NBMD 1GQYA 3RSHA 2P5UA 3PGA1 2RAPA 4GI2A 1K97A 2ZRIA 1ODJA 1P1RA 2FPGB 3VUFA 1I51A 2XXAA 1YI1A 1AZWA 4RH0A 1VHDA 3FOAA 2OHXA 3U09A 2VDWB 3WKBA 5FD8A 4YBRA 3S2FA 2XI4A 4YY3B 2H5JA 4N3GA 4DJDC 3BE8A 3A1FA 3Q10A 2OAQ1 4HAYA 4GMXA 2OM2A 3LSTA 1IJFA 3WGLA 2O1XA 1BXKA 5G3ZA 1HPLA 1CDEA 3KPJA 2F2TA 3W5HA 5HZHA 2VHEA 2EW8A 2QLBA 3L7IA 3P3PA 3GBPA 2UVDA 3NANA 1JVNA 3C6XA 4UVEA 4NESA 1E2KA 4BP9A 3QIVA 3KOXA 2QPOA 3H17A 5FDFA 1KNJA 5JRJA 3B6ZA 3P27A 2IYLD 2MDTA 2EZ9A 5B36A 3LNTA 2Z56A 1UKCA 3GCGA 3IUNA 3WV4A 5BWCA 4D3SA 2PRSA 3PZBA 1VE6A 1F2VA 1N34B 2YYEA 2WNIA 2QRUA 3IHWA 4URWR 2OHJA 1DCKA 5DTJA 3FYTA 5IF9A 3IQXA 1VXOA 2X5JO 5EHXA 3AEQA 4D9FA 4TOIA 5LIPA 3H1PA 5DIFA 3EZ2A 5J4LA 2F3TA 1DHRA 4HSEA 2QL6A 5BO5A 1DAFA 4E14A 5IM5A 3BCCH 1E1QD 3CCQV 1HR0O 5I9SA 2AK2A 1RPJA 4RQAA 4H3SA 3F7YC 5MGBA 4K03A 2JI8A 4I9QA 1E8MA 1J97A 3LUCA 1E92A 4BT2A 2L2QA 1J9ZA 2VSYA 4JVSB 4EF5A 2FDXA 2YMMA 3KUDA 3EZFA 4TV8B 4QT4A 3DYBA 1W59A 1EN4A 1VG1A 5KNCH 3BYZA 1BTOA 1Z2OX 1I94O 2X6TA 3K5NA 1YFJA 1H2GA 1CEEA 3FCUB 3SFVA 3K30A 3LOQA 4UNSA 3MQ4A 4ECAA 3FVRA 1IB0A 5GIOE 2HD4A 1JB1A 1CQJA 2O4CA 2ITCC 1TZMA 8MHTA 2QAGC 2FEAA 2D62A 3LG2A 5U4XA 1PW5A 2Q6LA 1C41A 1THMA 2ZGVA 2YJ6A 4K0KB 2XNDG 5CR9A 5L3GA 4KDEA 3TIVA 4KSYA 1Y3FE 2FETA 5LDHA 1K8XB 5F21A 2W42A 3K1AA 2OP0A 2DCUA 5I7OA 3D3WB 1JBKA 3DEFA 2H9YA 3KKLA 1NU6A 4BVLA 1DARA 1K8ZB 4PYLA 3C3EA 3ZMTA 4Y2YA 3MOIA 1XZFA 1E7MA 3LFOA 4TTPA 1WBDA 1OE0A 2UKDA 4DWOA 3JQ6A 3LA8A 4Q03A 1U94A 1HFJA 2NZ8A 3L74H 3C2QA 3KCNA 1QFMA 3U4IA 4TV8F 3WKCA 1IK6A 3VVMA 2J32A 1XMJA 2VHVA 2ERXA 3EQ8A 1LBQA 4FUTA 3WRVA 1S8FA 1M5IA 4FYHA 2DT5A 4RTQA 2OGUA 1F3LA 1NQ5A 1ANKA 4AMBA 1BE3H 3X1XA 2JKZA 3EC7A 4XJXA 2DWEC 2CTQA 2V1XA 4AURA 1XTIA 3PVZA 3IO3A 3NEYA 3IDSA 1A7AA 4PPFA 4BY9D 3ROMA 2Q5ZA 4B35A 4MYRA 5GPBA 4IKPA 2FMIA 2G4CA 5E0OA 2CB0A 2A0XA 2BN4A 4WBXC 1JHUA 2X9QA 2XOKG 1OIWA 3V34A 1WF6A 5JHHB 1N25A 3D7NA 1TCVA 4I7EA 4NYJR 3EISA 1AV6A 4L0CA 3TNFA 2AQ8A 4HATA 3NHMA 3L1HA 2CLLB 2B92A 3EXEB 2XV1A 4NYJQ 1D04A 3OE7D 3GRZA 3R0ZA 2H7YA 2YI9A 2WT4A 1ONOA 1TRKA 4DMFA 3EUEA 1QP0A 4QULA 1C0KA 2FSUA 1AR1B 2A1TR 4RV4A 4KDFA 3SFZA 1V6SA 4BUCA 3KT6A 4IQGA 3ZVKA 1BS3A 3KHKA 5LOVB 2EGGA 3OMLA 5JQGB 2AJBA 2QM8A 3QXHA 1KNKA 4AU1A 5ADVA 3ENVA 1NT4A 4AJKA 2ZWIA 1BW9B 2FUEA 3HJRA 2HL6A 1Q0SA 4IX1A 2CNLA 1XU9A 9ATCA 3PD7A 1ML4A 2G36A 1U7ZA 1YOVA 5A4KA 3ZGOA 5CA1B 1L8XA 3CJRA 4J0KA 2TECE 1N5IA 3NI2A 3TG8A 4Z2YA 2I03A 2XDWA 5HF9A 1S2LA 4BV3A 3U3XA 4M76B 1PTJC 1DGQA 2CL7X 4COOA 2F48A 2AQHA 4WK2B 5JSQA 3VJRA 4NEQA 3RC1A 5C5CA 2HP0B 2OB2A 3K71B 3UCSC 1WA5A 1U8YA 4LDAA 1Y89A 1HOTA 4FMDB 4BO7A 2Y05A 3OF3A 5J1TB 1ZGCA 5CTJA 3PKJA 4P80A 4X8HA 2X6QA 1JR3E 4DN6A 1S5PA 4KQ6A 2PL9A 4BECA 2Q62A 4WKCA 3C3MA 3PQDA 1E3JA 1AS0A 3AY7A 4B80A 3FYUC 1POXA 4TLDA 3ASNB 3R41A 1IZ0A 1KEVA 4EJ0A 5JQGF 2CVZA 5L51A 2Y66A 3CYOA 3V4DA 4G41A 1KFEB 2RDCA 3GLSA 5KAPA 2YNMA 3VV3A 2X9VA 2Q4DA 3GCDA 1RHRA 2CMFA 1GGHA 2C94A 5B1AB 2QGFA 3IUJA 2PKCA 3NBKA 1DC3A 1PYDA 3N76A 5CA1F 1E0JA 3GFTA 2QXYA 1UEJA 1G20A 4BW9A 2GH1A 4ZJYA 1A1SA 3NTLA 4P0TA 2J5XA 3D8UA 3O8CA 2BZSA 1UPTA 1VPTA 3M2PA 1ZLZA 3D4NA 2AL7A 3TQSA 4YDRA 6LDHA 4DXAA 1JEYB 2FN3A 4JEMA 5FO0A 3DOIA 4FMDF 4P82A 4MRVA 4QLAA 3GNQA 3BPSA 2IQ5A 3VPSA 2WZDA 3J7AC 3H97A 4JBWA 5IDQA 1OAOC 3CZ9A 3HLKA 2VH1A 3UV7A 1OJHA 4PCAA 1M0EA 5F1PA 3BH7A 1AZTA 1QAMA 3H9JA 5HQ3B 3BMQB 5EP3A 3SHVA 4DNXA 2H2HA 2QEXF 2C9BA 1IM8A 2ZUTA 3OLXA 1LWOA 1QU7A 2IV7A 5HY1A 4NV3A 2HCJB 3KCQA 2B5UA 5B8FA 5DHFA 3SR3A 3RFXA 2EFHB 2EP5A 6NULA 5JJJB 3ONDA 5BOSA 3BBLA 2J0UA 4TN1A 1I01A 1GT91 1Q50A 3D5QA 2C20A 4L7VA 5GJBA 5H82A 2BP7A 2ZRMA 3EGIA 3WB0A 4J10A 3WQBA 1HETA 2DXIA 2PVPA 1MT3A 5ARCA 3VV2A 4O4IB 5IH7A 2OGZA 1UBUS 3NS7A 1T5TA 3TGLA 3PENA 3EWAA 3D7MA 1JHAA 5EEHA 2ROQA 1T8UA 3U4QA 2NAFA 3S2SA 1EVJA 1FLVA 5JMWA 4OQXA 1V25A 4DR4B 3M33A 4OFZA 3D5EA 4EF4A 2WA3A 4RHUA 3G0IA 1V7PC 1ISPA 3AT1A 2ZSAA 3S99A 5GWXA 3NIDB 1QLEC 5A6SA 4XDJA 1Z88A 2F3UA 3VYTB 4OQDA 3S1AA 4Z9BA 1EFDN 4JQCA 2ZDHA 5KOJA 4C20A 2XJ9A 1I1OA 2P4SA 3T5DA 1KI3A 1O6BA 1VZ2A 2OXIA 4H9G