3JARB

Cryo-em structure of gdp-microtubule co-polymerized with eb3
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
429
structure length
429
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanistic Origin of Microtubule Dynamic Instability and Its Modulation by EB Proteins.
pubmed doi rcsb
molecule keywords Tubulin alpha-1B chain
molecule tags Structural protein
source organism Homo sapiens
total genus 151
structure length 429
sequence length 429
chains with identical sequence D, F, G, H, I
ec nomenclature
pdb deposition date 2015-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3jarB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 3jarB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 3jarB01
2R751 5J2TA 2RHJA 3N2GA 1TUBB 5JCOC 3JARB 5LYJA 4X1YA 4FFBA 4O4IA 4F6RA 4TV9A 4ZOLA 5LA6B 4ZI7B 2GVIA 4DRXA 3JASA 3JALA 4O2AB 4X1IB 4XCQA 4LNUA 5KMGB 3V3TA 3JAWA 5EZYB 5MN5A 3VPAA 1W5AA 3JATB 5CA0B 1RQ7A 3HKEB 3E22B 4O4JA 1FFXB 4O4HB 3UT5A 2RHOA 3WGKA 3VO9A 4ZHQA 3JAKB 4WBNA 5JH7A 4I4TB 4DXDA 3WGJA 5CA1A 2Q1YA 5EIBC 2RHHA 5LP6A 5EYPB 4YJ2B 4U3JB 5FNVB 3ZBQA 3CB2A 5CB4A 4M8IA 4X1KA 3VO8A 3RYHA 1W5FA 4IHJB 3N2KB 5GONA 5IJ9A 1Z5VA 3RYCB 1TUBA 3JARA 5LA6A 3RB8A 4O2AA 3HKBB 4HNAB 4O4LA 4X1IA 5KMGA 1TVKB 2VAPA 5EZYA 3VOAA 5BMVA 3JATA 5CA0A 3HKEA 5IYZB 2XKBA 4U39A 1FFXA 3HKDA 5LP6C 2XKAA 5EIBD 5KX5B 1W581 3M89A 3N2GB 1JFFB 4X20A 5JVDB 5LYJB 1FSZA 4O2BB 4O4IB 3HKCB 1OFUA 1W59A 3JAKA 1RLUA 4TUYB 4I4TA 5IJ0B 3M8KA 3R4VA 4TV8B 2BTOA 5ITZB 2VAWA 4YJ2A 5LXTB 5FNVA 4EB6B 2VAMA 1W5BA 4EI7A 4IIJB 5J2UA 4I55B 3RYFB 4IHJA 3N2KA 3WGMA 4B46A 1RQ2A 5MN4A 4I50B 3RYIB 4ZI7A 2BTQB 1Z5WA 4YJ3B 3RYCA 5C8YB 2VXYA 3ZIDA 5JQGB 4EI9A 4B45A 2R6R1 5LP6B 3HKBA 3E22A 1SA0B 5CB4B 5LOVB 1TVKA 4KWEA 4EI8A 1W5EA 4O4HA 5IYZA 5J2TB 3WGLA 4X1YB 4FFBB 4F6RB 4TV9B 4ZOLB 5KX5A 3C8LA 4DRXB 3JASB 1JFFA 3JALB 4LNUB 5JVDA 4E6EA 3JAWB 4O2BA 3HKCA 5M7EA 5EYPA 4TUYA 4O4LB 4U3JA 5IJ0A 4O4JB 4TV8A 5JCOA 5ITZA 3VOBA 2Q1XA 5BMVB 5LXTA 3UT5B 4EB6A 3HKDB 4IIJA 4ZHQB 4I55A 3RYFA 4WBNB 5JH7B 4X20B 4I50A 5CA1B 3RYIA 2BTQA 4YJ3A 2RHLA 5C8YA 3WGNA 5JQGA 4HNAA 4X1KB 5MN6A 3RYHB 1SA0A 5GONB 5LOVA 5IJ9B 3ZBPA 5J2UB
chains in the Genus database with same CATH superfamily
1M5UA 1PZXA 4MWZA 1J2TA 4FHEA 4JA2A 3O8NA 4IGKA 2HB6A 3VSBA 1ODKA 4XX0A 2CNKA 5LQKA 1OWMA 2IH2A 3C4QA 1HE1C 4A6XA 3LC2O 4HDKB 3VR0A 4HBGA 1JDNA 1FXSA 1YQUA 1F1JA 5K3BA 3HBFA 3N27A 4F2DA 3MGCA 1E5LA 5F7ZA 3W2EA 1QU2A 1R5OA 4NNPA 2MOKA 4R2JA 4KLZA 2D5CA 5CNMA 4TLAA 5BN4A 1H2ZA 4HJRA 3A1TA 4JT8A 4JB2A 2HFEC 1HT2E 3FDJA 1KO5A 2Y1CA 1EB8A 1UBEA 1R6KA 3DZCA 3QNMA 2ZDQA 4CT0A 1SIOA 5E1DA 2Q3CA 4CV0A 1BS3A 3INNA 4E30A 1N34O 4KE7A 3VVLA 4LJLA 2HEIA 3JD4A 4LIPD 3PEVA 1CY7A 2Z4RA 1VHAA 1Z4KA 1VM6A 2VP5A 3CRW1 3X1YA 4RVCA 3P20A 4WINA 4Q20A 2HRCA 5KSOA 3LPMA 4NFLA 2WYIA 1ZXXA 3MWJA 3L1UA 1J8VA 1T0PA 1CQJA 3H19A 1ZTEA 4ZEMA 5I7AA 5KYNA 2Z2IA 2WAYA 1WCWA 1KMHB 3WA6A 1N7HA 2IH5A 3KLOA 3RD5A 3EG9B 3P97A 1R9MA 4BX3A 1H9CA 3PRYA 2H65A 3R4VA 4N9QA 3WLRA 5FNVA 3U7FB 4RF5A 1APBA 3R8CA 5FLEX 3Q2OA 3HFGA 3UTDA 5KNDD 1YI0A 3VKGA 2J4DA 4LRQA 4HDSA 4YTEA 4CKEB 2PX2A 3D6AA 1RLIA 1ZD3A 2X1LA 4Z7OB 3K5NA 1YZNA 3EF3A 2XLCA 3SQWA 4NCJA 5JD6A 1PBNA 3ZUPA 5E95A 5ICSA 3T0IA 5LD2B 1NV9A 1NNI1 2JEXA 1U3DA 3ZI0A 2IUYA 4IXDA 3VR3A 1FP6A 1ISIA 3QX9A 2WLKA 1GCOA 4URWR 4FM0A 1SN7A 3V00A 4A2PA 4RFSA 4BLRA 1O6GA 2EJUA 2IXDA 5H7XA 2WKRA 3OTIA 2CNDA 3C98A 4UU7A 3KCQA 3HKBB 3A10A 4JLOA 4BV9A 4LYHA 4OHFA 1XOIA 4JBHA 2ZTUA 5LMNO 2NGRA 2E4YA 3QFHA 2KG7A 4M6WB 2V9CA 2CL6X 4CQMB 2FN4A 2JFOA 5HCIA 2PGLA 2Z1DA 3CH6A 5FPTA 5K01A 4DVJA 3Q9UA 4P9PA 3A1FA 3O26A 3CG0A 2GLXA 4TYYA 3ZS9A 4D9GA 2WA3A 4BQEA 4CEIA 2N04A 3WHPA 4XRGA 1PJSA 1NNEA 5EJGA 3U9TA 1P81A 3CC2F 3V5NA 3W1EA 1I0LA 1A8UA 2ZRLA 1YUMA 1KEVA 4ESVA 2P7HA 1U6IA 1F0KA 2BE7A 4U2FA 4WACA 5CT9A 4N8DA 2XLBA 1NQAO 2CLHB 1JP7A 3ABMC 3A14A 3IDSA 3G88A 4N7RA 3E8GA 3GLSA 2J5BA 3SQOA 4XCQA 2YNMC 1JUDA 4GS5A 4UU0A 4UPDA 3S8EA 2H85A 1A7JA 2ILMA 5KWEA 1K9MH 4XYGA 1S8NA 1TMKA 1DS6A 1HYQA 1ZFNA 2ZIOA 2Q5FA 2L42A 3BYZA 2VUHB 2YXHA 4DQXA 1K7SN 4EDFA 2DYYA 1TVKB 5K0CA 5FOSA 4BEBA 3ULKA 4B3DA 3IAM6 2W8BB 4QUBA 4D74A 3AESA 4CU2A 4WOJA 3HB3B 2JFHA 4CC6A 1IN7A 4FYVA 4RDHA 3D1VA 1G6Q1 1L8OA 3RO7A 3TIGA 5IDJA 3VPBA 5CW2A 1QK5A 3ZTTA 3LOUA 1BCSA 4H15A 3FTCA 4YUAA 1QLJA 4PRZA 3T3OA 4GW3A 4HB0A 3DZDA 1IRIA 3DUFB 2C4VA 4OJQA 4QELA 4QE9A 5C7YA 4TRRA 5C1DA 3PC2A 3T12A 2UXDO 1VMAA 1LV7A 1O96B 2XUPA 4MA5A 1HQDA 2F4NA 3WQRA 4R7CA 2JIBA 3D6MA 3WAKA 4IGAA 4J49A 3PJRA 2P0YA 5FYQA 1GY8A 2ZJYA 1RYMA 1T6YA 2GBFA 1R0KA 3N5KA 1K27A 4ZIRB 3UVEA 1YOVA 4RADA 4M60A 1ZHOA 4J1NA 1NRXA 2QD2A 3OOJA 3REQB 4M83A 3OBWA 1JA9A 4UHBA 3ICOA 2IUSA 2Z6AA 3W7BA 4D80A 5JSFA 3DLIA 2ZREA 4NV0A 3ZXUB 5ITZB 4HFNA 1U0OC 1P4JA 1XI2A 3UCXA 3ZCTA 4INPA 2AFHE 2W0FC 5KTMA 3NTUA 2DE0X 1CS4C 3M0EA 3EIQA 4J2TA 4OBBA 1GN8A 4ARZB 3WO0A 3I56F 2B8NA 2WQ6A 3G9QA 2YEVB 3UH1A 4MA4A 3QBEA 1AH2A 2HKOA 3UMRA 3I61A 2IS6A 1V7CA 2C2KA 3B6KA 3I01A 3STTA 2TS1A 3GNQA 1IONA 2C5FA 2MSNA 1CK2A 2SKCA 3UWSA 4ZCIA 4KVGA 3RTAA 1D0VA 2PRKA 3ZBUA 2EQ5A 2CZGA 4LXTA 2J9FB 2DKOA 4I9QA 1DP4A 4P31A 2H9IA 4YQYA 4WJKB 2RIRA 1WAZA 4XD7D 3L8GA 1F2DA 2NZWA 4RVDA 2E4ZA 3SBDA 3CB2A 5ERGB 3NVMB 2PGAA 1NI4B 3BA6A 3IPXA 5LSAA 3TOSA 1EFKA 2BH2A 4Z1MG 2AJ8A 4FLMA 4PX9A 1MZPA 4FZ1A 2VWGA 4EJ2A 2HVYD 2ZG6A 2J32A 2OD2A 4Q4LA 3M1LA 1X9HA 2WAOA 2VATA 2QTAA 1PBTA 3QWFA 3ZCCA 4MTLA 1L7NA 1L4UA 2IBTA 1IMOA 1IWOA 4UB6Z 2XTNA 3DE3X 3W3AD 3EIFA 3F2VA 3NIBA 3WP1B 1LSOA 1Q5PA 4IKOA 5EA2A 1U7DA 1D03A 4IIVA 1GQSA 4I4LA 1JWAB 3FD6A 2W2KA 4X5OA 4G5SA 2WPDG 1MPTA 3IQZA 1LSUA 2YASA 1VE1A 1E7YA 1IEQA 5HZMA 3HBAA 1VSQA 2WU1A 3BREA 3K9LA 3V48A 1ATZA 4OM8A 4XUCA 3K9HA 1VEWA 3BDAA 4GVLA 4DCMA 1JB9A 4UMEA 1Z5VA 3D8HA 4Z53A 1TKRA 4HT3B 3UXMA 3U3RA 5HZGA 4X9QA 1G9XA 4GKAA 4ARUA 4KAAA 3FTQA 2ZOVA 2FA9A 2UXBB 4H44B 1GYQA 1XZHA 4Q02A 3NTVA 4BUJA 2O6HA 2Q49A 4OU4A 3CW2A 1U94A 1V11A 1IAVA 3EVGA 5H4HA 1IVYA 5T8KA 1QTIA 1FP2A 3CEHA 4KFCA 1XQ6A 2FZVA 4REOA 4JYPA 3Q4GA 4MK4A 3M4XA 4DRXB 4DC9A 5DX8A 2IYPA 3NK6A 3WHIA 3DFZA 4AILC 1O54A 1XWWA 4MUFA 4OA8A 3HHPA 2F8TA 4Y2QA 4DIEA 1Q1GA 4NWOB 3K79A 1Y7PA 1PGNA 9ATCA 5GWXA 4D3YA 3T06B 2OAEA 2HPVA 4Z9XA 1QQAA 5BWOA 4WFQA 3BF8A 3OMXA 1TAUA 2QRNA 3GO4A 3OURA 4P33A 3F78A 3KFVA 1KYYA 3LHSA 3ILXA 2P2LA 5AM1A 4DLLA 1G5RA 3EGDA 3L6EA 4YFYA 4ZARA 2VEOA 4KKVA 3DQPA 2JCVA 1MKYA 4DXWA 3GEEA 3PRJA 3KX2A 3KQMA 1P5ZB 2B94A 6NULA 1ZOPA 3COSA 5K1PA 1K5HA 1TEZA 1X8XA 1OXBB 4FJ2A 4YJGA 4MVOA 4DARA 1HYBA 1KAHA 3LRTA 3D8RA 4QHYA 3HU1A 2AC2A 1ABFA 3JD0A 3KZKA 1PV0A 4O5AA 1G5IA 2UYNA 1QHGA 4DANA 4I19A 3GZTB 3E58A 4RJKA 4BV8A 1YHQV 3BSSA 4Y9UA 3IA7A 2IYUA 1BWRA 2VP4A 1V35A 1LPPA 4EG8A 2W2OA 1DB3A 4L87A 4U0JA 3K70B 1PT5A 2RGCA 5KNLA 4LYFA 2GXAA 5FPYA 3SFVA 3KEMA 4LPKA 3EZFA 3EEQA 3WLQA 1UKYA 4JGIA 1PZMA 4WFBV 3QXGA 3IVAA 2B20A 5T3UA 4JYAB 3O3MB 2FOXA 4DE5A 1M76A 4JP1A 4CRWB 4K9QA 1PT8A 4CR8A 4PYNA 4ETNA 2ASVA 4XVHA 4AYWA 4IJMA 3TO5A 1QFJA 3GFQA 3A3YA 3GWZA 4JC8A 5C8YB 2Z2KA 2H08A 4M1OA 4ZO8A 2P2YA 4ER6A 1BOFA 4XB6B 3N5CA 1TU4A 3MA0A 4KE6A 4RVOA 3BERA 3W5SA 3TAHA 5JJJB 3IBCA 2C5BA 3ZWOA 3W77A 1GUAA 5DCLA 2I22A 1N1EA 1ONOA 1T8SA 5A7HA 2QVGA 1D2NA 4F3CA 3T5BA 1EVEA 2DKFA 4FMCB 3EISA 4ZOLA 2WSSD 3H6HA 2LCIA 4A9AA 3X2EA 3CSSA 1DQZA 4MVJA 3ICQB 3ZWYA 4DLKA 2BFDB 4FQ7A 2JZNA 1LV8A 5CBPB 1B16A 2EJRA 1CETA 4J7CA 1LUWA 4JC5A 1OT3A 4O2BB 1T43A 1WULS 3Q72A 5IWAB 3OO0A 3GYQA 2V6IA 3UW3A 5IM4A 1DZ3A 3Q3GE 4QUIA 4HWGA 5SY6A 3WRWA 4EI7A 4KKXB 4WKGA 5EPUA 2GAFA 3G7SA 1UDXA 1KI4A 5BNIA 2XZDA 1ENVA 1K5GA 3S2YA 3LHIA 2DFDA 4X00A 3K9WA 5CBFA 3PUWA 3ITKA 3BORA 1IM2A 3FVWA 1ZAYA 1JHUA 4PLHA 5CDFA 4UD6A 1BXZA 4PHGA 2GN0A 2ZZKA 1A5ZA 2DULA 4BQNA 1TFUA 3C3AA 2WSLA 4NATA 3A2NA 1PR9A 4P5PA 1Q5OA 1GVHA 4JJAA 4DG5A 4ZTZB 2C20A 4E13A 3UT5A 5GOZA 5TEVA 4EEXA 2GEUA 4FWTA 2DJ5A 4ZOAA 1WY7A 1FUKA 1V9PA 5AJVB 4Y8VA 4LMPA 1H3EA 3LECA 1V47A 3A4YA 3NTXA 2FV8A 4UPVA 3D5TA 4UVEA 4P83A 1LB1B 2WK1A 4EB3A 4FR2A 4Q24A 3BMCA 4TYMA 2VQ6A 3ERNA 1BO6A 1QGOA 1GQRA 3DP9A 3QIAA 1P6QA 1M2OA 4D5GA 1CE8A 2FN9A 2A9PA 1VF7A 1C1HA 2L0XA 3IAS6 2NV0A 4CR7A 2X7JA 4N7BA 1YE3A 3C48A 3VI3B 4DTCA 4GP9A 2BMVA 2DFTA 1RYZA 1Z6QA 3MHPA 3MWEA 3WGQA 4PCUA 3T1YO 4GL2A 2DYRB 3EEYA 1Q20A 2J0UB 2ETXA 3AJRA 4PHFA 4OOFA 4CLRA 1K86A 4LEIA 4ZVRA 5JI2E 5F2VO 1NLZA 1U2RA 1H9AA 4HZUB 3TLXA 1E4EB 2NNWB 3ACDA 3PZBA 3ZDEA 2FKAA 4FUQA 8OHMA 2R8YA 5L9AA 3GK3A 3GUHA 2J41A 4HNHA 4NK5A 5AUQA 3RC9A 5DHUA 3SF8B 1NLUA 3RVDA 1K4KA 1VLQA 4MV9A 2GJKA 3U5TA 5BVGB 4JITA 3SC4A 1R73A 3WLLA 3AWIA 3BB3A 4M7OA 5JRDS 1RC0A 3A1DA 1HDZA 3AGQA 5CNJA 4MUJA 2VDPB 3UJNA 3LO8A 1WWKA 1ZDMA 4TV9A 4CUJA 3TIFA 4IY1A 5DGTA 3FI0A 2ZRMA 3GMDA 4ZAGA 2YJ5A 3JRNA 2Q5ZA 4B6RA 4K9MA 3ABTA 1G20B 3A26A 2FI1A 1USVA 1I10A 3NP7A 1K9MW 4JZ2A 3FFTA 3LVBA 5A6VA 2W6JA 4ITUA 5ICCA 3D1JA 4W8HA 3MCAB 3D31A 2CHTA 4IOKA 4L7QA 3ETQA 2WYVA 2ODEA 4HQ0A 5BOSA 3V1UA 1WV0A 4DSNA 4PYLA 3KKPA 3RJTA 1G291 3ICEA 2GWRA 2WWWA 2XNKA 3PXGA 1GN3A 3R66A 4HAIA 2HK6A 2GD6A 3R7BA 1MX9A 5EZ6B 3W6UA 1P4RA 4G81A 4TZTA 5KSWB 4YAUA 3UMCA 4WZAE 2FLWA 1MO5A 1QIGA 1G4AE 1TJ5A 3REOA 3Q1LA 3KSZO 2FK8A 4J94A 4L08A 1L8LA 4GXNA 1K08A 3Q0TA 5LJIA 3BIJA 4HP8A 1ZHHA 2QI9F 3VSEA 1IBRA 2ZWOA 3WJRA 1CVIA 3D3EA 2R6GA 4MW1A 3PU6A 1LX6A 1L3BA 2WWRA 5GPBA 1N2IA 4H1TA 1P60A 3R4CA 1GGEA 2VJPA 3KAKA 2QVZX 2VS0A 5A6SA 1XDUA 4ZHVA 1XTZA 3OY7A 2PGNA 1Q0ZA 2PZMA 3C3KA 4QQFA 1YI2V 3ZV6A 5LUAA 4DV1B 3AOEC 3VQYA 4PX2A 1SVMA 1JG1A 1G8JA 4D82A 3O03A 5TGTA 2F90A 3CEPB 5C3UA 5LLTA 3TQRA 4CM6A 4YV0A 1H2LA 2DYSC 1U7WA 4XJTA 4MWDA 4G89A 2PZJA 1PV2A 421PA 2EV9A 3KYCB 1A77A 4F4UA 3FFWA 3AEQA 2CSUA 2XAGA 4MUHA 2AL7A 2O7SA 5EMLA 1PJ3A 1PLKA 2IP4A 2V7XA 4Z49A 2HA2A 4WXHA 1JQAA 1F3LA 3UGQA 1F9AA 5DNUA 4ENTA 2EP7A 5B66Z 1V4NA 2UUBO 4QJBA 4K5QA 3EVFA 1BGVA 3ZXSA 4LQDA 4OOEA 2GN2A 4BW0B 4D8XA 5C7IO 5FDFA 4RV4A 1X80B 4CMHA 3EPHA 5E0OA 5DT9A 4BFUA 1YA8A 3IRUA 3LGXA 2PZEA 1CUBA 4M1MA 1T36A 4L4YA 5JQGF 1X0VA 3CXUA 3O4RA 4MRRA 3AB7A 2VJNA 1E2PA 5HIKA 2UZAA 1ZGCA 4JLWA 4MNTA 1D1TA 2PE5A 1UBOS 4MPPA 5GVRA 1YAJA 4Z1MD 4NULA 4PBSA 2I78A 3AGKA 3UF0A 5E2IA 2P4SA 2IHUA 5CPFA 3QJGA 1E2UA 3ROGA 1AJPA 5BMVF 1YCIA 2I6QA 1QGDA 4PQEA 4D9FA 4DR2O 3RW0A 4UAGA 4TLDA 3QA3E 2IS1A 1ZD4A 4NVPA 1ESDA 2OZPA 1XX6A 5I8WA 1QH8B 1GQOA 2FWIA 4FHCA 1WXIA 5C18A 3DVAA 3F73A 3BB1A 3GAZA 4GC5A 2EJTA 1S3SA 4UE3S 2WPDD 4E22A 2VYVA 3WB9A 1VQ9V 2I7DA 2WTAA 3FUXA 3ICVA 1L1EA 4UJ5A 5EXDA 1SHJA 4EJ0A 4NJMB 5GJBA 3T5AA 2BTUA 1E2KA 2I3GA 3ENQA 3G2OA 5I4IA 2WM3A 3FETA 5BZBA 2JEOA 3LC0A 4AQ7A 4GOND 5HKKD 4AG5A 4G27B 2MSEB 4EPWA 2AXPA 2YV3A 2O48X 1DKNA 4I36A 2Q0XA 3M6IA 3QVLA 3R5HA 3NKFA 1N6KA 1J56A 4C2AA 3SR4A 1Z6YA 4YX9A 1KARA 4LR3A 2X0RA 3R7NA 5ALKA 4UE2A 4HDMB 4V2UA 5LDHA 4JAAA 4OHWA 5JMOA 1JDVA 2Z1MA 3D6JA 4JBWA 3OQNA 1PZNA 5CB4A 1F51E 2JGUA 2GPWA 2YR0A 1Z2CA 4C43A 5AQEA 3U4GA 5HMLA 1NMEA 3PCXA 2YV1A 4BNNA 5TVKA 4U5XA 2C5EA 3CNNA 2QEXF 4BRUA 5SZHB 1SXIA 1SZCA 1JJBA 4RU1A 4XDJA 3CZ4A 4MRAA 3OKCA 4UEOA 1M1YE 2JRLA 3QE4A 2EJCA 2WD9A 3QVOA 2JVIA 3H8JA 3OO1A 1C7ZA 2AZMA 4Q3AA 3GT0A 5LMCA 3HM2A 3B1KA 2HXGA 1TT5A 4GWKA 2CWJA 4RD4A 1VQOV 4EY7A 4RO0A 1P0IA 2B98A 2BFOA 2GBGA 5FI5A 5ER6A 3N53A 1DRVA 4D4JA 2EG9A 1EAMA 3U5ZB 5BV8A 2JLWA 4HVLA 2R66A 3CCUV 3CF2A 3WMXA 3N8KA 5EJ6A 4ID9A 4EJ6A 1O77A 1FS0G 2EJ7A 2PNJA 1ZXLA 4J0CA 1A9QA 1ROPA 1TOAA 4AZ0A 1RRPA 1ISPA 4X91A 4P5DA 3TQCA 2I4NA 4G9BA 1J8DA 2OWEA 4GF5A 2JNBA 1SKBA 5H83A 1BAPA 2CNLA 1G3UA 4FGUA 1NYQA 3GEMA 2CYAA 3HFJA 3AERA 1XV2A 3K92A 5DIZA 2OCYC 2W2LA 5DHPA 3LCRA 3OCVA 3E9RA 1E0SA 2O1WA 4XVUA 1KIFA 1TJNA 3DE7X 2GCPA 4QPJC 4MPRA 4PG6A 1XA4A 2NVUB 2WJVA 4LZZA 5BYKA 1F2TA 2HLDA 1OLXB 4X64O 4AJOA 4RABA 1PIWA 1SC4A 4CKXA 1ZYUA 1S9DA 4UFNA 1U0BB 3VSCA 4CF5A 1GNSA 4NF2A 3SIPA 5AI8A 1R0CA 2AI3A 3BQMB 3ZN2A 3BXGA 1TCVA 1KD1H 3KEOA 2VHTA 2QN3A 2VP3A 4YASA 3Q7IA 3D2LA 2ZSFA 2PRIA 3I9NA 1E3SA 4G8BA 4XR9A 4P0PB 2XRMA 5DB4A 3OPMA 3AFOA 4KWIA 1UJ2A 4EVRA 1TAEA 4Q3KA 5FWXA 1ECFA 4TUYB 3C1AA 2NSDA 4HB2A 4HTAA 3GFBA 3G4SF 2VPZA 2OZLA 5ICFA 3U7IA 2Z04A 4D4HA 4KN9S 4YRAA 3EA5A 1J95A 3DF7A 1YBFA 3CN9A 1DCMA 2JS5A 1WMEA 3TS1A 2IW5A 4XUEA 4YCCA 4FGZA 3JSLA 1YS9A 4X3CA 1LWNA 3CRZA 5CA1F 5B3JA 4M1ZA 7REQA 1ZESA 2JGIA 3AV0B 4LY0A 2DUJA 2XY4A 4DA0A 2QDKA 3UGKA 1T0UA 1R64A 1QU9A 4ZVQA 4BN0A 1OH5A 1N4DA 5EC8A 4RHCA 4URXR 1UPTA 4BECA 1ECCA 2OCKA 1QYXA 3M33A 3VDXA 1ISGA 3B1FA 1WNTA 2LW7A 1NU6A 4XSHA 2IH4A 1GTRA 2XDWA 4HX5A 5BXZA 1VOTA 4M1YA 1V3QE 1GV0A 4RMIA 2GYWA 2FRDC 2WUEA 3KE9A 2W8ZA 3U3MA 1O8BA 3T1HO 1MAUA 4D46A 4JI2O 3HCDA 3AL3A 2C00A 4RH0A 4JI5O 2H17A 1ISHA 3FF4A 3DEAA 3PUXA 3FFQA 3M3HA 3N0VA 4FI3F 2AQHA 3BXFA 1H4QA 3EC2A 3FXAA 3RVNA 1YU6A 2ZYRA 3K4PA 1C1YA 4NMMA 3V2UA 2HDWA 4EHBA 1SQ0A 4DDUA 3IHLA 3GYBA 5DSZA 3I6ZA 5CDGA 4RK7A 2F1KA 2Q9UA 1KRHA 2P4KA 1H0HA 1QMPA 3I42A 2FSVC 4RD1A 2ABWA 5EUMA 1K68A 4LCUC 4R2KA 4KH1A 3KQVA 1YMUA 3P9QA 1MOQA 5JJ5A 3QY0A 1UBRS 2PGDA 4B75A 4R8VA 1VG0B 4YHHO 1C7EA 1D9XA 4PNZA 3ZHQA 4WADA 1UODA 4F04A 4O63O 2JK0A 1USUA 4IR7A 2Q6LA 5FL7G 1IG0A 4ZDIA 1PDVA 4CNQA 2O9JA 1AI7A 1Y76B 3VI4B 3FMIA 1JE0A 4XIFA 4U9HS 3FVVA 2HMTA 3FJOA 1HG1A 3PEUA 3R75A 8ATCA 3IUBA 2YBEA 2IV3A 2BGWA 4KLRA 4GP7A 1DAIA 5CVJA 1U2GC 1CB7A 4GZRB 3FHCB 4R68A 1G6OA 1O3YA 3ERCA 5K3DA 1GDTA 2P9CA 2YHIB 2HJWA 1FTSA 4YCNA 2YOHA 1RXVA 2DZDA 1U99A 1AMOA 2PJDA 1IMJA 1KSJA 3EEFA 1O9BA 1XYYA 3ML0A 4I1YA 3AR4A 2NO0A 4P98A 1D0SA 4HQNA 1R9NA 4Z4IA 1VHDA 4N1AA 4UCRA 4Q4JA 4CEJA 3W4IA 4EPXA 5AVQA 1EAYA 4LCJA 1FKAO 3ONDA 2DAPA 3FN4A 3PEEA 3O8QB 5JCOA 3FCOA 3O7MA 3HFSA 3ZV7A 1MENA 1N6PA 4UJ3A 3RVJA 4N0MA 3P5SA 2NZ8A 1UBJS 2AFVA 3QY9A 4RPGA 3DB1A 5H80A 1FW6A 2ZW9A 1UT6A 4D8YA 4HY3A 2FKXA 3UY4A 2BKLA 3ONEA 4F4FA 4ND8B 3VR5D 3AEKA 1J0BA 1VK3A 4QDJA 5JCJA 4WCEV 3HACA 1UP6A 4J0FA 3N0TA 3SZLA 1KI6B 1VIYA 2RGRA 2NM0A 5L3BA 3LF2A 4TLMB 3ZDZB 5DULA 4BDSA 4BS9A 3IO3A 3GVPA 3WRYC 1CDZA 4KNWA 4RH1A 2AFIB 4ZHQF 5BV7A 1Z2GA 3LCJA 1GRCA 3A32A 5KOHA 3U48A 3A1VA 4ZYVA 1HTTA 1L6IA 4JOSA 4M87A 4UCXA 2V5VA 2HJRA 1B42A 3CCVF 1M1XB 1RWKA 1H2XA 3UENA 3R1IA 1POXA 4JEMA 5DYGA 2ONKA 1MW9X 4YMSA 2QMHA 5KNCH 4F4HA 2C2MA 1XJCA 1Y3HA 3ZU3A 1FFGA 3R7WB 1Z5UA 2B9EA 1VE9A 1FTYA 4K86A 3MTEA 2O3SA 4M0DA 2ZU0C 5BSHA 1DAMA 5FWNA 2HA0A 1X9GA 1SEPA 2YRWA 4LKRA 3NDRA 2CWDA 4MVJG 5CFZA 1THMA 1HNWB 3Q11A 4HDRB 4LYYA 1DKLA 4WLFA 3DXRB 5EIXA 3M5PA 1TZBA 3MDOA 1GWNA 3BIWA 1EZ4A 1YJWV 1G7TA 2GK3A 3KVOA 4MVUA 2IBZH 1A8HA 1EA5A 2XQVA 2Q28A 3EAGA 1P1RA 3O1JC 1M57C 2VSYA 1B8PA 4MUYA 4TQFA 2QAGA 5JNRA 2CXOA 2ILTA 2PHZA 1VFPA 1WVGA 1YAHA 1F0NA 4EW3A 4X41A 3B82A 2HQSA 2ZVPX 3IDFA 1IK4A 1K89A 4I0XB 2Z4SA 3MMPA 5KNBH 3D54D 1VTKA 1WU8A 4XIGS 4HX2A 1NBMG 3FB1A 4ESHA 2FZ4A 4DPMA 1E6EA 3KIZA 3A27A 2YZMA 2QN9A 1UDBA 1QTNA 1TTQB 4TTTS 4XJSA 2PRJA 3DAOA 1V41E 3C3SA 3LT2A 1DKUA 1EVLA 1Q50A 3NDJA 4GSLA 4JA0A 3RUIA 2ECKA 3IBSA 2YSUB 3ESCA 4GMXA 4R3WA 1O4WA 4X3MA 2BFAA 1DKRA 3WDLA 3O3CA 1CNMA 5EIHA 2Y67A 4C7UA 2XIQA 4WRRA 4DLZA 1C4KA 4US2R 2ODPA 1Z74A 5EWMA 1KK1A 1E7WA 4H0LB 1H38A 4MTXA 1I32A 4J4TA 1II9A 3RQSA 3OTOB 3L5KA 5ALZA 5AVUA 2QX7A 3HGTA 2IXEA 4DADA 5FAKA 1EM8B 2ZSEA 4GD3Q 3LQ4A 1QGZA 1CTQA 4QATA 3OJOA 1N78A 1HTWA 4ND1A 4U8GA 4D0GA 4DRZA 4IH1A 4IEFB 4RLHA 2K5UA 3B6JA 1B6QA 4YCAA 4Q9NA 2PU5A 1YO6A 3ZS8C 1EFVA 2IGBA 1SKQA 3OD4A 3FNIA 3WV5A 2LCQA 3VRHA 3E8MA 2GXUA 5GY7A 4L74A 1KORA 1JFFB 3QKWA 2BR5A 2JB9A 4E0BA 1T25A 2VHYA 3IIMA 4FLEA 4CM7A 2I4TA 4M1WA 2PZLA 3G0CA 3O8OB 4N3GA 4WKCA 4DCTA 1IAQA 5DNAA 2CFOA 4RD3A 4TT3A 1UMCA 3X1DA 4WEQA 1TM4E 3CNLA 5D3KA 2XF8A 4U6QA 3ZZMA 4D97A 1QQ6A 3C8MA 3VJKA 4J42A 4UUJC 1HO3A 2NO6A 4OAQA 1E0AA 1QAOA 3DOHA 3GRFA 3JZFA 3KTFA 3IMKA 5AJXA 1T8TA 2O5EA 3K8ZA 3SDLA 5AM4A 2C4KA 1V3TA 2CXSA 4OJMX 1L5FA 1NX9A 2GTSA 1E8DA 2B1JA 3VVMA 2UVPA 3DBRB 4ERHA 1YRYE 2JGDA 5T4HA 3OFNG 1M73E 4M1QA 3TEMA 3QVKA 1JTFA 2YW2A 1ZK2A 1U8TA 3UTCA 3TI9A 4MUGA 1OFVA 4OHMA 5AH0A 1CVLA 2ZWVA 4WH0A 3HSYA 1TJPB 2R4QA 4B7XA 2QG9A 1V5IA 2PLNA 5EHIA 3FR8A 5IP5A 1XZKA 3A4LA 3WB1A 2RAUA 3WMEA 2W6JG 2Q99A 4C4PA 1N5OX 4DC0A 1D8AA 1GTMA 4GNRA 1ID1A 4DF3A 3WRXC 2FUKA 1DELA 4FYKA 4YGYA 1N33B 1Q0TA 4ZYTA 3C1TA 4L8WB 4Y2VA 1FLAA 2W2NA 4LGYA 3LC7O 1U9ZA 3T3IA 1BNCA 3GPBA 2A79B 2XNSA 2N9UA 2V1DA 1SUSA 2HMWA 2ZZNA 4INOA 4R2HA 4NFSA 1KD1W 3ZDBA 4P22A 2EQAA 3PBKA 4GYCB 4D9BA 2IDZA 5DP1A 1MO3A 2ZF8A 4A23A 1CP2A 4AY6A 2BH9A 1X7XB 4EFMA 2EFCB 3RVLA 4OXRA 3ZMTA 5FA5A 3R6GA 5K99A 1TQDA 1OU0A 2C98A 3ABUA 3FTFA 5EAZA 2ERYA 4PO3X 2J3JA 3SSAA 1EE2A 3IEUA 2PSDA 1BRTA 2H1CA 2JAHA 2KB0A 2IYSA 4YIHA 4RXMA 2ZGVA 2H8KA 1SDSA 1A2OA 5JAQA 2QX6A 3GLHE 4UCOA 2OT3B 1ZOIA 1W44A 3AXSA 3ZOZA 3HCBA 3OICA 2ZE7A 1DGSA 2OHVA 4PC6A 4P93A 2WTXA 7MDHA 2XVXA 2VSOA 1BCRB 1Z83A 2ADOA 4ASUA 4RKWA 3ESAA 4MZXA 3NB0A 4YMWA 1P72A 2DYSB 1YVUA 3W8FA 2P90A 4LE0A 4EFDA 1NT2B 4IZHA 2V6JA 1X87A 2NT3A 1PJQA 2ZQMA 2X6RA 3GLGE 3V7QA 2DOKA 3LSSA 2QEQA 1EINA 4XGQA 1L7MA 1KY2A 4LOIA 5CG2A 3C3DA 4I9FA 1XT6A 5L51A 3F1LA 4GRIA 4BQOA 1G64A 3B9RA 3W06A 1XHXA 2CB9A 1W3EX 1E9BA 2G07A 2ZYHA 2P2SA 4PFSA 2BFFA 3AM3A 1JQBA 2QRKA 4BFCA 3JTEA 4ZMSA 3NCHA 2FTKA 2YVLA 3IH5A 4ZDJA 4H7JA 3RIYA 4JK3A 3RFRA 3RFFA 2X19A 3FNBA 3AK4A 4ISCA 1BA3A 1TMOA 1FXUA 3UMBA 5IDVA 1F4LA 4F6LA 3CF4A 2J3QA 1K3EA 1HYHA 3THXA 2QIOA 4L85A 3O65A 1UBUS 2AK3A 3WB0A 4L78A 1GKLA 3OC6A 2AEFA 1YDMA 2YWDA 1UEXC 2YYZA 1QVAA 1UKBA 5TSDA 3O9MA 2NXJA 3P9ZA 4FD3A 1EFAA 2CD9A 4C03A 4FZVA 4JOCA 1H5UA 2ZXEA 1SHLA 5HS6A 2ZCUA 4IM7A 4PYOA 1I0ZA 5KEIA 1KQOA 1ESEA 3P4YA 2NO9A 3LUBA 1AHPA 1GKIA 3VX4A 1HNZO 2DPXA 3SZOA 1DCTA 4OMFG 4BW9A 3QVUA 4MPJA 1SVSA 3IOEA 5AVYA 1QVFU 4GDMA 4NYMR 2QM0A 2OUKA 2JEUA 4MPTA 2RG7A 1XIVA 1YZQA 4WOBA 4ENPA 5JD4A 5IRCD 4O2AF 4BP1A 4AF8A 4G0QA 1Y5IA 4PQGA 5J4LA 3ZRXA 5FL7D 2I99A 3VHRA 4C4SA 1WKVA 3EGXB 1Q2XA 2BYTA 2JFXA 3I5XA 1QANA 4EGFA 1H9BA 1IY2A 1X39A 4PGAA 5ALNA 3KE1A 2Q3DA 3L43A 3FI9A 1IOVA 3EBLA 4MYCA 2XUQA 1YJNF 2ZITA 3RHSA 1P1JA 3Q3HA 2H4XA 2XYRA 5JRJA 1M2GA 1WXQA 3DOFA 3NXSA 1NXOA 1PX0A 1ZAUA 2YWXA 1Z5WA 5U9CA 1DO8A 1UC5B 4QHTA 1SG9A 1Y8RA 2NPFA 5K0LA 2PS0A 2BW0A 3ETEA 1TZ2A 2K9PA 3BL6A 2ZIVB 1GA1A 3HKCA 3UYLA 4ZDWA 1C29B 3DLHA 3N70A 6GPBA 3ABLC 1NMSA 5C0OE 3ZDYB 1ENYA 4HF7A 2JLAA 1E3LA 1M6VA 2Z5UA 4PVCA 2HP0B 2F3PA 3AQIA 3N74A 1L7RA 2G17A 2JGLA 2A2ZA 2PUTA 3L9XA 1YBMA 1YR1A 3WJ2A 1BH2A 4K9NA 1I5XA 3LXRA 2HRBA 2UZ1B 2PZAA 1K9SA 3EE6A 2Z1EA 3LUHA 3K03A 2CHQA 4BO6A 4Y6SA 3CC4V 4FCVA 4AP6A 3IOBA 2WE7A 2OHOA 2EFGA 1DLJA 2H06A 3N0RA 2C7BA 1F48A 3H0KA 4YJ2A 5HIMA 4UZFA 5LL6P 1XDGA 3IMEA 5I4CA 2CZWA 1G19A 4YJDA 3F90A 3KKKA 3RN4A 4UTOA 4EGSA 3IUYA 1NZ6A 3EFHA 3FZYA 5MF6A 3HNRA 1HR0O 3G71V 3H3JA 2Q1XA 3UC5A 2PMKA 1K97A 4YRGA 1E3MA 2C7RA 2GMWA 1UMDA 4PLFA 1YHZA 3ZWQA 1BXKA 2C4MA 5CFNA 3O75A 1KMNA 3R9XB 3SQMA 1LNQA 3TD2A 5D7NA 2COKA 5KZMB 1JR4A 2EATA 2HLDG 5BQXA 4LF5B 1WCXA 3BFXA 2JI6A 1PW5A 5LKRA 3CRAA 4OREX 2VLBA 4BGEA 3A3PA 3L2OB 1JTEA 2W22A 3EMDA 3M4NA 1MNGA 3IESA 1B23P 5EUCA 1Z4OA 2IJGX 1J2YA 3DDZX 1NP3A 2H1OA 1NUQA 1AJQA 1QM5A 4C0KA 3SPHA 4PFJA 2NZVG 2PKRA 5E6RA 3DC7A 3V4DA 1ZMBA 3S27A 2ZUDA 4FBLA 4ENUA 2C9MA 3RODA 4HZIA 5L7TA 4PLZA 2DMXA 4Y98A 5CVEA 3I8SA 1A88A 5M7EA 3LUJA 2AIFA 1Y3DE 2GDJA 4MVJD 2ADPA 1IUPA 1YJ9V 3V8PA 2WOJA 3BE8A 2KHZA 1GFZA 4YC7A 1D2EA 4ZI7B 4IQFA 3WIBA 1XREA 3IP8A 1KKMA 1XU4A 3UWKA 4L4ZA 5F5XA 3DOOA 4RNCA 4DGQA 1F1BA 4DYHA 1T2UA 4LTNA 1GEGA 4I1PA 1RT9A 3CBQA 3QW4B 2ZJAA 4KMOA 2YVUA 3HJTA 4Z9BA 1T0IA 3PNOA 2FSSA 3DTNA 1W1UA 5EP4A 3DZFA 5FAXA 2ZS8A 4YMTA 1Z37A 3VAYA 3PRKE 1D1PA 2QA4F 2IS4A 4L02A 1HURA 3CLTD 1NBMD 4KSCA 2IYAA 5F7OA 4IXTA 5DLPA 1DT3A 1QO9A 1GPDG 2C42A 3STXA 3ASNC 2DGDA 1QIDA 1KA9H 2R8OA 3I2IA 4BO5A 2GBLA 3CSUA 1KFKB 3B2QA 3AONB 1U4SA 2FPXA 4I5DA 1YQXA 3F0GA 4N41A 1PEDA 5E1MA 4NYIR 3MCZA 3QVMA 1D09A 5CBHA 1NAIA 4Z4CA 5KMGB 4CXMA 4AECA 3TL2A 4GBJA 4RQAA 4R0NA 3FF1A 2G4CA 1A8IA 2AW5A 1T35A 4KX3A 1DK1A 2OC4A 1DC7A 1Z0FA 2O2SA 1ORVA 2P9TA 3CNHA 3PNVA 4AKSA 3BMOA 2BEUA 3N87A 4UDXX 1JSZA 4F71A 2V59A 2ZODA 1SD5A 4FLTA 2R6FA 3VYWA 5IZCA 1C3OB 4C30A 1Y42X 1ISRA 4J0HA 1DC3A 3IURA 1JHXA 3PD0A 4YBZA 2GBCA 1T4MA 3W2HA 2JIOA 3F6SA 3KAQA 3BRQA 2XQJA 4FFBB 5BYAA 1ZEJA 1U5BA 1IEXA 2PS1A 4BV2A 1XF1A 3VU9B 3K9FC 4BT4A 4FIZA 4AN4A 3ZE6A 1YZBA 2Z3YA 3K9QO 3Q40A 1YVRA 4FYHA 3S40A 2D2XA 2LQTA 2XWBF 2UV8A 2JATA 2HPZA 2KS6A 1AP5A 3E5NA 2OTLV 2JHPA 1Z4JA 2VL7A 3J80N 1V54B 2COUA 4J43A 1E3DA 1BL8A 1FUUA 1K3FA 4OJNA 5ICEA 5FCDA 2B1RA 2CVFA 3DBOB 2F1OA 1EM1A 3ZRWA 4Z2WA 4EKEA 3BKWA 3HABA 2IU4A 4LOLA 3S8YA 5CLIA 2A0LA 2XQIA 3TQHA 3UJ6A 5J2UA 4HAWA 5ECDA 3OFND 4BFLA 2NUAB 3EUFA 4FOOA 1M54A 1OYOA 2ANBA 2VYFA 5LMNB 1JAXA 3UJ7A 4GLFA 1W75A 1IOZA 3WK6A 2RCYA 4GMGA 2C3PA 1AJEA 2H2FA 1M67A 5DRTA 4DUYB 2FW9A 3WGNA 2O2EA 3EVCA 1Q1EA 2Y1KA 3AF6A 2JGAA 3B2EA 4JS0A 4QQNA 2W6JD 3SI7A 1H85A 4AMBA 4YQZA 2OORC 2Z3WA 4PG8A 2C82A 5JE8A 5K3FB 3G5LA 3B09A 1PS0A 4YK7A 4UXHA 1E6MA 2B6HA 1PNVA 2MSWA 4YRJA 1VKHA 1CXZA 4DBLE 4GI5A 3THYB 3HY4A 3HNOA 1ZNWA 4OB8A 5JDCC 4NMHA 3EPPA 5ETJA 2NXNA 4A8PA 2B8EA 2DCUA 3AG6A 4UHFA 2AEJA 2JDIG 3M6VA 4DQDA 2H1VA 1MB3A 3M9XA 5E9QA 2H1SA 1JEOA 4BRWA 3EGWA 3I1JA 5AXCA 5L95A 3E8FA 2J6BA 4UEWA 1W0CA 4RO2A 3EVDA 3AG7A 3LYLA 1SOVA 2ENUA 1VQPV 2XCRB 1VRWA 5KHOC 1PFKA 3N2ZB 1X19A 4V0LA 3RRJA 3UW1A 3KB1A 4HDKA 3SYLA 2C9OA 3HCFA 2QRMA 2WQZA 3LL7A 2QX9A 4C5CA 2HR3A 4PA9A 5CBKA 1RJ9A 1N5RA 1DKQA 1MF7A 2YWBA 3ZNQA 1GUYA 1I2ZA 3X2SA 5HKOA 2Y3IA 3NRCA 1YTFD 3QTTA 3ZD9A 2Q6TA 1WCYA 4WPGA 2FP3A 4X45A 4RQTA 4MHSA 4ZRDA 1DRJA 3DLTA 3V8RA 3SJCC 5H5JA 2ZI6A 1FMCA 5AVMA 4Q4HB 1KOLA 1ZVQA 4C4RA 2OGSA 2ORED 2O8BB 4ZK2A 4CMEA 1B3QA 2WP0A 4JKOA 2EP5A 5A4KA 3F0EA 1JX6A 5J4VA 1QUFA 2CMDA 3ZNPA 1QCYA 1XNRB 1SQXH 4CCYA 5EBWC 2FZGA 2KQXA 1Q21A 5AKYA 4Q5IA 2EAUA 3EZLA 4QXMA 3FDXA 5LA6F 4F11A 4CUZA 3GP3A 2FUG1 3EG9A 2Y05A 1KAQA 3OD1A 5I9NA 5ENVA 4GXRA 1W6RA 4WY8A 4LBEC 1KJNA 4IFTA 3ZP7A 1ZD5A 2NTNA 3GJTA 1R6AA 4Z8XA 3P2OA 3L18A 4X1OA 4XIIA 4PO9A 3KTAB 3L8YA 4G85A 1PQ4A 1KQPA 3OLQA 4CKEA 2HBZA 2N3ZA 2QRUA 4KP4A 1Q0QA 4KXVA 3JAKA 4AKEA 4YRLA 2WVAA 2XVMA 4I3GA 4AYXA 2H54A 2SKDA 3A04A 4ZJZA 3F7OA 4F4IA 4BT3A 2M6RA 2G7ZA 4PC2A 1QO0A 3W8EA 2NSHA 2ZUWA 2GD2A 4J0GA 2DQ4A 4UEQA 1LBHA 3UHJA 4E70A 2M7WA 4N49A 4MW7A 3K16A 2FWAA 3QBVA 3WJAA 4W5TA 3VYRB 5B58C 1NBHA 3WIUA 2G0AA 4JLJA 1BG6A 3KSRA 3VU8A 1CUCA 4KR6A 2OHJA 1TLFA 5LZ5A 3K9SA 1EXWA 4CFSA 4NCBA 4IF6A 5AHRA 3ECCA 3GFGA 1CRQA 3LCMA 3OGIB 1HMYA 4LE1A 1QX4A 1SMKA 5JO9A 2LBWA 4P4UA 3AR2A 2B25A 4IQ4A 2J45A 3WG7C 2JBHA 1R4NA 2NZJA 4YREA 3ZIUA 1NMXA 1Q6ZA 5SY4A 1WHSB 1XQ1A 1D07A 1QBZA 1DZIA 5TV2A 1D1QA 5JC1A 3N2YA 4MQBA 4F56A 3EOZA 3TFWA 2B4RO 5JZSA 3OCYA 2OIGA 3HC7A 1SXPA 4Z5XA 3S44A 2XMRA 3TX2A 4H7EA 3RDPA 2QSZA 3QUBA 1VMIA 2Y6VA 5IBQA 1HBJA 1WVMA 1JQ0A 4B3SO 3LXMA 2ESRA 1ULHA 3EXEA 4CLOB 2FSIA 2RJZA 5EKDA 3FVRA 2JLCA 4EDHA 4MYSA 1TX4B 2GEVA 4NFYA 4PU0A 3SIWA 1HFJA 4TT3G 4FNMA 3A2FA 2B35A 3P9XA 3DFKA 3FB7C 3IV9A 2OMEA 5COQA 4EUNA 3BL8A 3TVYA 3DFMA 1GN4A 3G9UA 1E9RA 1WKCA 4WXPA 2UKDA 5SYAA 4BVQA 4TMZA 3U4AA 5IYBO 4MQ5A 5H5NA 4GX0A 1GYRA 2QGZA 3GPCA 3ZN1A 3L02A 3FOBA 4LOAA 4HGPA 2R1ZA 5TC4A 1XRLA 3HVUA 2R96A 4UFZA 3ZDCA 3S2SA 5KJEA 1IHXA 3IHKA 1KECA 4PHCA 2P8JA 5K0NA 1JHPA 1GO3F 4EAQA 5J2TB 2XT9A 3NWBA 3APOA 3L1KA 3L1IA 3U16A 1NLYA 2DR3A 4LJSA 1QZTA 4DLXA 2BM0A 2XJ4A 2E89A 4LZWA 3WQQA 2CJWA 4FD2A 2C61A 4LC1A 1CEYA 2W4QA 3K96A 3P27A 1T0HB 1IJFA 5HF6A 1E18A 1S5PA 1E8MA 4WEOA 2IUFA 5DNVA 2I8CA 3M4SA 3NIFB 3F1KA 1XL0A 3B5IA 3LA6A 4G36A 3I73A 2H29A 4YRSA 4Y7DA 2P6UA 3R7DA 2Q68A 4KGXA 3ZYCA 3UJ3X 2XYPA 4HDNB 4E2ZA 2BGTA 4ZVKA 1HTBA 3K6RA 2VYNA 2E7ZA 1YR8A 2ZB2A 3PGA1 3DWEX 1UFOA 4YXFA 2HLDD 4YPFA 1E9EA 4TN5A 2JLRA 4PFQA 2PMBA 1XYVA 4R51A 2C0PA 2J9FA 2JCSA 2GQ0A 3H01A 3ANTA 1CR0A 1LU9A 4L8YA 2WT9A 4HX9A 3NMUF 2YFYA 4I5EA 3FSGA 2F48A 4IHQA 2J0VA 4ML3A 4EA8A 5LXTA 3BD8A 1U6JA 2ARHA 1QF6A 1M6EX 3WDMA 1P8JA 3CBGA 5DN6A 1KAGA 3Q87B 2O2IA 2YIMA 3V6MA 1BT8A 5JXWA 3RS3A 1PNMA 4EG4A 4EYKA 2ACVA 2BDEA 5LQNA 2R0QC 3B1ZA 2IPXA 3EZYA 3PUKA 4JTAB 3HUFA 1EBFA 4NPHA 5LBQA 1IQRA 1T10A 4IWNA 4EABA 1GO2A 3DMTC 4L95C 2FMTA 2HFJA 4ASUG 4OQPA 3BPZA 3HLTA 1RYFA 3N7TA 3AKCA 2QM8A 1P5FA 1DVRA 3MNFA 2C5SA 4V02A 1KK0A 3MQ2A 1RM5A 4YJHB 4BR6A 3DO5A 2ZWPA 3E35A 2C92A 3BJMA 4UU1A 1VARA 1QZZA 1NATA 4DW8A 3KK0A 4U63A 1D6JA 2R9RB 2X0FA 3AFGA 3B3QA 1GZ6A 1FTNA 3G0HA 5FBQB 4CM1A 1KI3A 1JZSA 4DCSA 4AMYA 2H11A 3LUKA 4GWLA 4PX3A 4ZVPA 1PP9H 4Q1VA 4NOKA 3E8SA 4UB8Z 3TTTA 1HH4A 6PFKA 2BI8A 3A6LA 4HNGA 2B82A 3LFOA 1R9JA 4WFGA 1PTJA 4QUDA 3V7YA 3AY0A 3O73A 5TX7A 2XEDA 3QELA 1ZM9A 2F6RA 3AF0A 3DWIA 2BMEA 1KI8A 3JQAB 3GGJA 4UNQA 3CF4G 2FEOA 4U2KA 3I9JA 5LYJB 3BFKA 2GTAA 5D84A 2CTWA 1NVGA 1RC8A 3QEAZ 3QRWA 2WIBA 1V95A 4NJEB 1XFAA 1OGJA 1A2KC 1UMBB 4DR4B 1IQUA 4LVUA 2VKQA 2ZSJA 3NIGB 1J99A 1N0IA 1AT1A 3NKLA 3RSOA 5DMHA 1CUIA 4MW6A 4FLVA 4MQFB 2X2EA 2I87A 3VAAA 2CH7B 3SICE 2O8FB 1RHUA 3IQXA 3FLEA 3S28A 3LP8A 3KM0A 1ZIDA 1HDGO 1J07A 1W36D 2YW9A 1H4SA 2OA0A 4F2GA 4N65A 1VYHA 2JJYA 4KV9A 3D3JA 4AP5A 1BRMA 4C06A 3M2PA 4J75A 2P9GA 3GBSA 5A3JA 3AKYA 3OUFA 3H9QA 3JU3A 3Q2IA 4MMYB 4E21A 3ABMB 4FGLA 4RHYA 4FJ0A 3D2BA 1MXHA 4LZPA 3O3OB 3T1YB 1WPBA 4BMSA 4OD0A 4BLWA 3D0QA 4JGGA 3WLTA 4W5QA 4BRSA 3IUSA 3T35A 1M34B 1HORA 3LDFA 1K7XB 1VQMV 4ZYUA 3ADOA 4XSGA 4NE9A 4WLEA 3UUFA 3WJ1A 4Q00A 3WJQA 2SHKA 1LD3A 4FLXA 3M82A 4IHJA 5EMNA 1GR1A 1Q6YA 4M53A 1KYXA 3FY4A 4N40A 4MS3B 2YINC 3CT6A 1J00A 2F8SA 3FBTA 3BXPA 3E7FA 2BJWA 1EVYA 1PU2A 5BQ5A 1SC5B 2IHTA 4M7WA 1T3SA 2QGFA 1KMCA 3BY6A 1A32A 4P53A 2OXEA 2VSXA 1UT5A 3B3JA 1LFAA 4F91B 3IMGA 3OC0A 3C16C 6CHYA 5ILQA 4PE5B 2P5OA 1Q16A 3QEBZ 4CMIB 1QHHB 3H8SA 3LMKA 2CVZA 4FNOA 5DEDA 4ER0A 1K7FB 5EMHA 3OLXA 1C9NA 1MBZA 2G7MC 2PVPA 4WAUA 5EI5A 4K9SA 3FHOA 3ZCVA 3VZBA 3BGWA 4JHLA 3RV4A 3Q3CA 2EP8A 4WGGA 4Q47A 4LSGA 1KZYC 3M89A 3EJ6A 4B3TB 4PZZA 2PXCA 2L17A 1U98A 1KZ1A 2JD2A 1WXDA 3KUUA 3ZWCA 3IEQA 5KVCA 3H18A 5IBCA 3C6KA 4RM3A 1MDFA 5HX7A 5GADl 5HTOA 3EULA 5IXJA 2Z30A 3MTIA 1SR8A 1QHXA 3BKXA 2VBFA 2X23A 1NQXA 5AJWA 4CKBB 2DU8A 2JDID 3CVWA 2DKNA 5IC6A 1CR1A 1HE5A 1TB4A 1AGPA 2QKAA 1NG9A 2ZYUX 4WESB 1LBIA 2WHQA 1CFZA 1XMJA 2BTEA 1U81A 4CMCA 3RJ5A 3V32A 4KE8A 3GUVA 1YNOA 5C53B 2VDWB 5JCJD 1X15A 3CPEA 2X9GA 3PXBA 1ULSA 4KDEA 5AKHA 1TA0A 4XWAA 1Z28A 1PJ4A 4S1PA 3IR6A 1QR2A 3FIJA 2HZBA 1KI2A 5A4IS 4WKOA 5P21A 1U7ZA 1ZN7A 1G17A 3KJIA 2FVYA 4RCYA 3HADA 3LA8A 3RFXA 4KQFA 1Z4LA 1FFWA 5D2CA 5TIIA 4DEVA 3PKJA 4GEGA 4COOA 1JHYA 5GM2A 3O9VA 4UV8A 2ALJA 3R0VA 4KPGA 2O8DB 4MT8A 3U2QA 4W8GA 3L0YA 1L3IA 2P2NA 1H0RA 2WM9B 2RAFA 4EYGA 2QVLA 4ZPJA 3UHFA 1L7QA 4I9WA 3WLEA 1BX0A 2PY5A 2IYNA 1DT5A 1YQNA 2GSMB 4MRMA 5J43A 3P52A 5B30A 3MTQA 4XTCS 3K8YA 4RY2A 3RA6A 2D7CA 1TRKA 3QLTA 4RBNA 3ED5A 4X7PA 2FP4B 1NYLA 2YBDA 2RHWA 1WA8A 4YWHA 1EVQA 3TW0A 3H1HH 1WEHA 3KT6A 2Q0AA 5HM6A 1FNDA 4D79A 1QK4A 4K6CA 3ELBA 2W6CX 1B6SA 1AKMA 3JYOA 3O4VA 5BVHB 3CEAA 4Y9TA 4J8PA 1XGKA 1NUPA 1XTKA 1XMOB 4RA6A 1NVTA 3THWB 3K0HA 3RC2A 3OPNA 1W48A 2DW4A 1M6WA 5JY1A 3RWRD 1M2JA 2WU8A 4F85A 3PLAE 3VCZA 5DWQA 2KW5A 2ODBA 3LWZA 2UUBB 1VQ6V 4OLJA 5LGNA 1EK0A 4HOYA 4I55F 1WXFA 3CT4A 1FFBA 4G5FA 5BQ3A 2BGGA 3WBKA 4NTXA 1FS6A 1X13A 3Q3VA 3FX7A 3EQ8A 3F4BA 1R5BA 4IEIA 3W9SA 4QIWF 2P30A 1Z8FA 2NYAA 3LFHA 1DC5A 2FW0A 2EKZA 3LOPA 5KJFA 3TRJA 1FVFA 3NAQA 1E4EA 4NZNA 3BZWA 3IIEA 3IOMA 3SXJA 2C8LA 2PCJA 2XZOA 3A6PC 2QWPB 5LQSA 2JHAA 2NYVA 3NHRA 4MULA 1ZZGA 2P9HA 1ZNZA 5K9ZA 1XZQA 1V8OA 3C6QA 1RQ7A 3L84A 1GH6A 3FDFA 1ZJJA 2VBCA 4QPZA 3MWDA 4DR2B 3B85A 1P44A 5D1NA 4H4CA 4KL1A 5KX5F 2XT0A 3MELA 1G8FA 4ZI3A 2H4HA 5TPWA 3H9EO 3W8RA 4RTLA 2A0YA 4NHEA 2DQ0A 4U7TB 4RESA 3T9BA 4D41A 1X42A 1OAAA 4KB5A 2QP3A 2WWXA 1BW9B 3KU4A 1C2YA 3LY5A 3MJFA 1AC5A 5KAFZ 1YRHA 5CYFA 2O1SA 2CLOB 2WFLB 5K0BA 4AD8A 4ZICA 1HYEA 5K0FA 2Q3HA 5GONB 3DE1X 5KDLA 4MLPA 4F12A 1CEXA 5L3FA 2EL9A 4KPUB 3GGSA 5EZQA 4NJOA 3UAWA 2ZJZA 4A0GA 5A02A 3AUFA 1R12A 3U44B 4CMJA 3DHVA 2EINC 2PBZA 5JS7A 1SULA 3K5HA 4RKEA 1K4DC 4KQWA 2WUDA 4K88A 4TT3D 1Y3BE 3OQ1A 5H0IA 1OCRC 2DWCA 3VYTC 4JL6A 4QYWA 1P0QA 3CLUC 4DLVA 3P9NA 4UW9A 2XT6A 3ASOC 5CG1A 4LUCA 2VZ0A 5GANK 2ZYWX 2XRFA 3U3XA 3AVPA 5M5BA 1Q3TA 2IPNA 3RSGA 4CM9A 2ZKOA 3KFLA 3ILHA 1SPBS 3SE7A 1Q0RA 5E6UB 3R9WA 1QFXA 1GUBA 3DAHA 1DNPA 1ZJ4A 4CQJA 1CUWA 3LFTA 1I4LD 3EA0A 4QUEA 1NPYA 2C2WA 1NH2D 4Y7CA 5CCEA 3EWSA 3SC3A 1C9YA 1JBQA 4M0LA 5I48A 4E4EA 1XTUA 5D3MB 4GYJA 1F8GA 4TGLA 4UUBA 5CMUA 3PEFA 3AY6A 3EVNA 1UC8A 2KM1A 1SQFA 3PGKA 4EW1A 2HU2A 1H2AS 3D8BA 1GGFA 3FWHA 3ELYA 2B34A 3INTA 3TD3A 1ZGHA 3T1TA 2FGYA 4G37A 1IBMB 4QDTA 3TLYA 5CBGA 5L4SA 2E5LO 2HHCA 4FFVA 2OXCA 3OUZA 4YMGA 2PKQO 1UOQA 4AJ9A 2Y99A 1MQ9A 4OXIA 1YJQA 3RFVA 2ECFA 1AGNA 4BJ3A 4KDCA 1JHRA 3R41A 3ZGOA 2OECA 2OY0A 4JASA 2C2GA 4IZIA 4U9UA 3I3OA 1H05A 2REQB 1JNYA 1PNTA 1TVCA 1JEYB 2QTBA 3DQZA 1S2DA 3N4YA 3OIVA 1DQSA 3H87A 1S5LZ 4FGJA 2ZXUA 2JHFA 2HN9A 2INGX 3BG5A 4QRIA 4WBSA 1IZ7A 1FPOA 4CEHA 3R3SA 1WSAA 5TQ0B 2H1FA 1T2EA 3G1TA 1MIOB 4RPCA 3I3SR 3C5EA 2NO5A 3AB3A 5M3BA 2F8MA 4BMDA 3CHYA 3PKZA 1JPUA 2WG0A 2EQBA 3NHYA 3RUFA 4KIFA 5DX0A 2BV3A 4IX9A 5AG2A 2HY7A 1GOTA 1K75A 5JWOA 3WMRA 4K3AA 4Q9DA 1BEZA 2OQRA 3UA3A 5KTNA 2CMGA 2QUIA 5KHJA 5TLSA 3F9CA 5KTSA 4N6GA 4LNHA 1Y9JA 1YZTA 4TWBA 2DBRA 5JCXA 2IY9A 4ASUD 2EVWX 2GPYA 3ANLA 2GM9A 3BAZA 5CM2Z 4V2IA 3GDWA 1NZJA 2OM6A 1RSOB 5F21A 2RHDA 3F3MA 4NJMA 2PLFA 4QQKA 2P11A 2PG3A 3UFXA 3NTRA 3QFCA 4UAVA 1A8QA 2SICE 3I0MA 1K7YA 2WF8A 4F3TA 5A9SB 2B37A 4RF2A 1SBYA 4HVTA 4Q1AA 2H5LA 1IVNA 3C15C 4MS4B 4LHZA 1GEEA 1XEWX 3GZ4A 4A0FA 4D9JA 3JQQA 1C4OA 1YB6A 2C31A 4LRXA 3OZGA 3KYIB 4BL5A 2P7IA 3FTPA 4MINA 1F2UA 2YV5A 1YIJF 2Z5FA 4IVPA 3CNQS 3VR3D 4HKTA 3K8QA 3SJUA 3F6YA 3WMFA 2E49A 2AI1A 4GMHA 3EFBA 3LXUX 2I3BA 2A3RA 2C3YA 1ORDA 1JG3A 5ANRB 4KRYA 3FSRA 5DGHA 4TLCA 2TECE 2ODWA 2PRZA 3A9RA 4YRMA 1XF9A 3LCUA 3NR7A 3D0RA 4JI5B 2QN7A 4JP3A 3EXIA 5JS8A 3QM1A 3I52A 2QLMA 2H5EA 3PG5A 1G5PA 4N5LA 2CDRA 1ABEA 1W25A 2XTMA 4KPEC 2RGAA 3NRBA 3KSMA 1KJ8A 4FK5C 121PA 4FDTA 3I58A 1R4AA 4WZBB 1U2TA 4FZ0A 2D1FA 1NDQA 1ST3A 5ABPA 4CL3A 1O95C 2A9OA 4YRRA 1G42A 1LF5A 1I08A 2R62A 1B06A 2CT8A 3TYXA 3HWRA 4IDAA 3ZD7A 5A05A 3O9OA 3UAOA 1VF6C 2A58A 4MKFA 3O85A 4FLFA 3SS7X 4A8TA 2VNIA 4JI0O 1F0PA 1T4CB 4HGZA 4YJ3F 3BMNA 4QEZA 5L3SB 4XDGA 3DT9A 4JLUA 1QORA 1RQ2A 2FDCA 4JXJA 1ZVJA 5EKTA 3E81A 4X90A 2GSDA 2O2YA 3E20B 2R9VA 3UOWA 2J07A 2BP7B 1DRUA 3EFEA 3EZXA 4YHHB 3FNHA 1C7IA 2ZU6A 5LP6F 1OIVA 3AQ4A 3T5TA 1MD9A 2V4ZA 1ZNQO 3WG7B 1OBCA 1NMZA 3PC7A 4BOYA 4DUPA 3RLFA 4DABA 3MGKA 4HMPA 4I08A 1A9OA 3CO0S 4DLUA 3B52X 1Y34E 2VPWA 3FUVA 4C2BA 3Q8WA 5TT1A 4NCHA 5D5QA 3LY9A 1KZ4A 1SJ9A 1QYWA 1K6EA 2X13A 3PT9A 1QYVA 5LMZA 3JCZA 2VTBB 5K3AA 4KYTA 4KQ6A 1GUFA 5LBTA 3RSHA 2V7WA 2WJ6A 5IYZB 2HD4A 1JZTA 5G41A 5LHIA 3NDBB 1L5SA 3FYHA 1EBOA 2P5YA 2RGNA 4AT1A 5JXHA 2X41A 1IZ9A 4X7RA 1YE8A 2C9DA 1J09A 3VXKA 5JAUA 5F4ZA 2R84A 4LP8A 4O4JF 1KBHA 1BHJA 3TUJC 3HDGA 3WFIA 2FMHA 1X1SA 4DBLC 3HU3A 3MPUA 3K4HA 3VGJA 1U8CB 2JCXA 3M8AA 2IHYA 1E79A 5CJJA 5BWBA 1TQ4A 1BMDA 1T6NA 1DJNA 2QSUA 1EMDA 4D26A 1M3SA 2UXXA 1U3WA 1ORTA 1UXGA 1OCCC 5L3EA 5AICA 1YCHA 1EUQA 3H5LA 5E4YA 2ZTMA 4FILA 2NU6A 2DH6A 3JSAA 4ANFA 3TSCA 3QG1A 1RYBA 4A0QA 5EWRA 4CT5A 1T4BA 5KYGA 3D1LA 1C9MA 4C76A 1FFDA 3EDOA 4P81A 1OZAA 3PXEA 3BE6A 5B3SC 3K6KA 2AKEA 2AJTA 1A4RA 1DDGA 1G1AA 1ONSA 4C3VA 2AMJA 3Q6IA 2A1UB 5SZKB 4WIAA 5A03A 3E86A 2OCPA 2PKYX 5CW1A 3MT9A 2V97A 1X7WA 3SYOA 1LGYA 5EE0A 1RR6A 4NE2A 3B3FA 4B87A 3ZEAA 3A06A 1NXVA 1X8LA 2CB0A 5K05A 3QU2A 2NUPA 3PPIA 1DUIA 1GDHA 2WLNA 4N54A 1XLTA 3T41A 2PWZA 2P9YA 5L7WA 3SZGA 3VH4A 5B7NA 2YJ4A 1DWPA 2COEA 3MBMA 1CVRA 3D01A 3BWDD 1FMTA 2W2VA 4HAVA 4QJIA 2W6QA 5T6BA 4IUYA 3ENKA 4RHEA 5BW5A 4EKNB 3KLBA 5F1PA 4R9VA 4TRNA 3KKZA 2A9QA 4IHAA 4CH6A 2R87A 3BXZA 3O31A 1IURA 4QTXA 4ZT2A 1SC6A 1L9XA 3VQWA 3QPCA 4KBGA 4PIPA 1VQ8F 5IT4A 4H3HB 1OLOA 3GVXA 3VR6H 4KQCA 4D3FA 2AD5A 2JIZA 2LGWA 3HTXA 1PZFA 1EGVB 1P7ZA 3N05A 3W6NA 3JD3A 4E4YA 1T0BA 3DBVO 2CFRA 4BASA 1RAHA 3K0SA 5FBHA 1YV9A 2D5BA 2HUNA 3HH8A 5IU6A 1ZWLA 2A5LA 4XD2A 4CGZA 3A6HA 4EKWA 4R7ZA 1RC1A 1VG9B 2C94A 2RB5A 2CZCA 3UAZA 1BMFA 2QTZA 3LWPC 2CN1A 1VYUA 1GUDA 4I81A 3MOGA 1Z6TA 4IRMA 1DXOA 3QBJA 1SXGA 4JX9A 5CURA 1TADA 5LGTA 2Q3FA 4NI5A 1E1YA 2NTEA 3LNNA 2XZPA 1NGSA 5KSYA 3RUPA 3OMIB 4ZVNA 1FYDA 2G8NA 2CL0X 3PLNA 3CCMF 1NM5A 5CRIA 1GM9A 1PJ8A 5FNZA 2R1VB 5ENZA 1FFYA 5JDIC 1IZYA 4NARA 1Y5MA 1YB4A 4O4IF 4BPRA 4NZMA 1IC6A 5FOXA 5FPQA 3N59A 5BMOA 3BWYA 2XIJA 4ZVVA 2X0JA 4JIGA 2QJRA 2GHIA 1C30B 5GGYA 4RD0A 3T7DA 3IAXA 3ABZA 1G8MA 3B20A 5L6MB 4JUDX 2F1HA 5CDSA 1T0KB 2B5UA 3JRWA 4NH4A 1N0NA 3B1YA 1A9PA 5EKUA 3GRKA 1LPBB 3G1UA 4GX5A 1NYTA 4XOUA 3QP9A 5G1NA 5MFZA 4UDYX 1TM7E 1XZLA 1RP3B 1X7OA 4R8RA 1W8DA 5B37A 1IPFA 1G8SA 2BCCH 3V2GA 2W9XA 3CXCF 1S7GA 3IODA 3Q7TA 1E1CA 2G77B 3PSAA 2X2OA 2H1HA 1CCWA 4DHWA 3ZVLA 1WJGA 1GITA 2EZUA 3U80A 2H9YA 3M4ZA 1T8WA 4CTNA 1Q1NA 1N9GB 4QYMA 5B6IA 2YIDA 1IPAA 2FR1A 2E5FA 1JLKA 4PA4A 2G06A 4DL9A 2BFCA 3B9QA 3HG7A 5C4IA 3AVUA 1Y74B 4UCQA 2R6ZA 1X3LA 3SJZA 4XGNA 3TPZA 4F5YA 1SU8A 4E1VA 3LLCA 3P3PA 2JJQA 1CQPA 4ZALA 3SPCA 5EP1A 1A9ZA 3ZP4A 4JI4O 4K9LA 4TYNA 3ITEA 1T1RA 3IVGA 5DBFA 4HHEA 3TSYA 4D4KA 5IHXA 1KEPA 1GVNB 4JI8O 3ESJA 1NA5A 5AOBA 1SELA 1R6DA 3NHKA 2HA4A 5LQUA 3HKEA 1D6SA 5AI5A 4NPCA 3I62A 3IT1A 5K3OA 1CD5A 2CTPA 3GLFE 5DI9A 1VKJA 2BT4A 3N0XA 1GU1A 1M7BA 2JGFA 4ZEWA 2YFHA 3F6CA 4JUAA 2C4TA 3EIEA 3VHQA 1P7BA 2ZULA 2ZJ8A 1LVUA 3G2JA 3W2GA 3QOWA 4EKGA 3CX4A 3H5IA 4J3FA 1CWUA 3VTAA 1SC9A 4V0QA 1VMGA 5K0EA 1RKXA 1EK5A 3MWFA 3I9V6 4FEGA 5CA0F 2WWIA 4HDRA 4RPIA 4BVAA 1X52A 4EFBA 3HV2A 3JQ7B 4IGGA 3ZQUA 1KU9A 2QN8A 1NR1A 3AXTA 5DFAA 3SCZA 2ORVA 5A1TA 3CEJA 1NSTA 3QHDA 1GGHA 4KAXA 2V4DA 3ZOKA 3KZCA 1E0JA 2PX3A 3HZHA 4H0CA 4S0ZA 4YV2A 4A2QA 2XKAA 3M2TA 3WXBA 4B6PA 2CLCX 4PBTA 2EFJA 2XUFA 4GNKA 4I0XA 2QWXA 3JYLA 3WGMA 3H1JH 5KDOA 3FZQA 3COPA 5JHGB 2WJPA 3TN7A 5HHTA 2FFQA 3H4TA 3TFOA 4DW1A 1VIDA 5E7QA 4UVAA 2J5XA 5HUHA 3H8VA 3DCIA 1X2EA 1N34B 3G3EA 4G1BA 4CKYA 4DDVA 3IGFA 2YTZA 3AR7A 2HJ9A 2CE2X 1XQWA 4OHBA 4CKCA 3GLHB 3ROFA 3ZXIA 1X7YB 3TZCA 4PG7A 4HQ6A 1ISMA 3L8HA 3ZHYA 4K03A 4B6EA 1LW6E 2PJUA 3LVQE 4C6HA 4H37A 3H1LH 1BDIA 4PA3A 1XB2A 1WUYA 3BCUA 4YPOA 5CX4A 2QE6A 2I7XA 1RHKA 5B3AA 2FN7A 1KZGB 4MIYA 3DWGA 4PDLA 1U4NA 4RXTA 5AW8A 3DC2A 2Q7GA 1G8GA 1NASA 2ZLBA 2QRGA 1BSVA 3MTGA 3K9GA 1UPXA 5DK4A 1ZK0A 3CYOA 3BVOA 2BPOA 4KXRA 2NNUA 2H7CA 4WT7A 4R7GA 5K8JB 5DBHX 4JT4A 1QIEA 2Y9MB 4CI9A 2RBGA 5C80A 2DUUA 4PGGA 5E4TA 3Q6MA 1WE2A 3KJJA 2M1ZA 3OJEA 2C95A 5DKFA 1YSCA 1ICEA 2MYTA 3ZHXA 3AETB 3VYSC 4UREA 5DK6A 2RBEA 1GUZA 2GVZC 3IP9A 5IUKC 5ESRA 3TJMA 2Y48A 3U0ZA 3V97A 1PNOA 3Q3JB 2OM2A 2G80A 5DHRA 4YMUA 3PGVA 2QMEA 3U56A 3BHMA 3R0PA 1QO0D 2V7BA 4PY2A 2J3LA 2E4UA 1U90A 4ZGGA 5ELMA 3G2KA 1WABA 3OKAA 5CLLA 1XJWA 2H8EA 1BWQA 4NG4A 5C7LO 5LOVF 1YJ5A 1CR6A 4WCVA 3PDCA 4GUAA 4CTOA 4PAQA 2CJFA 5KYVA 3ZU6A 3CJQA 2PX8A 4DJ5X 4S3MA 2FFBA 3TTYA 4KXWA 1OV6A 1VJTA 3PQ6A 2PUBA 4XWGA 3PQDA 1EM6A 3OP4A 3UCEA 4UV9A 1FFSA 4C0HA 2ZETA 3KT0A 5EIOA 1NQVA 4E07A 4F7WA 3IHWA 1JYFA 1AIPA 4FDAA 1K33A 5K20A 1WPQA 4H31A 3PTLA 1GARA 5HKAA 5J47A 3GD7A 4MI6A 5JJEB 2DPHA 4E3WA 3OT1B 1XJ5A 1NNUA 4C14A 1WUKS 1HLFA 1W85B 1SK8A 2JF0A 1GPH1 2AKYA 3CONA 4G4XA 4IJKA 1RQRA 5L3GA 4Z7NB 2WB4A 1TPYA 1VDMA 1E2QA 4H7KA 2JI8A 5TGDA 5KC9A 1Y3FE 3C4VA 1PFUA 1R1MA 1SXJE 5EGNA 2P41A 4LHWA 2X6CA 4AP9A 5IAGA 2JRIA 1D6MA 4PNHA 2PS3A 4CM3A 5JSHA 4W5NA 4JI3O 2ZT8A 2WLLB 4N5NA 3GLTA 1H4VB 3LYAA 3CQ9A 5KTYA 4W5OA 2X1VA 2UXDB 4BVEA 3L72H 3JTMA 5JSUA 2DQSA 3ZQKA 1VQ1A 4XQ0A 2OFFA 2WR8A 2CMHA 1NN3A 2JFQA 4HUQB 4IEEA 1O4VA 3QENA 4FYPA 3QIVA 3RJMA 1R50A 1VCIA 3DL4A 3R0ZA 4YRCA 1LVGA 2ZS7A 1KBZA 1JLSA 3ZV5A 2WKSA 2JFWA 2YIAA 4JP8A 3ESRA 2FCAA 3SVTA 2Q07A 2G0NA 1FY2A 4NE7A 1EXMA 3P0HA 4J80A 1IUOA 4MV8A 2WHXA 1EYZA 2AFHB 3CUEF 3UUEA 3I30X 3JQGB 3EEOA 5B4UA 1X3SA 4YN3A 5AOVA 1PG0A 4KR9A 1EDZA 4L28A 2B9VA 1CUFA 1BCRA 3FZEA 3PGLA 4HEJA 2YQZA 4EHDA 1KMHA 2MMGA 3AIIA 4TXMA 1KU0A 3CH7A 1NBWB 1RXWA 1D2DA 4UMDA 2X0KA 1B0PA 4EX7A 4QTUB 1NTOA 5I9IA 1W4ZA 4ZP1A 4PN3A 1U0HC 3TCXB 821PA 5TS2A 1DLIA 1M57B 2F17A 1UWCA 3VC1A 2XVAA 3ZY2A 1HR0B 1M8FA 2JFFA 5F1OA 4B82A 3SPJA 2Z3VA 2DQ3A 2EC5A 2PMCA 2VYND 1M6NA 3LLMA 5AKZA 2OZBA 3IULA 3TSZA 3FWYA 4OUDB 4F84A 1CUEA 2YZGA 4GM4A 3A9CA 5FBLB 4BFZA 4QYTA 1U5CA 4C01A 5I45A 3FSGD 5IAJA 3LLVA 3TLEA 4WLNA 1XEQA 1Z22A 3UO3A 1L7DA 1L7BA 2IKSA 4IKPA 2ZWAA 1L4HA 1KRWA 5ARCA 3HKBA 3TL3A 4BNZA 1TIPA 1CW2B 2XNHA 3DVLA 4G84A 4L22A 2VYVD 3JALB 2MIIA 2UYKA 4EG5A 3RG2A 4M6WA 3KR0A 4V1CI 1RCTE 4CQMA 5DDIP 2P4QA 3DV0B 4FEYA 4ZJYA 3SIUA 3W2IA 4PEVA 3QTCA 2CY0A 2B8JA 2OBLA 3OPYB 1IQ0A 3PLAC 2LFRA 1FSFA 2ZYSA 4QA9A 4XKJA 1QVRA 3Q5GA 1HRDA 5G4KB 3A6FA 2GI4A 1CUUA 4UNPA 4NNOA 3L5OA 1PR1A 3SP1A 3KOXA 4QGGA 1O5OA 3QSGA 2IHKA 2BKXA 2HBYA 2XMZA 5C5IA 2P40A 5IPFA 1HW7A 1G7SA 3OEHA 1FZQA 5AVTA 1Z6XA 1TZMA 1CB0A 2RKWA 4RHFA 1OA1A 4KO2S 4GYYA 1TVKA 3SQLA 3I05A 3LBIA 1SG0A 2W8BA 3JXEA 2QT0A 1AKUA 3C3JA 3N6XA 4QGFA 1DX4A 2ITCC 4HRXA 3MGGA 3C97A 2ZWIA 3IGAC 1SQ6A 1VQ5V 2PSHA 3OZ7A 3KDAA 3T1CA 4EJFA 3Q2KA 5LQRA 1JVNA 3H6KA 3TLMA 4MS2A 3ZBPA 3S0WA 2GASA 3CKMA 3R6TA 3G2HA 1OFGA 3DUFA 3AU8A 2ATEA 3I53A 4DA4A 1VL5A 1B15A 3RCBA 1VI6A 1O96A 3CF0A 2JAQA 1NP6A 2QZ4A 3U7HB 4J16A 3HE3A 3AJ9A 3QHAA 1NXQA 2XWSA 1P45A 2BF4A 4NCNA 1XAIA 2R6DA 1XNHA 2NIPA 4ZIRA 2VCYA 5HFAA 1PNRA 3AM4A 3RVMA 2IDMA 3OJ0A 2D0IA 1TYEB 4W1PA 1PVDA 1R3KC 2VNJA 1TJ3A 2I7TA 4WERA 3REQA 2XCTB 5ELXA 4X88A 2OD7A 1QG2A 3ELUA 2C8JA 5EHQA 1NVUQ 2O2JA 2V7EA 1QDEA 1ECGA 4W7IA 1D2RA 3BWCA 1U0EA 1KYTA 3NT5A 2GJ9A 1OUMA 1ADCA 4M0PA 2P9FA 1Q1ZA 4MYDA 1XO1A 1AHIA 5ITZA 2A9HA 1RLGA 4B08A 1JDTA 1NPTO 3UO8B 2B1IA 2I2DA 5CITA 1UWKA 4KAFA 5KKAA 1F5SA 4IIHA 4J7UA 1PJLA 4ARZA 3JARB 1OX6A 4Q1DA 5FI0B 2YEVA 2W2LD 3CMAF 1SHTX 2H4YA 2QVBA 3IIKA 3S3TA 2B7BA 3TZEA 3QF4B 3QVNA 3MWYW 3WL6A 4M88A 4L1KA 4EEQA 2ZNIA 2CL7X 3TPCA 1Y0BA 2EW8A 3IELA 4CKZA 5E1BA 3OMAB 1YFZA 4O33A 4KRGA 4MV6A 5P8WA 2PQ0A 3LYUA 3E7WA 1QYCA 2LP4Y 1IBKO 4XM1A 1NI4A 4A91A 3I23A 3KYJB 3FROA 2QQ0A 3CUWA 2L6LA 1LPAB 4OP1A 3RREA 1NWCA 1UBTS 2PH3A 2GTIA 2D5AA 1J06A 4IIFA 2HCTA 4YLEA 2ZTVA 2A92A 5HDBB 4D44A 2AEEA 5JSZB 3LY7A 5IJZA 3GDFA 1V6SA 5EP3A 3NBYC 2Z5VA 4RWUA 2G5TA 3PHCA 2WTEA 4F1KA 9LDTA 2D74A 3L1VA 3PE4A 4OJYA 4XYBA 4JLPA 1XTTA 5AWFC 3T94A 2IOFK 3Q7PA 4Q37A 4RDIA 3QUQA 2IU6A 4RE6A 4FEAA 1VCMA 2CJXA 4PIMA 1B73A 2Z8XA 3B4SA 3R0JA 3K5LA 3SFTA 4MOWA 3SYQA 2CMKA 3TZKA 2PPLA 3DC5A 4U5QA 4URYR 4MQEB 3N7AA 4BATA 2HHLA 2VAVA 3BILA 4ZI7A 4FONA 2AS0A 1SUAA 1GL6A 2QDXA 3AEZA 4ZGWA 2V7PA 1N1DA 1G2IA 1REQB 3EXHC 1E3JA 5J5VA 1GZ4A 1VMKA 3G2PA 2H4FA 3IKJA 3K2QA 1SFRA 3N75A 4NPAA 1Q7TA 5HG0A 2X8WA 1ADGA 1Z6AA 1N1GA 3FOWA 4LJ7A 1PUIA 3PA8A 3ZZTA 2WICA 4LRSB 2N1MA 3W4KA 4O8ZA 2E0IA 4DRXA 1JHAA 4X3OA 4ABTA 2G1AA 1PVOA 4GLXA 2WYWA 5L3QB 2QNIA 4GBED 2IZOA 3O84A 4BC0A 4PZPA 3AH8A 3LU1A 3QO8A 1ZD8A 1C5KA 1RWWA 2KB1A 1TF5A 3DMFA 4CGYA 5KO2A 2V4MA 3RM3A 4XPZA 1M1KW 4II2A 2BDUA 5HF9A 2IU0A 5TR9A 1FFTB 5F4BA 2HO5A 1L4GA 1PEYA 5B6JA 2E87A 4RNDB 4MX8A 3GPLA 2OE2A 2WD8A 2CC2A 1L5QA 2LIPA 1MOPA 1N92A 5DEIA 4D5EA 3WKBA 4QGPA 1XRRA 4I9NA 1XSEA 1KTVA 4PO1A 4IIDA 1W9MA 3BRSA 4RTRA 1XCBA 2RGGA 3R20A 1UOEA 4LECA 1PF5A 2VK8A 2HCJB 5ALEA 3JVDA 2EW2A 5L3CA 2XAUA 5BN1A 5KSPA 4R3UC 1E2LA 1CJBA 1I1OA 3VPCA 4TQUS 1D1SA 4JZGA 1Q19A 5EZYF 3PA6A 2FQXA 3W1WA 2I6UA 1P2TA 3PWKA 4FT2A 4EJMA 3A2LA 3TGLA 1NF9A 1KO1A 1Q14A 5CB8A 3PTAA 3A9UA 2JAUA 5AKJA 1G7CA 1QAQA 4PD4F 2GAAA 2Z2ZA 2Z1FA 4YMVA 3LDCA 2FB5A 5IDXA 1T6XA 2IYFA 1BMFG 1L5NA 4Y67A 2V6GA 3RFTA 3ILYA 3ABQB 3KOZA 1G5QA 3KL2A 2RMKB 4B33A 3IQFA 4LFAO 4KR2A 3IEWA 3H2IA 3G89A 3T3EA 1U3FA 3L77A 4V0KA 1CUYA 1AKTA 3W05A 3SK0A 3LYBA 5ALUA 2QLFA 4GPD1 1Q8IA 4L5AA 5C8YA 3NIDB 4K8ZA 1ZCJA 4RDCA 1GFSA 3AJDA 5HY2A 1XR3A 4ND5A 3V7WA 4P30A 1WCIB 1PL0A 1RRKA 5HY1A 4GC9A 4L9AA 2E37A 4GYWA 5B7GA 1UBNA 4HUTA 3QXCA 3ZCXA 1MP0A 4O4HB 4Q3EA 5A3VA 1QV7A 3CRQA 3ABLB 1XVLA 4CMGA 4LY3A 1U0LA 3CYQA 1AV7A 2AW3A 2WP8J 1IXZA 2I5PO 4TXHA 3DGFC 2ORIA 3T7EA 4MAFA 4HSGA 3MJCA 2BFDA 2H2AA 2HKIA 2Q5HA 5CBPA 3CF6R 4CMKA 1K8ZB 3CCRF 1JIJA 1GNQA 5B2FA 2GJAA 3OWOA 2DETA 4KXQA 4WZAB 4BB9A 4O2BA 5LCXA 2D3OW 1UPFA 3G5MA 5EIAA 4F4JA 3QNUA 4INAA 2IQIA 1CJVC 3MCWA 3BC1A 5T4BA 3VU3A 4F7DA 2VPQA 5MN6A 1FXWF 1DEHA 4LMRA 3LQ1A 4Y2HA 3E89A 4URFA 1D4FA 2PN1A 2I33A 2QYHA 2XOEA 2GCGA 1FSPA 1FNCA 2AR0A 4A10A 5FO1A 5KU7A 3LWDA 4FPXA 4P4SB 4IOMA 2EG5A 2JH3A 1MFZA 2PI4A 1HZJA 3L05A 3UAYA 1H94A 2I2CA 3TECE 1E2FA 2WAXA 3ZXXA 1PKXA 4OIFA 1Q11A 3RI3A 3SU8A 1JFTA 3EUWA 2OBYA 2YICA 2ZDHA 4JQOA 3LHFA 2BTQB 4KFMA 3HB1A 2A33A 1ESMA 2RGUA 4BIIA 1WB4A 4L0DA 1GGMA 3TXQA 1WVIA 1VL0A 2UVDA 3RJ9A 3KTDA 5DNYB 2Q9LA 2V4UA 3TZLA 3W5UA 3GLVA 1PYOA 2IE8A 1F4NA 1ODTC 4TRJA 3CCEF 1GRQA 4E08A 4FW9A 2I1QA 5I9BA 3ISTA 3FMOB 4W5RA 1G98A 3KE8A 4I4TF 5DBOA 2DPLA 5KHLB 1LBTA 1DIGA 3O91A 5JNTA 1GSAA 3TBFA 3RTBA 5GM1A 1VHJA 1E99A 2CAZC 2PFSA 2B6NA 2R2AA 3OCUA