The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
33
|
sequence length |
131
|
structure length |
131
|
Chain Sequence |
MAVNVYSTSVTSENLSRHDMLAWVNDSLHLNYTKIEQLCSGAAYCQFMDMLFPGCVHLRKVKFQAKLEHEYIHNFKVLQAAFKKMGVDKIIPVEKLVKGKFQDNFEFIQWFKKFFDANYDGKDYNPLLARQ
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule keywords |
Tubulin alpha-1B chain
|
publication title |
Mechanistic Origin of Microtubule Dynamic Instability and Its Modulation by EB Proteins.
pubmed doi rcsb |
source organism |
Homo sapiens
|
molecule tags |
Structural protein
|
total genus |
33
|
structure length |
131
|
sequence length |
131
|
chains with identical sequence |
N
|
ec nomenclature | |
pdb deposition date | 2015-06-19 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
M | PF00307 | CH | Calponin homology (CH) domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Orthogonal Bundle | Actin-binding Protein, T-fimbrin; domain 1 | Calponin-like domain |
#chains in the Genus database with same CATH superfamily 2R8U A; 1MB8 A; 2E9K A; 5A4B A; 3REP B; 2D88 A; 1AA2 A; 1H67 A; 4Q57 B; 1SH5 A; 3F7P A; 1SH6 A; 1VKA A; 1QAG A; 2L3G A; 4B7L A; 2YRN A; 1WYM A; 2VZC A; 3KMW B; 4Q58 A; 2JV9 A; 2D85 A; 1DXX A; 1WJO A; 1V5K A; 2QJZ A; 2K2R A; 1WYN A; 4TXI A; 2EYN A; 2DK9 A; 3JAK M; 2D86 A; 3HOP A; 3HOC A; 3I6X A; 1AOA A; 1PXY A; 2WA6 A; 2D89 A; 3JAL M; 2EYI A; 1P2X A; 3CO1 A; 2VZD A; 3HOR A; 5BVR A; 1WYP A; 1RT8 A; 1WYL A; 2VZI B; 5A37 A; 1WYR A; 2R0O A; 1WIX A; 2WFN A; 1WYQ A; 4TXK A; 5A36 A; 5J8E A; 2VZG B; 2RR8 A; 1UJO A; 2D87 A; 2EE7 A; 1BHD A; 5A38 A; 1UEG A; 2WA7 A; 2K3S A; 1WKU A; 3FER A; 4EDN A; 1PA7 A; 3KMU B; 4Q59 A; 1WYO A; 2WA5 A; 2QJX A; 1BKR A; 1TJT A; 3JAR M; 5L0O A; 4EDM A; 4EDL A; 1P5S A; 3KY9 A; #chains in the Genus database with same CATH topology 2R8U A; 1MB8 A; 2E9K A; 2WDT A; 5A4B A; 3REP B; 2D88 A; 1AA2 A; 1H67 A; 4Q57 B; 1SH5 A; 2HL9 A; 3F7P A; 3VP7 A; 1SH6 A; 1VKA A; 1QAG A; 2L3G A; 4LVR A; 4B7L A; 2VE7 A; 2YRN A; 1WYM A; 2VZC A; 3KMW B; 3EAY A; 2JV9 A; 4Q58 A; 2D85 A; 1DXX A; 2EQO A; 2HL8 A; 2WE6 A; 2HKP A; 1WJO A; 1V5K A; 2QJZ A; 2K2R A; 1WYN A; 1EUV A; 4TXI A; 2EYN A; 4LVP A; 5FMU A; 2DK9 A; 3JAK M; 2D86 A; 3HOP A; 3HOC A; 1AOA A; 1PXY A; 2WA6 A; 4DDP A; 2D89 A; 3JAL M; 2EYI A; 1P2X A; 3CO1 A; 2VZD A; 3HOR A; 5BVR A; 1WYP A; 1RT8 A; 1WYL A; 2VZI B; 5A37 A; 1WYR A; 2R0O A; 1WIX A; 2WFN A; 1WYQ A; 4TXK A; 5A36 A; 5J8E A; 2VZG B; 2RR8 A; 1UJO A; 2D87 A; 2EE7 A; 1BHD A; 5A38 A; 1UEG A; 2WA7 A; 5FMT A; 2K3S A; 1WKU A; 3KY9 A; 3FER A; 2VE7 C; 4EDN A; 1PA7 A; 3KMU B; 4Q59 A; 1WYO A; 2WA5 A; 2IGP A; 2QJX A; 1BKR A; 1TJT A; 3JAR M; 5L0O A; 4EDM A; 4EDL A; 1P5S A; 3I6X A; #chains in the Genus database with same CATH homology 2R8U A; 1MB8 A; 2E9K A; 5A4B A; 3REP B; 2D88 A; 1AA2 A; 1H67 A; 4Q57 B; 1SH5 A; 3F7P A; 1SH6 A; 1VKA A; 1QAG A; 2L3G A; 4B7L A; 2YRN A; 1WYM A; 2VZC A; 3KMW B; 4Q58 A; 2JV9 A; 2D85 A; 1DXX A; 1WJO A; 1V5K A; 2QJZ A; 2K2R A; 1WYN A; 4TXI A; 2EYN A; 2DK9 A; 3JAK M; 2D86 A; 3HOP A; 3HOC A; 3I6X A; 1AOA A; 1PXY A; 2WA6 A; 2D89 A; 3JAL M; 2EYI A; 1P2X A; 3CO1 A; 2VZD A; 3HOR A; 5BVR A; 1WYP A; 1RT8 A; 1WYL A; 2VZI B; 5A37 A; 1WYR A; 2R0O A; 1WIX A; 2WFN A; 1WYQ A; 4TXK A; 5A36 A; 5J8E A; 2VZG B; 2RR8 A; 1UJO A; 2D87 A; 2EE7 A; 1BHD A; 5A38 A; 1UEG A; 2WA7 A; 2K3S A; 1WKU A; 3FER A; 4EDN A; 1PA7 A; 3KMU B; 4Q59 A; 1WYO A; 2WA5 A; 2QJX A; 1BKR A; 1TJT A; 3JAR M; 5L0O A; 4EDM A; 4EDL A; 1P5S A; 3KY9 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...