3JARM

Cryo-em structure of gdp-microtubule co-polymerized with eb3
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
131
structure length
131
Chain Sequence
MAVNVYSTSVTSENLSRHDMLAWVNDSLHLNYTKIEQLCSGAAYCQFMDMLFPGCVHLRKVKFQAKLEHEYIHNFKVLQAAFKKMGVDKIIPVEKLVKGKFQDNFEFIQWFKKFFDANYDGKDYNPLLARQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tubulin alpha-1B chain
publication title Mechanistic Origin of Microtubule Dynamic Instability and Its Modulation by EB Proteins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 33
structure length 131
sequence length 131
chains with identical sequence N
ec nomenclature
pdb deposition date 2015-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00307 CH Calponin homology (CH) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.418.10 Mainly Alpha Orthogonal Bundle Actin-binding Protein, T-fimbrin; domain 1 Calponin-like domain 3jarM00
2R8UA 1MB8A 2E9KA 5A4BA 3REPB 2D88A 1AA2A 1H67A 4Q57B 1SH5A 3F7PA 1SH6A 1VKAA 1QAGA 2L3GA 4B7LA 2YRNA 1WYMA 2VZCA 3KMWB 4Q58A 2JV9A 2D85A 1DXXA 1WJOA 1V5KA 2QJZA 2K2RA 1WYNA 4TXIA 2EYNA 2DK9A 3JAKM 2D86A 3HOPA 3HOCA 3I6XA 1AOAA 1PXYA 2WA6A 2D89A 3JALM 2EYIA 1P2XA 3CO1A 2VZDA 3HORA 5BVRA 1WYPA 1RT8A 1WYLA 2VZIB 5A37A 1WYRA 2R0OA 1WIXA 2WFNA 1WYQA 4TXKA 5A36A 5J8EA 2VZGB 2RR8A 1UJOA 2D87A 2EE7A 1BHDA 5A38A 1UEGA 2WA7A 2K3SA 1WKUA 3FERA 4EDNA 1PA7A 3KMUB 4Q59A 1WYOA 2WA5A 2QJXA 1BKRA 1TJTA 3JARM 5L0OA 4EDMA 4EDLA 1P5SA 3KY9A
chains in the Genus database with same CATH superfamily
2R8UA 1MB8A 2E9KA 2WDTA 5A4BA 3REPB 2D88A 1AA2A 1H67A 4Q57B 1SH5A 2HL9A 3F7PA 3VP7A 1SH6A 1VKAA 1QAGA 2L3GA 4LVRA 4B7LA 2VE7A 2YRNA 1WYMA 2VZCA 3KMWB 3EAYA 2JV9A 4Q58A 2D85A 1DXXA 2EQOA 2HL8A 2WE6A 2HKPA 1WJOA 1V5KA 2QJZA 2K2RA 1WYNA 1EUVA 4TXIA 2EYNA 4LVPA 5FMUA 2DK9A 3JAKM 2D86A 3HOPA 3HOCA 1AOAA 1PXYA 2WA6A 4DDPA 2D89A 3JALM 2EYIA 1P2XA 3CO1A 2VZDA 3HORA 5BVRA 1WYPA 1RT8A 1WYLA 2VZIB 5A37A 1WYRA 2R0OA 1WIXA 2WFNA 1WYQA 4TXKA 5A36A 5J8EA 2VZGB 2RR8A 1UJOA 2D87A 2EE7A 1BHDA 5A38A 1UEGA 2WA7A 5FMTA 2K3SA 1WKUA 3KY9A 3FERA 2VE7C 4EDNA 1PA7A 3KMUB 4Q59A 1WYOA 2WA5A 2IGPA 2QJXA 1BKRA 1TJTA 3JARM 5L0OA 4EDMA 4EDLA 1P5SA 3I6XA
chains in the Genus database with same CATH topology
2R8UA 1MB8A 2E9KA 5A4BA 3REPB 2D88A 1AA2A 1H67A 4Q57B 1SH5A 3F7PA 1SH6A 1VKAA 1QAGA 2L3GA 4B7LA 2YRNA 1WYMA 2VZCA 3KMWB 4Q58A 2JV9A 2D85A 1DXXA 1WJOA 1V5KA 2QJZA 2K2RA 1WYNA 4TXIA 2EYNA 2DK9A 3JAKM 2D86A 3HOPA 3HOCA 3I6XA 1AOAA 1PXYA 2WA6A 2D89A 3JALM 2EYIA 1P2XA 3CO1A 2VZDA 3HORA 5BVRA 1WYPA 1RT8A 1WYLA 2VZIB 5A37A 1WYRA 2R0OA 1WIXA 2WFNA 1WYQA 4TXKA 5A36A 5J8EA 2VZGB 2RR8A 1UJOA 2D87A 2EE7A 1BHDA 5A38A 1UEGA 2WA7A 2K3SA 1WKUA 3FERA 4EDNA 1PA7A 3KMUB 4Q59A 1WYOA 2WA5A 2QJXA 1BKRA 1TJTA 3JARM 5L0OA 4EDMA 4EDLA 1P5SA 3KY9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R8U A;  1MB8 A;  2E9K A;  5A4B A;  3REP B;  2D88 A;  1AA2 A;  1H67 A;  4Q57 B;  1SH5 A;  3F7P A;  1SH6 A;  1VKA A;  1QAG A;  2L3G A;  4B7L A;  2YRN A;  1WYM A;  2VZC A;  3KMW B;  4Q58 A;  2JV9 A;  2D85 A;  1DXX A;  1WJO A;  1V5K A;  2QJZ A;  2K2R A;  1WYN A;  4TXI A;  2EYN A;  2DK9 A;  3JAK M;  2D86 A;  3HOP A;  3HOC A;  3I6X A;  1AOA A;  1PXY A;  2WA6 A;  2D89 A;  3JAL M;  2EYI A;  1P2X A;  3CO1 A;  2VZD A;  3HOR A;  5BVR A;  1WYP A;  1RT8 A;  1WYL A;  2VZI B;  5A37 A;  1WYR A;  2R0O A;  1WIX A;  2WFN A;  1WYQ A;  4TXK A;  5A36 A;  5J8E A;  2VZG B;  2RR8 A;  1UJO A;  2D87 A;  2EE7 A;  1BHD A;  5A38 A;  1UEG A;  2WA7 A;  2K3S A;  1WKU A;  3FER A;  4EDN A;  1PA7 A;  3KMU B;  4Q59 A;  1WYO A;  2WA5 A;  2QJX A;  1BKR A;  1TJT A;  3JAR M;  5L0O A;  4EDM A;  4EDL A;  1P5S A;  3KY9 A; 
#chains in the Genus database with same CATH topology
 2R8U A;  1MB8 A;  2E9K A;  2WDT A;  5A4B A;  3REP B;  2D88 A;  1AA2 A;  1H67 A;  4Q57 B;  1SH5 A;  2HL9 A;  3F7P A;  3VP7 A;  1SH6 A;  1VKA A;  1QAG A;  2L3G A;  4LVR A;  4B7L A;  2VE7 A;  2YRN A;  1WYM A;  2VZC A;  3KMW B;  3EAY A;  2JV9 A;  4Q58 A;  2D85 A;  1DXX A;  2EQO A;  2HL8 A;  2WE6 A;  2HKP A;  1WJO A;  1V5K A;  2QJZ A;  2K2R A;  1WYN A;  1EUV A;  4TXI A;  2EYN A;  4LVP A;  5FMU A;  2DK9 A;  3JAK M;  2D86 A;  3HOP A;  3HOC A;  1AOA A;  1PXY A;  2WA6 A;  4DDP A;  2D89 A;  3JAL M;  2EYI A;  1P2X A;  3CO1 A;  2VZD A;  3HOR A;  5BVR A;  1WYP A;  1RT8 A;  1WYL A;  2VZI B;  5A37 A;  1WYR A;  2R0O A;  1WIX A;  2WFN A;  1WYQ A;  4TXK A;  5A36 A;  5J8E A;  2VZG B;  2RR8 A;  1UJO A;  2D87 A;  2EE7 A;  1BHD A;  5A38 A;  1UEG A;  2WA7 A;  5FMT A;  2K3S A;  1WKU A;  3KY9 A;  3FER A;  2VE7 C;  4EDN A;  1PA7 A;  3KMU B;  4Q59 A;  1WYO A;  2WA5 A;  2IGP A;  2QJX A;  1BKR A;  1TJT A;  3JAR M;  5L0O A;  4EDM A;  4EDL A;  1P5S A;  3I6X A; 
#chains in the Genus database with same CATH homology
 2R8U A;  1MB8 A;  2E9K A;  5A4B A;  3REP B;  2D88 A;  1AA2 A;  1H67 A;  4Q57 B;  1SH5 A;  3F7P A;  1SH6 A;  1VKA A;  1QAG A;  2L3G A;  4B7L A;  2YRN A;  1WYM A;  2VZC A;  3KMW B;  4Q58 A;  2JV9 A;  2D85 A;  1DXX A;  1WJO A;  1V5K A;  2QJZ A;  2K2R A;  1WYN A;  4TXI A;  2EYN A;  2DK9 A;  3JAK M;  2D86 A;  3HOP A;  3HOC A;  3I6X A;  1AOA A;  1PXY A;  2WA6 A;  2D89 A;  3JAL M;  2EYI A;  1P2X A;  3CO1 A;  2VZD A;  3HOR A;  5BVR A;  1WYP A;  1RT8 A;  1WYL A;  2VZI B;  5A37 A;  1WYR A;  2R0O A;  1WIX A;  2WFN A;  1WYQ A;  4TXK A;  5A36 A;  5J8E A;  2VZG B;  2RR8 A;  1UJO A;  2D87 A;  2EE7 A;  1BHD A;  5A38 A;  1UEG A;  2WA7 A;  2K3S A;  1WKU A;  3FER A;  4EDN A;  1PA7 A;  3KMU B;  4Q59 A;  1WYO A;  2WA5 A;  2QJX A;  1BKR A;  1TJT A;  3JAR M;  5L0O A;  4EDM A;  4EDL A;  1P5S A;  3KY9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...