3JASB

Cryo-em structure of dynamic gdp-microtubule (14 protofilaments) decorated with kinesin
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
426
structure length
426
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanistic Origin of Microtubule Dynamic Instability and Its Modulation by EB Proteins.
pubmed doi rcsb
molecule tags Structural protein
molecule keywords Tubulin alpha-1B chain
total genus 158
structure length 426
sequence length 426
chains with identical sequence D, F, G, H, I
ec nomenclature
pdb deposition date 2015-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3jasB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 3jasB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 3jasB01
5FNVA 1RQ2A 4M8IA 4TUYA 1Z5WA 4B46A 3UT5B 3JARB 5JCOC 4I50A 3JATB 2R6R1 2VAMA 3VO8A 3HKEB 1TUBB 4XCQA 5LP6A 5IJ9A 4F6RB 3JATA 4DRXB 3E22A 3JAWA 1TUBA 4O4LA 3E22B 4ZI7B 5LXTB 4O2BB 1TVKB 4YJ3A 4IHJA 4HNAA 5LYJA 4ZI7A 3RYIB 3VPAA 5CA0A 4TV8B 1RLUA 1Z5VA 3N2GA 4X20B 3VO9A 5GONA 2Q1YA 5EIBC 3ZIDA 5KX5A 5ITZA 5GONB 2RHJA 5MN4A 4DXDA 3JARA 5JH7B 4EI8A 5LOVB 3HKDB 4DRXA 4ZOLA 3WGMA 3JAKB 4FFBB 5C8YA 5EZYA 5JVDB 4FFBA 4O4JB 4F6RA 4WBNB 2GVIA 4X1KA 4WBNA 2BTQB 2Q1XA 4IIJA 5LXTA 4LNUA 1W5FA 4EB6A 2BTQA 3M89A 3RYIA 1OFUA 3CB2A 5CB4B 4X1YA 4O2AA 4EB6B 3RYFA 3N2GB 4X20A 5CA1A 4I55B 4O4IA 1FSZA 3JALB 4YJ2A 3WGNA 1JFFA 5EIBD 4ZHQB 3N2KA 1RQ7A 3JALA 2VXYA 4I4TB 5EYPA 5C8YB 5J2TA 5LOVA 4TUYB 3V3TA 4U3JB 3HKBA 5J2TB 4TV9B 3JAKA 5IJ9B 3WGLA 3WGJA 1W581 1SA0A 1W5EA 4TV9A 5LA6B 2XKAA 4O4JA 1SA0B 3ZBPA 5JQGA 3RB8A 4X1KB 4X1YB 3VOAA 4EI7A 3M8KA 5KX5B 5IYZA 5BMVB 3VOBA 4LNUB 2VAWA 4I55A 4O4IB 2RHOA 5JH7A 3WGKA 1W5BA 5KMGA 3RYFB 1FFXB 3HKDA 5ITZB 4U39A 3ZBQA 3JASA 3HKEA 3R4VA 4X1IB 1FFXA 3HKCA 4O4HB 4YJ2B 2RHLA 4U3JA 5FNVB 5MN5A 3JAWB 4X1IA 4E6EA 3HKCB 4O4HA 4I4TA 5EYPB 4KWEA 4EI9A 4ZOLB 5LP6B 4O2BA 4YJ3B 5JCOA 4IHJB 5LYJB 5MN6A 3HKBB 5IJ0A 5EZYB 5LP6C 5JVDA 4IIJB 5JQGB 4O4LB 3RYHA 5IJ0B 5J2UA 5LA6A 5IYZB 1TVKA 1W59A 5CB4A 4HNAB 2RHHA 4O2AB 3RYHB 5J2UB 2BTOA 1W5AA 5CA1B 5M7EA 5CA0B 4TV8A 3RYCB 5BMVA 3C8LA 2XKBA 1JFFB 4ZHQA 2R751 2VAPA 3JASB 4B45A 3N2KB 3RYCA 3UT5A 4I50B 5KMGB
chains in the Genus database with same CATH superfamily
4F97A 1T8SA 1CY0A 2AI2A 4URYR 4P80A 5AJZA 4U6SA 4BW5A 3NM6B 5D3QA 1H85A 4YPOA 3BHPA 1NW8A 1Z0ZA 2ORED 3WFIA 3I2JA 2P9YA 2UDPA 3IC7A 1WLSA 1XEXB 3I28A 4KO4S 1V7ZA 1L4HA 2Q07A 1ZM3A 3OLXA 4D46A 2YW2A 4LYEA 4A2QA 3D02A 3T9AA 2AXEA 1OIXA 2BELA 2KBEA 1FFHA 4MS4A 5DX0A 3S2IA 1COWG 1UAAA 3H3FA 1QGAA 4HHEA 2LIPA 2XOXA 4EYSA 3X0DA 5JV5A 4HMOA 1XHEA 1ADBA 5AM2A 1SBQA 4R9VA 3EBOA 1LXCA 2PKXA 4F4LA 1JFRA 1E1YA 1T8PA 1Y37A 3B7PA 1RT9A 2Q6KA 4MVMA 1QFZA 2VH1A 1I14A 4XD7A 5CLGA 1YJCA 4BVBA 4UPEA 3I2HA 3WV5A 5KB3A 3DWIA 3QOYA 2HMSA 2QMHA 5ES4B 1EE1A 1XVTA 2AD1A 1U0JA 2OFOA 2XPCA 4RKEA 4TRJA 4HZGA 4IDBA 3TZHA 1ZWZA 1AK9A 1SB9A 2OGTA 1I4OA 3IQHX 1KOGA 2H9IA 4BFYA 3HJBA 4P0PB 4QA9A 4X61A 2GVZC 4KAFA 3Q15C 3VSBA 1AURA 1OBVA 1VGQA 2QUHA 2SKCA 3QTTA 3RH0A 1ZD4A 3OT4A 2B2XA 3LX8A 3EGOA 1TGVA 2C5GA 2Q4RA 3JW8A 1PR4A 1Y9AA 4N40A 3K0EA 1XREA 1T4CA 3QX9A 3B6NA 2QKAA 2Z5UA 1ONSA 3GG2A 3NJ8A 1HGXA 1EXWA 1EAYA 1OX4A 3HVKA 1RKBA 3I58A 3DS8A 3PPXA 3G5AA 5ALRA 5G41A 4FN4A 3TIVA 5BRJA 1XEWY 2PS3A 4EY5A 2XGJA 5CBKA 2VF4X 4DRYA 4PCUA 3PQ6A 4B31A 2C2WA 4V0ME 1RQGA 3G13A 4U4AA 5G02A 4GUNA 5DU2A 5TMEA 3KEGA 4XOIA 3JYCA 3T1HO 1BGWA 4F71A 4ZI3A 4I2NA 1NJ2A 1IHDA 2V3WA 5CT5A 1J2EA 1UK8A 2AF4C 3GFQA 4C0QC 1Q83A 3DXXA 7MHTA 3TXQA 1CWUA 4Z4HA 1P9WA 4AUNA 5LQMA 4AILC 2YX1A 2YVLA 4IH9A 4F2HA 2B3TA 4IHJF 1IWBB 3C6BA 4KW7A 1V9CA 5KQSA 2OC4A 5L6LB 1RWQA 1SZPA 1PYGA 3D4LA 2B1JA 3OOJA 4MYTA 4UUPA 2XDWA 3DEYX 5A9SB 4EO7A 2WPNA 3GN1A 2HREA 1U8XX 3K30A 4Q3LA 2QPOA 3GXBA 1EG7A 2JNWA 4ARCA 2JRLA 5M2QA 5AO9A 4OOFA 2B4YA 2IKSA 2NVBA 4UTPA 2BFEA 3TEMA 1M7HA 3BTSA 4N5LA 3KETA 4UBLA 3D0RA 1A9OA 1OR8A 5TSDA 4LF6O 2FL4A 1R64A 1V8DA 4PVDA 4KDFA 4R7TA 4RV9A 1QOZA 1C1XB 1RKVA 1UM8A 3RG2A 3PXGA 5HOEA 5DCLA 1HBJA 5MN5A 2HMVA 5D7NA 3GJ5A 4L1KA 3AQIA 5IU6A 1V71A 1V25A 3ZBUA 5BNWA 4JJEA 2R79A 5K3CA 1KFJB 1BQ0A 1Y3BE 1ENOA 2Y92A 5IXYA 4YUZA 1R0RE 1T2DA 3MAJA 2WAAA 4QDOA 3QEJA 2VF2A 1UC9A 2Z08A 4XJVA 4EW6A 2ZJZA 4RK1A 2I2BA 3IPRA 4R40A 3IC9A 2OORC 2W2QA 2WD8A 3G49A 3LY9A 2WFLA 2FWRA 4NARA 5BMOA 2FJUA 1D1QA 4UZFA 3WGTA 1G66A 1VHQA 1K68A 4OL0A 2V1UA 1XZMA 2FMIA 3VYUC 2Z9BA 1LQUA 4UXHA 3B1XA 3ND6A 1VQ7V 1J5EO 2XH8A 2NP6A 3L8YA 4ISBA 4NBWA 3DKVA 3AY3A 1YIJF 1XBIA 1SZXA 1EDDA 4DIEA 1HEIA 3AL3A 5IXSA 3ZZMA 5I5EA 4DXWA 4NTXA 1PR3A 4WJZA 2O2GA 3G5UA 5I9BA 4G26A 4N4AA 3T38A 1F4MA 2AMTA 1LBTA 1MT3A 1N5MA 2GAFA 3LBAA 3ORYA 4F84A 2I55A 2FN4A 4DSZA 3T3HA 3D6FA 4DR6B 2ZSDA 4GYKA 1JBEA 4HG2A 4PSKA 2P41A 3CM0A 1OWNA 4O4JF 2G67A 2OD9A 4JLDA 4CGYA 2YASA 3BMCB 4GXTA 1V6SA 2HBQA 4IY1A 4DM3A 2PK3A 5BN5A 3RJTA 2XMDA 1YB2A 2EERA 1K8YB 3CKKA 4KYIB 3V9AA 2AQKA 2Q28A 4NOLA 4BJHB 2O8DA 4BGIA 3N1UA 2ETNA 3VR3D 3A05A 1U2QA 4ZKIA 3OE1A 4OQNA 2ZTLA 1OWLA 2GJSA 3Q12A 4ROTA 4QT4A 3PNLA 4HNRA 5DCVA 1QMPA 2QU7A 3DEIA 3NETA 5TF0A 5JNUA 5LD2B 1NA5A 4BVQA 3CNNA 3FETA 3HB0A 1H8HD 3SHQA 3WSWA 4BKRA 1V5EA 3FNFA 1KYOF 3I9MA 4PZYA 2V55B 3UY4A 2N48A 5C7IO 3VNAA 1XR3A 4JUAA 1HYEA 2FN9A 3ETEA 4ZD6A 2GNPA 2VCHA 2VJKA 1I08A 4YUVA 8ATCA 5F9HA 2ODMA 3RUFA 3UJ8A 5BNFA 1JIIA 1N77A 1MRNA 1JA8A 3K6JA 3ZZ0A 4HQOA 2H48A 4AX4A 4X66O 3E8BA 5DWDA 1R8SA 1FDUA 3UW3A 1SEPA 1GEGA 2ZANA 5LXTA 1E6LA 2NV2B 4GH5A 4LRXA 4PW0A 5CJPA 1UOQA 3SZUA 4BWYA 3L92A 4FFVA 4Y6QA 4G88A 3A9TA 3TUZC 2ZLBA 4DK1A 3QPDA 3H1JH 1N0HA 2OYRA 4LZNA 3X2SA 3ASVA 4E2FA 1JN1A 1UOEA 3M7MX 3IX7A 3MJDA 1U2TA 1W2HA 2VBFA 4HSEA 2VNKA 5F3DA 3ZGLA 2I3BA 2WTUA 1UP4A 3E7DA 2O8CB 2ATVA 3IVAA 1I1QB 1H2EA 3HO1A 4GR4A 3UB2A 1GZ3A 2FMHA 4M22A 4L4ZA 5F4ZA 5KDDA 1Y6FA 3FR7A 4ML3A 1W40A 5JI3E 2AZXA 1CNEA 4D0SA 2YVUA 5K0GA 1V41E 5TS3A 4TV9B 1Z7BA 3LYLA 1K75A 4KSCA 3QMVA 1VQ1A 4PHGA 4X54A 1FQWA 1SU4A 3ZWXA 2GJ9A 2NU9A 1NTRA 3GP3A 4FI3C 2HPAA 4JROA 3B9PA 3NC4A 5CM2Z 1D09A 1FUKA 1JR3A 4YRDA 4CPDA 3U16A 1W7AA 1MC4A 1Y7LA 2A8YA 2FZ4A 2JD0A 2XWPA 1CETA 3GWZA 1BC5A 3DD1A 1DKMA 4PZEA 4RWEA 5EXEA 1YRAA 2PD6A 1I0IA 1L6IA 2VP4A 1M54A 2VPQA 3OT1A 4WIAA 3SU8A 4NNPA 4MPJA 4G24A 4CTNA 2W42A 3OPMA 3PDIB 3I55V 2ST1A 4NXNB 4WN9B 5B1AB 5BYJA 2ONCA 2DY0A 2R5FA 3F5DA 5T6MA 1DJOA 2BMFA 4UQOA 2NU7B 3V4OA 3VYUB 4CN9A 1AO0A 2VS1A 1DAHA 1H2MA 1I80A 4DKXA 4EW1A 5EHNA 3DPIA 3IUYA 5CW2A 4H16A 4UEQA 5AVSA 2ZBDA 5TGTA 2ZUWA 3TR0A 4C6HA 2X2FA 2XT0A 3Q0EA 4UPDA 4F60A 3GQBA 4Z0NA 3S0JA 5DFAA 3EULA 3M99B 4FXPA 4GBGA 1GZHB 2Q5HA 2AR7A 3L5KA 3DZKA 1L1QA 3AKZA 4MKXA 3K5IA 3D01A 1YFJA 1JYEA 2ZVYA 3DMTA 3KQKA 2G36A 2H4XA 4JASA 8OHMA 4DV6B 2Y1DA 1P9NA 4YROA 4IGAA 5AP9A 3TCXB 3U11A 1KJ8A 1RWKA 2C9MA 4EKWA 2HY7A 4HDSA 4XYMA 1IG3A 3NTVA 3OQIB 4EABA 4Z7NB 5MFZA 1FS4A 3U81A 5AHWA 4A0FA 5JQWA 1V4NA 4CC5A 1EFVB 3J7AC 3TSCA 4Q48A 3IR9A 1NBAA 3V7WA 2R96A 4GDFA 4G5RA 4TYQA 1R6NA 4LHSA 1VPTA 1K9SA 1J8QA 1TA0A 1H8HA 2XECA 3DTVD 4JJZA 4TTJA 1N6PA 2YOHA 3BS4A 3CRRA 4HAZA 4QOEA 1QPGA 3GFTA 2Z2JA 2GI4A 3D5EA 1Q74A 3UANA 4AP9A 1CQJA 2ZIGA 2LPMA 4P3PA 2FPRA 3G0OA 2AN3A 3B1FA 3DC7A 2QL7A 3CS5A 1YFLA 4EA8A 2Q0OC 2RBKA 1F4PA 2PBRA 1B2RA 3CKYA 4MPRA 4FVTA 4Z53A 1QCDA 1VJRA 3TLGA 5JJLA 4W5HA 3S3XA 2MU1A 1MPTA 4KHZA 3MQWA 4CEIB 1VQ9V 1M1KH 4EB0A 2LCIA 4KV7A 4JYAB 1EQUA 1ZK2A 2MSLA 1H4QA 1LK7A 3NVKI 1O97D 4LJ7A 3F0FA 1EPUA 1R8QA 2G82A 4LDPA 4PGMA 5CXXA 5F7ZA 3HVUA 4ZV7A 5CVUA 4ID9A 4DGSA 2O8BA 1ENPA 4IHQA 3MCAB 3UK6A 2O5VA 1B00A 4QQRA 3U1BA 1WO8A 4D3DA 3THOA 1PKXA 1BMTA 3BORA 3GPBA 3MHSC 1J5PA 1KXJA 1GMGA 1L5MA 1NXVA 3HB4X 3UHAA 4UC0A 4PV1B 1ID1A 2OK8A 3D54A 3SBXA 1H6AA 4RK6A 3QA9A 5FLXM 2YN2A 3ELWA 2QXUA 5EFOA 4LQLA 5BSUA 3PI6A 4B3MO 1FX0B 4Z3KA 1NJ6A 4HQKA 3DEJA 1B06A 2PUHA 4IV5A 5AHOA 1Q0ZA 2B92A 3WQSB 3W8EA 4FNMA 1S1CA 2JH9A 2IS1A 3CVOA 1NN5A 1XZGA 1EBOA 1RBQA 2X1VA 4HDCA 4KE7A 5CFQA 1SKVA 2PTGA 1SA0B 3Q5GA 2QV0A 2X9GA 4LJ9A 2POCA 4UHFA 4X1KB 1L7RA 3VKWA 3IOYA 3S2EA 2XMSA 3HC7A 4WASA 4WBSA 3WDKA 2P6MA 3UMYA 3QYFA 4UUOA 4O4IB 2CEKA 2YWGA 3H11B 2O0MA 3RS3A 4A36A 3HMQA 1R3JC 1K6IA 2JFUA 2LW7A 4PR0A 1FMJA 3SQOA 3AVUA 3BCRA 3BH6A 5HY1A 3HBAA 3O2NA 2WKQA 3NHAA 2RHLA 1C8LA 3S1AB 2D8AA 3ZD7A 3LWVC 3R0QA 4DBZA 4YREA 4EELA 2HL6A 5KNDA 3I76A 4R7CA 1XD2B 4JBNA 3O47A 1YE5A 1ZA2A 3FOFC 3I72A 2LFSA 1FYVA 2A30A 3GT4A 5E7IA 2QZPA 4MVJA 1LK0A 2OV8A 4MVJP 2ALJA 4P2GA 3R7BA 1NR7A 2XZTA 3SR2C 3NHZA 3K09C 3RJMA 2QBYB 1WQ4A 2C8KA 4LV8B 2PFGA 3NYIA 2ZR3A 3F0DA 2DH5A 1C9MA 2OZPA 1NQAO 3HB5X 5ALHA 4RUEA 5SZHB 4MTLA 1ZR2A 5K1ZA 1RFGE 1E1QG 1B73A 1K7SN 1XP5A 2B21A 2O0JA 2ZI5A 1YO6A 2VH5R 4I55F 1OCZC 1GPNA 3B13B 2I2FA 3KQQA 6REQA 3OWXA 1L4UA 3OTIA 2FSVC 5B58C 4Z7OB 1IK6A 3QUBA 2QKYA 1TUEA 2V58A 2WJ4A 4MW3A 3C98A 3VQWA 3C6YA 1BE1A 3JPWA 1QAHA 3LC7O 3M6AA 3OCCA 4FZRA 4NZYA 3G0CA 4U0JA 5GJVC 3VYTB 2B1GA 4YT2A 4V0QA 1K3EA 3IEQA 3RTGA 4KR0A 4KRGA 1M6HA 2NYAA 3OG9A 5B2FA 2PX0A 3ZVRA 1RP7A 2A1UB 3RV4A 2F3UA 4BO6A 2IIQA 4RTMA 1FQJA 1M76A 4IS2A 1DJMA 1WB9A 4YCMA 2PLRA 4GXQA 4YA6A 3LWQC 5DGIA 3H4MA 4QGAA 3U7EB 5LL6Y 2GN6A 3L02A 2C07A 5AW9A 1TYDE 4X64B 3PXXA 5TS2A 4AKIA 1DRWA 1PG2A 1FTQA 2OCKA 1IZYA 2XVZA 3CJRA 3FJYA 3AVVA 1S2GA 1TUIA 4MAFA 4XCXA 1DFIA 2IG8A 4RSHA 4XGRA 4HS4A 5G0SA 2EIKC 3L77A 4QOJA 3SYKA 1ZFNA 1XNQO 1MVOA 2QTMA 3E0XA 1WCIB 1M73E 1GG9A 4NS4A 1R5NA 2J3QA 2L35A 1Q7EA 1DTWA 3JAKB 2Q69A 1E18A 1KYQA 1LA2A 2WHRA 4DV0O 4AWBA 1TM7E 4CG3A 3UEOA 3CUUA 3AR3A 3IA2A 3OLYA 4UARA 1T2CA 3ZDFA 4EJSB 1IJBA 3DMYA 4PIMA 4PPYA 5D5PA 1RPZA 4YB8A 2OUKA 2Y0DA 4RMNA 1U80A 3RWBA 4H0CA 4OHZA 1R8JA 5HRAA 2OHIA 1S72V 3ITDA 2AFHE 3F8SA 4YP0A 5BY2A 4OLAA 5HFNA 3H0KA 1QU9A 2V4ZA 1FJGB 4RTJA 1E7SA 3ILSA 1TO1E 2VAXA 4PG5A 4YNBA 5CA1A 4JZYA 3ZCQA 4GD3Q 1YHYA 4K0KB 1G291 2PVCA 1R1BA 5C80A 2ZB4A 4R5HA 1FSPA 2GYVA 1P6XA 3U17A 5FR2A 4TKVB 4E7OA 4QWMA 3EDOA 3L18A 3E8HA 3F2IA 1FE8A 4P4SB 3DLCA 4Q6BA 3DLBA 3M81A 5LGNA 4JTDB 3V3TA 1NN1A 3EGVA 3FMFA 1JR9A 1WUJS 2PGDA 4FP9A 4FYPA 1ZCAA 4IGKA 3ZHTA 4LWSA 2H5EA 1Y9EA 2QE6A 2ZVJA 4OUDB 4DLSA 2IY7A 4IRMA 3ZD6A 1KC1A 1S2OA 3ZHQA 3LT5A 1Y76A 1SU7A 1GKUB 2OESA 2BD0A 2FFJA 1FPOA 2YJGA 4NBNA 5EFZA 3KSAC 1IB6A 3Q0IA 1IEWA 1PR9A 3DV0B 3UA3A 2PANA 3R77A 3SC6A 2RK3A 4A7PA 4KPUB 3DVRX 2O1EA 4LRSB 4DYDA 5FH9A 3CLSD 1CY4A 3B3GA 3WL8A 4OJKA 1MC1A 2OCDA 1FDTA 3OAAD 3FTPA 2R7LA 5AKXA 5H6RA 1NJIH 1AC5A 2JVDA 2BGIA 2ZVZA 3IQIX 4ARVA 4IIYA 1YR6A 3F47A 1WUIS 3ZBTA 4P0TA 4TPKA 3NI2A 1YRQA 1GO2A 3E1SA 3GHYA 3H19A 4L72A 1P9LA 3R7AA 3RBAA 4C3OB 2JIZG 2QUBA 5EKXA 2AMFA 4IDCA 3HM2A 5G0TA 2EEPA 3TL6A 3EVDA 3WLRA 3SS9X 3ZG6A 4AU1A 4WFQA 1E64A 2XAUA 2XRZA 3CXRA 1XP8A 3U1TA 5JC1A 1JR6A 3T7KA 2KLBA 4PSVA 3RUEA 2IRWA 1XPOA 4MLZA 3FYIB 2P4QA 2PKYX 1W5TA 4M76B 5FHRA 1G8YA 2I4LA 4Q4DA 4ZREA 4BAYA 2FE4A 1HL3A 1RVDA 2I2CA 3MWJA 4B4KA 1QR9A 5J2UB 2L82A 4KOAA 1XMOB 2CDNA 4MROA 1P31A 2QQFA 3LT1A 3UM9A 3WYNA 2ZAUA 4Q9JA 4J0KA 3F46A 3FGOA 3BWXA 4EHJA 3JCMM 3RYCB 5G4VC 1NT2A 1Z4LA 2PH3A 3FFBA 2DUWA 4Z7QB 5ALVA 5DNUA 4B45A 2JCVA 2YCLA 3WYEA 2O59A 5KMGB 3M5PA 4PLZA 1R37A 1YA8A 4LF9O 1VLHA 3ZDEA 1MAVA 1Z4MA 4Z2YA 1DG3A 2YYYA 1S3GA 5YASA 4E5DA 1QP0A 5LSAA 1A98A 3PDWA 4UCUA 1Z7WA 1WB6A 1Z0FA 3JD2A 2DJ5A 1CQXA 3GAMA 2CK3D 1O5TA 1S8NA 3T1OA 2Q4BA 4EENA 3KAPA 4UV8A 1KBHA 2FK7A 1ENZA 4FN5A 4JL5A 5EMNA 5I7AA 3VPAA 4DCVA 4TV8B 3L1KA 3K73O 3KZIZ 3Q7RA 3C15C 2A3RA 4EJ6A 3J7AU 5GONB 3PNYA 1I0LA 3RSSA 3LKVA 16PKA 3DAOA 1SIBE 3NIWA 4KZPA 2CYBA 2X4DA 4O33A 4OB6A 3Q8HA 5FAXA 4ETMA 2CSUA 2HUNA 5L6MB 4G8JA 1E9EA 5HY0A 1FQKA 1ZOLA 2P69A 3AFIA 3CNHA 3L05A 1YNOA 2HJWA 1Z0AA 1JSLA 3O4FA 1I13A 4II3A 2GPJA 4LVOA 4R7GA 1WF3A 2ZREA 2ZB7A 3TVDA 4CM4B 4EO4A 3A2MA 3USES 421PA 3MIIA 2I1WA 4JB0A 4ZZ1A 1AHIA 2VJAA 1DEOA 3OJFA 4MP3A 1DIHA 2GB4A 1RI5A 3OQPA 3CG4A 4WKBA 2VK4A 2O8DB 3I2IA 3T9BA 1GUFA 2CLMB 1EUDA 3E61A 3MGGA 1LJUA 3OA2A 4H0NA 4YP9A 3NOXA 1JH9A 1GHTA 2QM0A 5ELLA 3B77A 2FC3A 1H2RS 2HSEA 2P8SA 5JD5A 4JT2A 4LKRA 2HP8A 3MSXA 4C4SA 3T9FA 4UE3S 4AO6A 2I9PA 4IDOA 5A1JA 2BGRA 3NEPX 3TRJA 3TAUA 3KQHA 5IVPA 4PYRA 4ZYTA 4ZVQA 4HDNA 3RCBA 2VYND 4M55A 1G8FA 2ADQB 1S2MA 1N5DA 1DAMA 3EQ6A 4QDZA 1YQ9A 3H9UA 2RONA 4RK5A 4DCPA 4F92B 1ZUNB 4HLUA 4JJAA 3ZRXA 1PIWA 4M49A 4TTSA 5FBKA 5JZSA 5HWEA 4YLYA 1H05A 4MEJA 2Y0IA 4FOSA 2VZ8A 2AL7A 4BU0A 1BJKA 1K8RA 4PA4A 3MJCA 5A06A 4FZVA 2ZBFA 2VHWA 3QW2A 2A35A 2WMNB 4BC1A 3TLCA 4B3TB 2Q4TA 2GPAA 4ZHVA 1JG1A 3FYDA 1F8UA 1H3NA 4GVPA 4IZHA 3OF2A 2Q3FA 2W70A 3ZJUA 1NNUA 1VQLV 1T6XA 2OBYA 3WRYA 1UMBA 2DM6A 3O8OA 2O05A 1GJRA 4EG1A 4UOEA 3QW4B 2QPAA 1VE1A 2DTEA 3AFGA 3W3AA 1JD1A 4CS4A 4C8GA 4UCXA 1SOUA 2AEFA 2M98A 3KZ1E 3UGTA 3BE5A 3UHPA 2J0SA 1XL0A 1PZMA 2PYJA 3GU3A 5JFTA 1I94O 2IUFA 1PJTA 4MVSA 1X86B 2WTMA 4LDAA 2Y48A 4G5QA 3S8YA 1OCCB 1TZ2A 4KE8A 2LBXA 2IUTA 3DBHA 3L1UA 4DSNA 1G20E 2OCLA 3EPLA 4C04A 4KXNA 3UMBA 5B30A 1GUZA 1Z08A 3I9OA 1U9JA 2RBGA 3QG1A 1R50A 4MRPA 5DOZA 1X7DA 5E9JA 2FSIA 4MPTA 1VG1A 1XQ1A 3AM5A 1UDCA 1PZNA 1T4MA 1ZUWA 3COPA 3OTGA 4FLEA 1CRPA 2FWPA 2E37A 3BVOA 2NM0A 4NMXB 3FAZA 4WY8A 4HS9A 1TAGA 2CLFB 2CUTA 3HJRA 4ZVVA 2RIPA 3TEJA 4MWEA 5K0ZA 2VTVA 4G1FA 1VI5A 4HN9A 1EJBA 4D9BA 4E1AA 1C2TA 2GEFA 3CEJA 3RYCA 1CZHA 1UPCA 2IP1A 4M6WA 2J0UA 4KMOA 3RS8A 5TEVA 3SYNA 4LFCO 1JQEA 3IEIA 3G6EF 1YB5A 2WWXA 4DV1O 2R72A 1S1MA 3QY9A 4IV0A 3ZKAA 5JHHB 4FQ7A 2PKRA 3K9SA 3L79A 4LSZA 2KW5A 1ZAKA 1GNQA 1G6OA 1VKNA 1W9HA 2PYDA 3KKNA 1OC2A 1KVQA 1X1EA 2IYEA 4KE6A 4C76A 3HB9A 1T5DX 1M2KA 3BX1A 4KQFA 2QTVA 3PYMA 4B6PA 1KD1W 2ZRQA 5AM5A 2DUJA 2JS5A 4J7AA 5GW7A 1PVDA 5AK0A 1M8FA 2DF8A 1YU9A 4Q3NA 4QFMA 1A88A 2GBIA 3M3PA 5JZ9A 5A3VA 1KZ9A 1F12A 2QLNA 2VHYA 2WV9A 1YDXA 3ZV5A 5ECYA 4A5OA 1LUVA 4JI1O 1VG9B 1YSCA 5B1DA 3PC8C 4MUNA 3IE2A 3TETA 2GJ8A 1PJ2A 2QJRA 3ZQUA 3NWPA 1GPH1 3WI7A 2V7EA 1I36A 1E6KA 1O4VA 2X7RB 2XMBA 3AF3A 3IODA 1UPBA 2VWKA 1KQSF 3NRBA 1NV8A 1PFUA 5E1MA 4G4ZA 2GAAA 1US8A 4IZIA 4AWAA 2NYUA 2H4YA 1NLFA 3AG1B 2WNHA 4WX2B 1P74A 3P45A 1XQ8A 2FDRA 4QU0A 5EE9A 4FGZA 1MCZA 5HFJA 1MNQA 1ZSVA 5K8VA 3GLFB 3KQLA 1MU0A 3ESQA 3DBRA 2HSDA 4MSUA 4MIKA 3B82A 3B1YA 4IYJA 2GYUA 3VYRB 3ZC3A 3AL0C 3WSVA 4LX0A 2EBHX 1NLZA 2C04A 2JZOA 5EIOA 1AXGA 1HI9A 2Q5ZA 3ZLUA 2FFHA 1LY1A 1S96A 2AQIA 2CVZA 3L7LA 2ZXWC 1DAKA 2PX3A 3DE7X 3L3BA 4B83A 4HQNA 4IDNA 1KI2A 3PP8A 5C34B 1KRHA 4NBKA 3TOVA 3KIZA 4JBWA 5JXHA 4U63A 4E21A 1DJLA 4F38A 4Q66C 4D4IA 3UWDA 2XUPA 2R6DA 5K3FA 2CYCA 5P21A 1EP3B 3P9IA 3QKUA 1Q7TA 4LR3A 3AV0B 1T5LA 2OWDA 3MUFA 4PR3A 5AJUA 4BJ5A 2RG1A 5CD9A 2Q7EA 5AVJA 1TF2A 1RLTA 1UT5A 2PL1A 1UBEA 4A0SA 4FLMA 1XKLA 5EE3A 4IRXA 1XQYA 1SGWA 1D7AA 2XE6A 4MV5A 2XGMA 2I8CA 3KALA 3WX0A 1E2BA 4CTMA 2QRKA 2NPOA 4LGYA 4M53A 4EUEA 5CIQA 1XI2A 3ESJA 2CHFA 1EX1A 1X1RA 2ISQA 2PZ8A 1BAPA 3OSZA 3VBCA 3H9VA 2F9FA 5HJ2A 3TBHA 2R68A 1IM8A 3GEDA 4NONA 2CMGA 2VRCD 2NW6A 5JAMA 4B2YA 3ZDYB 3N0XA 1MFZA 4MUEA 5B57C 2JFBA 1M83A 3DT9A 4GM1A 2BP7B 3UV7A 2LRHA 3E8SA 3EIHA 2PHZA 4TKMA 5A1TA 5IN4A 1QH1B 3H9JA 1N2CA 1O54A 4GS5A 4F56A 4DV3O 2JFVA 3IUNA 2WQ6A 2WVHA 4JC8A 1Q44A 3ILXA 5EY5B 1VQ9F 3NNNA 1I3MA 4H6WA 3SJBA 2BEWA 3KS9A 3B7WA 5KNLA 3VZPA 2QDKA 3TI7A 4QJ5A 4TQUS 5FPKA 2VTDA 3Q41A 3EEBA 4AJ9A 4YCLA 2GHIA 1F23A 3MW8A 3KD2A 2PSDA 4IS3A 2HG5C 2QYOA 4TZTA 4HDAA 5ED4A 2YZ2A 4J9YB 1NVBA 2G0AA 2R2AA 3ZNNA 1MAAA 4B79A 4DR5B 4LBWA 3WTCA 2EYUA 4FGLA 1X8KA 5JJJB 2NT3A 2RI0A 3KQTA 3P2JA 4BPRA 4N3BA 2FW7A 1J21A 3MMPA 4XIYA 1QHIA 5DBIA 4AG5A 4BWGA 4ZI7F 3P30A 4FGSA 5LZ5A 4DDMA 1SKMA 4I0XA 3BG5A 5CH8A 3NNDA 2C29D 3VH3A 1JIQA 1BCSA 2FB9A 2GX6A 1EESA 2EU8A 2WMOB 4I4NA 1XZPA 2BEUA 2VAMA 1P0QA 1T3LA 3AVOA 4KQMA 3E84A 5JXIA 3QLVA 5SY6A 4MQBA 2ZUFA 4OLHA 3UJNA 1I2CA 1U8FO 1N9GB 1NBOA 4QX6A 2MHCA 3FI9A 2EZOA 1M33A 3MGCA 5F12A 4B1FA 5DMHA 4G0WA 4KFSA 1YDGA 4B7XA 4C7VA 5F3RA 1CFJA 3K57A 1WY5A 1E4EA 2VKQA 1RYFA 4CF6A 4HDMB 5KTRA 1UKYA 3ZH2A 4Z7JA 1M7GA 4YDRA 1ILEA 3SFTA 3BA8A 4OQLA 1CHNA 4IIEA 2IE0A 2WF5A 4KUMA 1MJGM 2I5PO 1T5TA 3HRKA 2GBGA 3SZMA 1WW3A 3A1VA 1DQPA 2MT9A 4TWBA 3RRNA 4RTLA 3NGXA 4N0MA 3RC3A 5B1IA 1RS0A 3U7JA 1FJXA 2F1MA 4PNPA 3N8DA 3G2JA 1A72A 2EKBA 4HWGA 4UAUA 4ZEWA 2VYVD 8LDHA 3OQ6A 3CRVA 1GNSA 4Q9AA 3TB4A 2BE7A 4WXYB 2VNIA 3NEYA 4I2VA 3RVBA 4FZ0A 1DQRA 1X0VA 1EFLA 2IGBA 4M89A 5L3ZA 3RHSA 1KJJA 5BQXA 3KHUA 4RYLA 2AOWA 2DSTA 3G5LA 4LJLA 5IBPA 2EKDA 2ZNIA 4HI0E 4M1WA 5KCZA 4XUEA 3VR4H 1SBCA 4DR2B 4EF5A 2WDPA 1P75A 4J7ZA 5DECA 2RH4A 2Z58A 2ZRMA 3A28A 2F4NA 2BM1A 2FEMA 3B2NA 3GCXA 3IRUA 4C0BA 4HDOB 1FOEB 4RJLA 3ADBA 3CVWA 4UVCA 2QWXA 1YCFA 2V0CA 1WAZA 3A1CA 3HP7A 3RVNA 4A16A 4XQGA 2PI4A 2F1RA 4M60A 4AYTA 4XGNA 1S3JA 2XDAA 2QW8A 2JCXA 4JC5A 2OK7A 1BN6A 4ARUA 5I7OA 5M29A 5L3QB 4XGQA 2QAJA 1Y3DE 1JWLA 3K2EA 1Z17A 4JYYA 1GAJA 2OCGA 1EFRG 4PBRA 4F5WA 5AOAA 1KI4A 4ZVOA 2WU4A 4Q20A 5C1IA 3V4SA 3KR2A 4HQ0A 4M9XA 2ZT9B 4QYIA 3VJRA 1UZNA 4EI7A 1W4CA 2QNRA 3CNEA 1FU4A 1Q0HA 3EXEA 4DIOA 1RRPA 3VI6A 2Q9LA 1ZJ4A 2X8LA 4NAHA 5IASA 2XWBF 1YZYA 1ZU5A 2B61A 4ND5A 1ZOIA 1QPZA 5DEIA 3T1CA 1QV6A 3WIOA 2CV0A 3QMPA 1JVMA 3R40A 2XOKA 3FRHA 1XYVA 4NNJA 4MWDA 4G56A 3NAGA 4QYXA 3LDEA 1OI7A 2YNMC 2IX3A 3QSGA 4MVUA 1TLTA 4IMPA 5AJXA 3MGAA 1J8VA 1NW6A 1OY1A 1ULAA 1ZOPA 2EJWA 3QXGA 4PNZA 5JVDF 1IPAA 2E89A 3K2XA 1FXKC 4DQ0A 2C4NA 4QYSA 3T35A 1U11A 2FPUA 2Q49A 1T35A 2IXBA 3IMFA 2CHSA 1E5TA 1AI5A 2BJWA 3TBFA 2A4KA 2QY6A 3AUTA 2YIBD 1JSZA 2FPPB 3VOUA 1B6TA 5AOCA 4BNVA 5C8VA 3OY7A 1WXIA 3JASB 1JEAA 2WT4A 3I05A 2O07A 3I7TA 3AR7A 3IGAC 1NZ6A 1NDUA 2DX7A 2R8EA 1PQYA 1QKIA 5FLKA 4B46A 2VRBA 1ABBA 2EARA 3JR3A 1EKXA 4JN6B 4WW0A 3QEOA 3MB5A 5EE0A 4UHHA 4JBYA 3ICQB 4CQLB 1DX9A 1P80A 3SPHA 4XARA 1BNCA 2Z8ZA 3COYA 5A6SA 2ACWA 5J4LA 2XSZA 3BH0A 2NZVG 4RJIA 1H38A 1YTLA 1ESDA 3NBUA 4ZI7A 4A15A 2FWIA 1BVUA 1NSFA 4FMPA 4KR6A 1V3TA 5SV2A 1DKRA 2IXDA 3PCRB 1ZHOA 2YV4A 4OI0A 1FZQA 2PGIA 1DEAA 1L4EA 3WHIA 4CODB 1I6WA 7MDHA 1MX1A 2O2ZA 1ZJJA 1XAHA 2XLCA 1W46A 3H5TA 4OQEA 4RFSA 5AW1A 3IP9A 5F64A 2X6TA 2Y1CA 3WR5A 2D74A 1MAUA 1XV5A 1Z15A 3PJEA 4ZMRA 4O2BF 1GN4A 1K2WA 1YRHA 2VPXA 3CE6A 4PU0A 2VUHB 2QMEA 2OAQ1 1X8LA 1SKYE 1QLHA 3BMNA 4JVSB 5EZYF 2F66C 5JVDB 2F2TA 1VI2A 1XXHB 1VYTA 1JR3E 2Q1TA 3AUAA 4IVQA 5CX1A 3IO3A 1RBYA 3KTFA 2XHBA 3I4CA 4HRVA 3S27A 4HGZA 2NOAA 4QBHA 3QU4A 5L4NA 1N5KA 3ORHA 4QL3A 4WCFB 2GN2A 3KEQA 4PO3X 3A9VA 4TS1A 3FPLA 2H1LA 4BFTA 4BFUA 1LPAB 5HXAA 4NTZA 1VQ8V 3QLUA 4U2EA 1ZVVA 4PLGA 4UHDA 2JFXA 521PA 4KQEA 1R9MA 1KDOA 3JTMA 1ONOA 3QXSA 1QHGA 1E3WA 1IVSA 1KNXA 1EDOA 2OQ2A 4LHYA 2KQUA 4I7ZB 2ICAA 2O2HA 2V7BA 3DP9A 3HDTA 4L95C 5FTLA 3IQDB 1HE5A 1G17A 2RAVA 2X9NA 4RL4A 1VLQA 4KTVE 5IDVA 5IG2A 1GO1A 3ZJYA 4F7DA 1UZLA 1FW6A 5H5NA 3FPEA 2BFWA 5EHIA 3LI2A 4MV3A 3UKOA 2R1VA 1QUFA 2VEOA 3EXHC 4JQSA 4S1VA 3WNDA 3QVGA 2QRZA 1CB0A 2AFHB 2PZGA 3HDHA 1CFZA 1N2XA 4PTLA 4JOQA 3L8GA 2AOXA 3D6AA 2CXXA 3NHBA 2IXEA 4DJAA 2IH1C 3CINA 3KU4A 4AMGA 3PEWA 3DEHA 4YCNA 1N5OX 4GZ5A 3WKBA 1VHDA 5T4EA 5LQUA 4GQIA 4GVXA 5KA6A 1CEXA 1NWCA 3H2HA 2L69A 5KWVA 3K35A 1AUXA 3BXXA 3BGOS 3KQSA 1OZGA 2QP4A 3CIOA 4LY0A 5L3GA 4JJ6A 4JT8A 1VQNF 1U6JA 4P53A 4XYBA 4BKUA 4KHPO 1CQPA 1X77A 3L04A 2AIFA 1WPQA 2BCEA 3DE2X 4OAQA 4U7GA 2D7JA 5A7GA 1H42A 1RI2A 1NVMB 4TSFD 5LP6B 5DXFA 5EHXA 5E2IA 3ABTA 2TECE 4YMTA 2Q6AA 2XOKD 1IFXA 1TZBA 3CC7V 1A04A 2IVFA 4LF4O 1R7RA 1E3TA 1H0HA 4NI5A 2CD7A 4OK6A 3RF6A 3HTXA 1CEYA 4YAEA 4YDHB 3SR0A 4ENTA 5J58A 2XCLA 5DNWA 5F73A 5B2EA 3CE2A 1HFKA 1H5QA 2G17A 3WQBA 4YXWD 1KSGA 4EG6A 2L18A 5CXQA 3BGSA 4REQA 1MO3A 1VIVA 3K6RA 4YP7A 1BWPA 2FP4B 4DQXA 1YJWV 4KN5A 5JH7F 3HXLA 4BP9A 2PXXA 4GICA 2G09A 4HXYA 3FPBA 4D7AA 4K03A 1TC1A 2P6OA 1IBRA 3DD5A 3AG2B 4U3FH 4B3RB 4UTOA 3P9PA 4E22A 2FCRA 3LDCA 5GTIZ 5BV7A 4LE1A 3ETLA 1NM5C 2TMGA 3HRIA 1X7XB 4DARA 1GRNA 1UWVA 2WU3A 3G8DA 3CJQA 4P5DA 3BRCA 3VR6H 4XDYA 3G0DA 4MAAA 1V48A 3I5YA 4CLXA 1VE3A 3A1WA 3L0BA 2JATA 3QEMA 4MQ5A 1O8BA 1K86A 2Y66A 3QVUA 4LPKA 1GZVA 3W79A 4BZPA 3RBZA 5I3ZA 2H8EA 3PFWO 4E2XA 5CB4F 4TL6A 3V8MA 3W7WA 1XZIA 4DLYA 1EX9A 3SIPA 1PGPA 2VOJA 3MINB 2XSZD 3EIFA 4A73A 4DXDA 2CXRA 3MHPA 3V48A 5BV0A 2YY5A 4BVEA 3EZ9A 4MVJG 2YHBA 4PQGA 4HJXA 4N23A 1IXKA 2LZ0A 4B08A 2DHEA 3F5WC 2O3QA 1M8KA 3AF0A 3S0WA 4I4TF 2VPPA 5IDQA 5G40A 1A4RA 4FOOA 4KK4A 3NWBA 3FCCA 2GBLA 1X7YB 3ON1A 2TMYA 4XPZA 2PLAA 4O4JB 1PKEA 2IYZA 2V7PA 2Z3VA 3COWA 4ZC8A 3RABA 4PICA 1GV0A 2XBLA 4V0LA 2Y1KA 5DBEX 3DWEX 1OZHA 2RGDA 4I5DA 2DFLA 5INTA 4QEDA 4JL8A 1W48A 3PICA 3U4IA 1C4WA 4KLZA 4YJFB 3F6BX 5H02A 4BP8A 6CHYA 3DDHA 1UEJA 1RRKA 3G2NA 3K6KA 3QUAA 1DFGA 1GRJA 1KO1A 2EGGA 3C8ZA 1YJNF 4MMZB 2BTUA 4RLHA 1O6BA 5F76A 4XBFA 2K2WA 4GMHA 5JAPA 1R0KA 1AE1A 3WKAA 1GH6A 1Z9BA 2W2VA 3FROA 1L7EA 1X6VA 2J9ZB 3GRZA 3ORRA 3CCEV 1T36B 3BZUA 5HHTA 5BSHA 1SPBS 4GBJA 4Q4LA 4CDMA 4JEIA 3HI6A 3L4BA 2BZ1A 1JTEA 1IYZA 4CS3A 2XHEA 2XUDA 2ZWOA 2HLDD 4HWRA 4JBHA 1U28A 3SE0A 4EGJA 4BFCA 2J5KA 1UANA 3LIPA 1UXHA 3M6FA 3ZHZA 4IMJB 1V5GA 2PJRA 4R8LA 1VBKA 4UEWA 1ZMTA 3CU5A 2ZYDA 1HEYA 2WLSA 1I33A 1P2DA 3FM9A 2AOTB 3P9XA 4LBZA 5C9ZA 3U7RA 2J07A 3FGPA 5DHAA 4BVJA 3L4JA 5BMVB 3QWFA 4B3SO 2XMGA 4JI7B 2QPTA 1IUNA 2K7FA 1QC5B 4AG3A 2AZ0A 4F8YA 1GTZA 3B6IA 2IZZA 5CEFA 3UHJA 5JZVA 1NY5A 1RW4A 4E08A 3UXMA 4YIHA 4WFHA 1E7QA 5L45A 1TT5A 1E94E 1QHFA 2LUOA 2Q9UA 1FZTA 3OFND 4ZYYA 2OIEA 2H4JA 2HAEA 3WU2Z 1L8XA 1KI7A 1HYQA 3KOXA 2BONA 2HD4A 4BT3A 5A2QM 4WXRA 4E2WA 5AW4A 2FPGA 1KBZA 1KPIA 3UJ6A 3UH1A 3HO8A 1R0WA 1CDZA 2FPOA 1ZRSA 4R0VA 3V46A 3G6BA 2ZQ5A 5FBWB 3CX6A 3MNFA 2DWCA 4YAWA 1YUMA 5JPCA 4CMEA 4MS4B 4ZDWA 3FCUB 3M7IA 2EX4A 3VSEA 2VDWA 1AILA 4F1JA 5BR8B 1T0PA 4RJKA 5AKJA 3NIFB 4PQYA 4RVCA 3RSOA 4FYWA 1PJRA 3V8RA 1T24A 1TB4A 1AK1A 3T4XA 3WLKX 4MKRA 4PE5B 1OGIA 1P33A 4DILA 3B8HA 2AZTA 3SZRA 3CCLF 1GA1A 1RAHA 4YJGA 1HNNA 4YAUA 1XDSA 5JS2A 1T25A 3HWSA 2EG5A 3PQDA 3C5EA 3V4FA 2IF0A 4HLQB 3E3AA 1QVFU 3CEHA 3JRWA 4P7FA 4RVNA 3RAPR 2C5LA 5KREA 3C3DA 4WEOA 2AFHA 4AP6A 4JU8A 1AOXA 3FKJA 2OXCA 1J7JA 3KUXA 2A9FA 3DBVO 3G88A 3F5TA 3J7TA 5CB0A 4H13B 2IYVA 2RGCA 4KH0A 1MKYA 1F1BA 1ZK3A 1PWEA 1MV5A 1BXRB 2WWHA 2Y6VA 4G81A 4H7HA 4QRHA 4J0QA 2Z3WA 3SE7A 2NX2A 1NBMG 1C14A 1RXYA 5DOVA 3TNDA 1BH2A 2ZAOA 1GQFA 1JL3A 5HG0A 4FYHA 4EQZA 4NYJR 4JB3A 4GE0A 1WMDA 3EDQA 2OQRA 4GI1A 2ADMA 4KLRA 4W1QA 1RMQA 1UJ2A 1U2EA 2E4VA 3N76A 4FK5C 1QOQB 3GHZA 2ZIOA 2B78A 3HR7A 4R05A 3ACBA 1JX6A 1XMXA 2HYDA 2ZRNA 4KOEC 3BL8A 4YT8A 3HUEA 4KDCA 5E3HA 3Q3IA 3O26A 3MT0A 5JYDA 1AV6A 1P62B 2HFKA 1EGVB 1YQGA 3F96A 3AWIA 1BKYA 1ZX3A 4XZ3A 1ZGHA 1BMQA 1FF9A 2ZB2A 1IBLB 4IAOA 3CXUA 3FZNA 4MP8A 5I7UA 1GKLA 1WP8A 2FEKA 3CB2A 2A94A 2NSJA 1Q6ZA 2SKEA 1PNTA 1H2LA 4WCEV 3L6EA 3RPEA 3UOGA 4BCCA 1KTIA 1RRCA 1CB7A 5DM1A 4G4JA 2W11A 2HXSA 1I7SB 1I5EA 1PU2A 1RYHA 1UL1X 2FR0A 2WI8A 5DB4A 3T95A 1THZA 1HFEL 1SIOA 1XHFA 3AV3A 2BC9A 4NE7A 4TLDA 3ZR4B 4FM9A 3B5JA 3Q4HA 2Q8NA 3ZI0A 2WWTA 1E7RA 1NRIA 4X92A 5ELMA 5G3YA 2WPDG 4Q9LA 3SLKA 5EMJA 3RNLA 2B82A 3ZIAD 1S3FA 2ZCJA 2ZSEA 4HF7A 4BIOA 4FIZA 5JXJA 1Z4NA 1QPBA 5D2CA 3P94A 3W7UA 3RFFA 2C5AA 1XTQA 3NKFA 6LDHA 4ND3A 3A2FA 4W1RA 3DG9A 1DKLA 5EE5B 4MS1A 3T5DA 1GGVA 3L0IB 1IC6A 3ILVA 4KU4A 4HK4A 4RIFA 1SUFA 5DCWA 1BW9B 5CLFA 4FHEA 1HP8A 1IZ8A 3INTA 1OV6A 2Y1OA 2ZT8A 4GWKA 1OH8A 1B0ZA 2WOOA 5HS4A 5EJ8A 3TG8A 3Q2OA 3OIWA 2BHRA 3N87A 4PWYA 2OHWA 3VZQA 4G4VA 1SZDA 2YFQA 2JVJA 3ILYA 3TLBA 1JSRA 4FZ3A 1MVNA 1ZNQO 4ZARA 3V80A 3ZHBA 1K4KA 1CKEA 3HUTA 2IZ6A 4M9ZA 1WMAA 2PXAA 2QRHA 3ZWMA 2PJDA 2XX3A 1FSSA 3CW9A 2OR3A 2VDVE 3OOEA 4P9NA 5DO9A 1RWNA 2O7RA 5CUQA 4A0GA 2YBEA 4I9GA 4IL5A 4Q0MA 1W75A 1QSGA 3DJYA 2QUIA 4S1TA 2CVPA 3A6ZA 5THQA 3RS7A 1TEZA 4F2PA 2XB2A 1KZYC 2PUSA 2J87A 1GUDA 2AN4A 4NOJA 5JATA 2IT1A 3AYXB 1TQ8A 2VWGA 5BSWA 3RC1A 5C5EA 5C51B 3A9WA 2WTXA 4B40A 2Z8YM 4DA8A 3D6HA 4NK5A 4QBTA 3DJFA 3L46A 3N2KB 1NATA 3DV9A 4DYHA 3PT5A 1N4AA 5FYQA 3IBTA 4IYIA 3EGXA 5AHRA 4MA5A 3GCWA 3TMKA 4OO3A 2RAPA 3CUSA 2RHTA 1P3Y1 1IOWA 2YS6A 3RIMA 2N3ZA 1AKMA 4JUBA 1TUBA 1VHWA 3LPDA 3OJ0A 4AF7A 2GVNA 3OONA 1AUOA 3SC4A 1SC4A 2C7BA 1L8OA 3GAFA 5D85A 4A4DA 4CKXA 3ZTWA 5T41A 721PA 5IKMA 1L7MA 4RW0A 3ESCA 4A8TA 1JJ2F 4EDFA 2SKDA 4JL6A 1NQ5A 4OHFA 1D1TA 3IP7A 4MSWC 3QPAA 3PJSK 4F0JA 4RJTA 2ZJ5A 2CXSA 1D03A 1T8WA 4I81A 3SSOA 3ZBHA 5HXZA 2PCJA 1JHXA 3IVMA 4X91A 2OYQA 2FZLA 3GUCA 3GXOA 3DDOA 3Q40A 4J4TA 3JQPA 3TSWA 4J0CA 4YCAA 5IKEA 3WYBA 4U2CA 3GFBA 4B6FA 5LOVB 4RLSA 4QEKA 5BOSA 1J9ZA 5F7JA 3K6SA 1MA3A 1Z28A 3NHMA 1BS3A 3A2KA 1E79G 1DIBA 1QLEB 5D6OA 5REQA 6PFKA 1EAMA 5KZMB 1WPXA 3QOFA 2V7WA 3VTFA 3EIEA 4RY2A 2A67A 1ESZA 1JLLA 5I9LA 3RN4A 1ML4A 1KQNA 5TQ0A 2O2SA 2IZ0A 4JP1A 2Q99A 1ONPA 4MUAA 3C9TA 2JCSA 2V1XA 3ZHUA 4MV8A 3UFBA 3LA8A 3ERNA 2IJJA 2GN0A 2IJGX 3OX2A 3VTAA 4F4UA 3MUEA 1R66A 3RAGA 1U7TA 1MJHA 3DTVA 3CNBA 3TRDA 3G2KA 1ZLYA 1ADYA 1B6GA 2W8BA 5K8TA 2ECFA 3SLGA 4HBNA 3K0BA 2XQVA 5C4IA 2ROQA 1EK1A 3P1JA 4HDRB 2F9ZC 1RQ7A 3UCSC 2C7GA 4QTUB 1KNQA 1UQUA 4Z8XA 5FO1A 2ERCA 5ALWA 4KK3A 4OBXA 1FXVA 2MYUA 1WOYA 3Q9LA 4TXHA 2Q62A 3BJRA 1IXBA 3KHSA 3GB7C 1QORA 2YRWA 1VA4A 2R7NA 3DUFA 4FYMA 3ZNOA 4WJLA 5B4UA 4F2WA 4LFAB 1Z74A 3PFIA 4Q39A 3UGKA 1JECA 3GJXC 3W5IA 4EY6A 4MS1B 5EXXA 4C8IA 1PL0A 3TOXA 4EF4A 3R44A 4IWYA 3IJRA 4D8YA 2UZ1B 5A4DA 3U4CA 3C9RA 4B8ZA 4HWOA 5KYXA 2DW4A 3HB3B 4O3MA 1UK7A 3HZHA 5L7WA 1EWRA 3DHYA 3OLZA 1Z6XA 2WLLA 1CRZA 3S55A 5BSFA 3DTTA 4Y0AA 4YYEA 1OHHA 2HLHA 2IV2X 4TQAA 2GHRA 2YC0A 3VR4A 3VJLA 1RWVA 4URXR 1DWPA 1FQOA 1EK0A 2PH5A 4YGYA 2QZJA 2OP1A 4Q24A 3OW2U 5DVZA 3WKEA 3ZCSA 3ROFA 3FY4A 2WUFA 5DBOA 3C8HA 1VSQA 1BTOA 4HL6A 5E4FA 3INGA 1CIVA 2GZHA 3DDZX 1Z0KA 4XB2A 3ZUPA 5ENVA 1N2JA 1QAQA 2PUJA 1W5AA 3O4JA 4GI2A 3PTLA 4HOYA 4LDNA 4F91B 1UFKA 4I4LA 5CA3A 1BD4A 1SH7A 3BFJA 2LCFA 3G2IA 2IV3A 3WGYA 4KQ2A 1OXVA 2E55A 1HOTA 2CJYA 4XRRA 3TBKA 4LGMA 3W34A 1JFLA 3HH8A 2W37A 4C7JA 4CKEA 2DMXA 1KDPA 3DE1X 1FNSA 2BFAA 5KHIA 2AJDA 3PR3A 2JDIG 4ZAYA 4N76A 3B1WA 2WKRA 3IUEA 4BN4A 3E22A 1QCCA 5FA8A 1RTTA 3TLYA 1WKVA 2XZDA 1G20B 3B1JA 1CK2A 3EXG1 5J2TF 4JJ4A 4TWJA 4BYGA 2CVHA 3OZAA 5K8LA 1QHXA 2X6BA 3CCUV 4GLBA 4ESHA 3U3OA 5CT9A 3BREA 2D1RA 1QGUB 2KTUA 2WD7A 4QRIA 4TQFA 4ENSA 3B1VA 1IEVA 2Q6IA 2CLCX 4PZPA 4RVOA 2EFEB 1TE2A 2JLVA 3ONWA 3JPYA 4RJ2A 1Z22A 5DYNA 3ME5A 4ROSA 4BT4A 4YAGA 3ROTA 5I7SA 2RHJA 2KM1A 1PWYE 4PZCA 1NJIW 2LXNA 3CCQV 3W9UA 2RKWA 2FWAA 2PMBA 4PG7A 3UMSA 4NQZA 4B44A 3VR5A 2ZVQX 2ZZNA 2SCUA 2CLKB 1T43A 1QR2A 1NN3A 3HVRA 4J07A 5BMVF 4LUCA 2O2DA 2DBRA 4HAXA 1FX0A 1MO5A 3OD5A 1EGAA 2GYYA 2Y27A 2PRIA 1V8FA 3DVAA 3P96A 4FDLA 5CTAA 2PL5A 3AR5A 4DSUA 4EPXA 4WL0A 3C39A 2II6A 3EAFA 3IAEA 5GADl 5L53A 3WNCA 1FP7A 3B6JA 4MPDA 4MR9A 1IB0A 5E6RA 2IF2A 1JLLB 3DCNA 3FNHA 5JCPA 3ETJA 1M1NB 2HNAA 2DPYA 3AP2A 3OEYA 1SCQA 2JASA 3X2FA 2XKKA 1DXQA 3PGVA 3KOUA 3SYTA 2VNSA 5ES3A 2F23A 2IX9A 1KKUA 3PHBE 3OR7C 1D6MA 1N8TA 3P0RA 4Z4FA 4JI6O 4NQRA 3REQB 5KYUA 4YIOA 4B48A 2BFBB 2W8ZA 1A2QA 3P4UA 3HU1A 5DYYA 4NX2A 5KDLA 2H65A 2PRZA 3MJHA 4ZKEA 4BO7A 2AHYA 3RU7A 4EPYA 3MJ4A 4BO3A 2WLJA 2FE1A 3P2OA 1GPAA 3KYCB 3O5AA 4FJ2A 4LOIA 4MGEA 5JDIA 3FCYA 3EPJA 4UU8A 3C5HA 1DG1G 2BKUA 2FLKA 3QKRA 3RIHA 4BQPA 1IN6A 2QJOA 3R1IA 2I29A 1XCJA 4X1YB 2ZZMA 1SXJD 4MUGA 3B60A 2WMDA 3F78A 2VUTA 3VOSA 1EGHA 1EFKA 1ODEA 2OFWA 3TAHA 1DGQA 4ONEA 4BO8A 3HJGA 1FRVA 4LQCA 1H8EG 3OF3A 4OU4A 5HJ7A 1E2GA 2UVPA 2XUKA 2QN8A 1JLKA 3KQYA 4RS3A 5KTYA 1EDEA 3CA8A 3OTFA 4LF5O 4Q4AA 2ET6A 3OFJA 3Q6NA 3TQQA 3CF4A 3EZGA 1J2RA 1N2BA 3ICCA 1Z0DA 4EI9A 1TM2A 2OP0A 3K0FB 1IULA 5J4KA 1SHZA 2W6IA 3CFYA 3EQ7A 4IOLA 3W2HA 1Y7TA 1M7BA 3RFUA 4ZTZB 4D9JA 3MS2A 4XYGA 1FKAO 3CRNA 1N6OA 1NSYA 4Y2RA 3GLKA 2LP4Y 2QPLA 4QUHA 4WHMA 4LF7O 1AG9A 2R44A 1QGZA 2FEAA 5EHGA 5IW8A 3ZCRA 3IXMA 1MRSA 4CZ2A 2VQEO 5CYGA 1ZPDA 1IZ7A 3P0EA 4JP2A 1YWGO 3PEEA 1YJNV 5KCMA 3WMGA 2Z2KA 2GRJA 3U5TA 2BFDB 3K9CA 2QJ1A 5A5GA 1N8NA 3AG4B 1OTXA 3CPWF 2HLPA 3H1TA 4L8WB 3IIMA 3MT8A 1KE2A 4RD0A 1LD3A 1A7AA 3W5BA 3K1TA 1WVIA 1DBWA 2CMHA 2Z1FA 1JDNA 2IUUA 2FMLA 2HCTA 3WG9A 4B34A 2VWHA 4O1HA 2QVYX 2BMAA 3C3CA 3KT8A 2V7QG 1H0RA 1WKCA 3QNWA 3PV0A 1L5ZA 3TFOA 3WK6A 5A71A 1O1YA 1ZMRA 3HGQA 4NDZA 2PT7A 3DDSA 4RVSA 3AGQA 4XVRA 1NI4A 1M1ZA 1TKBA 4ND8B 3G5MA 2HWUA 3M9XA 3TH5A 4F6CA 3EFFK 3KLNA 4KVFA 4NYMQ 1W25A 4OXYA 3NG1A 4XWYA 2QQGA 4U9UA 1DO8A 4R6WA 5AIAA 1G5PA 5KJEA 4R3UC 1AUQA 3AOGA 1OBFO 1GPJA 3LQRA 3U4HA 2PEZA 1B6RA 1LS1A 1LBQA 3GEBA 4GMFA 3KZNA 3MFYA 3K15A 5AVTA 4RF2A 4X65B 1GR1A 3WE7A 4AVYA 2XUMA 1LTQA 1OA0A 3BMOA 1ULUA 4O08A 4EFDA 3FVWA 3W2IA 3LF2A 4NCNA 1OJHA 5H80A 1EHIA 3UJ3X 4B6OA 3CLTC 3AUFA 1Y76B 1UJ6A 4P82A 3KO8A 1FTNA 2C59A 1DKPA 3TRKA 2NUTB 2ZI9A 5GIOE 2JLRA 2J3KA 2LD4A 3L1JA 2BYTA 2GJAA 3NYQA 4Q4HB 3N0RA 1XYGA 4OAOA 1JI3A 1HK7A 3E7WA 4QXRA 4UDXX 1LW6E 1L8AA 2IEYA 1J2TA 4AJHA 1E3MA 3G9TA 4LZPA 5BWCA 1VOTA 1G6KA 2GZ2A 2Q6TA 1ADFA 4JWTA 1L3IA 3V7QA 1CR1A 2HO5A 4XOUA 3N2IA 2WYWA 3GCDA 4M0EA 3E9RA 3I9LA 4MVXA 1HDXA 1ZCBA 3MN1A 4H35A 2GEVA 1S76D 2O8NA 3SHFA 1ZD9A 1KBOA 1M5TA 4NXMB 4LDRA 1E2QA 3BSSA 3F6RA 4H2DA 3IAYA 2IW5A 1VDMA 3W5SA 5KYGA 4DBVO 3JVIA 1EFAA 1E4YA 4RUFA 4HH3C 5CCEA 2PUTA 1QU3A 3FSGD 4JIMA 4EGSA 1OT5A 2HH9A 1B3QA 2E87A 3BKXA 3EIQA 4B35A 1THGA 1SOWA 2QW0X 2C5FA 2QTNA 5JMOA 2P2CA 1YR9A 3M9LA 1H2WA 1E2KA 2I4IA 2O23A 4DNXA 4M1SA 2XOKG 4NWOB 4Q37A 5HZHA 2Z8XA 2AX3A 3DGFC 2B1RA 5EVCA 4F3CA 2J9FB 2P9FA 3E9QA 1R6UA 3IFXA 3CR7A 2I2AA 1GLNA 2AN9A 1SVMA 3R6LA 1CR0A 1WU7A 2WU0A 3CTPA 2CHTA 2VDLB 4J2HA 4ZO9A 1V6AA 2ZINA 4U3JA 4YWJA 4DPMA 5B6PA 3JAWB 1T5SA 1F2TA 3C7TA 1J97A 1FJGO 4KRYA 1JLRA 2GN4A 4YTEA 2VUUA 4AQYB 1NP7A 1YZTA 3KKMA 1GG5A 3L01A 4RBNA 5EBMC 1GK9A 5E1DA 1V47A 3ENNA 5JQGB 5IT9N 3SNHA 3I1JA 1RHJA 3RYHA 4K1XA 5E7MA 2XDYA 1C4KA 4GIBA 4JUCA 1ONBA 4FJ1A 4JI5B 5HM8A 2DWOA 5EP1A 3LXUX 5HF8A 3BXZA 4UHKA 5MGBA 1HSOA 1TU0A 1ZESA 4ZHQA 4F45A 4OXIA 4I6JA 4HNGA 3K58A 1FFGA 2C54A 3LDGA 5JNRA 2IBZH 3PEVA 4JB8A 3LDFA 2ETVA 4CIBA 1C50A 3QEKA 3NZEA 4OM7A 1Q3EA 3L1IA 2PX6A 3VO8A 4LJSA 2GS9A 1ZWLA 4BLSA 4ZV9A 4OLBA 4D0NA 4ES6A 1V8BA 2I62A 4OJYA 4GXRA 3WK4A 1TJPB 3ET5A 3L6OO 4DQKA 2B34A 1TFUA 5EKUA 4YMGA 4TZ6A 3E5HA 1XEAA 4A8PA 1Z37A 4CEHA 3W3AD 4C3VA 2QL9A 2CH7A 3VVCA 1IIBA 2WIFA 4D7SA 3C7KA 2DJVA 3I6BA 4D3SA 3KSBC 3AKEA 3T6KA 4B8WA 1AUVA 1VP9A 4Q3KA 2JHGA 2CW5A 4FFPA 1JPXA 3CCJF 1XNJA 4MIEA 1SZTA 1CQWA 1BE6A 1GITA 3F6PA 3OQ1A 3GLIB 2W98A 2HF9A 2Y05A 2GZSA 2H4ZA 4JHLA 4JI4O 5BSRA 3UQZA 1HH4A 3F6YA 1P3DA 1EFPA 4MVJH 4FYIA 1S8FA 3DF9A 5C3UA 2UUAO 4KFUA 1NY6A 4HADA 1J70A 2DRIA 3OCVA 2GBCA 4PG6A 2BGJA 1LSSA 1X7PA 2C0PA 4RZ3A 5U4XA 3EG9B 1NLMA 4BMCA 3UCXA 1AF4A 4PONA 1V45E 1NV9A 4H4EA 1H2SB 1TK3A 3UYKA 5ILQA 2JGRA 5EZYA 4TVOA 2QUZA 3HXTA 4IIJF 4ITRC 5IMSA 3HXQA 3SYQA 1OH6A 1H22A 1JQJC 3PTZA 3ZW8A 3OUFA 4BVTA 1MN6A 1Z2EA 3H8WA 1IATA 2GPBA 2QX7A 4FZ1A 2RHDA 3H5IA 4QG7A 3FJ1A 1FU8A 2KKWA 4I9QA 2Q5LA 1R9GA 3EVCA 4UUNA 3K2BA 3TUIC 5A3QA 5LJIA 1KETA 2XI4A 2XUAA 3C3PA 4NTWA 1FU7A 2O3RA 2IWHA 3ESZA 1AKYA 1VP7A 3ZI4A 5IKXA 3TNJA 3OGIB 3SYMA 4J16C 2NV0A 2JGUA 2FGJA 4IWNA 4C5BA 2HJSA 1EEHA 2C94A 1Y9JA 4DL9A 1I3OA 2GO7A 5CJJA 5EIBD 3QUCA 4B6JA 1DHRA 3FB1A 4KP4A 4WFGA 5ICSA 1RJWA 5ALIA 3LQ1A 3FOWA 1SMKA 1XELA 5CRIA 3GEHA 3EISA 4MVYA 2C5BA 3U3RA 2OD2A 4I1VA 5ALLA 4OKIA 4MRSA 4BOYA 1Z63A 4LJRA 2LJ2A 4F6LA 3CCRV 1Z2NX 4V0NA 3DZIA 4CU2A 5IJ9B 4UDYX 4RQBA 3A27A 1TD9A 4Q1BA 2MDTA 3JSAA 3ER9A 2BVNA 4P84A 1F14A 5LLTA 4GOXA 1FFYA 3AI1A 3IEWA 4G1CA 3RRBA 1EM6A 3M6MD 1F0KA 1Z88A 3C7DB 4FYKA 3M6UA 4XVQA 2W6JD 4LMAA 1HX7A 1Z2GA 3SJQC 2Q2QA 3A0HZ 4US0R 1YQWA 2Y2VA 1JEYA 2WY2D 5AW6A 1QVZA 3BE8A 1KMQA 4NZOA 1EK5A 1VMIA 3B3AA 4I3HA 3EOZA 1ZN7A 3VKVA 2PA3A 2NTJA 4IIHA 4DFDA 5EA2A 4ZCTA 1LDBA 2XYVA 3CGGA 4KIGA 1WVGA 3ZOZA 1SCAA 2Y1FA 4LF8O 1RXUA 2ON6A 1DDGA 5ENDA 3CMCO 3AW9A 3BMOB 1JEQB 3L4EA 3ZWBA 2C97A 4Y9UA 5AJHA 3D7MA 1F7YA 3OU2A 4TROA 4DZZA 4ALMA 5DW0A 2XBUA 2ZB3A 2JLBA 3LZ6A 2UYYA 4IJMA 2FI1A 3SVTA 3RKUA 2JGEA 2Z09A 5AG2A 3OX3A 2GA8A 4KFTA 3BWVA 3UOWA 1FJHA 1J09A 3PUYA 4B73A 3QWIA 1SCDA 3D5TA 3IP6A 5KJ1A 4GPBA 2XTZA 2E21A 2CC2A 1M0TA 1H3EA 2H3EA 2LBPA 5AI4A 4G6ZA 3H5WA 2Q3EA 4M0UA 4UV9A 5FTJA 3B6EA 3EEFA 821PA 3SQMA 4J42A 4DW1A 2YINC 3IHLA 1IBCA 3F7TA 4NNOA 1KJ9A 2D2EA 2HLNA 1T26A 3CYFA 4L6CA 4BWVA 3DZDA 3UXHA 4BP3A 5C46F 3WWOA 1JU4A 2CNOA 3K12A 2NO4A 4HJRA 4QIHA 3N8KA 4LKOA 4QPDA 4LGVA 2P3LA 3JZFA 2J3DA 4ZU6X 1HYBA 2C3MA 4WNYA 4MYUA 4M88A 4C0XA 2AVDA 4BLVA 1G18A 3MCAA 3LVQE 2AA3A 1NASA 3ABUA 1KZ4A 2ASEA 5DLQC 3CX3A 1LEHA 1LBHA 4D8XA 1P77A 3I1IA 2C3YA 2X8AA 3AR4A 3SKVA 2QLMA 2VHVA 3DMTC 3QOXA 5U1PA 1RPOA 4MTCA 2HC9A 4ZRNA 1SVOA 1Z83A 1PQ4A 1YDWA 1XK7A 4C6RA 3PQ8A 2BSAA 1VF5B 2VZLA 3A32A 4J4HA 1I5YA 4CKEB 3GLIA 6REQB 3EXAA 2JGNA 3R24A 2PSFA 1E2HA 1SFRA 4RA9A 1H8HG 3CNOA 2PZKA 1IXZA 4GOKA 2CLOB 5B3JC 1VQ7F 4RVUA 4BNKA 4RE5A 2C4WA 2OBXA 1SXJE 4OKNA 2VHCA 3IIIA 5FR1A 5FPOA 4XDHA 4BVRA 3M6LA 1PS9A 1O96A 4ARZA 1QRUA 4KJXA 3T80A 2P7TC 2XCOA 1MGPA 1QIJA 2IYOA 2YS8A 4X1KA 1FMCA 1XMSA 4J43A 4MVWA 4D0RA 4S2EA 3A1FA 5FV4A 4GCZA 3GWOA 3UIEA 3PLRA 5CIWA 2WZDA 3GLHB 3I1YA 4IG4A 2GWRA 3DR5A 3VTKA 3HR8A 4QAQA 5K51A 3G9ZA 1DT3A 2PKEA 3HG7A 5CFOA 4W1SA 1CUDA 3AVQA 1W4RA 4EEXA 4NCAA 3BSFA 2UYNA 2W58A 1WNFA 3EW9A 4LHZA 3WNBA 3KKOA 4GLFA 3VDNB 2PMDA 4RVDA 2VJDA 3D0KA 3R3YA 1YI2F 3GF4A 2YDYA 1S3SA 1V9LA 1XNRO 5JYEA 2NO1A 3HFGA 4F8EA 3JAKA 1HG1A 2JK0A 1L5KA 5LBQA 5TQ2A 1UAYA 2QBYA 1Y1SA 4Q1DA 2H1WA 2W6ZA 1QKJA 4HGOA 2P6PA 5FBRB 1N0VC 4JOCA 1M9NA 4KFMA 1QZXA 3EASA 3K59A 2DOKA 1UXJA 2IHNA 3WGVA 4AMBA 3A3KA 1DT9A 1A1SA 3E8FA 4ZQEA 2CXNA 1SXIA 2YHUA 4AMUA 2I2WA 4GVLA 1YB7A 5HGXA 1OGJA 5G0VA 4Z4EA 1S0VA 5EZSA 5KYUB 2YNMD 3AIOA 4QWWA 3T9EA 5EE1A 3V4DA 1YJ5A 1I7LA 1MO6A 4PINA 1PGNA 3HACA 5B7QA 2CDYA 2HQBA 3NWEA 1GVNB 3R8XA 3QO5A 1ADJA 1ST3A 3TQSA 4O5AA 2C4UA 1WZCA 1QBGA 1U1CA 2BM9A 2V9CA 3AZOA 1CP2A 3LOPA 3MUNA 3WGZA 3AGKA 2VIIA 3QA3E 4WKCA 2V1DA 2WT8A 4WK0B 3STHA 4FC6A 1W8DA 3ZOKA 1A69A 1YR2A 2HI0A 1R18A 3ACCA 4LYGA 4PANA 3VI4B 1GADO 3OKAA 5HCUA 1M2EA 1RWXA 1NH2B 4B7UA 1XJCA 2CGOA 1RPJA 3NHLA 3BXEA 4CLOB 1SU8A 1RLIA 3PQCA 1L5FA 1HOXA 2ILVA 4I9HA 3ASOC 4ZDIA 3IJEB 4L2IA 3HM9A 3RODA 1GCUA 3UK0A 1RKQA 4TYPA 5FTWA 4B2PA 4QUJA 1FDRA 5FBQB 5KOHA 2H9AA 4MARA 2VSFA 2QN7A 2DQ0A 3LG2A 3MBIA 5E38A 4EB8A 3GMDA 4XVCA 2ETXA 3M2TA 4D25A 5AK3A 2WWIA 1RIIA 3IBGA 1SD1A 4EPRA 1BX3A 3VKUA 4EJSA 5I7RA 3RSFA 4U8HA 4G01B 3STXA 2FX3A 4CF7A 3BFVA 2NU9B 1DWQA 3UW1A 3CCSF 4F06A 1W88A 3O1IC 4BQNA 2XZLA 1FDSA 2HNBA 2RB4A 3OICA 4QHTA 1XNHA 5A9TA 4TLMB 4X88A 1K73W 1LVHA 1E3IA 1Z39A 1WHTA 2HBYA 4RHAA 2ZRHA 3NAZA 4H7IA 3K5WA 1KC8W 3ROGA 2JEZA 4ITUA 4FLZA 2I33A 1LSOA 2EEZA 2O0KA 2QN1A 3GRFA 1EVLA 4G1EB 4IGFA 4F4CA 4O2LA 4PAQA 1YCIA 1OPRA 4CN8A 3ZDAA 3HCBA 7ADHA 4K3AA 1MR3F 1HE2A 2AZDA 2QEQA 1RJDA 3N6VA 3NORA 1Y3HA 3QMMA 4NYJQ 4P4NA 1P18A 4WERA 2CVLA 3H9BA 1X7GA 4IPTA 5FI5A 3W6NA 1R0ZA 1W36D 2ZOVA 1XF9A 4BFLA 2FMTA 3BEHA 3NTRA 2C58A 2QD2A 4FGJA 1HY3A 2UZ3A 3Q7SA 4MUXA 2BGGA 1EX7A 1VPWA 4Q82A 3AOEC 4L16A 1EU1A 4CMHA 2N46A 3AM1A 1W42A 2ZYSA 3QX8A 4MYSA 1IJKA 3VU1A 2WG0A 1MJFA 5EC8A 1XTKA 5ALZA 4F4FA 1SXJA 4R9NA 1CS4C 1PE0A 2QAGB 3L7AA 3UMFA 1W85B 5K0TA 1VLJA 3PHGA 4AJJA 1YE3A 4V0MA 2I80A 3GLHA 4RGQA 3TSYA 2BJHA 3FHJA 3IAS6 2CMKA 4OSEA 5JCJD 1GPLA 5FULA 4X6XA 2F17A 3T5PA 1U0FA 1C7RA 1N3BA 2J31A 4V2UA 2UKDA 2G7ZA 4HZUB 5EI5A 1T5HX 4EVIA 2J3MA 2J48A 2QTSA 2W0SA 5J2TA 3C74A 3I83A 5JU6A 3U60B 1VQOF 1DSSG 1Z6ZA 3WS7A 4DV4O 1P17A 5I4IA 5JEEA 2J3IA 2ZYUX 3ZDRA 1US6A 4EGQA 3U7GA 4QELA 5DGCA 3WGJA 1I2DA 1YS6A 3KCXA 2NACA 4XKJA 1R00A 4P35A 1X9IA 1JKMA 2CNDA 4B2IA 3L70H 3DW3X 1ESMA 4ARBA 1WX1A 3L6CA 2EW1A 5AKGA 3FFQA 1HQDA 2XB6A 5AI5A 3S2UA 4FLXA 2Q0HA 3RM3A 4Y1GA 3KEOA 4HTFB 2CB9A 1OA1A 3BB4A 3OE7A 3EGDB 4LNUB 4LW8A 4XUGB 1E2UA 1HPLA 2G5TA 3PC6A 4Z9BA 3VQVA 4TMYA 4BEJA 4R50A 2JLUA 1C1DA 4R01A 2IXGA 3NTQA 1PSWA 5KOYA 2H5LA 4YCDA 1ZM9A 3T3EA 4OHBA 5KYWA 2B9ZA 3C9SA 3U37A 3JASA 1QO7A 3D4OA 3FNBA 1P4JA 3L84A 5J5CA 1J9EA 4FFMA 4KO8A 4HEA6 4KIWA 3LNNA 2R8ZA 4QU8A 3BHNA 3Q3VA 5BWMA 5HUHA 1A9SA 3IELA 3F67A 3AUUA 1E6CA 3ORQA 4MR7B 7REQA 2P0EA 2GOYA 2Y4OA 1JMVA 1YC2A 1XZNA 2NIPA 1ZIPA 3AFHA 2OC9A 4C3UA 3KD3A 4YRKA 1JGTA 2HMAA 1P1CA 1R3IC 1L5RA 2G9NA 2GTAA 3U44A 3ADCA 2OTCA 3ETDA 3EA5A 3ZMVA 3ODPA 3GYQA 4GKKB 4RZXA 2WB2A 4QUGA 5JRZA 1EM1A 1ZW6A 4L3WA 5EO3A 1BE8A 1KAOA 5E6UB 5BUZA 3MDOA 4NDAA 4PYKA 3FTFA 1YIOA 2OO5C 4S24A 5T4HA 2RG7A 1M2VB 1NJFA 2XKBA 4I14A 4OI2A 3T9CA 1LGYA 2D0OB 4KBYA 5CAEA 5ALKA 3SPXA 4AKTA 1M66A 3PG5A 3O4HA 4M9UA 3EG5A 1G1MA 3LLSA 4UD6A 1C81A 1MUUA 4QO7A 2Q73A 2EATA 2O8EB 4TMXA 2CFCA 3DMGA 2A06H 2WDZA 3AINA 4DRXB 3I2YX 3N75A 3WWYA 4D1YA 3T3NA 3VYTC 5JLJA 3JQQA 2Y4NA 3VOTA 3B1ZA 1Q1QA 2IUYA 4ON9A 1NPDA 3D0OA 4UZSA 3U4MA 4EAQA 3IKEA 4OHRA 4QM7A 4V2IA 4ME6A 4BL5A 2GUZA 4G4YA 2H3HA 4K1LA 5CX1B 3F9CA 1UFOA 4TMZA 4GPEA 1YBMA 1H2HA 4I1RA 5ARCA 4E1VA 2VGNA 2ZT6A 5A2GA 4IIVA 2QQEA 2E5LO 1L4LA 3D64A 3P4XA 2ZF8A 4MOWA 1TCAA 2JFPA 3SMVA 3ZWYA 1JXMA 4LJ5A 4EUHA 4JQZA 1P7WA 3WLOA 1K7CA 1KFCB 4E15A 5H16A 1U0HC 3GIWA 1A50B 4FDMA 3DULA 1DMRA 4JVOA 4C6TA 4CEHB 1E2MA 3DTYA 4KVAA 3CBQA 4FR5A 1FS0G 1E61A 1VRCA 2XUHA 3H75A 4BJ1A 4I08A 5JANA 3QEAZ 5LHGA 4J7KA 1QWSA 4OYLA 4OK3A 5FWYA 3SKXA 3LT4A 2V8OA 4RHFA 4N5DA 2AR9A 2J0EA 4IXDA 5FF9A 2UYKA 4ZYXA 3QE4A 4KITB 2NU8A 4KREA 4BNZA 2YV2A 3EH2A 3BA1A 5AJVB 1MTOA 1GV1A 3G5TA 2DU8A 2XNJA 4RAQA 4J0DA 3KR9A 4D56A 3E7PA 4UBJA 1XU4A 4N3CA 4ABTA 1G16A 2Z1NA 3M4SA 1XRGA 5KNCA 2EJ7A 4N5HX 4Y1RB 2DULA 3HPRA 5IVIA 1RE0A 4F3KA 2OVBA 3S0YA 2ODAA 1FFDA 1WW8A 4OMDA 4P4SA 3W1EA 1AJQA 2W22A 4BB6A 1O0SA 4RAIA 1E5LA 4UCWA 2A9HA 1O6GA 4J1TC 5LQKA 2OFFA 2AR0A 3SPIA 3BDVA 3GWGA 5AOBA 1RNLA 1RYBA 3NDBB 3UZUA 4HRAA 1T3ZA 3WG7C 1GX1A 3W5HA 2XMRA 3I55F 2A5FA 2DT8A 1UDXA 3ANSA 4HD8A 4NG4A 5D87A 2GCGA 2RGNC 2ZNJA 2Q2VA 3EEIA 3BD6A 3SDZA 4KXXA 2D2IA 3IAFA 3FPGA 1CQZA 5BW5A 4ER7A 3SQNA 3WJRA 1BCRB 3QVNA 2ZBUA 1PTJA 1KO7A 4HB3A 4B9AA 2QXYA 3BOSA 5THXA 3SCZA 5IT4A 4NE9A 3UN1A 4N7JA 5G0UA 1QQTA 2QYSA 4HNSA 4AKGA 5GAPK 2BO1A 2Z0AA 3EEYA 4D4LA 1FFAA 1XJ0A 3T1YB 3E1YA 1YIAA 2P79A 2V65A 2WA1A 3OZEA 3QZUA 4KYVA 1F0YA 1R0XA 2DBVO 3GJ8A 4A2CA 4C4XA 2EKQA 4IUCS 1W29A 3WRYC 3ZS8C 2GO1A 3KU1A 4QXQA 1V7PC 2YFYA 3QJGA 1QR8A 3K0GA 5EWLB 5CA1B 1ODIA 1EN6A 1IDOA 3DLIA 3GEGA 3PPVA 3CX8A 3MWGA 4I6EA 4QE3A 4HYEA 1UH5A 2HDOA 4LI3X 4PI2A 1GGMA 1GQQA 1RRFA 1OAKA 2OSVA 2VSYA 1V4VA 2Z0MA 3ZGNA 1TECE 2NVWA 3P7MA 3RRZA 5JRDS 4WEQA 3BHJA 3H83A 4L57A 5LZ9A 2AQ8A 2PUVA 3PT9A 4R6XA 5C5DA 5EQJB 3O3OB 3COVA 1Q1ZA 3OU7A 1Y5NA 2WU8A 4OUDA 4BNUA 2R97A 3OE4A 4HFNA 4HRYA 3I56F 4MQUA 4UAVA 1G8AA 4YMWA 4AG6A 4D3ZA 2FVXA 3WP0A 5CU7A 1SR8A 2CFTA 4GW3A 4LMBA 5D01A 3ZW9A 4QIWF 3FHOA 3K70D 3VNQA 1B15A 1XZFA 1BWRA 4RD2A 3R9KA 4TN5A 4CKWA 4RMIA 4XAQA 5FO0A 2PNJA 1M6NA 3O6VA 4NZ9A 1NW4A 2OHOA 3B3JA 4BBAA 3CC4F 3IQGX 1MQ8B 3K5OA 1W19A 1ZGJA 3HA2A 3I6IA 1ZRNA 4Y6OA 4P9OA 5LZ7A 5GP1A 5IHXA 3G85A 5FUBA 1N25A 2ZDGA 5A4FS 3CISA 1KU6A 4DMFA 2A14A 2PQ2A 1WXDA 4ACBA 3AEXA 2F9MA 1BG6A 4GOND 3GAAA 4HLCA 4V0OA 2IOYA 2Z43A 3JYOA 2PKCA 5ER6A 2YW9A 3TVYA 4BO4A 2ZXEA 4CM4A 5AVWA 4TT8A 4CE6A 5GIPC 4DV7B 4JITA 2O52A 2QL5A 2QJFA 2H8CA 1XRLA 3KELA 1GYPA 4ZP1A 2VTBA 4CKCB 3MTIA 4N39A 1PK8A 2F93B 5ESDA 1K7FB 5IVKA 2HDNB 2EWMA 1HDEA 4PNHA 1QCYA 5FB3A 1SUAA 3FX7A 2DSNA 1Y6XA 4RVGA 1Y80A 4GPZA 3FDIA 1Q81W 4JI8O 3D3QA 3ISTA 4FCVA 5L3BA 4Y2TA 4C21A 4J3FA 3T2MA 3GIDA 2B7BA 3TSAA 3MMNA 3PDCA 2ZIMA 3ABKC 3D4NA 1JAZA 2DFKB 3ND9A 2R0QC 3IULA 1IZ9A 4H1UA 4HDNB 1Y82A 1U2SA 1S2LA 1FIUA 4CKBA 1WNTA 5IARA 2GN8A 3GY0A 2ZUVA 2RGWA 4C22A 1ES9A 1PDWA 5ALYA 2P5OA 1POWA 2BT4A 4FBLA 4DMKA 5BSKA 3WWZA 3HYRA 4ZYUA 4DIBA 3EIUA 3SX2A 3SDLA 1DS6A 3OY2A 3QM1A 2H7XA 4FFNA 1C0IA 4D41A 1E2IA 2FUKA 4RELA 5I4KA 4CBCA 3EEOA 3LX4A 1JI0A 4I55A 3SIUA 2H94A 3ANTA 4IX9A 2OORA 3KEMA 4IXNA 1DKNA 1LDNA 4MQ6A 5CVJA 3LWOC 3SIVA 3G82C 2WTAA 3HQ4O 3PDIA 4IRUB 4R16A 4WN9A 4YP5A 5IAEA 5IDYA 5K4GA 4IT5A 3QSYA 2CHUA 3SZGA 4W9NC 4BATA 5CDGA 3FB7C 1OI4A 1EYZA 1TADA 1WZEA 2IEIA 1C0KA 2ZU0C 1N9GA 3E2PA 4Q1CA 5G4LA 2QD3A 2EZTA 2QVXX 2VXCA 4BB9A 3A0UA 2YZMA 5C32A 2CY0A 2FWBA 3OC0A 4WESA 3KXDA 1DADA 1WPGA 2VPWA 2X14A 1OQAA 3AVPA 4NK4A 3C9UA 2H00A 4P92A 2RHGB 4RANA 1V95A 1YTFD 1LB1B 1PRYA 1YKGA 2RD2A 4IM7A 5H4GA 1Y8RB 1LTHR 3AG7A 1KYIA 1ZQ1A 2JF0A 2JJ2D 1BXZA 1U98A 2ZS8A 1Z5UA 4H0LB 2ENWA 4PYNA 4Q4JA 1T3GA 4R81A 1IV2A 1X1TA 3PJFA 2CK3G 3ZX6A 1NVXQ 3DHVA 3R5XA 4TS3A 3LL7A 3PXBA 4LCKA 4Y9RA 4HBGA 4ZHSA 2HOQA 3L93A 1I7FA 1OFVA 2QLLA 3RSGA 3VSAA 5C35A 2E48A 4UXNA 5DDIP 2EWVA 4I5SA 2JGAA 1PJLA 2C3PA 5L4SA 5K3OA 1KC3A 3ANMA 1EWVA 1E9DA 2IXFA 4PHCA 3W05A 4J11A 2G1UA 2Q3MA 3ZEDA 4DUYB 4L0DA 2GXAA 3V7FA 4GEKA 4DQLA 2PYZA 2O4UX 1IOVA 1FS6A 3D7SA 2WW8A 1DL5A 4P7GA 2R7MA 1DGSA 5IBRA 4BNDB 4C43A 1PEAA 5BW8A 2OILA 1YF3A 5TLSA 2B8WA 5DPMA 1EEXB 2J08A 1RRGA 2H1FA 4UU7A 3VX4A 2XTNA 1KI6A 1YQUA 1C0EA 3OM9A 4R1SA 4R2WA 3A4TA 3QV1A 3L06A 3D6JA 2P9HA 3ANYB 2EZPA 5AFSA 3UKMA 1RZVA 2D4HA 1Y48E 1X4TA 4X20B 3DOFA 3U9SA 4CNBA 5LL6P 1N8RH 3DKIA 1UQTA 2PJUA 1OIWA 4QUBA 2HKIA 3TLGB 4CM7A 5ICCA 2JJ2A 3RT9A 1GAQA 2ATIA 3TQTA 4CV0A 2VJOA 1SXHA 3QY0A 3ZRWA 3F6MA 1O97C 4ZVKA 2GH1A 3IE0A 4K6KA 4FFSA