3JASB

Cryo-em structure of dynamic gdp-microtubule (14 protofilaments) decorated with kinesin
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
426
structure length
426
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tubulin alpha-1B chain
publication title Mechanistic Origin of Microtubule Dynamic Instability and Its Modulation by EB Proteins.
pubmed doi rcsb
molecule tags Structural protein
total genus 158
structure length 426
sequence length 426
chains with identical sequence D, F, G, H, I
ec nomenclature
pdb deposition date 2015-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3jasB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 3jasB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 3jasB01
4I4TB 5LYJB 2RHOA 5IYZB 4X1YB 5JVDA 5CA0A 4DRXA 3JAWA 4EI8A 5JCOA 3RYFB 5MN6A 2R751 4TV8B 5GONB 5C8YB 2XKAA 3E22A 3RYHA 3WGMA 4O4JB 4YJ2A 1W59A 3ZIDA 3HKCA 4FFBA 2GVIA 3HKDA 1JFFB 4X20B 3RYIB 4F6RA 3RYCA 3UT5B 5J2TB 3JARB 3JATA 4EI7A 4U3JA 4EB6A 5KX5B 1FFXA 5JVDB 1OFUA 3JALA 1TVKA 4TUYA 5LP6C 3JAWB 5IJ9A 5LOVB 1RQ7A 3N2GA 5LXTB 3VPAA 5CB4B 5ITZA 2XKBA 4ZI7A 4I55B 4IIJB 4YJ2B 1W5AA 4O4HB 4FFBB 3JAKA 3HKDB 5KMGA 4LNUA 4O2AA 4ZOLA 3RYCB 5FNVA 4M8IA 4F6RB 4YJ3A 4IHJB 2BTQA 4EB6B 1TUBA 5EZYA 4X1KB 1TVKB 5JQGA 3WGLA 4ZHQA 5EYPB 5JH7A 4EI9A 5IJ0B 1Z5WA 5CA1A 3N2KB 3V3TA 4TV9B 1SA0A 5LA6B 4WBNB 1W581 5BMVA 4U39A 4O4LA 3ZBPA 2VAMA 2VAPA 3M8KA 2R6R1 5J2UA 5KMGB 4E6EA 5LP6A 4I50A 4KWEA 3ZBQA 5CA0B 4DRXB 4X1IA 3HKBA 4YJ3B 3E22B 3RYHB 5EIBC 3HKCB 4XCQA 1W5FA 1RQ2A 1Z5VA 2RHHA 4O4IA 3HKEA 4I4TA 3CB2A 3JASA 3VOAA 5IYZA 3JATB 4U3JB 2RHLA 3C8LA 1RLUA 3RYFA 1FFXB 3JALB 4TUYB 5IJ9B 4TV8A 5C8YA 3N2GB 3M89A 5ITZB 4O4JA 4X1IB 4ZI7B 1W5EA 2VXYA 5M7EA 4HNAA 3VOBA 1FSZA 1JFFA 4X20A 3WGNA 2Q1YA 3JAKB 4LNUB 4O2AB 4ZOLB 3UT5A 5FNVB 3JARA 5J2TA 5MN5A 3JASB 2Q1XA 4O2BA 5KX5A 2BTQB 1TUBB 5LOVA 5LXTA 5EZYB 5CB4A 5JCOC 5JQGB 4ZHQB 5JH7B 4I55A 4IIJA 2VAWA 5CA1B 3VO8A 4O4HA 5EIBD 5LYJA 1SA0B 4X1YA 5BMVB 4O4LB 4HNAB 5J2UB 3WGKA 5LP6B 4I50B 5MN4A 5GONA 4IHJA 3RB8A 4O2BB 3HKBB 3WGJA 4X1KA 1W5BA 5EYPA 5IJ0A 3N2KA 2RHJA 3R4VA 3RYIA 4B45A 2BTOA 4TV9A 4DXDA 4B46A 3VO9A 4WBNA 5LA6A 4O4IB 3HKEB
chains in the Genus database with same CATH superfamily
3ELUA 4EYOA 3MSXA 2Z6VA 4P30A 2AFIA 3UO8B 1RCFA 5CPFA 4QTTB 4LZOA 4L57A 4H7KA 1L7PA 1I1HA 1OXMA 2YJ6A 4Q0MA 2WF9A 4BVBA 3RSQA 1KFCB 5CMLA 3DTUB 2VDPB 3Q0EA 3HBJA 4EB3A 1FFBA 3ZWWA 3P19A 2I4NA 5LN1A 1OF1A 3I23A 1UCFA 2B35A 2VQFO 3FHJA 3LF1A 1PJLA 2C04A 4HH0A 2APJA 3C6XA 3K12A 4JLSA 3HA7A 2BE9A 1R8QA 4QTUB 3FAVB 2XE6A 4BEJA 3OJOA 3DVLA 3LFHA 3EUAA 3GV0A 1WD7A 4KIUA 4JA2A 3SJQC 3RN4A 4IJQA 3ZR4B 4B73A 1QHFA 3K72B 3BWXA 4A82A 4ZOCA 3K79A 1VYHA 3GDWA 2HXGA 2QV7A 4RFLA 3WLNA 4BGUA 3RVLA 3FZGA 3R7AA 4D0SA 3K70D 3KVYA 4UD2A 2QTOA 2XQFA 4TLEA 4I55B 3FJOA 3OMXA 1L5MA 4M1MA 2UVQA 1G1MA 5H3HA 2ZCVA 2OSVA 2JIZG 3GFSA 3PYMA 8AT1A 4N54A 2PT9A 1OV9A 4RK0A 4UUBA 3JVDA 3ZDXB 4DUZB 5A05A 1FK8A 4YRIA 2YXNA 1AO0A 1KJ8A 1M8KA 1Z2CA 4EG4A 3L7JA 4J90A 1UMCB 3NEAA 3L93A 1ULZA 5TS2A 1JSLA 3N7TA 1ZOSA 1AZWA 5KTPA 1P80A 4DR5O 3INNA 3GLFA 3TS1A 4A1OA 5EJ6A 1G1AA 1ETHA 4M4SA 2ZRMA 4PHHA 2ZCJA 1FYWA 5HZHA 3RBAA 1LPPA 2ZUEA 5EC8A 1GTG1 6LDHA 1IDSA 4HQRA 1IV3A 2XZDA 3GP5A 4RTQA 4BNDB 2Q4TA 1VCMA 5TS3A 4LTMA 1VHDA 3ETDA 2Q3MA 3BXOA 1V8OA 1R37A 4KNYA 4DDUA 4JGGA 3CEPB 1JJ2F 5CN0A 3TLZA 4BLVA 3J7TA 1VBKA 2M6RA 5IM4A 4MVJD 10MHA 2PLNA 4ENTA 1NDQA 3OY2A 3T3GA 3K6SB 3E18A 4IIXA 3ZDFA 3KHSA 2FUKA 3AB7A 3B3GA 2HLDA 9LDBA 1S7CA 4ABTA 3P27A 4CTJA 3V7NA 4Q20A 5T57A 1KDRA 2XI4A 4GMFA 1H0KA 3CXCU 1WXDA 4G0UA 3CLRD 4P9OA 5B7GA 4WN9A 3I05A 1YVPA 2AA3A 2XOKA 2KB0A 1CJVC 1VG1A 3R7BA 3V6MA 5T8KC 1W52X 1R8JA 4TL6A 5J23A 2FYUH 1KXZA 2HJGA 5AW7A 5J2TB 4DE5A 4QKQA 4OHXA 3QTYA 1E8DA 2OUIA 3TL2A 3Q1KA 3H0CA 4H1UA 1L5YA 5ETJA 4KUHA 2FP4A 1YXMA 2FPUA 4GX1A 3IPLA 3IIJA 4ZJUA 2PVCA 3GARA 3WU2Z 3R4CA 2G38A 2XWSA 1T9DA 1B6TA 1BXRA 4LY6A 3PFBA 4RH3A 4ZHYB 4I8IA 4HB3A 3AP3A 3OIUA 4X6YA 1CXZB 2GBIA 4R3UC 3O8OA 2YUAA 3COJA 2GFQA 3DOCA 1TVCA 5AW4A 1PS9A 4G5YA 3ZW7A 4MQBA 3WQSB 4W63A 4FMCF 4Q24A 1IY2A 1PU2A 2OBXA 2RHRA 3MIIA 1N1GA 2L82A 3LZ6A 3L02A 3E1SA 1KWGA 2J7KA 5T6BA 4B34A 3A6DA 3PFKA 2J0VA 4N7JA 3P1JA 2G76A 4Q39A 2FLKA 5GIOC 1Y76B 2GLTA 2QRNA 4K7JA 4KV7A 4Z2AA 2ZNJA 3NTUA 3NK6A 1H1TA 2V6GA 1IC6A 4TSKA 3QXHA 2RI6A 2NAFA 1CCWA 2OCPA 5FI1B 3SD7A 1T1JA 2OL4A 1V7CA 1G8FA 3IUEA 2JGEA 4LFBB 1B4DA 2V8BA 2VP4A 1Z6YA 4U7GA 3SBDA 3LP6A 3KKZA 4J0GA 4TLDA 3K0SA 5D2CA 5LBQA 5IJ9B 3HWUA 5JEDA 2FMKA 2NP7A 2ZXUA 1SUAA 4G1BA 2IA5A 3RM3A 2QMEA 2IKSA 3PDWA 1E4EA 5AKZA 2QRVA 5AVJA 2F48A 1Y33E 3W9BA 2BMJA 2NO7A 1SXJC 2KLBA 3V8QA 2YVAA 3AUSA 1GFIA 1GRJA 3F9RA 5GINC 3K0AA 1U8FO 1E7QA 4HVTA 4KHZA 3I28A 3CEHA 3HKDA 1BU5A 2IU6A 4YRMA 3V8BA 3N0WA 2BMVA 2YY7A 4HWSA 3INYA 3G2JA 3IMFA 2WTBA 1XI1A 3SJUA 3WYBA 1IXBA 1E79D 1E6WA 4FFDA 1JAHA 4M1TA 3U81A 5JNWA 3SIXA 4FYPA 3GWZA 3QEBZ 5K3BA 1X14A 4DR1O 2XUFA 3KOZA 2F3UA 2ZJ1A 2WT8A 4PSVA 4NBKA 3ZVKA 1XAGA 2VYFA 3SVZA 1OAAA 2C0PA 1OGJA 5EMJA 4QASA 5JECA 4GE0A 3NVMB 5BN5A 4C3OB 4OBWA 4Z4GA 2NVUA 2BCJQ 5JFOA 1F0NA 4C2AA 1JAIA 4MW5A 2Q46A 2VJKA 3T4ZA 4D0LB 4LTNA 4UNRA 1NL3A 3SPCA 1IHUA 1QXSA 4JBHA 5CM8B 2VWKA 4GOMD 3CD6V 3ADBA 2CVZA 2GZ1A 5E4FA 3EMVA 3TUIC 2KM1A 2BSKA 1PGOA 2FG7C 4JJKA 5NULA 2C1XA 1O87A 3E3MA 3O75A 2MK3A 4L0QA 2B8EA 2XYHA 5CDUA 5ICMA 3RVYA 4LG1A 4NAVA 4EY6A 1VRVA 5JRDS 5HIJA 2ZI6A 3D5EA 3IUQA 2BFEA 2ZBPA 4ZKEA 4NCAA 5EXXA 1A5ZA 1ZJWA 3SVTA 1GPKA 3WG7C 5EE3A 1T8PA 4BLUA 1QJCA 2NV6A 4PC3A 1OT3A 4GNRA 1EGVB 3SCZA 4PELA 1BD3A 1NT2A 1XQ6A 4NCHA 4BKRA 3K53A 3IEMA 1N8RH 4F4JA 1EXVA 3DPIA 3HJWC 1IHDA 2FUNB 4CKXA 3WWZA 4WGGA 3CRAA 4O59O 3DUFA 1Z38A 1U40A 5CK5A 3WISA 4JT9A 5HBRA 1XX6A 2HWYA 2VHZA 2FX3A 3S8EA 2UYQA 1WXHA 1U3CA 3PXXA 2V1DA 3LBYA 1K2VN 2WJIA 1ZGHA 5E1BA 1ZN7A 2QN6A 4U9IS 1IWOA 1QNLA 1FY2A 2PHNA 4S2UA 4Z1VA 5DM2A 4RXMA 3VHRA 1KJQA 3DAHA 2IYLD 4F04A 2A06H 2B2CA 1E1RG 4XQ9A 4LW8A 4LCEA 1WQ1R 4OG2A 1IZ3A 3ICWA 5BSGA 2O3UA 3VR6A 4ZOLA 4KAFA 3G02A 2EQBA 3K08A 3MNFA 4C0BA 2RGXA 1AKTA 3RBXA 4D4LA 5D6OA 1B6QA 3T61A 4NTYA 4FR0A 3BTUA 3TEFA 2QW8A 4MHSA 4Z9XA 2H1IA 1W0KA 4MQ4A 2OHHA 4J2OA 4ER5A 5LMNB 3F90A 2AFVA 5LR6A 3VDNB 1P5FA 4HFRA 1ZR4A 4R8VA 2GK6A 1U2SA 3N39C 3LDDA 1KYYA 1B2RA 1SZXA 3PXBA 3VC1A 2PS3A 3AF2A 2FH5B 1LJLA 3QUSA 2QF7A 1B3RA 3O8CA 2QX4A 1XD2A 4NCKA 2G0TA 2ZJ3A 4TS4A 1BHJA 3V4PB 3RA6A 3HU3A 4OQMA 1TK2A 2CW5A 3NTLA 4PN3A 1ES9A 4B45A 1CIVA 4I2NA 5KTMA 1UFIA 2OM6A 3OU2A 4W9NC 1X38A 2AYXA 4BP1A 2FE4A 3IURA 1DAPA 5CVJA 3IPRA 4KUEA 4JYYA 2YNMD 3L8DA 4L22A 1DWOA 1W3EX 5KMGA 4C4OA 5IG2A 4XGRA 3NAMA 3R9XA 4HRVA 4PHZA 1A69A 2QRJA 4JOCA 1O7JA 4N8EA 4KKXB 5EJ4A 2PKEA 3T5GA 1YQTA 5AICA 3KUKA 2Z95A 1GNVA 4BX9A 4U2GA 1J9GA 3LYAA 2YJ5A 3G71F 1GZSA 1IM2A 5B3KA 1Y37A 1QG6A 1WB7A 2PZFA 3DE3X 3CE2A 3JWHA 3W3AA 4RLQA 1WUTA 4B5KA 1CHNA 2IEAA 4QGHA 1JJVA 4C7KA 3BDAA 2OENG 4JSRA 2IHUA 3QKWA 1GZVA 4GSLA 5F21A 4NBWA 4BCDA 4ZMRA 2CNOA 4JNCA 1YCDA 4LHZA 2VHQA 1A5AB 4ZYUA 2OXEA 4CTMA 1SN7A 3MXTA 4AMBA 4C8IA 1YRBA 1LFDB 3OTGA 3BQMB 5K3OA 3I56F 3THXA 1L7NA 1ZK1A 3JXEA 1EN5A 3RADC 4RD3A 1GSHA 5EZYA 5BP7A 4H0LB 1MC8A 1F60A 3AONB 1GCOA 1M6VB 4MLCA 1I4TD 3I01A 4IS2A 1G8YA 2P0AA 1YS1X 2MW2B 1A5TA 1Y8ZA 4E7PA 1Z07A 5LBTA 2CTPA 1JDNA 4LSMA 2YZGA 5CX1A 2NNWB 4XEHA 3T7CA 1U2GC 3W4IA 1M83A 3OIFA 1U2QA 2XMQA 3DHNA 5CT9A 4IXWA 2XY4A 1QDLB 1ATIA 2B5UA 1F0KA 1GD1O 1YD7A 3VO1A 2Z2YA 3D6NB 2W6JD 5DI3B 5EYPA 4RF4A 3DCNA 1IXRC 1U0EA 3GLHB 4LY9A 4MGZR 3UW3A 5KYXB 3UWPA 3H6HA 4QD3A 5FJIA 2I4OA 1BOFA 2RGDA 1NUHA 2FQ1A 1I3NA 4HVLA 3VSBA 2O8EB 1XHEA 1WOYA 2ZR9A 3IKVA 4FDVA 1TKAA 1FUKA 1JLLB 5LDDC 3MGAA 1Z7EA 1QFMA 2OYSA 4HMOA 1I1QB 5LM3A 2DHQA 1ZICA 5FL7D 3K0DA 4LWQA 3AJ9A 1Y6FA 3CA8A 3WLOA 1ZMOA 4Z1MD 2QVGA 4QLBA 4O63O 2AI1A 1FP4A 1FFHA 1XFAA 3DC5A 1AF7A 4XJXA 4C4YA 3KNZA 3FBGA 4N6NA 4GM0A 1NBMD 1YJWV 3QYPA 4OUDA 4DBZA 2QM4A 5AUQA 5H70A 4JQZA 3JD4A 2ST1A 3TQQA 3NMUF 2R6JA 4HZIA 2ZRCA 3R3VA 4IKPA 2WIKA 1IONA 1SCJA 4AJOA 4RSGA 2Z2XA 4PDMA 3VYTC 2QKAA 4RPCA 4WBNA 3PQFA 3OCZA 4IQFA 3HB5X 5TR9A 4D4IA 1FYJA 4XDZA 1WWKA 3LO8A 4YAFA 3GI1A 1E8MA 3AK1A 1AMOA 5B1OA 5C93A 5DBEX 1T0HB 1C30A 1VM6A 2LW7A 3D4OA 1E64A 5HE9A 1EVYA 4QJ4A 4WCFC 3JTMA 2J3HA 5LDGA 1J7JA 2Y9MB 2TECE 4TZ6A 4IZ6A 2HD4A 1LPBB 1O0BA 1OFVA 3BBLA 2B7BA 3Q3JB 5A9SB 3UWMA 3KUCA 2O8BA 4IIFA 2HA3A 3G8YA 4YHHB 1Y34E 3G5MA 4UZSA 2HRRA 3IUNA 4A0RA 4CLRB 5FQOA 3AHFA 3U4IA 2IYYA 3F3YA 4WZAA 3M9WA 2EJUA 4QDUA 1K4KA 3KQYA 2XVZA 3MMXA 4ER7A 3U62A 1YHYA 4OXSA 3M4ZA 1ZINA 4U9UA 3TB4A 3NG1A 2A0WA 2D54A 4D6XA 4UPEA 1GFSA 2FPGB 2WJPA 4PS0A 1Z2OX 1ZUWA 1HRKA 2UUAO 4GUAA 4F72A 1B6GA 5IY5B 1Y4ZA 1AN9A 3BKWA 1J2YA 4KBGA 2I7XA 4NCBA 2JLYA 1VHLA 3PI7A 2Q4RA 3T1VA 4KDFA 3RS2A 4L28A 2IC5A 4KRFA 1ORHA 3JSNA 3IP6A 2NOAA 4YJ3F 1VMKA 4UHEA 5FT9A 5L8VA 2HFJA 1IJKA 3KD2A 1T5HX 2FEWB 3ESDA 4F46A 1JHAA 4G41A 2OPBA 4OPHA 2OTJV 3AFIA 3AW9A 4GI1A 3K0KA 2DBYA 1AJQA 3U0ZA 5JSHA 1CQXA 2HMSA 4BVJA 2I4IA 4I1UA 1GV1A 3L75H 3G7NA 3H2HA 4LTDA 2SNIE 3FVWA 1P29A 2CNBA 1RU3A 1SXGA 3PFFA 3LWOC 2Z1FA 1LK0A 1T2FA 5JAHA 3HJAA 3BIWA 3EEOA 4KVAA 4LGMA 2B99A 1U9IC 1E20A 5IBCA 1P6XA 2ZDIA 1TFUA 2QHXA 3ZRXA 2YFKA 5LOVF 2X14A 1U1IA 4ICGA 4E70A 4YAIA 4BKQA 4EKDA 2Y0PA 4YRGA 2YIBA 1C1YA 3ED1A 2VI5A 3I5YA 2QN8A 2HRYA 1W96A 4MVUA 5FWDA 4ESHA 1ZJ6A 1XRQA 5AJWA 1Y6QA 1BE0A 1TQDA 4W8OA 4D9MA 3TXAA 4FTWA 3WO1A 1NKTA 3HGMA 4WE3A 3FETA 2DPYA 4YAKA 1J2TA 4JC8A 3W8EA 3BJRA 4US1R 3UV3A 4EFBA 3RWBA 4BDTA 4R7TA 1ZD5A 1H2YA 4UDNA 1DMRA 2EKDA 4RQBA 3HR7A 3OM9A 5KBYA 3ZZMA 4BVFA 1GRCA 16PKA 4B9AA 1OTHA 3P5BA 3K2BA 3EMDA 3CCRV 1MJFA 1UDAA 4DMKA 2MINB 3O2JA 1L5ZA 3VPGA 3I9JA 2FR8A 1IQPA 4IG4A 3P45A 4W5RA 1XTUA 1JJAA 3HCWA 3ER8A 4EUNA 5A9GA 4J7CA 2O4UX 4GOND 3CEJA 1KFBB 3KP1A 4CM9A 4F5ZA 3IEPA 1VIVA 2ID4A 3H2ZA 3UUGA 1QGYA 1LRKA 3KEMA 1IL0A 3NHKA 4TLCA 2ZD9A 1JP7A 1ZEJA 3P4EA 1PZGA 4CU2A 1JE0A 1JAZA 4CI0B 3HWX1 2NXCA 1RZVA 1KAHA 1IJEA 4EW2A 3UFXB 1ACJA 4ZVQA 1NW8A 1NBIA 2PZJA 1DO0A 4O2BA 1B74A 4AG6A 3SM3A 1UJMA 4JASA 3ROMA 4ED9A 3N5KA 5KJ6A 5JPIA 3MK31 4E7OA 3UBMA 4GDMA 5ADWA 5LBUA 1DG1G 4OJNA 3G7SA 1V3QE 3H7IA 4DQXA 1G4YB 4J0FA 1HFJA 5IDJA 4M0FA 3OMAB 4ZT5A 4QGBA 2X76A 3TD6A 1F2TB 4FGJA 1LC0A 2I6DA 2BKUA 5FBWB 3R5JA 5E3JA 1HURA 3II6X 4YJDA 1HGXA 5DNAA 2ZRLA 3SICE 3CVXA 4IL5A 4J16C 1WO8A 4QRDA 5HUHA 4PFSA 1OA1A 4KUGA 3ROEA 3CO5A 6CHYA 4BS9A 1M2KA 2C96A 3BH7A 4UD6A 4L5AA 3ZV6A 1J99A 1YOVA 3HQ4O 3H5IA 1JWBB 1E4YA 1RI2A 3R74A 4DIKA 5ALXA 3VU8A 3HLKA 4WNYA 1Q1QA 2GR9A 1IPFA 2Z1MA 2BH2A 4P4SB 3MJVA 1MB9A 1QDEA 3OEHG 1VDMA 5ALZA 4A03A 4EMBA 4Y0AA 1N2CA 1J1IA 2PM8A 4AMYA 3LUFA 4BQEA 3OU6A 1B0ZA 2PRJA 2PZBA 2WVGA 5JDCA 2YRFA 4DR1B 3MGKA 1ZGGA 3K9QO 1QVFF 3IVAA 1EUZA 3KPYA 5J40A 1PPJH 3V7UA 5HKKD 3Q15C 4MAAA 3I0MA 3GGCA 2VLIA 4KUMA 1PQYA 3ZTWA 1G8JA 4IO0A 5TE9A 1EDEA 2WYVA 1B6SA 4TPKA 3RRJA 4HZGA 2Y92A 4LE2A 3JZIA 3BICA 1U1GA 4B2YA 3QA9A 1BJRE 3K8QA 4H27A 3AILA 4XCQA 2PRZA 2Y9PB 2QAGA 2O57A 1C7RA 2OV6A 2DY1A 1C3EA 2IBMA 3DTVA 4BIMA 5ITZB 2EXXA 1N8RW 2FF7A 2PLAA 3D1VA 1V16A 2GYUA 2OMEA 3AEKA 2I7VA 1EN4A 1DO2A 4PRYA 1TF2A 3K6RA 5C8YF 4DNOA 4MUAA 5IX8A 3H9VA 4RVDA 1G3QA 1Q5OA 5CP8A 3WMXA 2ID7A 5AFSA 3H75A 2GASA 2QR3A 3P0EA 4YT8A 3C6BA 1EUQA 3EDCA 3TDMA 5CYFA 2OECA 4D4JA 2Y0IA 4MVSA 1KOJA 4QHYA 1VKJA 3LPLA 4II2A 2W93A 5DBHX 3JQBA 2ZE5A 3NHPA 3GRPA 4G25A 3T9FA 4AIIA 1YBHA 2X42A 4LQLA 3O7WA 1KVRA 3RRFA 3S2ZA 3X1KA 1M6EX 3AKDA 4ADSG 2JLVA 3D4NA 5HE8A 2FPKA 4QNNA 2GTPA 3GEEA 3KOWA 5A0FA 4HDNA 2CNLA 2GQ0A 1O6FA 4M1QA 3LECA 1MVOA 2FQXA 1LF0A 2JFVA 5GMOA 3NJ4A 2AYYA 4KFSA 3AEIA 5J4VA 1HT1E 4G8CA 1TT5A 5JS8A 3ORQA 1XG5A 1U2DA 4DV3B 1JG1A 4HT3B 4JGSA 1SKYB 4K28A 2PS1A 1KE2A 4D42A 5AI0A 4J9VA 5KDDA 3PDUA 3P9YA 1A9YA 4EW6A 5IFKA 2XT6A 5KLVH 3GPDG 3DEFA 5KVCA 2OO3A 4X6LA 1ARZA 2C8LA 3BTOA 3KZKA 3HO6A 5HY1A 5BUCA 5BT9A 2Q28A 2A30A 4I7EA 1S76D 1ZOIA 1RQ7A 3LWRC 4YP5A 1C8LA 2ZIWB 2B5WA 1L9XA 2OY0A 1B3QA 3LY8A 5DHFA 4JK3A 5ISMA 2PUJA 1JLMA 1ACMA 4Q3OA 1CUZA 2FSIA 2H06A 5JIBA 2JRIA 3RJZA 3OCCA 3WNDA 5K0TA 3CNQS 3BRWD 1IEQA 1PQWA 4ZEOA 3R9IA 1PGPA 4QGPA 4AY5A 3ZU4A 5LU8A 3DVRX 1IBMB 2A79B 2ZU6A 3OHSX 1FP6A 1XZPA 4ZFNA 3W6ZA 1CQJA 2W8BA 2WLNA 4B4VA 2LDBA 2ILTA 1W94A 3O2NA 4C82A 3PK0A 3QOFA 3MWGA 2DR0A 3UO2A 3P2YA 1WLSA 5C7OO 1WEKA 4UV8A 3GLIA 2WOJA 4UUPA 1NR1A 1V11A 4L4UA 2BGNA 3MCAB 1U8TA 3BIXA 1ZZEA 1UFYA 3AVPA 2J4DA 2PLWA 2WALA 3FWZA 4GI3A 1JR4A 5F1PA 5FO0A 1IU9A 5CLLA 5TQ2B 1T26A 4XVHA 1QC5B 2ZRBA 1SH7A 2X4LA 1ZD9A 1E6EA 3UOGA 2ETNA 4P08A 1DLBA 2BMWA 1U11A 3I9KA 3W7VA 4NJEA 4TSFA 1PZHA 1WVGA 2EFHB 4QUDA 2MSDB 3D36A 4KXRA 2WKWA 3L1UA 4CFSA 5TRTA 4FGLA 5AXDA 3OTOO 1JNXX 5DE3A 4K6MA 2H2WA 4F5EA 2DJIA 3T4UA 2WKSA 2ZQYA 5F2OA 3UJDA 1H2HA 1IQRA 3P9NA 4ROTA 3AY0A 1HQDA 2ECOA 3V4RA 7REQB 2G04A 1E0JA 1UADA 4K9OA 2BBWA 3P9CA 4FP9A 3OX2A 1T6NA 1X80A 4MYRA 1Y6XA 2BM8A 5HK8A 3ZDDA 1JHOA 4OH7A 3HFSA 1MXFA 2A0YA 3LT1A 4MZDA 3JVIA 1GT6A 3TCXB 3G79A 1UEIA 2QBYA 4EHIA 2POCA 4A8JC 1JD1A 1JDBB 1YRYE 4URVR 1XTQA 1B41A 2PTHA 1COWA 4C2BA 5H59A 1PLKA 1LZKA 4BVTA 1SZCA 1O4VA 1SCDA 1DT9A 3VQXA 1A9TA 1HE1C 1LNSA 3AG3C 5DRTA 5FADA 3EXG1 3IT2A 3UMSA 5I9BA 4OGLA 3C70A 3DT9A 4FWIB 3WOHA 3OD4A 1D7OA 1ZOPA 3L4BA 5IU6A 2IVZA 4NOJA 4ALJA 2GN0A 4IS3A 2HCBA 2FEOA 3LW7A 1MEEA 1HNZB 2C78A 3LQYA 4RJKA 4CETA 5JS1A 1HP8A 2OHXA 4MIOA 2CC2A 1CB0A 4WFQA 1SQQH 4LCUC 5K1ZA 3KYIB 1WMFA 1EFVB 2V7QA 3BE5A 3NBXX 5T3UA 3STVA 4IY1A 1VF6A 1UDRA 1VG0B 1VQ7F 2ZUUA 2OHWA 2OFPA 2CLDX 4PWYA 5GJBA 1FLDA 2O7RA 5B1AB 5J3JA 4L6IA 5EJ8A 1XEFA 3RRYA 2VT7A 4C06A 3KBOA 2IOFA 5DTRA 2Q8QA 5I7RA 4A5OA 1QZTA 3A7EA 3MWKA 4Y2VA 4O4HA 3CRQA 2R4QA 1M6YA 4Z9BA 2VZ9A 4IKOA 4E88A 2IQQA 3OSZA 2EIHA 3C5VA 1AGRA 5DIFA 2ES4A 4A6EA 2JFFA 1S2NA 2ZKIA 1MB0A 3QEKA 2CVFA 3I4CA 3HCDA 5CD9A 2WJJA 2QIOA 1Q83A 5FTNA 1YHQV 1YJBA 2CE4A 2XKKA 2J46A 3CG6A 4MRMA 3SYAA 5IT9A 3EGCA 1HA3A 1UBEA 4DA9A 2G5TA 1RRFA 2D5BA 3ST7A 4U7TB 2OBNA 3PJGA 2RJNA 2WDPA 2XGSA 1C50A 1SQ6A 2PLRA 4GMGA 3F1LA 1HDZA 4P84A 2AFRA 3HGQA 4B3GA 3AV3A 5L4SA 2UXBO 2UUAB 4MCIA 1YIOA 3HS3A 2AN5A 5DVZA 4MYDA 1ZBDA 1L5LA 4MUBA 2JIOA 4L87A 2XF8A 3X1YA 3B9BA 3ND7A 4YFVA 1RMQA 3WLEA 2HL6A 3QHAA 4NPCA 3IT1A 2YWGA 4Q9AA 3U60B 3WGJA 1S2MA 1ICEA 5GANK 3PF9A 3C41J 2AG0A 1WHTA 5EIWA 2BIFA 1OIXA 4FOSA 2OV4A 4P7GA 5CDFE 1V1MB 3PLAC 5DNDA 5ALNA 4Y7CA 2EFEB 3KOOA 1B3BA 1ZL8B 2BR4A 1E5QA 4ALKA 3SM9A 3WPWA 4D44A 1PV0A 1H23A 3LM8A 2AGAA 1RP3B 3CCQV 3MGBA 1DTWB 1H1DA 2ZINA 4X44A 4DNFA 3MEQA 2FG6C 3NFRA 2ZAMA 2GPJA 5DHPA 1GTVA 5CCBA 3KRTA 1IV4A 3B1WA 1UKBA 4YJHA 3U7QB 4RJTA 1ZWLA 2DYRC 3QEOA 2J3LA 3A4YA 2RAUA 3UHJA 3JZFA 4BQSA 3H2YA 2DSNA 4L3OA 1QF6A 2W70A 2C4VA 4G5GA 4DRXA 1FFGA 3M83A 5E3HA 3VZPA 5JYBA 1T5EA 4Y2PA 2RBEA 3RA5A 3W5JA 4PFKA 3DDOA 4J6EA 5BSHA 2ANCA 2F3QA 2DQYA 5HJ5A 3SJBA 2PU5A 3Q3EA 1UOQA 3UAWA 1G1XB 2IU3A 1X1RA 4ZVNA 4D80A 3RRMA 2JIZD 3SPXA 5JQGA 1Y1PA 3PQ4A 1H48A 3ZJVA 1EFLA 3L71H 4L78A 1ZNYA 4BEVA 4ZI7F 3NB0A 1FSFA 3GGPA 3QFSA 2XUZA 4H44B 2AFHB 1BDMA 1UPTA 2ZJ2A 4WACA 5JSYA 1P60A 2H7VA 2H2GA 1ZAUA 4XJVA 1YA6A 2WK1A 2FSHA 2HNBA 4KIWA 3SHQA 2UYJA 1KZGB 2RHBA 1E9RA 5A6SB 1E2PA 1IUPA 2Q5QA 4X1YA 1E3IA 3ZMUA 5DNUA 4M9UA 2W2TA 1QKIA 1KJZA 1VQ4F 3WGVA 1VYUA 4IT5A 3R3YA 3CUWA 1WCXA 1X7WB 3KOUA 4AULA 4YJ2A 1G64A 1H2ZA 4UEJA 1AXRA 3HWRA 2GF0A 3ABUA 1I8TA 1JQKA 2FXVA 4AKGA 5C5IA 5DEOA 4PR0A 1TXGA 5AW0A 4PGAA 1Z15A 3W7UA 3E05A 2SICE 4KE6A 2ADMA 4N3BA 3EXAA 3H2IA 2JH9A 2RGAA 4XJSA 2EP7A 5EKSA 4OA5A 4HN2A 4YDHB 3FHLA 1H6CA 2Q69A 3LNNA 4X3PA 3OZCA 2A1IA 1Y74A 1X25A 3IXQA 4GEGA 2OV8A 4HSGA 1QYXA 5D3ZA 4A0FA 2AEFA 1K1EA 5AI5A 3U1VA 1Z5GA 2GHQA 4RQEA 4B81A 4HN9A 3I5DA 1YB2A 2OCLA 3PD0A 2VT6A 2ZTLA 1YF2A 3OMIB 2Z04A 4AF8A 3FKSG 3W9SA 2B98A 2D1QA 2G9QA 5I7FA 2W6OA 1RQXA 3R75A 3IA2A 1TA9A 5FLXN 1Q15A 3LDFA 1M74A 2YYAA 1LH0A 2XYPA 4ZT4A 1SD1A 1JV2B 1QHHB 4WOJA 2QA4V 2BP7A 2HU5A 2FF5A 1GGKA 4ERHA 5LLDA 2IYXA 2F4VO 1P31A 1TQ6A 3ABRB 4OATA 1NMEA 2FR0A 4GXQA 3LPNA 4YJGB 3THYB 5JH7A 2QE6A 2GBLA 4C07A 3HB7A 1YCIA 3I1YA 1II8B 3N2NA 4R2KA 2GJ8A 2EBOA 5BYJA 3TM5A 5DW0A 1ZN9A 2D2FA 4NWOB 1Z29A 3NBKA 4JBYA 1DU4A 1VMEA 4YIPA 5JNTA 1GVHA 3KELA 3HB9A 3UGQA 1GPYA 3DZJA 4Q3EA 2I1QA 3HR8A 2P4UA 2JC3A 2VOEA 3QKSB 1TA0A 2F93B 1XNRO 2WLIA 3A4LA 3HU1A 1V9SA 1NQOA 4ZD6A 1OBHA 3ZY4A 2Z98A 3IAS6 3F5QA 5CYPA 3KFVA 4WBXC 4KSBA 4NAHA 5G1OA 1A9QA 2ZRIA 1QE0A 1Z4MA 4D0RA 1PT9A 1ZM2A 3KDSE 3OW2U 2CAZC 3IDFA 1W36D 2I3GA 4CXMA 3OE5A 5CNMA 5IT0A 4QNMA 2O9JA 1AQ6A 4QUAA 4JBLA 4AS3A 4Q1BA 3EF3A 3A70A 3GJSA 5B6JA 1ZSPA 1H2WA 2O0LA 1RA4A 2V3WA 2BFOA 3LUDA 3H0EA 4AMZA 1BT8A 1I2AA 1N0VC 2WQ6A 3ANSA 4J0IA 2BFFA 1CF4A 4F6EA 1KXJA 4R1SA 4MYUA 1JR6A 3GY0A 1I0ZA 1FYVA 2JZNA 4G85A 1XA0A 3D43A 3K6KA 3Q8LA 1KOGA 3R66A 4DPLA 3ZKWB 3HJTA 3GYQA 2CMDA 2XIQA 1R88A 1E6CA 3EEYA 4RHCA 3MBIA 4BVSA 4HQFA 1UP6A 1ZDMA 2VA9A 2OQIA 4FCWA 4GWLA 4JI2O 1YS6A 2O5CA 1GSIA 2ZIOA 3CWQA 3OP4A 4HUQA 1W8DA 3EVTA 3EHBB 2GA8A 4OREX 3GR6A 5SY9A 1RM1B 2XRMA 3FDFA 2OBBA 3A9RA 4G84A 4H7DA 2ECKA 2D3TA 3BKXA 4HAUA 5DBOA 2DPMA 3LQ1A 4MUJA 3AYZB 2VYND 2EQAA 5DYYA 3MELA 2XAJA 4HGQA 2A33A 4FYJA 3GLQA 2J6BA 3C8DA 1M1XB 3A2FA 4OAOA 4PDLA 1E3JA 4P22A 2WSBA 2B2XA 3OQ1A 3OZSA 5FPPA 3R8FA 1ONPA 2X4DA 2VPYA 4P3NA 4G2KA 5CB4A 3SK0A 1DQRA 3LSYA 1DVRA 2LIPA 3EASA 2ZWVA 2RCNA 3MWFA 3LOQA 4K9RA 4U2DA 2YJTD 4EWLA 3I5UA 2GF2A 4NESA 5ILOA 4LHEA 1MFPA 2JB9A 2ZSIA 5KJFA 2RJZA 1VBMA 5AVVA 1M34A 3AK2A 3FE2A 4UNNA 5KC9A 3SOZA 4K35A 5KCMA 5E79Z 2A0UA 1V2HE 4JVSB 3EWNA 2VDRB 4WESB 3GUZA 2EOAA 3DV0A 3GVXA 5M2QA 1UJ6A 2EF1A 4MA0A 3ZCQA 3W04A 3ZCUA 4YR9A 1U6KA 1BMFA 2ALJA 4MS4A 1RJ9B 5EBMC 2XVAA 1XJWA 1FFAA 2WLLA 3ZLJA 1HNNA 1PK8A 1JHUA 2YBEA 5F78A 3DF9A 1I7NA 2AHYA 1U2RA 4K3UA 1ZJ4A 4FQ8A 2PD6A 1YR1A 2P4HX 4CM4A 3BFKA 5CU7A 2XMSA 1VL5A 4X65O 1I0HA 4IDFA 3F6BX 2GTSA 5JPDA 5CJPA 4DYDA 4ZKIA 3MB5A 2N1MA 3KQOA 4UBOA 3U39A 4NXMB 3O93A 3WB2A 2ADQB 4NE7A 5LQSA 5AI9A 2WPDG 2JI9A 2WWXA 1OZHA 1P7CA 1WAMA 1HE8B 1XZIA 3QVTA 1SPXA 5HBGA 4XOIA 5JHGB 3U5TA 2V0GA 1NYTA 2JAXA 4WXYB 4MP6A 4P4GA 3H5OA 4DVJA 2DULA 5CD1A 1PT6A 4AYXA 1WPRA 1OAKA 1NLMA 2R60A 3R5TA 3E0QA 2Q3CA 3AFOA 2PXHA 4QYSA 4OGFA 4RQFA 1SKUA 5DGIA 2YI9A 5TPWB 3FNHA 4EYEA 3EXHC 1ILEA 1Y6RA 1OCOC 1EBBA 4N7MA 2NM0A 4UKDA 2LFSA 4AFNA 1C4XA 5GOZA 4PZDA 3OCWA 4EHHA 2OGTA 2BSXA 2K7ZA 2WLTA 4D7TA 2GN1A 2HGZA 3WLLA 1II9A 3SN6A 1E2EA 3OTOB 3MT9A 4YDSA 1RYNA 3NGMA 3PICA 1XKTA 4GD3Q 4OVKA 4GPTA 3SSOA 1NNEA 4PV7A 3Q3VA 3WXBA 1RXUA 4Q21A 3OKAA 2WIAA 4UXIA 5IW8A 1N8SA 3MS4A 1XZ8A 4F6RA 3ZWDA 4BX3A 1FD9A 1SCBA 4L5BA 3CF2A 4IV0A 1FYDA 4BCBA 4JSYA 2JJ2A 4NICA 1ODEA 4KXYA 2Q5JA 4NYMQ 3FIUA 4MAMA 3ENKA 1XMSA 3FPHA 5LC1A 4HVAA 1T4BA 2BMEA 3W6PA 2GCPA 3EIWA 2A94A 4PC1A 3FMIA 4E09A 2OT5A 3LQKA 4E0BA 1KU9A 2O52A 1NXQA 4BNLA 1VQ5F 2E0IA 4HG2A 4BNUA 1QR8A 4BPBA 1TE2A 5K8IA 4YCMA 3OTFA 3Q3IA 2GZDA 1J8MF 2D1SA 3DZFA 2XBLA 4O3MA 1QHEA 5CNIA 3EXFA 2JI7A 5F52A 1NVFA 2VJYA 2VJDA 1MOPA 1URFA 3ENNA 3ZE1B 1IRIA 3GLSA 1SQXH 1X7ZB 2C03A 2Y3IA 2YWDA 2LCFA 1VA4A 5B66Z 5K01A 4AI6A 1TQ2A 3CW9A 3BHJA 1MOQA 4OBXA 3KZCA 4HYYA 1W36C 1YACA 4RTMA 3RWRD 1E7SA 1RYEA 2WR8A 1N1MA 1IDOA 4AICA 4DV0O 4OP1A 4BT3A 1D1SA 3ZJ4A 4F7DA 2OAEA 3V97A 1HFWA 1Z6TA 2H6LA 2NSDA 2FWAA 5C18A 3W9UA 2CWJA 1OI4A 4BNXA 4LV5B 1VQOV 1T35A 2W90A 3WBFA 3ZI0A 2XADA 4RD0A 5DEIA 5UKDA 4FYYA 4Y2GA 1NXSA 3TBHA 1K92A 2GM9A 4MTOA 2VK2A 2IEZA 5B5EZ 4PR3A 2WSSA 1TAGA 3M4XA 3K70C 1EYZA 3ISJA 2AG6A 3P96A 5LIPA 1JF8A 4LMAA 3Q41A 1DIRA 3HJBA 4NI5A 4KQCA 4KXNA 2HTFA 3OLQA 1NVAA 2HCFA 1H6AA 1QYIA 2B8JA 4BO1A 2WUFA 5HM8A 2XUDA 2OTLV 3SC2A 3WYDA 3BHPA 2QD3A 5ALOA 2HJSA 3JAKA 4MOWA 4NONA 2I3AA 4GLXA 4LF9B 3PDHA 4PYMA 2PT5A 1AROP 4MUYA 3OPYB 4RY2A 5LA6B 3N87A 1PJSA 1I7FA 1VSTA 2CXNA 3LCMA 1UDXA 1QVGF 1KIMA 1XZQA 5KWJA 1FXHA 2N1BA 3L2OB 2Z0AA 4X8MA 3MRSA 3DAYA 2W00A 5GOTA 1EP2B 1O5TA 1Y82A 2VTDA 4MR9A 1K8XB 2BFWA 2J9FA 3VR5H 3VISA 3JQAB 1AMUA 1OYVA 1U3FA 1CHDA 3OONA 2XTNA 4KN5A 1QF9A 2JHFA 4X20B 3TZBA 4G4GA 4C4SA 4B76A 4DKJA 4Y2RA 1NYRA 1AA9A 3ESRA 3BD7A 2WWFA 3JVHA 2QM3A 2YV5A 1XTVA 2XSZD 4EFLA 4C7VA 3O74A 4GGOA 2Z6AA 2IF0A 3TEMA 5C4GB 3V55A 4ITRC 3CCBA 5KNCA 5C4IA 3H1IH 1U3WA 5B36A 2FZLA 3L06A 2A4MA 3ZE6A 3FXAA 1MENA 5DYIA 3CLRC 1IBKO 1MVNA 3X1WA 3DAFA 1N7GA 3M6LA 4ZXPA 1E2GA 3AGPA 4V38A 1UWLA 1MJGA 3B8EA 4KREA 5M34A 4MWSA 4ZPJA 4FHGA 3Q7EA 1CQPA 2EJBA 2VCEA 3A9SA 2FFBA 4B7UA 4K0KO 1ULSA 3HABA 4W6QA 2C7VA 3GELA 1CLUA 1KI6A 4KN9S 4UHCA 4L9WA 3SJCA 1GHTA 1P4GA 2C9MA 2GUZA 1PJ3A 3SEZA 4EQ6B 1I4LD 4UHHA 4ZAYA 5CCDA 1J0DA 2GVZC 1JN1A 3OJXA 1NZFA 1QPGA 2Z43A 1TZKA 2HVYD 4XPIB 2VRCA 2ZTHA 1JEYB 2OCBA 3U7EB 4R9SA 1R66A 4E15A 1EA5A 4DNXA 3DKPA 5AWFC 3CVWA 1X1SA 5KSPA 2A0XA 5KHLB 4X8HA 2OOKA 4FUTA 5THXA 4GYJA 3G5TA 2FOXA 1DE0A 5KTRA 3ECAA 4PVDA 1T1SA 4U2CA 1L5VA 3DWGA 5A4AA 5HUQA 1E2JA 2V7BA 1P3DA 1V6SA 3UTDA 4C0LA 3GFGA 1DAMA 1QH8B 3ASYA 1LQTA 2UKDA 3MVEA 4L8LA 3VHLB 1N9KA 3HJGA 3IIMA 1YB6A 3JYNA 3KC2A 1Q6ZA 5A2QA 2B78A 1N4CA 4KTTE 5ALSA 4XB1A 5KZMB 1ESZA 2Z5GA 1XPUA 2VWJA 7AT1A 2VRZA 4Z7NB 1HG1A 1ODKA 2ISSD 2XB8A 3BA6A 4I8DA 1SU8A 4OQEA 2C98A 2PV7A 5K6AC 1T29A 1F6BA 1PR3A 1GO0A 2H1RA 4N0EA 2WE8A 3KAKA 1ABFA 2QSYA 4CYMA 2P77A 3R0ZA 1FQWA 1OCCC 1JGTA 2OCDA 2JLZA 4YV2A 2JFGA 3SNKA 4FZ1A 3A9TA 3JVEA 3C9SA 4BMCA 2R47A 1I9GA 3KSBC 1KKLA 4DNPA 4QBGB 1TNDA 4TRRA 1CW2B 1KO5A 4QVKA 5EN4A 4JLNA 2UVPA 1BXGA 4DG9A 3LJKA 1ENVA 5G41A 5I4BA 2DYKA 1GWNA 4G65A 5E7JA 4ZU6X 4PNEA 2C88A 3CZCA 1KMMA 1Y63A 4K26A 4MQEA 2UU9O 5C1OA 1DCTA 2F4VB 3MTAA 4D82A 1JBKA 1N2OA 3DMTA 5ESDA 2QRHA 4ZDIA 3CYOA 3V4VB 3IBTA 3GGGA 3QKUA 3MF4A 5G40A 2C83A 3AVYA 1JXAA 4KE8A 4EEZA 1XNGA 3NP9A 4R9RA 3UV7A 3VYUC 5U9CA 1RKVA 2WFZA 1S0VA 2YV3A 3BD9A 5LL6Y 2AI2A 1H2KA 2O6LA 7MDHA 2WYOA 1KQFA 4AF6A 1XMQO 3T41A 1FSPA 2EP8A 4CL3A 4YTEA 2CHGA 1S5HC 1G6Q1 2Z2JA 4M36A 4D1YA 3HP4A 1QKJA 1Q77A 3TKLA 3L8YA 1YTFD 2PRKA 1IPEA 1GQQA 4B6GA 3LQRA 4WZZA 3ZGZA 3A6GA 5JTUA 5DTMA 3ELDA 1EK6A 5DOVA 1PVDA 2VQFB 1PTJC 4PLGA 3DZ8A 1E2LA 4HCJA 1S8AA 3TR5A 3RYCA 3VYSB 4MVXA 3HWSA 1P1IA 4WZ6A 1YVRA 5AXCA 3U48A 2F8SA 3WKBA 4DBVO 2YXYA 5EZ5A 1W40A 2EINB 4CR8A 3IO5A 2J5QA 1KS2A 1I3CA 3U3ZA 3VPHA 1YQUA 1ZNZA 3ZC3A 1NTZH 5JXIA 4MWDA 2RAVA 3N1UA 4ZDJA 1T6YA 4FKBA 4YIKA 3RQSA 3W8RA 1YR7A 1GZ5A 3RABA 3K1YA 2RIRA 4O4IA 2K4MA 1N3BA 3TI7A 4BMVA 4JT8A 3PQ2A 4YCBA 3PGMA 3CUEF 3H1KH 2CWDA 3RSSA 3EZNA 1CFJA 2WAOA 4HB2A 4DIUA 4IDBA 1TM4E 3VXKA 1T43A 4C76A 1QFSA 2J5BA 1RIIA 4G4SP 4CF6A 4BLTA 1E3LA 1L7BA 4RDIA 2LE0A 3RSCA 3PUIA 1NVBA 2MSCB 1QFJA 3UUEA 3DA8A 1TC1A 2VK1A 4XM1A 5DZSA 3QA3E 2YQZA 4IBOA 3FPSA 1TAHA 1KOFA 3T5BA 2G28A 4RNCA 4RZXA 2JLQA 3SC3A 4DUYO 4QXAA 3MZ0A 2IJGX 3AQ4A 1N8KA 2X6TA 5EGNA 4DR5B 3WYAA 4MARA 5TARA 2II6A 2WHPA 4ARZA 2NU6B 2Y0CA 1LW7A 4BFTA 3TNJA 1UXJA 2R1TA 3U4CA 2G9VA 3H1TA 4LVUA 2PS9A 1LKZA 2XB2A 2XYRA 5CDSA 1IQUA 1ZY2A 1AZLA 4RSMA 1B8UA 1IVSA 2P30A 1NX6A 1P4RA 2YVQA 1QBZA 1GN4A 4ZHQB 2JKZA 2AIZP 1V1RA 1XR3A 3WBBA 4LZAA 4UCOA 1BQ4A 2YNMC 3IUBA 4NJMA 1YL6A 4MI3A 4POAA 4DLPA 2G40A 3S7ZA 2JH8A 2YY5A 5IH3A 3D59A 3G89A 2ZAUA 2ZB2A 4AZ3A 4JVMA 5AT1A 3EW9A 3T5AA 1JPVA 2OSBA 1AKWA 3L41A 4KGXA 1XLTC 1BG6A 1UODA 1USUA 1U5BA 4H3HB 3KZNA 5JJBA 4AS1A 4FE7A 5COBA 1X3SA 4QPPA 1D0VA 2QTMA 2I6SA 3U10A 2RMKB 4G3XA 1U0RA 4CPDA 1OA0A 3GEBA 1RPJA 1NVWQ 2K2QB 3OM8A 4L5YA 2F67A 1TIKA 3H4TA 1YDMA 4B74A 3I2JA 4BAUA 4X65B 1XZEA 1Q3HA 2Q9UA 1MF7A 1JQLB 3K04A 1GM7A 1G5PA 4AROA 3UZUA 2JANA 5THQA 1TTQB 3OCXA 1UUFA 4MX8A 1AHNA 1RXIA 3PHIA 2YIDA 4Q12A 5KWVA 3BAFA 1LVUA 2REXB 2FN8A 2HM7A 4I9NA 1XQ1A 2XQVA 3HUEA 1O4WA 1Z33A 3I3SR 4LISA 3GFVA 1KJJA 4DRZA 4H6XA 4L8WB 1Y3DE 3ED5A 1UZMA 3WNQA 4MV8A 3ENVA 1DQPA 5HF9A 2F2TA 1T13A 3K5WA 4TV8B 2DM6A 1PR4A 4TT8A 4QM6A 3I2IA 2IOHA 4N49A 4CQLA 4KQEA 3R76A 2UUPA 5E4TA 3MOGA 3JAWB 4GPBA 1GA1A 3AF4A 1GIAA 4PW0A 1DOAA 2CZGA 4XIJA 4NYMR 3KVOA 4ENVA 2X22A 1PNOA 1RKUA 5A5EA 1RI4A 3QMWA 4YYEA 4LA4A 1FS0G 2OG1A 1EZ4A 1IM8A 2QEXV 2LRHA 5HKOA 5L3QB 3JQ8B 1AK2A 4IDCA 1MN6A 1E0AA 3CLSD 4KSCA 3LUCA 1B43A 4IUDS 2G9NA 2E1PA 1KNQA 1A96A 5H3LA 1CETA 3N6VA 3X2EA 2N9UA 2Y66A 2Y71A 1JMVA 2H31A 4M0MA 4UBJA 3PQ3A 2PR7A 2ZVPX 4M1YA 4IX1A 4A0SA 1XP8A 3V00A 4UASA 1YB4A 4B3FX 2W2MA 4H1WA 1NJFA 5HPYB 2R2AA 1VPTA 3PQ7A 2QTLA 3KB8A 3PGJA 2PYDA 4LFCO 2WJHA 1OC2A 3ZWCA 5FTMA 2ZPTX 3D00A 3MINA 4KG7A 3A25A 1LTHR 6PFKA 4UVCA 3EDOA 4JQSA 1FYFA 2PNFA 4CFZA 4DMFA 5IMBA 1D0IA 2VBIA 4ZEMA 1PIWA 1Q1GA 2OXRA 4BMSA 3EC7A 2PUGA 1H0RA 3PHGA 2YW2A 4M9CA 4Q1EA 3KXPA 3HXLA 3MWDB 3TWOA 3ZDEA 5G2OA 3ZHOA 2GBCA 3LL7A 2CLEB 2W6MA 4CHTA 2NMUA 2V7XA 2YDYA 1M5TA 4JXJA 5KTOA 3R44A 5B3AA 4RBNA 4CODB 1LPNA 1DRJA 4K9PA 2VWPA 4BNFA 1M93A 2EIKC 4CBCA 3FF4A 3UYKA 3CZPA 4JROA 5JT1A 1BRTA 2WHQA 1W76A 1P6UA 4CF3A 2JFQA 1A97A 6REQB 1QX3A 4AM8A 3HWWA 3WXMA 4DXDA 1ZVMA 2I03A 1HMPA 1L5WA 1H4VB 1T3SA 1PCXA 1J0CA 5MGBA 4I4CA 4XUCA 1RWKA 4DV0B 2FW1A 4MS3B 4IDHA 1I94O 5A4DA 1EE9A 1MABB 4KITB 2WA4A 1MOZA 3CPWU 3O1IC 3IDAA 5TT1A 2V6BA 2R7KA 1YI0A 4MUIA 1KEPA 4BZPA 2ZWIA 4IHJB 2G83A 5DK6A 3RFFA 3GP8A 1TM2A 2PUDA 4BMPB 1SBHA 1W7AA 3JCZA 1NJ6A 1QRTA 2VFAA 5F2VO 5BV0A 2VLBA 3S7TA 3ICOA 1IULA 1EQ2A 2R7MA 3FPIA 3NM6B 1SUIA 3U3KA 2WT4A 1U8YA 2B1GA 4ZAXA 2HAEA 4YQEA 5KX5A 1ZONA 1QYVA 1Q11A 4DO2A 1T8RA 2AE2A 2DWCA 4HY3A 3LC0A 1OX6A 5E9AA 2K6GA 2AG5A 4U0KA 1P49A 4OGQB 3W1WA 2OO5C 3Q1LA 1J8DA 2MT9A 3R8XA 1Z5NA 1TL7C 1Y8RA 3NHBA 2ZUWA 5JFGA 1B73A 4G37A 3ZJYA 5CT5A 3VO2A 4J11A 1XHOA 3L1HA 4YXFA 4MR8A 2AOUB 2P7HA 4BAGA 4TT3D 5DM60 4TYQA 4EPVA 4QSHA 1Z73A 1T9CA 1G3RA 3JYPA 1QIFA 3GCDA 5L7WA 2O3SA 4TUYF 2EFCB 3H0KA 3KB6A 1ZW1A 5EJAA 4U63A 1TK3A 3VBBA 5CA3A 1U2ZA 3AF5A 3LFTA 5IDYA 5SY4A 5H7XA 4DIMA 5ELLA 1D7AA 1AQNA 3DDNA 1QGOA 5GZ3A 2UZ0A 1P45A 3ENWA 1AKYA 3MUOA 1G291 2CHFA 1XWIA 3UKMA 2K5UA 2I6XA 4DJJA 3KAPA 1QKKA 4YI3A 2Q7XA 3BK2A 5A3RA 1IMJA 2DU8A 1X52A 1RYFA 1DC3A 2ZVZA 2YIAA 4QUHA 2IYTA 3TNLA 1F4LA 4G28B 2VH1A 1QZ3A 1VQMF 3QFHA 3FHTA 4GOLD 2QSAA 1KKUA 4NEGA 4BT5A 1SWVA 5KAPA 4WK4B 1BEZA 1WP4A 2QP3A 2Y1WA 2VF5X 4U9HS 3B09A 5EPOA 2B37A 3A0BZ 1Z18A 4R54A 1EJ6A 4D57A 2RAFA 3HYRA 3HNPA 4B8ZA 2JBAB 3B53X 2GJ4A 4K0KB 1JQBA 1G21A 4NARA 4UARA 2ZNIA 2PZKA 2ZQZA 5CLGA 5C1DA 5BW5A 3OZUA 1TYBE 4RHFA 1MC5A 3KUUA 2VJQA 3LUJA 3TVTA 1LNQA 4RHAA 1NJ1A 2YWCA 4LWZA 2FMIA 4YXWA 1KHTA 2JAHA 2M6KA 1N5LA 3SE0A 4C6RA 4D45A 3HVJA 3T1NA 1J21A 3N76A 1QGUB 5LXTB 1A0OA 4AP5A 4Y0NA 3C6MA 5FLXM 3FGPA 3G5LA 2IX9A 3PQDA 4EJ6A 2W6IA 2GSDA 5HS4A 4KU4A 4V24A 1QK4A 5E4YA 3VKWA 2V6JA 3Q2OA 4W5JA 2O54A 1G0NA 3F3MA 2OA0A 3TD3A 4CC5A 3CKKA 3MHHC 1E1QA 3PJEA 2ZDGA 1EIZA 3MAAC 4QM7A 1U4NA 4N03A 2QVYX 4IRUB 4B33A 2G1KA 1QLJA 1W6UA 2R9IA 1TJPB 13PKA 2WKRA 3VV2A 4X95A 3AR9A 2CKDA 4EY3A 4HNVA 2POQX 3C5HA 1XPOA 1A8SA 3GUUA 2GPYA 4IMJB 2B4QA 4WUTA 4WK0B 4E4YA 3LT0A 3JD0A 4YGXB 1GGJA 1Q8IA 1TZBA 3L82B 5JD5A 5KNDA 3C3KA 3CZ4A 2QU8A 3FFAA 2WJ3A 3CX8A 1CR6A 3GGJA 1CZRA 2C31A 2X8JB 2XNKA 4XFJA 4FS8A 3EIUA 1VCIA 5K3AA 5DCVA 4GYYA 1L7MA 3ZEDA 3T06B 4FDMA 1ITZA 1CQIB 1P33A 4IHKA 4E03A 2ERCA 4AKSA 4RGYA 4NZPA 3OZRA 1QO0A 2FMHA 3HRHA 1DRWA 1WW2A 2XXAA 3PP8A 1BDBA 2GWHA 1T8WA 4KMOA 3PHJA 4RAIA 4C7XA 5IN4A 3WIOA 2A9VA 3AIMA 1VHJA 1SKYE 4Q3BA 3LI2A 3WWPA 1GNRA 1G59A 1XK7A 4UQOA 3W5CA 5CA0A 4OHVA 2VJMB 3W78A 1CEQA 1ZC3A 3CX6A 1BDIA 2OCAA 1GRVA 2QD5A 3BYZA 2YH2A 1GN2A 5E2AA 3EGOA 4EYQA 5BN4A 2RI0A 5E9JA 4GGMX 3E9DA 4ZQBA 2BGTA 4DARA 1WP7A 4G5HA 3J7AR 5HRUA 1P2VA 2VP9A 2ZWPA 1KTIA 4E21A 1TUEB 3UPTA 3GQBA 5ERYA 4LV8B 3JQPA 2XUIA 2Z4RA 2WF6A 3Q12A 4TKVB 1GR0A 3AWDA 3K57A 1SD5A 3CO0S 2FA9A 1R64A 3S2SA 3KTFA 2WUEA 5FPHA 3M7IA 4HAIA 3M89A 4LRUA 3IE0A 3ASOC 2WM3A 2FFHA 2GM5A 1NVDA 3ZS8C 2BE3A 3EVEA 4JP5A 1KYQA 3QGMA 1RFGE 4N5LA 3P8ZA 1IV2A 1AR5A 3FKSD 3USCS 3CC4F 4DLYA 3G17A 3LW8A 1N8TA 4H18A 3AG4C 3L9WA 4PZLA 2W2LA 4TTQA 2PUVA 1CEYA 3ZMTA 3QLTA 1CY7A 4BKUA 2RHTA 3RTEA 4LHVA 3UGKA 3OOEA 3JQ9C 1DWQA 2J9XB 5LSAA 5FA8A 3N05A 1THMA 4MS1A 1GM8A 3FA2A 3H65A 2XUAA 3LX5A 4MULA 4DW8A 3DEIA 3RPEA 3C4JA 1KMIY 5FXMA 1KEZA 4R51A 3HY3A 2CFCA 3K2EA 4I6GA 4YMIA 1XXHA 4J0HA 3ZGVA 1VE7A 1P7ZA 1WAZA 1DI0A 1W44A 3PQ8A 4BUCA 1XI2A 5G3ZA 5JHHB 3OQIB 4F71A 1QMGA 2X6RA 4QPJA 3R3WA 4PSCA 5IKOA 1GTZA 4RORA 1VQ8V 2XCQA 3ZD8A 2P6RA 3TVDA 3LOPA 5DGXA 4DUYB 1I3LA 1O0SA 1ECCA 2ZXEA 4UVDA 1JT9A 1Z0DA 4Q9DA 4UOQA 1AS3A 2AQKA 2E5FA 3NLLA 4OHCA 3T3HA 1SVMA 3AJ8A 1QCDA 3OKPA 3RS8A 3U9LA 4OXKA 2HHAA 2NZWA 5KHAA 3DV9A 3UFBA 1Q1EA 1KMHB 2J9ZB 1U63A 1SRQA 5EOVA 1PFGA 5DT2A 1YS7A 1A2QA 1JVMA 4I1SA 5IYCO 3ZD7A 3QEMA 4WLNA 3ROZA 3QPUA 4TMFA 3IC9A 5C37A 3GJ7A 2QKYA 3OZ7A 2X3FA 4E31A 3GRFA 4X6XA 4LHXA 1A32A 4KH0A 1SG6A 2V7VA 1C14A 2IOYA 4U7DA 3RVJA 4MI6A 521PA 2JGAA 3B4SA 2J09A 4Z2WA 2A7WA 1RZRA 5HFJA 3N2YA 3AL2A 5KOJA 3LHKA 2H2IA 4PWTA 1BRMA 4RZ2A 3I9V6 3W06A 4TL9A 1YZUA 1VB5A 5U1PA 5FOVA 3CJHA 3PJDA 1F4PA 1GNTA 5GONB 2WQZA 4HJRA 3CVUA 2F43A 4YVFA 1U65A 3GNLA 5SICE 4XIYA 4R8RA 1SUFA 1JHRA 4XWGA 2PZLA 2O3QA 1P44A 5JY1A 3N3BC 3QFCA 1FLAA 5EP2A 1DWUA 4UPVA 4UTNA 2G63A 1DTEA 1OBVA 4DEYA 1HT3A 4UC0A 3TL6A 4RWUA 5EJIA 4RUEA 2QTVB 5GTIZ 4YPFA 2QGFA 3S2FA 4IIEA 3COZA 5LP6A 4G0XA 1AGXA 2GCNA 1BX3A 1YQWA 3R0XA 3ZHTA 1G66A 1G8SA 5JNLA 4LJ4A 3SMQA 1FQKA 2FKXA 4UE3S 3RFTA 1S9DA 2Z3VA 2FHPA 3L0CA 1GPWB 5H2FZ 1H5NA 1T36B 2QRGA 3K3PA 4XCVA 3SI7A 5JCOC 1ZH2A 4LF7O 4HQ0A 3F3KA 2IXEA 2C3YA 2DOKA 1GT91 2LCAA 2CLSA 2OKCA 2HG5C 4EG0A 2XDWA 3D81A 5L3FA 2B20A 4J0QA 2KTVA 1PJ8A 1XRLA 1A4UA 2XYQA 1FUUA 3A4NA 1P7VA 5JCPA 1XDCA 1J22A 5AVMA 4OAQA 4BY9E 3ZIDA 2VNIA 2WLHA 4MVZA 4CF7A 4LF8O 5DWVA 5ALWA 3NVAA 4X45A 2HEIA 4FGZA 2P4QA 5FNVA 1D4ZA 3FRHA 2OBLA 1FJXA 1GTMA 1JB9A 2AJ8A 3U9SA 3S1SA 4PBTA 1L3CA 1J95A 3Q9NA 4JI3O 1DOHA 2Y4UA 1LI7A 2HLPA 4R6ZA 2HS4A 3SBOA 2OYQA 4B7XA 4BO6A 4HBZA 4UDYX 2EKQA 3WGGA 2JHPA 1UT5A 5B8FA 2XEXA 4GZMA 2L19A 3I9MA 5KINB 1OAOA 1MHPA 4DQKA 2HRBA 3VYRB 2EILC 1NAHA 2HS0A 3N28A 3ABMC 2CL7X 3Q5DA 4L4YA 3FKJA 4G0OA 3GPCA 4YC7A 3NDJA 1LNZA 2WPDD 4B46A 2W2KB 1E1DA 4TRMA 2BRUC 3RKSA 3JCMM 1P7GA 2D4HA 2KI5A 4LGYA 2P2DA 3HKCA 1H42A 4QAQA 3SS8A 3WO0A 3SF0A 3EUWA 1EHYA 4G01B 1VQLV 1KDOA 4OQPA 4DT1B 3F5WC 1MHTA 1PP4A 1S3FA 3S3WA 1U8XX 2GN6A 1F51A 2A3QA 4IDNA 4LSWA 3WDLA 3WGLA 4F6CA 3CHXA 4LXYA 5B7PA 3FNGA 3K96A 4MRSA 3AIKA 4G97A 2W71A 4BNTA 2JGJA 4R1PA 3WLMA 5LB4A 3ILSA 1MO4A 1SCUA 1K9MH 3J81N 3FFBA 2B1QA 2G5GX 3BL8A 3O83A 3REQB 4PLCA 4Q47A 2WTEA 2Z08A 3O8DA 1GQYA 1KVSA 2FZWA 2PT6A 4ZV4A 3CCUF 3D02A 4HUTA 3FLEA 3SX4A 3UQYS 4I55F 2R97A 2FI1A 4AYWA 2Y1KA 5CUQA 1L4NA 3KSRA 3OCYA 4YRCA 3C97A 4OHUA 1JH8A 4FSDA 3KBBA 3TSCA 4E4EA 5CBHA 1YJ8A 5JDIC 4BR6A 2VNAA 1KP9A 4NMXB 3Q10A 4HWOA 2GX6A 2ZSDA 4WK2B 2I6RA 2GEUA 3CZ9A 4QOIA 5TDHA 3E8GA 1NJ2A 3BSSA 4JI6O 1MZVA 4XB2A 3GRCA 1E4VA 5CLFA 2BUAA 3BWEA 1Z4QA 3W90A 2FSVA 3UCXA 1SQ5A 2CXPA 4O4JA 2AFHE 3M6IA 2IH4A 3KQUA 3G8CA 3T99A 5LZ8A 5AHOA 2GPNA 5CXQA 2X5KO 1JPNA 3S27A 1ZHOA 2FW9A 3HKBB 4G5QA 2LCQA 2XWBF 4KYUA 3HH8A 1O9HA 1IWBB 4MKFA 4CM1A 1AQIA 4PRKA 4RK6A 3VC2A 4CQMA 3L74H 4BNMA 4LJLA 3LLVA 2GHRA 1ZW6A 4EGFA 1RBZA 2Q3JA 1YAHA 3IQIX 1BS1A 1M66A 3H3JA 5M29A 3VVBA 4D8YA 2ARHA 4ZOBA 3BY6A 4QQFA 4YX9A 1CF9A 1K34A 1P77A 1UKZA 2EIJB 3TYXA 3G3EA 1UH5A 2TRSB 5F35A 4L9SA 2ZFUA 2NIPA 2BFDA 1YIAA 3JQQA 3JR3A 3PYXA 3F8TA 4CM8B 5E1OA 2XQJA 2FFRA 3D3IA 4YLEA 3U3MA 1VE3A 3PJRA 3C39A 1P1JA 2OBFA 4OX9Y 4XAQA 2GA9A 1S89A 4HPJB 3QPDA 3SDBA 4EW3A 3K1AB 1W0JG 2B1IA 1Y9ZA 5J2TF 3ZOZA 3BZWA 3SYOA 4INAA 1N9GA 4AJ4A 1ZBQA 3GK3A 1MO3A 3DEAA 1WL8A 2VJNA 3L6EA 3PE4A 3EK2A 3EULA 3IAFA 1I1OA 1Z0AA 3HYCA 2IHBA 4LZNA 2B25A 1N0UA 4U02A 4PU0A 3AJAA 3QM1A 3NOQA 1VCNA 5EWRA 1BMQA 4KHPO 3CKYA 4G67A 3PC8A 3GG2A 3RK0A 3D0RA 3O90A 3ON5A 1O1YA 1U9JA 3U11A 3B51X 4KXXA 5L6LB 3LBIA 1SELA 1X3LA 1I6WA 4PDVA 1GAJA 4MYSA 4RVGA 4CR7A 3LMKA 4P4LA 4UHBA 4MQFA 1I1NA 3NNNA 2QUAA 2WV9A 3DZHA 2Q1WA 1GAXA 4O33A 3PX2A 3ZWKA 3ZWPA 1AR4A 4IXNA 3C9RA 5HQTA 5FORA 3WP1B 1V4VA 2AZ0A 4JNKA 1L5QA 4RIFA 3NBZC 5PNTA 1E1RD 4H2DA 5FIUA 3PUVA 3ZHXA 4UOEA 4JQCA 1O6GA 5FLYA 1RHUA 1ACLA 4FFVA 1JJFA 2FR1A 2XYVA 3TGPA 4EO4A 1SUWA 3QBDA 3QVWA 1KKMA 5LZ5A 4ZYWA 2V5VA 1XTPA 2DOSA 1PFYA 1HPLA 2ZYTX 3EGXA 4HS9A 4RD4A 3C3EA 5HILA 3L05A 3L4EA 3P4XA 4H1HA 3IVRA 2QZZA 1DEAA 4EFKA 3KIZA 2VHWA 3E27A 3G2KA 1DADA 1DQZA 4FW8A 3L6RA 3H9GA 2E4XA 4ENUA 1UJ2A 4EZEA 4NBUA 3CCEF 2G7ZA 3A10A 5BQ5A 2YYEA 1S2DA 2ZUTA 1TCUA 3VQTA 4CS2A 1KY5A 3OOWA 4EMTA 1JH9A 1Y7TA 3QNWA 1FXWF 3FPFA 3NC4A 2FN7A 2HDWA 3COVA 1PKEA 1ZIDA 4ZZ2A 1JSRA 1T25A 4WZBB 4NPHA 3U09A 2OXTA 2P2CA 4CKWA 4GL4A 1SXHA 2Z6QA 1TADA 1F2VA 1B15A 5IAGA 1OKKA 1NURA 1VQPF 4BQQA 3H5RA 1IOLA 2OHVA 2XJ9A 1M1KH 4IINA 5EKXA 1CJCA 4PV1B 3E8BA 3O85A 1JZTA 3NANA 4HWKA 4L08A 2GJSA 2Q0SA 3O4HA 4YB8A 1YI2V 1WPGA 1IY9A 2XZLA 1ZJZA 3SQDA 5IVHA 4OBEA 2X8LA 2IKQA 3TTUA 2GT1A 4MHTA 3PFHA 2QLJA 2DPGA 5F5XA 2EZPA 1UJ4A 4KK3A 3UXEA 4NC9A 2W0XA 4CC6A 3VAYA 1F2UA 2R0QC 4NL4H 2QLMA 2P0YA 2R48A 2OTMA 1O94D 4PSKA 2R65A 2F1KA 2BO1A 1ZS9A 3R5XA 3SXPA 4TZTA 1FPQA 2HDOA 3OLWA 4ON9A 4LXHA 1E77A 1F06A 3CH6A 2CZWA 4ZT6A 1DKQA 2Q2NA 1Z28A 4RTLA 2P4SA 2JFNA 2NZVG 3C9UA 2V54A 2H85A 2QYTA 1V95A 3RARA 3VAZA 2B3DA 4JR0A 2YHAA 3V46A 4EH1A 1NI8A 4H7JA 4GBJA 4D9GA 2CMKA 4Z4IA 2I66A 3RHZA 1H05A 4F3YA 4HQNA 1SHKA 4ARAA 2F3PA 5BUQA 3DXYA 2QMOA 3IBFA 3GMIA 3CKMA 3SS9X 3AHJA 1FX0B 3DUWA 4DUGA 4CEHA 1QHIA 2JIBA 3RVBA 3W7WA 2P41A 1XEWY 1M2NA 1R3UA 4U4AA 2RE8A 3OEEA 1Z34A 4L76A 1F0YA 3C1AA 5BN1A 3RC7A 1TZCA 2P7TC 1BKSB 4OQQA 3G0DA 2E5WA 2NUAA 1DAOA 3ZCXA 5D01A 1DPFA 4JAVC 1ZU4A 2ILMA 3N8IA 1RSOB 1P5RA 4UBMA 4MKHA 2I65A 3VBEA 1SC6A 4IYIA 2HH9A 2RHJA 3FYUC 1D2AA 1QAHA 3ZWYA 1KNJA 4R8CA 2W42A 2DYSB 4IWNA 1I7LA 3V2UA 2VZEA 4FFBA 3RYIB 3GCGA 1Z56C 3WDSA 2UXBB 3HU2A 3HA5A 1OCRC 3A1EA 3IIIA 3PC6A 2JAOA 4EB6B 3PUWA 3RK1A 3V1YA 4UJ5A 2QD2A 4GNKA 4LOAA 5JI3E 2CLIB 3X0DA 2CHTA 1ZMRA 2LJ2A 4COKA 5FOTA 5GAJA 3JALB 1O5OA 1OAPA 2D5CA 2AIFA 3CUVA 4S0XA 2XHZA 5BWBA 3BD6A 1IBLO 3CLHA 4JBNA 3HHPA 4GLOA 2DKNA 2ZT8A 3QY0A 3TKAA 4C4XA 5C7LO 2JVIA 5F73A 1IXSB 3LHDA 4JT2A 1X1EA 4OI4A 1OHHA 3ZCPA 3KYDA 1Z7BA 3DGEC 1QMPA 2AX3A 1K7SN 3EIEA 1M8FA 1YULA 4PXAA 4ETNA 3L6CA 2FDXA 4LJSA 1Y4MA 1TAQA 4FS3A 4Q4JB 3H6GA 1PVOA 3C14C 1HR0O 1ZI6A 3A8TA 2H4YA 2R72A 3FPCA 5A6VA 1MORA 3CCSV 1YQNA 2NZYA 3ANNA 4MEAA 4UXHA 1SA0A 1H65A 4FINA 2R1VA 1BWQA 1CVLA 3ZXIA 4P34A 1PDWA 3CNNA 2CSXA 4Z49A 4YK7A 2COEA 2CK3G 4U3JB 4G0QA 4KO2S 2B5OA 4EL5A 4LK3A 5EAIA 3H4MA 4OP2A 4UREA 3GT3A 1T3TA 4UMEA 5F3RA 1QUEA 2JGMA 4FFLA 1HZJA 4JCCA 3FFWA 4B6EA 4Z1OA 4AJHA 4I4TB 4R8MA 1XC7A 5B3JC 2WFMA 3EH2A 5KHHA 1HK7A 3RHFA 4CFYA 4FKZA 4YEDA 1EINA 1ZISA 4AX8A 3BE4A 3M4YA 2V4UA 1X1CA 3EFFK 2DKOA 4WNCA 1PRYA 1RE1A 1AK1A 1RJWA 3OPVA 4GPEA 5LQMA 3PKJA 3UWOA 2ZTMA 2DQ4A 1NRWA 1DB3A 3A3KA 2R44A 1J00A 2EFJA 5A9RA 5C0OE 4EPWA 1OFGA 3IV6A 3E2PA 3KKOA 4F97A 4YS6A 5L45A 4Y7DA 4GOOD 5HG0A 4DA4A 3K9FC 4DIDA 3A1SA 3VHXA 4WEOA 1G18A 2OQRA 4TMZA 2PR2A 2DPHA 3DMPA 1YOBA 4MVQA 2G9UA 5H9CA 4RPGA 2QTFA 2F3SA 1X86B 3U3RA 4K6CA 4JZKA 1AUOA 2V7EA 1Q7TA 2TMKA 4JI3B 1QHSA 1W41A 1GGHA 3SDLA 1P2TA 4LVOA 4O2AA 1VMDA 4LWSB 4MEBA 1EX9A 5KQRA 1R5NA 3G1WA 2HK9A 2XE7A 4GLJA 2YV1A 1HEUA 1RYBA 1YI8A 2A3RA 1VIYA 1W581 4U39A 3ZV3A 1UBJS 2DBVO 3OM0A 4FR5A 3ZHVA 5GTDA 1XEWX 2V4MA 5JZVA 4Y8VA 4Z51A 3IERA 1DUSA 4KXMA 2Z3ZA 4IR7A 3LXMA 2JGDA 2P91A 4BV8A 4RHEA 1E3WB 4FSXA 5AKJA 4JMPA 2WLJA 3ADCA 4OHFA 1K9MW 1ZLZA 3EOAI 4I5IA 1FMLA 3E8FA 4CN9A 1SOWA 4MR7B 3IRUA 1EA7A 1Z2AA 3VR5D 3L0BA 3LHSA 4H17A 3PFCA 1LPMA 4C03A 1KEWA 4TKUB 1FFDA 2QRLA 5F7ZA 1R10A 3U7HB 3EQ2A 4G4WA 1L7EA 1SESA 2AYZA 3TQIA 1GILA 3BXZA 4U00A 1AH2A 1MC1A 2QTAA 5AI4A 1GKKA 1EVJA 4OM8A 1TEXA 3OAAG 4GRIA 2ZYRA 1NLFA 3TLJA 2H5IA 1GDHA 3QWHA 3P0FA 2PUWA 3GZJA 2EBWA 1TU3A 1OJLA 1S2OA 4K9DA 1XNRB 2Q6OA 3IUJA 2ORYA 1ZHFA 2NU8B 2CUNA 1MBZA 2V03A 3ESXA 3OA2A 5E0OA 1YAJA 5IDWA 4DREA 3EZFA 5ITWA 4WLEA 3K2IA 2QI9C 1VIDA 2VTEA 3BX1A 3PD1A 3V4OA 1NVPD 2R8OA 2OOSA 4Q3AA 1ESMA 3JQGA 4KNVA 2JJ8A 1MAVA 1M7HA 5IAJA 1LRLA 1HW7A 3R7DA 2CLOB 1USIA 4KXQA 3DBRA 3TNFA 1GEEA 1W85A 3D6AA 1VKNA 4MW6A 1JIKA 3W4KA 5CW1A 3GVCA 1XZFA 5I7HA 3UMBA 4HP8A 3I39X 3UM7A 2UXNA 1LF5A 1K5GA 2GJAA 5F77A 4JI6B 3N7AA 4HX9A 2HT1A 2UVDA 4XW2A 3ONEA 3N2LA 1XVIA 2BUBA 3V4LA 4HQLA 2UZ3A 1VARA 3W7XA 3M6AA 1T1IA 5BVHA 2B33A 1BGYH 2ATKC 5EWLB 1TKCA 3H4IA 3V8PA 4JP1A 3WJAA 2OGWA 4DJAA 3OEHD 1NW9B 2A86A 2RFLA 1Q0TA 1T2NA 1XSEA 1FFXB 4G1FA 1PKXA 1WCV1 4JI2B 1Y1RA 1UAYA 3SHTA 2PYJA 3I55F 3HZRA 4DA0A 2OB2A 1OU4A 1U0FA 4C88A 1M2JA 3NDBB 3LX8A 5JZSA 2FY8A 2JGLA 2ZJFA 2HA6A 3HXMA 1QVAA 1Z62A 4RGVA 2X6AA 2XAUA 1WJGA 2O0KA 1ZX3A 2ZW9A 5IP5A 4ZCMA 1ZIYA 1MNAA 3UJCA 5IYZB 3FD8A 1XALA 1YZLA 1CR4A 5HIAA 3OLXA 1Z26A 2LUOA 5I9LA 4R4JA 1TVKA 5BNIA 4IIJB 1DLIA 4ZIRA 4P80A 2P6MA 1E9BA 4KLCA 1I4OA 4NBSA 1GZDA 3NHUA 3CGGA 1UBCA 4J9UE 3UMVA 2CNKA 2Y4NA 3R0PA 2GEJA 4CKEB 3MFYA 2CVQA 3ZDQA 2C3PA 3WJRA 1DLJA 1UIRA 2CF6A 4Y2XA 2YHIB 4KXFB 1G5TA 1WV0A 1JU3A 4FLMA 5EIHA 1UMBA 2X77A 2X6QA 2X9GA 2WUVA 1XMJA 3DKVA 2PDAA 3DTYA 3GLHE 3G8DA 4QBFA 2NU7B 1L4EA 4YRFA 1EWKA 1O2DA 2WABA 3E7PA 3G85A 4RFSA 3FUVA 1L5RA 4ONEA 5D3MB 1YFJA 3VKGA 4WX2B 4PIPA 2QI2A 1E7WA 2C99A 3D2AA 2H0AA 3QJYA 4FIZA 4TTAA 2ETVA 2YDEA 1DBRA 3LE8A 1R16A 3HMQA 1PBNA 5JVDB 2P9TA 3DF7A 3U9TA 2QWOB 1B93A 4QUGA 1H2AS 5T8KA 4F3CA 4MUNA 3TMYA 4ND7A 1EE2A 2IJKA 4MLDA 4KKVA 2P11A 3K9NA 4L8VA 1HFKA 2OESA 5IJXA 5EHIA 3A0RB 4I36A 3V4FA 2FNAA 2QL6A 1TZ2A 3DXZA 4P35A 4YUZA 4ZA2A 3PRYA 5GIPC 1LCIA 1T0AA 5AVUA 4P3YA 3ZRWA 2FZ4A 4OBBA 4GMDA 1K5DA 3AESB 1KA9H 4ETMA 4U2FA 4TL7A 3VTIC 4F92B 3K9WA 5AW9A 4D6YA 4Q00A 3T3PB 5LD2C 1XL1A 4XLTA 3FDZA 3V33A 1ISSA 1ONOA 5GZ1A 2BBSA 1F8FA 1VCHA 2Y93A 2ZITA 4D3XA 1GLVA 1JR3E 1UBNA 3QO8A 4X91A 2PMCA 3ZGOA 3LC7O 5F76A 4P86A 4RDXA 3AY6A 2PUHA 1D2MA 4GMXA 1P8JA 3O1HB 5IXYA 3FNBA 3GFQA 3NNDA 3U7FB 1M1KW 4B47A 2ODWA 2LBPA 4X0EA 3WV5A 2WM2A 5BRAA 1K75A 3FCAA 4NG5A 4FFNA 1GGNA 3Q85A 5CH5A 4PX2A 1FNNA 5BYKA 4DC9A 1Z83A 3QNEA 1YJCA 1KJYA 1J8FA 2E37A 2YDXA 4BIZA 4IXDA 3VU3A 4PZ9A 4ZQCB 3PIIA 4N7BA 3F3SA 4CG2A 5AIAA 5AM1A 1M56B 2PJDA 4WL0A 2DQKA 3WLSA 2DUMA 3THWB 4QC2A 5AJVB 1YRHA 1U81A 5DMHA 1Z4LA 4X3LA 3V7EA 2EG5A 4B43A 2FSPA 5KWEA 1SXPA 2ACVA 1LS6A 1D5CA 3OR6C 3D6MA 1DCFA 2FN4A 5I4IA 2Z4SA 4W5NA 1XLUA 3GZTB 2PY5A 4S1VA 3ANYB 2WWRA 2BEJA 1N7IA 1P72A 3QVMA 1AG9A 5EMMA 2RHWA 1FFEA 3DNPA 3AI2A 4QTYA 1NVUQ 4FJ0A 2R6GA 1P0CA 1RTTA 1XMIA 3CEMA 3VFDA 1JA9A 3ON1A 2WFLB 3LVRE 1SXJA 5IE9A 3U3DA 1H4TA 3VSAA 1BKDR 2CXXA 4V1CA 1VQ6V 3G2LA 4C08A 4LJKA 1XPRA 1W35A 3HBMA 4OSOA 1GDTA 4KQWA 1JPJA 3CZRA 3PGXA 2X5NA 3X3HA 4LXTA 5IH7A 2RHHA 1V7PC 2EV9A 4MB2A 4F3NA 1DWPA 2WEKA 1L5NA 4FM2A 5ALEA 3PV0A 4LXGA 2BVNA 4S1OA 3EWAA 1NQWA 3G5UA 2VDMB 1DKNA 1KVQA 2E1RA 5CA1B 2VOJA 2EIXA 4Q9JA 4UM9B 4GAEA 4FFRA 2WW8A 1UPBA 821PA 3BSYA 5TJHA 2JVDA 3ESCA 1MB2A 1PJZA 3T6KA 3M6WA 3NK7A 9ATCA 4LY0A 4GYWA 4BU0A 4ZCPA 3MTIA 2I1LA 4CG3A 3TIVA 1S4QA 5KA5A 2OHJA 1IXYA 1K6EA 2AIRA 4U7OA 2G88A 3TRDA 4OMFG 4JUFA 1VSVA 3CKLA 5D7NA 3EFOB 1FRFS 1E4OA 5L3CA 2Q7HA 3UK1A 2Q8NA 3KJFA 3QV2A 4YP6A 4M1SA 4LOLA 1H94A 3L0OA 3H1BA 3ZLBA 2XCOA 5B3LA 8LDHA 4L8JA 5HP7A 4PPFA 1RBQA 4JLKA 3I2GA 3JSXA 2DSTA 3KHTA 4JLDA 3WSTA 5LQJA 5CG1A 2RK4A 3A1CA 3KHKA 4BO4A 4RADA 1SHJA 4XUEA 2RONA 3ESYA 5ALGA 5DK4A 1BVHA 1U8AA 1R73A 1T6BY 2CSLA 4B3IA 4JT4A 5BOSA 3CF4G 4H0FA 4Y2QA 3SR4A 5HR5A 1KQGA 2V6MA 3BQ9A 5A3VA 3ADPA 3MDOA 1VL8A 4BO5A 1OX4A 4BNZA 2RBKA 3BMQA 5JZ9A 1ESDA 2LBWA 1N6PA 1MJHA 5F7XA 4JENA 3KZIZ 1PWYE 1HTWA 5WRFA 4G07A 4A15A 1M0WA 5ESXA 3QIVA 2E9SA 1FDVA 4RF3A 4B3BA 4NYKA 3MAQA 1XOIA 2OWOA 1R0CA 1YSCA 3D7RA 3CYQA 4FILA 3KKMA 4NDAA 1WVIA 2CT8A 4IPTA 3DW1X 1E69A 4H7EA 3D3WA 1DKPA 2JLXA 3IILA 2AI3A 3R5FA 3RIEA 4TXNA 3E7XA 3VSCA 2PX2A 2HK8A 5AHRA 2CXTA 2P5OA 1Z2PX 1VFPA 1OZFA 4ZK7A 3RLIA 4L8YA 1D3AA 3KZVA 1AVMA 4UB6Z 1RMYA 3WLAA 2ASEA 2P2LA 3IMCA 2TS1A 4U5XA 2QE7G 1ZOOA 4EP1A 3GDOA 2AC4A 3AEQA 2ONJA 4XUDA 4EA9A 1IBKB 1APBA 4J49A 1COZA 1EFAA 1LQUA 5IS2A 4L74A 2OWEA 5CXSA 2HKOA 1YCHA 1X2BA 2Q0AA 3ZQUA 5EP4A 4DSTA 2ZKOA 2O20A 3F6PA 3H1LH 2XJ4A 2AWNA 3GLFB 4W9NA 1EFKA 2VS0A 1QJ4A 3AO0B 3H3FA 4IFEA 4EARA 4P32A 1MRZA 5KVQA 2GAOA 3QUTA 1N25A 1X87A 5EWJA 1E1NA 4H33A 2HV8A 1FNJA 1MRNA 3VOAA 4FEYA 1QU9A 4IFBA 1SKVA 1K6IA 1EQUA 2QDOA 5G53C 2YXEA 4OH1A 5A03A 1NPDA 2XITA 5DXAA 5HOQA 3TAXA 2NSJA 4I66A 1KAMA 3V6LA 1U7TA 1PJBA 3CRNA 4ND3A 1Q74A 1YBVA 2VRWA 3RUPA 5LQAA 1KSJA 3HUFA 1I2ZA 3LXUX 1F17A 5KJCA 4XJTA 4B4KA 2I6QA 2H8PC 2Z1EA 3BAAA 1YZNA 1ZXLA 2BHRA 1Q3TA 2RB9A 1XL4A 1GZHB 1L4GA 5D87A 1K7EB 3ZH2A 3PVCA 4DDTA 2RK3A 3A2MA 1GXSA 3M6FA 4GLFA 4CEIA 2FWRA 3CLSC 3GNTA 3IIKA 5LPNA 4W7SA 2E21A 1ZLXA 4XVRA 3Q8MA 4E51A 1K73H 3JS5A 4WN9B 4R3WA 4UBNA 5TGZA 2AOVA 2YVUA 2QVBA 2EJTA 2FUCA 4XRRA 4AJKA 4CTOA 3OZBA 5LL6P 1CU1A 3VAAA 1KY3A 2FHSA 1C7QA 3QHQA 3DJFA 4OHYA 4I5GA 3NH6A 2C0QA 3KLBA 1AQLA 2EYUA 5KVAA 4C7OB 4RHUA 1DP4A 4UCQA 4D97A 3O95A 4N0DA 1IYZA 5FFMA 1I32A 3LZCA 4H6VA 5K6AA 4QDOA 2FP4B 2XA9A 3J81M 1BCRB 1CZNA 1QOZA 3AM5A 1IY0A 2NYUA 2P06A 5JJLA 3H1EA 1BXRB 1U2GA 4OD0A 4X85A 3FCYA 3CSUA 1ZPDA 4WTOA 2XGGA 3B2NA