3JASB

Cryo-em structure of dynamic gdp-microtubule (14 protofilaments) decorated with kinesin
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
426
structure length
426
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanistic Origin of Microtubule Dynamic Instability and Its Modulation by EB Proteins.
pubmed doi rcsb
molecule tags Structural protein
molecule keywords Tubulin alpha-1B chain
total genus 158
structure length 426
sequence length 426
chains with identical sequence D, F, G, H, I
ec nomenclature
pdb deposition date 2015-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3jasB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 3jasB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 3jasB01
3N2GA 2VAPA 3E22B 5EIBC 5IJ0B 3JALA 5C8YA 1W5AA 3JASB 3VO8A 2BTQA 4X1KB 3JARA 4X1YB 5BMVB 4I4TB 5CB4B 1TVKA 4FFBB 5JVDA 4B46A 3JAKA 4O2AA 5IJ9B 1W5FA 1W5BA 4I50A 4O4IA 1SA0A 4EI8A 4TV8B 2XKAA 4I4TA 5EIBD 3JAKB 4O2AB 3JAWA 2RHOA 5ITZB 5LOVB 5CA0B 2Q1XA 3WGLA 3JALB 4YJ2A 5EYPA 3RYCA 4KWEA 5CA0A 4IIJA 2BTQB 4X1KA 5BMVA 3HKBB 5JCOC 4FFBA 3ZBQA 4DXDA 4EI9A 4EI7A 3HKDB 4O4HB 4O2BB 4IIJB 1SA0B 4U3JA 5CA1B 5IYZB 1RQ7A 3C8LA 5EZYA 3HKDA 5ITZA 5FNVB 5LA6B 2VAWA 5JQGB 4X20A 4ZI7A 3ZIDA 4ZOLB 3UT5B 4ZHQB 5EZYB 5EYPB 3JASA 1FFXB 4M8IA 4IHJA 3JATB 3RYHB 5JQGA 1TVKB 1W59A 4O4JA 5IJ9A 4HNAA 1JFFA 4TV9B 5GONB 5M7EA 4O4LA 5J2TB 4TV8A 1OFUA 3JATA 3RYHA 5IYZA 3VOBA 5LP6C 5C8YB 5JH7B 1Z5WA 3M89A 5J2TA 5FNVA 3JARB 4X1YA 4ZI7B 3CB2A 4X1IB 5LP6A 4DRXA 5J2UA 4E6EA 2XKBA 4WBNB 3VOAA 3WGMA 4I50B 3E22A 4F6RA 4EB6B 3RB8A 4TUYA 3R4VA 3RYIB 5MN6A 3RYFA 5CB4A 3HKEB 5LYJB 4YJ2B 3RYIA 2GVIA 3WGJA 3WGKA 1Z5VA 2VAMA 4B45A 4YJ3A 3RYFB 4X20B 3HKCB 5LYJA 4ZHQA 4X1IA 5J2UB 5LP6B 3JAWB 5KMGB 5LOVA 2RHHA 2RHLA 1W5EA 5JCOA 3HKCA 2BTOA 4EB6A 3ZBPA 3VO9A 5LXTA 3RYCB 4TV9A 3N2KA 4I55A 5KMGA 4O4LB 4U39A 3V3TA 2R6R1 1RLUA 3HKEA 4ZOLA 3UT5A 5MN4A 5LXTB 3N2KB 4I55B 3N2GB 4IHJB 4O2BA 4U3JB 5CA1A 5IJ0A 5MN5A 1RQ2A 4DRXB 3WGNA 3VPAA 3M8KA 4WBNA 1JFFB 5GONA 5LA6A 1FSZA 5JVDB 5KX5B 4F6RB 1TUBB 1W581 3HKBA 4TUYB 5JH7A 2VXYA 4LNUB 1FFXA 4O4IB 2R751 4O4HA 2Q1YA 5KX5A 1TUBA 4O4JB 2RHJA 4XCQA 4HNAB 4LNUA 4YJ3B
chains in the Genus database with same CATH superfamily
2ZXWC 4NCHA 2XTZA 3E48A 4MV3A 3TLGA 2HCRA 4NCBA 5LQRA 1YBVA 4QTTB 2P79A 1QK5A 1XZ8A 2JK0A 3NJ4A 4C5AA 2H52A 2X7JA 3GEGA 3P96A 1AZLA 1NULA 1QGZA 4RFSA 1H6BA 1XMXA 1QCDA 2HIMA 2V59A 3BMQB 4XEHA 5K8TA 4NSNA 2WTBA 1K9SA 5EWJA 1RWBA 2CJXA 3RFRA 3C9RA 1BA2A 2PL3A 1CVIA 2Y1LA 4MRSA 5JZVA 5G0WA 3K70D 1GCAA 3BBPA 1SUCA 2A0KA 2X2PA 1WLYA 1ZNZA 2PX8A 2Z83A 1YF2A 2FRXA 3EDOA 1RJFA 4NZYA 4OHVA 4V3CA 3VR5A 1IHOA 1V7QA 3VV3A 4AO8A 4UM9B 1OJLA 1JMYA 4OQXA 2F7SA 3HGQA 4X97A 2AG1A 5CX1B 5ICCA 5AW2A 5J2TF 1BU5A 1U3WA 2MOKA 4IVPA 5TY0A 3CFYA 4CKEB 4X65O 1RSZA 2Z9DA 4X8HA 1NQUA 1XRNA 1K7DA 2QN8A 1UBRS 4PQFA 2C88A 4N1AA 3RYTC 4PCLA 4DMFA 3PHJA 5CFQA 4E09A 3OX1A 5BSWA 4NTXA 3CH6A 4JYMA 3L4BA 3LDAA 4HFJA 4RV5A 3U0BA 1OKKA 2BSKB 3CNLA 3SYCA 1NUTA 1QFJA 3FWZA 3CKLA 3BHIA 3AHDA 3HWRA 4TSFA 5AXDA 2Q8NA 4XIFA 5D3MA 4S04A 3GYQA 3GRVA 1FQWA 4EFNA 2LGJA 1S0UA 3E8SA 3H11B 2QG6A 1H8HG 3CS3A 1VB3A 1XTUA 5G4KB 5EPOA 1OFUA 2ZTLA 4GYWA 2ZUWA 5KQMA 5IVPA 1J22A 1MR3F 3AF4A 2OXCA 1Z5WA 1P7WA 4JPRA 3D54D 3WP0A 2CL5A 2GEUA 2V3WA 3RHFA 3ID6C 3L7KA 3ESZA 4YMLA 1VK3A 3WPXA 1XF9A 4V2IA 4J0EA 1L1FA 2X86A 5HKOA 1T9HA 4LPSA 1V8OA 2GN2A 2WJYA 2WFZA 4MR9B 4FT2A 2F23A 4BRSA 3PG5A 4C4RA 3B3JA 1CPYA 4AN0A 4EAAA 1H8ED 2J5BA 2RI0A 1YR1A 3DQQA 4JX9A 2HO4A 2JD0A 8ABPA 1FZTA 3OGIB 3LDCA 4AXXA 4MR8B 4IXDA 3IVAA 2LV8A 4RMNA 1II0A 5K7SA 1YIJF 1HOXA 1FE8A 5ALTA 5JSQA 4ZHQF 3ZXUB 5ICSA 1HX7A 2FEPA 4H2DA 5BQ5A 3NMUF 1RM5A 3AONB 1ZSYA 2I1VB 2QE6A 4FHFA 4I4CA 4MIOA 1U2SA 3ETEA 1BCSB 3O4GA 2WMOB 4P7BA 4IZ6A 3WYDA 1Y48E 1E1YA 1PJLA 2ZZKA 3I23A 3I53A 4QRHA 4EX7A 4AIIA 2YWCA 4UM5A 5TMBA 1IY0A 2GOYA 4POAA 1E79D 1NVBA 4EFMA 2WWTA 3KNZA 2BFFA 4IRMA 3ETJA 3I8OA 4P92A 3BIJA 1S96A 1XQ9A 3DNFA 1MGPA 3TJRA 4HOYA 2AKEA 3LOQA 4ATNA 4I55B 1Z5ZA 3PDIB 3UPTA 1YRAA 2JI6A 4FJ1A 3TRKA 3A1EA 1OD6A 3DYIA 3PJFA 3QA3E 4WLNA 2Q5FA 1L7PA 3LLSA 1HNZB 3DBLB 4EUNA 4KZKA 3L0ZA 2OO3A 3PUJA 1BD4A 4NH0A 3ECCA 4LV6A 2BMJA 2EZ9A 4UFOA 1N7JA 4GPEA 1QQTA 2DTXA 4HDCA 1OZFA 2I2XB 4XA8A 1R4ZA 3ZDRA 1UJWB 2AW3A 2ZPUA 4WIAA 1PZNA 4QHSA 3FAZA 1WAMA 4GUAA 4RDXA 1IBLO 2OWOA 3H4IA 1HI9A 1YS2X 2WT9A 1NF8A 1O0CA 1H2WA 3D1JA 2PZ8A 4MV4A 4BS9A 1CEEA 1CNFA 3B9PA 4ZQEA 3GGGA 3A6FA 3PTLA 1N25A 3WMEA 5MFZA 1TE2A 2I6FA 1TVKA 3RTCA 5A4FS 1U3GA 1BS2A 2SHKA 3OE1A 3GYGA 5FUXA 3N7UA 2WI8A 2ONZA 4ZEOA 5JSYA 1BQEA 2I9KA 5DGIA 1F6BA 4AD8A 3F5SA 2FUCA 4N49A 1JOYA 1XR3A 2HIAA 3PUKA 4OHBA 4ZDWA 5H4GA 5LQKA 1R6NA 4RAQA 2E5LB 4LJ4A 1K8AW 3WTBA 2EFCB 4UAJA 1DOZA 5FNZA 3WKEA 3KSAC 5AQEA 5KSOA 3F1LA 4EI7A 3H7AA 4IEFB 2C9YA 4BX8A 3BYZA 1T2VA 1N8RW 4ZDKA 2M98A 1T10A 2DUUA 3V7UA 4RULA 2ZQ5A 3JPYA 4WN9B 3TVDA 5EZYA 4GC9A 1QQ6A 3RC3A 3E5NA 3KOZA 4EGJA 2P6YA 5KOJB 4WACA 1K3EA 3HDVA 1M2VA 1GNLA 2OYSA 1DAGA 1C1HA 3A4VA 1XQWA 3NNSA 4UPEA 4LMRA 1FQJA 2QWRB 1DRWA 3FYHA 3E2PA 2O7QA 1XROA 1GPWB 1L8LA 3ZBUA 1EIWA 1KC3A 2XXBA 5AYVA 5M2QA 3FWKA 1EZ1A 5J2TB 4B0OA 2FZKA 3J7AC 1N1DA 4DDHA 4X92A 4LF7B 2R7AA 5REQA 1QOQB 1RI3A 4TVOA 3S27A 1VQVA 4UV9A 3JARB 3GNLA 4KQJA 1AGYA 2XX3A 1SMKA 2XA9A 1QYVA 4MQEA 5CD1A 1AU9A 4YRIA 4TQDA 2JARA 4YAJA 3DTVA 1CT9A 2F90A 5GP1A 4F1WA 1OB2A 1RZRD 1L7RA 2CDBA 3AUJB 3KOMA 4MLDA 3OD1A 4ZTBA 3UG7A 1FCJA 4D7SA 2XOKD 4N3GA 5NLLA 4EVRA 3M4XA 3BF8A 4CG3A 1C7IA 4PONA 3QUTA 1J1UA 3VZBA 3VPDA 3SC4A 3HDGA 1A8IA 1JAIA 5IJXA 3VO2A 2GD1O 5DN6A 1N9ZA 1E1CA 5FLEX 5K8CA 4I3HA 2RGXA 5HXZA 2Z01A 3FBTA 4BCBA 3I9NA 3S81A 1U02A 3I6BA 4L22A 6YASA 1AMNA 3KAPA 4FOPA 4MQFB 1WCWA 4ARVA 2DYSC 1Z29A 1RQGA 3TDNA 1TMKA 4HQFA 3PB3A 5EHQA 3TPZA 3BL5A 5AP9A 3LUGA 4U4AA 2NVUA 3FVWA 3SC2B 4JGBA 3ZV6A 3WG9A 5BSGA 1FQKA 2ZE8A 1MZFA 1TU3A 3Q6MA 4WGGA 4LNAA 4LSZA 3C5EA 3M3PA 2XUFA 4I5DA 4ZANA 4AURA 4PG5A 4RGYA 1JZSA 2E2WA 1D2EA 1EBUA 1QTIA 1V8FA 2WA1A 4WEQA 2DR2A 5LMUB 2A35A 5IC5A 2IYTA 1JRLA 2C98A 2FZGA 4TTJA 1Y1PA 5JSZB 3ER8A 4YJGA 1E2QA 4PJ0Z 1Z36A 5I5EA 2QVBA 3N53A 4FD3A 5KNDA 2ZYRA 4KFTA 5TNXA 2ONKA 3V4OA 2PZGA 4OP3A 4LYGA 3SYMA 2A9JA 4OXQA 4HWOA 2OV1A 3C3SA 4DV5B 2VG8A 3ZRWA 3D3EA 4TLBA 3C3TA 4DR1O 1L2TA 4NYMR 1LGYA 2IU6A 1H3NA 1JCHA 1YJ8A 2M1XA 3F6YA 1UBUS 4IIJF 1UWKA 4MVJA 5LDGA 5C93A 3UY4A 1BYUA 4PNEA 3LWZA 2OTJV 3NV9A 2JEOA 3SR0A 2YI9A 2YN2A 4UUQA 1ULHA 3NKFA 3AEUB 1E1QA 1OC2A 2IHYA 4P38A 5BN5A 1XREA 1DO0A 2NTYC 2OOKA 1Z9BA 3U11A 1IN7A 3P9QA 3S29A 2CVOA 3KPVA 4GXQA 4XAQA 4DLSA 4EY8A 1A7JA 4ENQA 4PPGA 2VTBB 2X23A 1PBTA 5I7HA 5KDOA 3DV0A 2JCGA 1F2TA 1B0UA 2JIOA 2QTNA 3K53A 3AV3A 3OPYB 2EZTA 4JJ8A 3SF8B 1Z7EA 1KSHA 5I45A 1IPHA 1GSHA 4EUKA 3VNVA 4U1RA 5KWVA 5JWHA 1P0MA 1E1RG 3HEAA 1EVLA 1X77A 3EWNA 1T2DA 3ZJ5A 5I7EA 2REQB 3IKJA 5JLAA 1R6BX 3NVMB 2JAPA 3OQMA 2PVCA 3EH2A 5A3SA 5LL6P 3COJA 4LJ7A 1N4AA 2B25A 3O8OB 4R8SA 2QSYA 2GTPA 1CFZA 5DBIA 1LTHR 2XEDA 5KPJA 1CZHA 1CRWG 1HL3A 3CONA 1U98A 2OHHA 2ORED 4A10A 2JFUA 2WF7A 2ZJOA 4F7WA 5JZOA 3OZEA 1RE1A 2JEUA 1FFXB 3HCCA 1XT6A 4AJPA 4L4SA 5HCUA 2XMZA 3NIBA 3Q12A 4N39A 2G1KA 4POOA 3B77A 1CQIB 5T4FA 3WLPA 1RVDA 3SMVA 5HHTA 5K03A 3WBKA 1HF3A 2IOFA 3EODA 3RIGA 4JLDA 3OUTA 3GLQA 4MUEA 4N41A 5M5BA 3BX1A 1BNCA 2C2YA 3L07A 3MJHA 1PJ3A 3OZSA 5H83A 1BG6A 5EZSA 1GITA 1OXSC 4OLJA 4FEGA 2GK6A 2BM9A 3ZR4B 1DXHA 3EGOA 3L7IA 4X7BA 3U6KA 1NW6A 4PLCA 3SPIA 5JQGF 1KO7A 2BI8A 1GLGA 2FPRA 1PNLA 1K7XB 2VWGA 4JYAB 1M1KH 4BW5A 1R0BA 1T3GA 4PM4A 1XEWY 1IK6A 5FFNA 3FKSA 2R6JA 1ECBA 2Q9LA 3W7AA 2NX2A 3GFTA 4ECAA 1A8HA 4XFKA 3N5CA 3EIFA 3MOSA 2K7ZA 1DHRA 1AHIA 4HSEA 3FVVA 1XK7A 2QE7D 2UDPA 3MD9A 4V02A 4YACA 1QKKA 4YROA 5DHTA 1L4KA 5HIMA 1PNVA 3H2JA 4GM1A 2W93A 1W0KA 2EZ8A 4LFBB 4FYIA 1P7ZA 2Q41A 1KAOA 2Y0BA 1MUUA 2ETVA 2YSUB 1XXHB 3P19A 2P4HX 2VFAA 4OGLA 3ZK7A 3QELA 2GS9A 1MTOA 1JH8A 2Y68A 1NU8A 5KNDD 3D36C 4HUQB 5EIAA 1C0IA 3NBZC 3WK8A 4UREA 3NATA 2RHMA 4BAGA 4E32A 1EX7A 1KMQA 3U09A 1W581 3ML1A 2OZKA 4FVTA 4R16A 4GGOA 3EQZA 2HYDA 3TLAA 3LPNA 2W8BB 3A9SA 3PENA 1B4DA 3SS7X 3WGGA 3G82C 3RFVA 4NTZA 2YNMD 4L4XA 2CBGA 2VK1A 2BLNA 1I94O 2YZMA 2A1IA 1CR6A 4IIVA 3CB4A 3BRQA 2NMUA 2UVQA 5G1NA 4BC0A 1JWLA 4KI0A 3ELDA 1PM9A 3LC1O 1IY8A 1B6TA 1PYOA 2FPIB 3MHHC 4FLZA 1KC1A 4JI1O 2QWOB 3EIQA 3AKDA 3KB2A 1F1BA 3CP1A 4MUFA 1BFDA 3SVLA 3UWKA 1OAPA 3CPWU 2QL9A 4RVHA 4D02A 1GYRA 1S72F 5AXCA 3BIWA 2H9YA 1NV9A 4MVSA 4DR4O 2QBYA 1BN7A 2IYSA 2XZLA 2EU8A 4UUBA 1DTOA 3RS9A 2RG1A 4DA9A 3OIYA 2YWRA 3L1KA 4FX5A 3P0IA 2H1LA 3MDSA 1C3LA 3H65A 3I9OA 2IQQA 3NPMA 4PZUA 2ATXA 1B0PA 3DAOA 2BFEA 3GLHA 1USGA 1PT9A 1QLEC 3I8XA 1EFRD 1RJWA 2OAGA 3N0TA 4JNKA 5EQDA 1U0EA 1XXHA 5JS1A 1QP8A 1MOFA 1VIVA 4L8YA 4OBBA 2EILB 4B7EA 3QE0A 5AW3A 1IV2A 2ONJA 4U3JA 1XRJA 1QR9A 1IU9A 3EVFA 4LBVA 5TQ0A 4ERXA 3RVKA 4MV5A 5IUNC 2R8OA 1MA3A 4HAUA 3HN2A 5E3JA 1UMDB 2WVGA 4IFEA 3DFUA 4DLRA 1XD8A 2VAWA 1QWSA 1K5HA 1RLGA 1E2LA 2ZVYA 1D6MA 1QUFA 2UU9O 1K4CC 1AQLA 2FPWA 4LCJA 1K89A 4CMEC 1XDSA 3CLKA 1P60A 3DONA 3R9IA 1ZX3A 1TLLA 2FFRA 1TIBA 1Y33E 3NONA 5AVMA 2J7PA 1N2XA 1NBWB 1YONA 1I3KA 5C18A 3G6BA 1DKRA 1F8UA 3CEPB 4FE4A 5TR9A 2PYLA 4LDJA 4KI7A 5E38A 3VSBA 5EKDA 3VKVA 5EIWA 3VSEA 2JEXA 2P0EA 1KK3A 1U2DC 1HZZC 3CUYA 4G9BA 4HNQA 4P31A 4UD6A 4CN8A 3GAAA 1BW9B 3TS1A 1BCRB 1O77A 1NBMD 3TTTA 1CNEA 4CM8A 1GGFA 4XDHA 3LE8A 2VKTA 1JUDA 2H16A 3P2OA 4GLBA 1NVVQ 5EIEA 821PA 2HUPA 3VPBA 4DR2B 1FNBA 2ZREA 3ZHBA 1K0UA 1I5YA 2HC9A 1KBQA 1R6DA 2ZBGA 2QZZA 3BILA 5BT9A 1KDYA 3KFVA 1XMVA 3OZUA 2VO1A 1PR5A 1S89A 3HLTA 1KVSA 3U3JA 1QR8A 1RJEA 1RJ9A 4Y2PA 1XPOA 1O87A 1J2YA 3BC1A 3T4EA 3CRW1 3PE3A 1QQ5A 4FKBA 3IUMA 1P45A 2G8LA 3IAM6 4AG5A 3G6EF 1LVGA 1XZGA 5A0FA 1C50A 1JHUA 3ZWDA 2RDMA 6GPBA 3GUUA 3G13A 3Q2OA 2C2GA 2QXUA 4GD3Q 5ILQA 4ZI5A 1BMFD 4D9MA 2J09A 1E1QD 2WD7B 1B8VA 3UH1A 4D74A 3P9KA 4NU0A 4EQ6A 3BICA 4EUEA 3IHLA 2VHVA 1JVSA 2E1RA 1JPJA 2QUAA 4I2VA 4QXAA 4BY9E 5CFOA 5REQB 1TMYA 5EE3A 1OC4A 5FBHA 2JFBA 4NX2A 3DCNA 2QUKA 4HMOA 2HSGA 5KNBH 2OV8A 3PJGA 4YMVA 5F1OA 4OHRA 2VNSA 1UK9A 3WA6A 4DV0B 1T5EA 4XYEA 1DINA 2V0GA 2W6QA 3ESRA 4JGIA 2HR3A 4MEBA 4ZT5A 4LP8A 3RCBA 2VJMB 5E0KB 4CQJA 4J49A 2L82A 5CJ2A 1ZH4A 4ND7A 2NXNA 2JBAA 4JJ4A 1VLJA 3JQ7A 4GLLA 2JJ1G 5L3DA 3CCRV 1SH7A 4FJ2A 4ME6A 4OFXA 1QJCA 3ZXSA 2IWRA 2X5XA 1CR1A 3H86A 1WPGA 2JKZA 3OTFA 3ZP7A 4WFQA 3ZCPA 5GGYA 4ADSG 1U5BB 5ELMA 1XELA 3QVXA 3AVOA 5LC1A 3KHSA 4X1KB 4DR3B 4L72A 3GEBA 4YCBA 4HVLA 3FOEC 3HB7A 1O4VA 2YY6A 1EFCA 4RQTA 2YWBA 4EHLA 2RKWA 1DJNA 4BJ3A 1DOHA 1CZKA 2OECA 1YXMA 4I50A 2BFWA 2PXAA 3BD8A 3HMKA 3QW4B 4ZQFA 3RE1A 2P5UA 4HYTA 5CHYA 4BP8A 5KSZA 2V9YA 2QU7A 2I3AA 3A1WA 5KYWB 1BDMA 1YUMA 5EFZA 5LMCA 5DN6G 3IIMA 2OHOA 3LT4A 3O0TA 3IELA 4WK0B 4UMDA 3QO5A 3DOFA 4YJ2A 1VL5A 5EYPA 2AN9A 4R8MA 1RZ3A 2WDPA 3DZIA 1DX4A 3WKDA 4LYAA 1LNQA 1W88A 4ZEXA 2J5QA 4RQBA 3LP5A 4MSWC 1NVEA 3VHQA 4NATA 4ZIBA 2VKQA 1RQXA 1YL6A 3DUFA 5G4LA 1VIMA 3MGAA 3I92A 1Y3CE 1Z4JA 1XMJA 1Z08A 3KCXA 3LHFA 1TAGA 5EP2A 1XZNA 1BEEA 1E6KA 2JIRA 3CWCA 4KRYA 4RY9A 4YB8A 5IN4A 2IYOA 4QGAA 5LPNA 2W5UA 5D00A 3W8FA 1DKNA 3RVQA 5HY2A 4P4NA 5JAPA 2VGMA 3Q9NA 1R8SA 5EE1A 2A9QA 3LFTA 4UOEA 1BWSA 3RYHB 1VF6C 4QGBA 1H0RA 4L4YA 1VCNA 4KRXA 4KRFA 4OAPA 1JFFA 1W3EX 1JJIA 1G20E 2Y66A 6ADHA 3PHHA 4C14A 2DMRA 1U7PA 4G4IA 5TQ2B 2G7MC 3EVKA 4UCUA 4WOKA 3TRFA 2YXZA 1V71A 3TZKA 5A03A 1ADYA 1AN0A 5BQ3A 3A2LA 4Q7QA 1KU9A 3AB3A 4ANFA 3EIUA 4H1HA 4DMHA 4REQB 1QP0A 1G291 2ET6A 3WNVA 3E0QA 2C5FA 1EJBA 3MOIA 1BXZA 3RBAA 5A04A 4B5LA 1NU6A 5A6VA 5ALIA 1L8OA 3KB8A 3R0ZA 4JA0A 5CCBA 1SXGA 4HX9A 5JYDA 1JSCA 1PUXA 2A6PA 5K9ZA 5CB0A 5I7FA 2QTZA 4NKRA 4RACA 1XTPA 3P4UA 5LB4A 3K9BA 1EH5A 2Z3VA 4LGMA 5FOTA 5DTEA 1GPLA 5FOSA 1R8YA 1A96A 1W88B 2ZUCA 1CS0B 3FFAA 1DBQA 2KX7A 1P6XA 3G88A 2I6RA 3LWDA 4QVKA 5DGXA 3UOAB 3VNRA 1XTIA 2Q07A 1M56C 1NF2A 4R31A 3HMQA 2B2NA 5C5EA 3DCYA 1HO3A 1S2MA 1WDWB 1RTTA 1WW8A 2H4JA 2Z9CA 2BM0A 3U0OA 2FSVC 3JYOA 4H7IA 4B87A 2GUZB 1SPXA 5EGSA 2H4XA 4KL8S 2QM4A 2YVUA 2QRQA 3OC6A 1BZKA 2XYGA 3WG7C 3HBLA 3VZPA 3GMIA 3HB9A 1Z6YA 2VRZA 4YDSA 5BXZA 3Q8XB 1FNMA 2FDRA 1VKJA 4OKNA 1XU4A 3F2IA 1CYDA 4OYRA 5JS2A 4K87A 3C24A 1HKUA 1NQAO 3TBKA 3NM4A 2WHEA 3WLEA 4BO6A 1K7EB 3LCRA 1FFHA 4XJTA 3ZZ0A 3RROA 2HCFA 4CF5A 5IVIA 3U13A 3ZYZA 2JCYA 1YVDA 1E1NA 2OBLA 3FFXA 2QJ1A 3ZE0B 1ZD8A 1S3JA 3FAVB 1WZ2A 1X8XA 4EGQA 1FMJA 4IDOA 1C1XB 4M38A 1N9GB 5H02A 2CC2A 1XK6A 4GZ5A 3R40A 1XNGA 3WBBA 4BDSA 1HE5A 4BQFA 4EA8A 3DULA 4KGDA 4ZVLA 3ZLUA 2G40A 1ZJ5A 5TIIA 3IT1A 3IT3A 2P90A 3NZEA 2NUAB 2YFYA 3NRCA 4A0SA 4ALKA 1ZRSA 4C2BA 1AUXA 1ZN2A 1KAHA 5FNVF 3AR7A 3STWA 1NUQA 4D82A 5MF6A 3CEAA 2H06A 3PUWA 3QVGA 1KC8W 5BR1A 3K6SB 4F56A 3K1ZA 1JR3E 2QSZA 2P2LA 3G71F 3FZEA 1RFGE 4NYMQ 3LSYA 4QXPA 3ND5A 2IV7A 5JJNB 3N39C 4DLZA 5JHHB 4TWAA 4R8LA 5CA0B 3PC8C 5I7AA 4BVQA 2XW6A 5EWJB 1K34A 1N32B 1J8VA 2BBTA 2EZPA 3D4LA 2X5JO 5BSHA 3O8OA 1U1CA 2O57A 2W83A 3KZCA 4WKOA 1WPXA 5C1DA 3EGWA 5T67A 3KJXA 1K3TA 2MQEA 3KVVA 2IUEA 1EP2B 3AK2A 1KPHA 3HKDA 2QZJA 5DP1A 3RV4A 4KVGA 5LA6B 2OCHA 1UPGA 2DYYA 1VQNF 1QRDA 2FW8A 1R16A 1B73A 3A6EA 4BT2A 1FRQA 1FFAA 4XIGS 4ZIRB 5HTOA 2B94A 4NZOA 1H7MA 4LZZA 2XVYA 2JNWA 2N47A 2H3OA 2P4VA 2PUBA 2PRZA 3CCVV 1X1BA 1IM8A 4PU0A 3Q3GE 3ZN2A 4G0NA 2W70A 3I62A 2H2AA 3ABMC 2P2ZA 4CC5A 3A2FA 3UM9A 1A9PA 1QYCA 2ZT6A 5JXJA 1MEEA 3DT8A 3C98A 3JY6A 4N6NA 3KUXA 4RORA 4Z2AA 4ZI7B 1PS0A 1SXIA 1U7ZA 1T8PA 3DLCA 4JHXA 4OIFA 3HL4A 4K9QA 3OBBA 1ZCZA 2RH5A 4XBFA 1IG0A 1R6VA 3T1HO 2CUGA 3EW9A 4YASA 3EORA 1FJGB 2NIPA 4RQAA 3QPUA 4G2NA 1CP9A 1C41A 3PFNA 4C29A 3H9JA 1Z8DA 1AI4A 4MVOA 3PEUA 5AM4A 1SBHA 4OOFA 3U60B 1XZMA 4GDMA 1QLWA 1Z0FA 4UB6Z 4CW7A 5JYCA 1KY4A 3QU2A 2GJAA 3IJ5A 5FT9A 4PLWA 3KQYA 3LL4A 4WNYA 2YX1A 1IEXA 1UJMA 1O95C 4ZYLA 1FUYB 4DR1B 1RACA 2PM8A 4G84A 3JYNA 3W4JA 3IKFA 1PG2A 5DMHA 5GAJA 3LYUA 3ABLB 2UUCB 1OFGA 2WU0A 3E18A 3IX7A 5AG2A 4PPNA 4TKLA 2V4ZA 4CKBA 1JR3D 2CZGA 2PEZA 1UC5B 3LLVA 3SG0A 4CGYA 3EEFA 5I8PA 2XCSB 1EZJA 1ZSPA 1LRLA 2H1OA 3A37A 4C4WC 3GC6A 4MTFA 4I14A 1BGYH 3KKKA 3RRZA 4BZQA 3KSUA 2A59A 2XNCA 4XYGA 2NU8A 2R9VA 3LYAA 4OU4A 5C3UA 4LK3A 3I4LA 1SHZA 3OFSA 2F55A 3L7AA 3ZWNA 2C04A 2QGZA 4ZT4A 4V1CB 4MS1B 4COKA 2NPOA 3WAJA 4A0GA 4U7OA 2GO7A 3B89A 2EKLA 4EJ0A 3NYWA 4Q9IA 4FWIB 1ZH8A 1RWOA 4CG2A 2WJ4A 3MJFA 7ADHA 1U1IA 3AW9A 2BAGA 3Q4HA 3OTQA 1Z22A 3WGHA 4BZWA 1SUWA 1G8HA 4EHHA 2W6MA 3TAXA 4WKPA 3KEFA 2AUTA 4QOSA 1ZM7A 3W1VA 4GMGA 4Y6RA 5JXIA 4RZ3A 5IPFA 1EFPB 4E12A 3K32A 1YFLA 4DO2A 3LK6A 5LL6Y 5EEGA 1ZR2A 1OIWA 1WXDA 4EW2A 1DAEA 2FW7A 3CVUA 1GX1A 3UJHA 5AVRA 2HLDD 3R9XB 4LKOA 1HUQA 4URXR 4LZWA 1SQGA 2PUWA 3CXRA 3HJBA 4J07A 4JP8A 2CXPA 3NEJA 2W00A 2XRZA 2VK4A 4HB2A 2GPAA 5AKHA 3HYNA 2AQHA 2Y1OA 3ZP4A 1T0HB 5CFPA 4ESVA 3W78A 4E94A 4UHDA 1KQ3A 1PDVA 5D1NA 1B0AA 5H6RA 2OEPA 4AJ4A 3U81A 2E4AA 1ZC3A 1N77A 4DJFC 1YJ9F 1CXZB 2EW2A 4FZ0A 4HMQA 2GCPA 5CM9C 3QOYA 2OO5A 3LLUA 4IZHA 1Q82H 2GEKA 4J9UE 2PNJA 4UNRA 3NCHA 3X1ZA 1P91A 3B60A 3GRCA 1U6JA 4HKTA 1Z8HA 1E18A 4PQRA 5AK6A 2OLJA 1R4NA 2FHSA 4ZVUA 3RC1A 3WSWA 3IE2A 1WJGA 4FSDA 4LOKA 1MAAA 3WFVA 2R6ZA 3BMCA 4R1SA 2K9PA 4CZ2A 3ZK9A 2NT3A 1OJ7A 1V1MB 3NUGA 4R5HA 2VQEB 1DTWB 2MSCB 1JXMA 2ZQYA 1ZESA 2P41A 3K9LA 3Q2KA 4HQKA 1FXKB 2YWGA 5LZ2A 2C95A 4MB0A 1AE1A 1C9JA 5TS2A 1CUWA 1XZFA 2AOWA 1VKNA 2C96A 2E7ZA 4YRNA 2XCRB 2XAFA 2F1RA 2CLSA 5C52B 2QQGA 1U7UA 3CE9A 1AS0A 3ILHA 5J2TA 3NNNA 2GN0A 3LAWA 3SBXA 4DY4A 2JGAA 2FZLA 5G40A 1RWKA 2NYAA 3SFTA 5BWBA 1NR1A 2WYUA 1V7CA 2OV2A 4YC7A 1QIDA 5THKA 5DNEA 4DCNA 4LF8B 1VBMA 1QZTA 1R3IC 3E20B 1USVA 1ZD9A 2P40A 3G2OA 2COEA 1PS8A 4P9NA 1R37A 3BGWA 3QPDA 1WF6A 1EGHA 2PUDA 1ACMA 1ZR4A 2C57A 1Q1ZA 4FYXA 2PRIA 4O4LF 3GF4A 2DXIA 3V48A 3CA8A 1I3CA 2OZLA 3AHHA 3EVNA 2I1LA 5IFKA 3OLYA 2YR0A 4FJ0A 1E59A 1QH9A 1YZQA 1KE2A 4AMZA 2ZNJA 4NPAA 1E8NA 5H5JA 4F4UA 5M04A 2RGWA 2EIMC 2VAVA 3PJEA 1ZVVA 5GZ1A 3LUAA 1TFUA 1Z6GA 1DMSA 3P27A 4S1OA 5IAJA 1RMQA 4FEEA 2QRUA 4NOMA 2DLNA 1YDGA 3G49A 1OX4B 3DNPA 1TA4A 2MU1A 2VIIA 4JVSB 4RPGA 5FUMA 5SY6A 1JA8A 2JA2A 2FPSA 2ETNA 2Z4SA 3TW8A 1DRKA 3IKTA 3O2NA 5K8UA 4JR0A 3NXSA 2SBTA 3NYQA 1ADFA 5ALSA 1J70A 1NPTO 4JCCA 2G1AA 2ZRPA 1NVUQ 2HRZA 3H9QA 4E5SA 2PIAA 3PS9A 1SCAA 3GJQA 3H99A 1VHLA 4AKTA 1ZAKA 1ZY2A 2JIMA 1RT9A 2Z1NA 3EB9A 4I6EA 4A2PA 2E4VA 3MTIA 2GI4A 2VYVA 1JEOA 4LXXA 2PR7A 2A0XA 3AEXA 4WOJA 5E2AA 1AC5A 1ZM4A 3I9MA 2OTMA 3WBJA 1E9FA 1OASA 4K9MA 1E60A 3QYAA 5CMLA 1U31A 2A78A 2N05A 5C2JB 2WLJA 1EXDA 4AY6A 3H13A 1PT8A 3FCAA 1ZEJA 2BY4A 4P36A 2ZOVA 5E0OA 3ZHQA 5L45A 1FVOA 3RUEA 2JJ2G 5AJZA 4M8NE 1E0AA 5KSPA 2Q8PA 1OA1A 1P5JA 4ZEWA 4PC7A 4QOHA 4DLUA 3VJMA 4JOQA 4GWKA 1XP8A 3H3JA 1UJBA 3EJWA 3GA5A 3R7DA 1KJNA 5JH7F 3T5PA 3GVCA 3OTOB 1JHQA 2GDZA 3OQIA 3W2HA 4C0SA 3RARA 1H1DA 1T2NA 2WHXA 1V11B 3PV0A 4EPXA 5AUQA 1RJDA 3M2PA 1KOGA 4KO1S 4BX0A 3OZDA 5LGUA 4C43A 1R3LC 1G8YA 2J8ZA 4MYCA 1UP4A 3KBOA 3S03A 4Z86A 3P9PA 5AI9A 4R6XA 4EL0A 2W2OA 1IVSA 4W63A 5ECYA 1KZHA 3VO1A 3NANA 3AG2C 3SJCC 4G4XA 1BDJA 1SOAA 1GD1O 2XVMA 5CMUA 1LUVA 1RPOA 4Y9DA 3SXJA 4KQWA 3AUFA 1DV1A 4C22A 2SICE 4WY8A 1PFUA 2O2JA 4IIJB 5DI3B 4DM7A 4F2PA 4YCCA 4LKRA 2OG1A 2KG7B 1JB1A 4KCGA 4NEQA 4QREA 3ZHXA 5BUZA 3IQGX 4K8OA 1DC7A 5J2UF 3F46A 2C2WA 1C9EA 3WJ7A 4R68A 4TYMA 3RWOA 4E2LA 4M6WB 5TPWB 2DF8A 2QQ5A 1XTJA 4YRZA 2MHCA 2PAAA 2A0YA 3AY0A 4RCYA 3NRBA 3ZMTA 4ZK7A 1QHFA 3SM3A 2O8FA 4K6CA 3ZWQA 4M37A 2OM2A 1OXMA 1Y8QB 1JR3A 2R6AA 1COWG 3K7EA 3GNQA 4P9PA 2RJZA 2G4LA 3QV2A 2BMVA 1A2KC 2X6TA 1FZQA 5BSEA 3ED5A 4G8JA 1NKDA 2HIGA 4WASA 2A9KA 4WAUA 3BXPA 4C04A 2AOUA 2YBEA 1VYUA 2FNAA 4XGIA 3JSXA 3ROPA 4GYYA 1Z3CA 2IH5A 1ABFA 2E5WA 3FD5A 3RTAA 1FS5A 2X0EA 2YYAA 1E2EA 4WD3A 4N5DA 4OLAA 3U1VA 1PV1A 1PNRA 1NJ8A 3B6ZA 1P8AA 2CH7B 5CG1A 2I4OA 3EXG1 3OA0A 5ARDA 3HKEB 4FHEA 1H47A 2PV0A 5B3SB 3HL0A 3JRNA 2UYQA 4NNOA 3LO5A 4K6GA 4GKKB 3BTSA 1HT3A 1KMMA 1Q0HA 2CNKA 2H08A 4UTOA 5I9TA 1GZSA 2E1PA 2GN9A 2X40A 3THYB 2BELA 5CUQA 1W0KG 4X1IA 1EK2A 2JFYA 3H3FA 3JQ8A 1Z8FA 3KKPA 4LFBO 3PTZA 4HH1A 1USKA 5H0IA 4UQLA 2G09A 3DOIA 4QGGA 4BLQA 3S7TA 3WGIA 2AF3C 3WWCA 5LXTA 1GFSA 4B43A 3QUBA 1NSTA 4GAEA 4JBWA 4A0QA 1QX3A 1Y4MA 4MVMA 2CXXA 4KOEC 2B33A 1RQPA 5TS3A 5KNLA 1LSOA 3DBLA 3OUFA 3M6AA 3GL9A 4IIBA 4E5KA 3OZRA 3U4QB 1ZKMA 2QI2A 1A4RA 2GFIA 4U8GA 4D44A 5LP6F 5DHSA 1AO3A 1CUEA 1BKYA 3FSEA 3V3KA 3VNSA 2P67A 4ZJZA 3Q8LA 2O3RA 3EZ6A 5C1BA 4MGYR 2CJYA 4FQ5A 1DXYA 5IY5C 2ZWOA 2V96A 4GS5A 4KDEA 2X4GA 2OOSA 2AZ4A 3ITKA 4L8LA 5A2QA 5IS2A 1O7JA 3BWYA 1RHKA 2WPDA 2X0KA 1VECA 5FTLA 2X5NA 4BLPA 1Q86H 2J85A 1X7ZA 1FYVA 2DERA 1E3SA 1ZJ6A 1ZC4A 3GMSA 5LZ5A 3M1XA 3AOEA 4KXVA 4TYQA 1VL6A 1XMQB 1N36B 4Y6QA 3BE6A 4CVNA 5A4KA 2DQYA 3JQEA 3EASA 2C82A 1MO6A 2Y77A 1PJSA 4ZOLF 2LVBA 2X77A 4BJHB 1DFIA 1HLFA 5JVDA 1U81A 3C6MA 1E3IA 1G8PA 3IQWA 4G5RA 3P71T 1AJEA 1EA7A 1IPEA 1Y7IA 2CUTA 5EERA 4PZLA 1K06A 3CM0A 3LDTA 1LBQA 3F6MA 2WUFA 3A3YA 5GONF 1M83A 3IUBA 3L8FA 2PUCA 3N1UA 1SHJA 2NSDA 1SQSA 4HY3A 4GZLA 3W7BA 4BQIA 3QEBZ 4Q3OA 1M9NA 1JXAA 5ADHA 1QRRA 2HVYD 5IMSA 4DT1A 4HH0A 3FSRA 5IN5A 2Q49A 5E95A 4CQNA 5DW0A 1TEXA 3PQDA 4B73A 2YXNA 5LP1A 2ZCEA 4OGQB 2ZJ0A 5FI0B 4BKUA 2I1QA 1V5WA 1KMIZ 2VHZA 1T91A 4IDHA 4O2BB 3CE2A 4FOOA 1YDXA 1RM1C 1AVTA 1Q0ZA 2B1GA 1KMHA 1XHLA 2X4IA 4DJAA 1X52A 1EK5A 3K0AB 3V80A 4BWYA 1J5PA 1Y6ZA 1BRTA 1Z88A 2IY7A 4E11A 3L72H 1FD9A 1E1QG 3ONNA 4CUZA 7ABPA 1BE0A 2JA1A 2KI5A 3LUCA 2AQIA 4M89A 1DT3A 4MGZR 5H1YA 5F35A 3WLTA 4MS4B 1W59A 1WKVA 1IHUA 2NOAA 3IH5A 4HV4A 1YQGA 1VLQA 3DMNA 2MSEB 2Z2IA 4HXGA 4LXGA 2X6RA 2JBWA 1N0JA 3LFUA 4NQZA 4PZ0A 1WP7A 2OHGA 4XGRA 4DIKA 2FFHA 4AX4A 3DUFB 4D9JA 3A04A 3B7GA 4ISCA 2Y05A 2EIKC 1WKCA 4F9EA 3D31A 3E81A 3LX8A 3B13B 1KYXA 3BL8A 4HS4A 3HG7A 2Q6OA 3U56A 3NHWA 1P29A 5IWAB 4EG3A 3H87A 2ZRNA 4A8JB 2O50A 1E2DA 1ZFNA 3K9HA 1GU7A 2EEZA 1VOTA 3C3JA 4J43A 3CY6A 3LF1A 4OSEA 1ID8A 2HK9A 3C5CA 1VQLV 1VIAA 5CIQA 3IEPA 4KO4S 6Q21A 5AKGA 2XYPA 3CSXA 4FBMA 4JLBA 4L1KA 4AKIA 4Y0VA 1M5IA 2R6FA 2VJLA 3ZVNA 4RD1A 3ZGVA 1ZK0A 1J4AA 1S9HA 2Q5JA 2W2PA 4MDYA 5FTMA 2GYVA 4JLJA 1GUAA 5GW7A 4DUYB 3FPKA 1FRZA 3K72B 3OD5A 4BMYA 4BWAA 1CLUA 1RAIA 1J9ZA 1YS6A 3NYRA 4EUFA 6PFKA 1V1MA 4RM3A 4AMVA 2J9GA 1TA0A 1U3DA 5COBA 2B5WA 2P9FA 4F12A 4YAIA 5CVVA 1Y42X 1J2UA 2ZR2A 2XD9A 4LHYA 1DXOA 3DMTA 3LUHA 4JOSA 4XYLA 3NHPA 3W8EA 3O8LA 3ASOB 4H33A 4JI4O 4TT3G 3H5RA 1CBUA 1P4SA 2QUIA 4KRGA 1QIHA 2GCGA 2Q1WA 4M4SA 4WT7A 3EEOA 3NVKE 1PSZA 4PDVA 4II7A 3CCCA 4NIMA 1VQOF 4KFSA 5C7OO 4X54A 4XQEA 4X24A 2AN3A 1MNQA 2I2WA 3MT9A 4O4HF 5BO5A 5JAHA 1FTYA 4CMAA 1XMIA 4DV3O 3MJRA 2FGKA 3TAUA 4FLFA 3PJRA 4TSKA 3SF0A 1M74A 1ETUA 1TUEA 1KY3A 3VDQA 4XCQA 1AI5A 4A1FA 4WLVA 1UBTS 2QRVB 4FGZA 3MYRA 1MT0A 2K87A 1BVUA 3RU7A 3ZDCA 5IVDA 1JHDA 3AEUA 4AN1A 2WE8A 2M6SA 2YHIA 4GIBA 1VSTA 3TOZA 4Q03A 3M6MD 4KUEA 4LZJA 4P82A 1DTEA 4UC0A 4WQMA 4X6XA 3F8WA 4I1IA 3V6MA 4MW3A 3RIMA 1G1XB 4E03A 3DW3X 1YDHA 3DMYA 4NFHA 3QE2A 4KQIA 1VPWA 1PG0A 3ILVA 3D59A 2ZAMA 3VX4A 5AIBA 3N0XA 3ELWA 3KWMA 4G67A 3RG8A 4JB2A 2YN0A 4FGUA 1R3JC 1R6AA 3RNOA 4XDYA 1NMEA 1XQXA 1IDN1 3SOPA 3BRWD 1CHNA 3VUEA 5E9QA 1KO8A 3BGSA 4GRIA 3ZU3A 3FMIA 5JNWA 4LN1A 4ALLA 3K9SA 1NMXA 1V55C 1W0JA 2Z04A 4JQOA 1RYZA 4C7MA 4EHJA 5A4IS 3LY8A 1TZBA 2FFBA 5JJLA 4XE5A 2QRLA 4QZVA 2DY1A 4L85A 4TZKA 3ZK8A 1XRLA 4ZGBA 3IQEA 3QVWA 3EXEA 4DXDA 4WXRA 5AKYA 3JQAD 1U97A 4M3NA 3M0EA 3WLFA 1AKEA 2ZCVA 4CIWA 4LCUC 4CS4A 1TUIA 2QOEA 3UVEA 5KNCH 5F7ZA 3RRBA 1SETA 1BXGB 5IEJA 2QNIA 4Q34A 1D5CA 4KP7A 4KIGA 3CHXA 4YUAA 4CETA 3TAHA 4KMRA 3CXCF 1L4NA 3TXSA 5B5SA 2YV5A 2P9QA 2O1SA 3R5TA 1JVMA 3HFJA 5ALWA 4C4XA 1HP8A 1JYFA 4BT6A 1UBHS 1W1IA 2J7KA 4IIEA 3RVDA 2RGRA 3HWWA 2FRDC 3DEIA 4HGOA 1ZOLA 4R1OA 1POWA 3ZGOA 4B76A 3A0BZ 1BROA 1PL6A 1RI4A 4U3FH 3OZWA 3T35A 3ZOZA 3F7OA 1GTRA 4DV5O 4IUDS 5A5EA 2B1IA 1E3DA 3VKFA 1O6GA 1ENVA 3E84A 3K9NA 1OH5A 1CG6A 4DRXA 1FW8A 1L4BA 2QD3A 1SQQH 5B3SC 3CR8A 1A8UA 3DMRA 4N7MA 3MFYA 4C4OA 4FDMA 3ZHTA 3RB8A 3VPXA 2HXSA 2VT7A 5AJVB 1XWIA 4U6SA 3QBJA 4IJWA 2WLHA 1VQKF 2BJHA 4HPXB 5BN4B 2C3PA 3MXTA 1UF9A 2AJLI 1CUGA 2OZLB 5FF9A 3ZGLA 3TD5A 5HBRA 1FXSA 1VE1A 2D5CA 3GVXA 5G0UA 5AW9A 3L74H 1KSJA 1ZL8B 5AKIA 5HXAA 5CGQB 1RRPA 1ZDMA 5BW6B 3I58A 3J80N 1RFYA 3PEYA 3BGDA 2Z43A 4RVGA 1OCZC 2RD2A 1ZU4A 4GCZA 5DNWA 2FOXA 1NY5A 1XF1A 2NSJA 4DG8A 1YQQA 3GWZA 2X9GA 1IZ9A 4E2ZA 4NYJR 5KOIA 1N0VC 4NP6A 2B1QA 3IUNA 4PHCA 2O8DB 3OTGA 1X0VA 5LHIA 1GPNA 1UPTA 1TW3A 1YZHA 2C3MA 2HJVA 2ZCUA 1A77A 3L79A 1XVTA 3EXAA 5HEKA 3RTDA 3AI7A 5CK4A 1A9SA 3JAMA 2JVJA 1ZOOA 3K94A 2E0IA 4XYBA 2NO4A 5G0TA 3SQNA 2VHYA 4ER0A 1WZIA 3X2QC 2G7ZA 3I9FA 2JGMA 4LOAA 1NR7A 1Z13A 4KAJA 4LXIA 4WY2A 3QHPA 4C4ZA 4NMWA 3U1BA 1YZNA 4NV3A 3IGFA 3QVSA 4QBKA 5L95A 1PN3A 5FOXA 3GVMA 2KWIA 5KTKA 2C31A 3L0CA 5KX5A 1SQXH 4B6JA 2FPPA 4U2KA 4INZA 2VNKA 3AR3A 3KAKA 3P4XA 3AG1B 4RJKA 4YLGA 2E55A 4CNQA 3OMAB 4PGGA 1EGMB 4PANA 4FGKA 2LCAA 3T1QA 4ND4A 3UQZA 2FW1A 2GTIA 3FROA 2IG8A 2BSKA 2AFHE 4OK5A 3KDPA 2C78A 1WCXA 2O7SA 3DKKA 4MMYB 4CEHB 1U8ZA 3M4SA 1G5FA 1L1QA 2KBFA 1CWUA 2X58A 3QYFA 4JXKA 3CPWF 4KAXA 3KC2A 4PRLA 3TIIA 1NUHA 3IXMA 4HLQB 5IK2A 2WLIB 1L4YA 1Q0QA 1Y74A 2KQUA 3G7NA 2AJTA 2PR2A 5DCYA 1N2ZA 2H1IA 3ZTYA 1R3UA 2HP0A 3WLHA 4ACBA 5G3ZA 3BIXA 1KP3A 4GFDA 1C8BA 4MXDA 1Z15A 2GZDA 4YMIA 3RS8A 4WERA 4DV1B 5JUWA 1Z26A 1XX6A 3CYFA 3KHTA 4C78A 1RXUA 3OG9A 5LLTA 3PXDA 1XDBA 1E5QA 1UBEA 2WKPA 4MRRA 3KDSE 2Q0AA 2PGNA 1JMVA 2AR7A 2C20A 3MTJA 3HU2A 1RLJA 3QV1A 3KPWA 2X1HA 1W85A 3C87A 3B2QA 3PBKA 5AW5A 621PA 1NDUA 2FAXA 4N8SA 1L4GA 4DV4O 4OO3A 4QDZA 1VHJA 2P11A 3BA8A 1KEUA 1P2DA 3Q3IA 4PCUA 2GJ4A 1V5FA 3QMWA 5I8WA 3K58A 3T3EA 1IUKA 1XAGA 3UMMA 1NJFA 3R74A 4B4DA 3MWGA 3ZN1A 2AR0A 1BMFG 1ONIA 3K96A 1YJNV 2GFHA 3SX2A 1ODCA 3RJTA 2EX3A 2J9XB 3I2JA 4V0QA 3ZBTA 3W5AA 2QRZA 2YIDA 3MG9A 3L84A 3W8DA 4DSOA 3SJBC 3GFRA 1YITF 4F5WA 4YO7A 4X66O 1TM5E 3SDZA 1IURA 3HZRA 1VIBA 2VDQB 5HCIA 1T4CA 3RFXA 5K0TA 3EFBA 4OKIA 5DWQA 4ONEA 4V38A 5KSYA 2ODAA 1S3IA 3IAXA 1UT8A 4LI0A 1PEAA 3FPGA 4LHXA 4DCTA 2H07A 1HFJA 5CCDA 2XRFA 2D1RA 3TTWA 1VFPA 3FB5C 1PLJA 4LJKA 4E1VA 3IVMA 1PJ8A 1PFVA 4Y2YA 4EY6A 2O5CA 3QOXA 3THYA 1JA0A 3FIUA 1CP3A 5DEIA 5BV2P 1UWCA 9ABPA 1J95A 1K4KA 3QELB 1X1RA 4NBVA 1VJRA 3V8VA 2RKOA 1HZJA 2L35A 3ESXA 3H16A 3ASNC 3I72A 3TKYA 4C0XA 2GN8A 3UBTA 1M90W 1U5CA 3IBSA 4CMKA 1AS2A 4DLNA 5DM4A 1WDKA 1JAYA 2PUSA 3K2IA 4H17A 4DB4A 2PUGA 3E2MA 4F04A 5BVHB 4M49A 5EUQB 3QQ5A 2G70A 1VMIA 1CVLA 2GZAA 4EFBA 2QQFA 2UZ1B 3E7XA 4RHYA 4B08A 3FXAA 3HYTA 3GGCA 1AKMA 3MWLA 4HK4A 4LDAA 5CNMA 3L9DA 3S5JA 5KNCD 3PYXA 2YZGA 4DSUA 2HV9A 4DS3A 1GR0A 5CFLA 2QE7G 2ZDIC 4W5RA 4EELA 5E1BA 2MT9A 4B6OA 5IBQA 1GG8A 4DAEA 4R50A 2F43G 2LDXA 3GP3A 1ZMRA 3HYSA 1LI5A 3PHCA 3RJ9A 3ZRXA 2GGSA 1KJQA 1ETHA 3UXYA 2VPIA 3T0GA 1NZFA 4G8BA 2D5LA 3FGNA 3MCAA 2Q73A 1CDDA 1H6AA 1NYRA 1TF2A 3HQ4O 4IH9A 2R4TA 3U3RA 4BKOA 3UMFA 1DKOA 3KJEA 2XSZD 2EHDA 1PJRA 4FONA 4UTNA 3RT7A 3SE0A 1SUFA 2AFIE 3KLPX 2P75A 3N7TA 4YAWA 3FWHA 4GPTA 3HSKA 1H9CA 1CUJA 4HZUB 5ALOA 4ZDJA 1MHPA 3N5KA 4JBHA 2VEOA 521PA 2I2AA 3CLSD 1W5FA 1RHQA 1M6HA 3KKQA 4TRRA 1SCNE 3K0FA 3U3KA 1UPCA 1BX1A 2VDJA 4QYSA 3R6WA 4DIEA 1U28A 1U63A 3HZHA 4JFAA 3DV2A 2IIVA 4C08A 3RASA 1B1CA 2I2CA 1A88A 3PVZA 1MJGM 4KIWA 4DEVA 4X65B 4PA3A 2I87A 3KALA 2GH1A 4NU8X 5FTNA 4XGQA 1RLOA 1R0KA 1H4SA 2FPLA 2GBOA 1UZNA 1E9BA 2CEAA 1TVMA 2AUMA 4JKYA 1EUZA 5T7BA 4UXNA 5HSGA 4B3JA 5JVDF 3A14A 2GK3A 3UMCA 4BFWA 2GXSA 2M9MA 3NJ8A 4REOA 4LF6O 1T9CA 1E1RD 1V1JA 2P30A 3LPDA 4ZARA 4PD4F 1F1JA 2UKDA 3K1YA 4LRWA 1OROA 1YVUA 4NI5A 4BNGA 4YMGA 3VKWA 1ELOA 2CLCX 2NYVA 2PJUA 4YLEA 3CC2F 2PGXA 3M3HA 4IS2A 3TZCA 1ICIA 1W87A 1FLNA 3CNBA 3S44A 3OFNG 3U31A 1VBFA 2VWJA 1A7KA 5KOHB 2BHTA 1PP9H 3IQFA 3U10A 3DC5A 1FFCA 3GX1A 4G4GA 4IJUA 2YW9A 3ZU2A 3R3UA 4REQA 3U16A 1DRUA 3L8HA 1DARA 2AGVA 1MVNA 2NQ2C 2Z56A 1V16A 5K8JB 2E6UX 3NTOA 4GF5A 5L6MB 2D1TA 2GBCA 2PLFA 1EBOA 4R81A 1Z0KA 4G0MA 2GYUA 3I0MA 3DE2X 4FZVA 2DBQA 4UMFA 4DVGA 5IF9A 4J7KA 1QPBA 4FR2A 1IN4A 3TLGB 5TC4A 2OZBA 1CS4C 1TYEB 3MK31 5JIBA 1KFBB 3CF0A 3REFA 3F6EX 4FILA 3V46A 3ZQUA 1SIUA 3CRCA 3JVHA 1FFSA 3I5AA 3I9KA 4XCVA 2COKA 4WKGA 4ZVOA 5P21A 1UM9A 5D5HA 2BSXA 5CDTA 4H60A 3BBLA 4Z9FA 1GNVA 1XQ6A 1GPYA 4O2BF 1DX6A 2X76A 1R8QA 4G86A 4Q9LA 2PX3A 1G63A 1Q86W 4J76A 9MHTA 2AQ8A 4XVRA 5LP6B 4ZD6A 2PL1A 3T4DA 4PI0A 5CYFA 5J4VA 3DMTC 2CGEA 2YIBD 1H5UA 2EKQA 3EISA 4AF6A 4MINA 3JD1A 4X64B 4QPKA 1UMBA 1GOTA 3DE1X 2QN9A 2YXHA 3GARA 4Q39A 5AKEA 3Q9SA 1AIPA 5HZGA 1CF4A 3FX7A 4HGNA 2YXBA 2JJMA 1HT2E 1SY7A 2I3DA 2AXQA 2EWWA 3C14C 4OHKA 5BOSB 1A2OA 5LJLA 2B7LA 4BVRA 1GH6A 4PDLA 3B09A 2O4CA 4BN4A 2V6GA 4NK4A 3ZIAA 2Z6VA 3UJBA 3NFYA 1H4TA 3DKVA 2NWQA 4KXUA 2WYVA 4Q18A 2QX8A 4Y6OA 3RREA 3ZCSA 5KVCA 5IWCA 4J1TA 4B8WA 7MHTA 1Y6GA 3TX6A 3QM1A 2YYSA 3AYZB 4NLLA 1JKFA 1N6PA 4MPPA 4MLZA 4RD2A 5C1IA 5CYGA 1CUDA 1GNQA 3PIDA 3RGWS 3LDFA 3C3XA 4DLTA 3GXBA 1WQ1R 5EMNA 4YRPA 2QENA 3K9FC 2JG3A 3AKEA 3RHZA 3UXMA 3GLGB 1PR3A 4DBLC 3H19A 2Q4TA 3MUEA 3KZIZ 3WLIA 4J03A 2BFCB 3JRWA 1T8UA 4YIPA 2PZJA 3C6YA 3HCAA 3BSFA 5BYJA 3U9SA 4BQSA 3T4PA 1VJDA 3AB7A 1DWUA 1CZNA 4NL4H 2B2XA 1UK6A 3ND8A 3TSAA 1XCLA 3W3AD 3BAAA 4CM6A 4TVKA 3EQ7A 3ABLC 5BV8A 1WSBA 3PHBE 4JI5O 4O02B 3O47A 3LVRE 1XJQA 4MJ3A 3SQWA 3E2IA 4B31A 4EF5A 1T24A 1BQ3A 1Z0AA 4GKJO 1V4NA 3DMPA 3ZX4A 1KNJA 3AZQA 1ZI9A 2BGKA 4OKSA 4RIFA 1C7QA 3SU8A 2P9YA 4O4HB 2CAZC 2WUWE 1GPDG 3KD2A 3QE3A 3S2EA 1I3NA 4UDXX 1DBPA 3ZWCA 1IB0A 5JD6A 1MT3A 1I32A 1Y1RA 1K68A 1M5TA 2GWHA 3IEVA 4O5OA 3RF7A 1YI2F 2EWMA 2FUKA 2K1SA 1UP7A 2Z8XA 5FA5A 1AP6A 5C4IA 2BZSA 3ZCUA 1H6CA 1YB4A 1I6WA 4M0PA 4YTEA 3FCEA 3L8ZA 3OKPA 4NBTA 3SKXA 1ORTA 5DNAA 5GTIZ 4CWAA 4C4SA 1HQDA 2P2SA 1G60A 3S6JA 4TLDA 3OZIA 2W4QA 1PKXA 2D2EA 3ZDXB 4BNXA 5B2EA 2R60A 1GSIA 5A62A 1XTZA 4MMZB 4LF5O 5U4QA 5KAIZ 4JI7B 1F2TB 1GR1A 2MWMA 1VE7A 1XNJA 1UBCA 2RJOA 3DNMA 2HCTA 4XWAA 5C4MA 2ZYVX 1DJOA 1GPH1 2AFIA 1ORQC 1JH9A 2XV1A 4HEHA 3ZHCA 1SD2A 4UVEA 1RC1A 2K2QB 1DHTA 4BO5A 3DD1A 1TJPB 3H6HA 5K6AA 1OCEA 2ZSFA 2YC0A 2OVFA 4AZ0B 1BGVA 5A3RA 5AK5A 4L4ZA 3WXMA 3DCJA 1N3LA 2J4CA 1ZEMA 5EC8A 2ZINA 3D6UA 3EIXA 3X2QB 1KIMA 5GAPK 2CNDA 4R4JA 4HEJA 4TRMA 5AHWA 1M4UA 1UOPA 1YVEI 3GG9A 4H7HA 1ONSA 4ZVVA 5HKLA 2WHYA 1ESZA 1M0SA 2E4YA 2HJ9A 1SD5A 4GI5A 1CJCA 2NP6A 5LYYA 1NXWA 3I3SR 2ZTMA 3ASOC 3OW2F 1F2VA 4XB2A 5FBZA 3ZJYA 2HK8A 4A6DA 3PL5A 4EFEA 2FSUA 2PI4A 1GTMA 2OQ2A 3EUWA 1JILA 2OHJA 2ZIAA 1B3BA 3HP4A 3D6HA 3LBNA 4HWSA 3OBIA 4M99A 3RIHA 1I2CA 1UJ2A 2X1VA 1KKCA 1HY3A 4UXHA 2XMSA 5DLDA 2NO6A 4ER6A 4KREA 3FY4A 1HMPA 1XD2B 1OCOB 4L08A 4AP6A 4QPZA 3SQMA 2EGGA 2R7NA 2RHBA 3AP2A 3CSDA 3MMXA 4KH1A 1RM0A 4BFUA 1FYXA 1FUKA 4H18A 3IEUA 1ES9A 2XGSA 3MRTA 4P4GA 5FPTA 1UL1X 1YI2V 4HC4A 4OHMA 1J2EA 2GLUA 3SPCA 1FX0B 1S5HC 1NKVA 5I8ZA 1Y3FE 1N36O 4UU0A 4FUTA 1QIJA 2HHHO 2AVNA 3BWEA 1NJ5A 1E1RA 4G36A 4PNPA 4ABTA 2HFJA 4OXIA 3BULA 4CQMB 1Y4DE 3C6KA 2CSUA 3GAMA 2LRHA 3JQFA 4WCVA 1RC8A 2JW5A 2D5IA 2AG8A 2ZOSA 5KAFZ 2PBLA 1BN6A 3AIKA 4L73A 5H3HA 5B3KA 1Z2GA 2XB8A 4Q37A 1WAZA 3A9UA 2AHYA 5K0LA 2QMEA 3GD7A 4HD8A 3DR3A 4MVJM 2JIBA 2ACEA 4Q3CA 1IULA 3WQQA 1SUBA 3V7FA 2XJ9A 3IUPA 2HP8A 4P35A 3DBHA 4ZQHA 4IMRA 3UA3A 5KLVH 3N27A 4WEOA 2R8RA 4PGAA 1M6VA 1F4LA 3PXXA 4YCSA 1IC6A 4YCNA 1J99A 1EBBA 3FW1A 4U7TB 4TL8A 2V6IA 3R9WA 4HJRA 4L7QA 5JY1A 3WIBA 3NALA 1ESCA 2Y1FA 1EHCA 1RWQA 2O4UX 2ZU0C 1IE3A 3FDZA 3HCDA 4XCXA 4F0JA 2AWOA 5F23A 2OCBA 4PTZA 4S0ZA 2HREA 5GY7A 4UCVA 4FFNA 3PC2A 4QUDA 1F7VA 1VYHA 2CF6A 1E3EA 1A9TA 2PO5A 5F1YA 3OECA 4OP2A 1DK1A 1JIXA 1BXRA 2C59A 2ZYTX 5B4TA 2MTBA 1Q82W 3ZIDA 3CZPA 3HR0A 4J75A 5HE9A 1S3GA 4JI2O 3UQYS 4DBZA 2I29A 4NF2A 2JFFA 3GDHA 1I1OA 1SVSA 2ASVA 2GLTA 3HS3A 4ID3A 3WP1B 2LBXA 1GN3A 3SPHA 3AEZA 1SHLA 3KYIB 4YV2A 5M7EA 3PFWO 3L0YA 2Q29A 1OCCB 1AGRA 2XNSA 3WLKX 2G08A 4YBZA 4YFVA 5KYUB 3RS2A 2QUBA 3EUFA 4HNGA 2A57A 3JZDA 4MK4A 4ND2A 4HGYA 1QGUA 1XWWA 3E5HA 1RRMA 4L3VA 5IT9N 3FGOA 4RZ2A 2IUUA 3WK9A 1WLSA 4KO2S 4F1KA 3D6FA 2E85A 5HGJA 4BRWA 1IJBA 3K3WA 4V03A 2UXCB 5CDFE 1IBMO 1FYJA 3I56F 4LDZA 4XM1A 2IX3A 2IE8A 1NW3A 2R25B 1X7XA 2R7KA 4Q0MA 1XL4A 1WKBA 4Q3LA 3AJAA 4QJBA 1VQ6F 1E9CA 2Z30A 1FUIA 1GP2A 4YUXA 3BM5A 2WMNB 3ZKAA 2FDCA 1F8GA 4RHEA 1ZGJA 1QVRA 4ZAYA 1JQAA 6ABPA 3I7TA 1XFAA 1HWYA 1T9BA 1T2AA 2W2XA 3G5MA 3QF4A 1NI8A 4Y9SA 3BQ9A 3JVDA 2IQIA 1BHBA 2O1XA 4IQ4A 3EXG2 4Y18A 5E8RA 2LCQA 3F0DA 3ROKA 4PLTA 3RTEA 1ODKA 4OGFA 5DULA 3S3TA 4OPHA 1NVWQ 3WMGA 4HYOA 3L4BC 4N5HX 2X7RB 3KOOA 4XIIA 4V1CA 3STZC 5EA2A 1VQMV 3FTCA 3IAS1 3ABUA 4OFWA 1MLDA 4Z7NB 3B5JA 5BV7A 1XSEA 5AMXA 1EA5A 3ZDDA 2WALA 2H8EA 3ZZUA 4A8TA 4MTOA 3R7BA 5FOWA 1ORDA 5M3BA 1C4OA 1Q7GA 1SWVA 1CZLA 4RD0A 3K03A 1W34A 3BUSA 4BFTA 1ZICA 3F0EA 5JDCA 2DFPA 2XCLA 4G89A 2P0AA 3WGNA 1M1NB 5KTMA 4MP6A 3DFFA 1M57B 2VUIB 4TT8A 1Z5GA 5DHPA 1NI5A 4LK2A 4MPRA 4AU1A 4MCIA 4BVLA 1RYEA 3IBFA 4C3ZA 1Y80A 2YL2A 1KDZA 4DIOA 3MPUA 2RFLA 4GXTA 5B1OA 4Q3KA 5HDQA 1M2EA 3K73O 2D7DA 4N9QA 3R3VA 4FFRA 3UGKA 4ITVA 4YJFA 3U44B 2V9CA 1JZTA 1D03A 3I2GA 2HW8A 4YJDA 2ZROA 2X0FA 4G0WA 4B6SA 3TOSA 3CMAF 1YHQF 2VZEA 5K1XA 1UFIA 2CW5A 3YASA 1M1XB 3DEYX 1PD0A 1GL7A 4OOEA 1T0JB 1Y9EA 4IH1A 4PRYA 1TOAA 2P3OA 1L5YA 1SUDA 1UANA 2H51A 3NAMA 4AK9A 1YBFA 3QKUA 4C7KA 1W76A 2AMLA 2FJPA 2B36A 1BMQA 3CUSA 4R6WA 4EQ6B 4KXMA 3TE6A 3LPAA 3OHSX 3WY9A 5E6UA 3T5BA 5A3QA 3NHAA 3II6X 2E4WA 3WISA 1V6SA 4A73A 4J1QA 2Y69C 1BIFA 4M0EA 1IQ0A 4UUPA 3UJ3X 1G8SA 2MYPA 4JLUA 5AESA 2C77A 6LDHA 5JRDS 4V24A 5ITSA 5ALMA 3G4SF 2ECQA 2IU3A 1HR0O 1ZHFA 4MUNA 3BAZA 3ILSA 4H7KA 2R1UA 1CETA 1UZUA 2ODTX 3D9QX 5TXGA 3GB7C 2JBAB 3NOOA 3UHJA 3FZGA 3A1FA 4KVAA 2I7DA 3OEHG 1C0PA 2FCRA 5AOCA 4BFYA 4NKGB 4HWKA 5AHOA 4M0FA 5JC8A 1QCCA 4ZCSA 4AFNA 4TKZA 4JU9A 1ZINA 3KEGA 1DUVG 3CKKA 2I34A 4GOMD 4UDYX 4UVDA 1KETA 4DNFA 1HNZO 3CCQV 1JHYA 4MUIA 1FPQA 4HJXA 2WHPA 1S72V 4BP1A 4CEIB 5JQGA 2GTHA 2G83A 4QRDA 4HQNA 4OHXA 4G27B 2AE1A 2XF8A 2EP8A 3MA0A 4RSMA 3LKDA 1GMGA 3CR7A 2PRSA 3M89A 3H7IA 2XAAA 2UUOA 4HTAA 4R3UC 1G8KA 3FCOA 4OL0A 1YHYA 2I9PA 4MS2A 3H4TA 3IDAA 3BXOA 4BIZA 3NV7A 2V3CC 5TDHA 1FSPA 1KRHA 4PYJA 3RYIB 1SB8A 2IKSA 2YIVX 5JD3A 5JATA 5IDJA 3VQWA 2ZRFA 4LZAA 3HB1A 3ZXYA 3HA2A 1KPGA 2WSSD 3QVMA 1FX0A 2GZHA 3UV3A 2QU8A 3R44A 2E75B 4CIDA 3Q8MA 1KOJA 2HHAA 2XMBA 3D7SA 1MXHA 1KORA 5GJVC 2G9QA 1IQUA 3PQFA 2P9HA 3U62A 3VPHA 4IP0A 3LNMB 4RDHA 5IAAA 1IL0A 4EM6A 3EHEA 2I54A 4FW9A 2WNHA 3JQFC 4I9WA 1LX7A 5HWSA 3O2QB 4HT3B 3GDWA 3TR6A 4DR6O 5C9ZA 2O0MA 1FU4A 4INAA 3RBZA 3STYA 1CVRA 2P65A 4WA7A 3LI2A 3SC6A 5KJ6A 3DG9A 5IDVA 1RZRA 1BXKA 3U0ZA 1W1UA 4J0HA 3TQRA 2VZLA 1TAQA 2XWBF 3FWPA 2HHCA 1AXGA 1CERA 2DHEA 1Q43A 3W9YA 5FBQB 3FNEA 4X88A 3ZN0A 4H27A 3IC9A 2KG7A 1PEYA 2JASA 2IC5A 4NV0A 2GVNA 3JWIA 1J5XA 3PFHA 4Y2GA 5K4AA 1S3FA 3IKVA 1SBQA 3LGAA 1RRGA 3L75H 4ASUA 2FMIA 3W2FA 3AJ9A 2CV1A 4BMCA 1X19A 2W6ZA 1GTG1 4OHPA 1THMA 4B0PA 4O4IB 1QLEB 3LPMA 3NPAA 1VB5A 3T5AA 1AH2A 3S1AB 1HQYE 3AY7A 3CEHA 3W3AH 5F7XA 3NQ41 1SVUA 1U2RA 1AGPA 1T8RA 1WSDA 1YVRA 2WAYA 3AXSA 4UEJA 4DPMA 1EDBA 5AQ1A 1DPGA 3ZDFA 5B1BB 2X2EA 4HUQA 3R3XA 2QA5A 4RFSB 3RVPA 1NLMA 1SQ6A 3Q5EA 4CR7A 1G38A 4IW3B 1H0SA 4PC6A 1HLDA 3M33A 1NRIA 3KJKA 4FFBB 1FB5A 1BCRA 1N9KA 1NDHA 2XH8A 3GHZA 1EX9A 3IESA 3RWRD 1P1IA 1T0PA 3IEKA 1WVMA 4GI3A 2R00C 4TOIA 2ZTHA 1SELA 5DEOA 1N2JA 4BNTA 1SVMA 2VNAA 3UJ6A 5BV0A 3U5ZB 1M2NA 4IHQA 5HUHA 3R2JA 4DIBA 4DLXA 2Y1EA 4MITA 4OQMA 3O82A 1XDGA 2OY0A 5I9MA 1JPXA 3T5DA 2A9FA 4QBFA 4MKGA 3DC2A 3SVZA 1SS3A 3FRHA 1AA6A 2BKAA 4P3OA 3SHTA 3C16C 1ZX1A 2DTDA 1WZEA 1E5TA 2AL7A 2EGUA 3IQZA 4JOCA 1HBJA 4MUMA 4E2XA 1ZGBA 1YK0A 4D0LB 1QH0A 1UAAA 2PTMA 5FV7A 1XVLA 4NBKA 3RN4A 4O63O 5D01A 5KQPA 1U8TA 1QVGF 3B9BA 2VZ9A 3WAGA 2HWYA 5AM3A 1TO1E 4BQOA 1QFXA 2H8PC 2GFQA 1Z73A 3WOVA 1OCCC 3R8CA 1ACLA 2POCA 4HBNA 1NX6A 4TZTA 4CI0B 1A04A 2F3RA 2SKEA 4IF4A 4G4VA 2EBFX 5EHGA 2QD5A 5LMUO 1TTQB 4IHJA 3A2NA 3GLHB 2GM5A 5T57A 5B7QA 1DAPA 1SQ0A 3TR0A 5T4BA 4XTRA 4IIDA 1IPFA 5BP7A 5CT4A 4KXYA 1WD5A 4TT3D 2OQIA 3L7OA 4UARA 1JIUA 3T9EA 2CBZA 1GKKA 1R0ZA 1A9RA 3TLCA 4DG5A 3V7EA 4YCAA 4FPXA 3ZY3A 3GLFA 4X1YA 1SULA 3TLYA 3H8VA 2GDSA 2FR0A 3N8DA 4IX9A 2VP3A 5F2NA 3BXZA 3O8RA 1IXRC 1JV2B 1KO1A 5EVJA 4PN7A 5LDDC 3ZMSA 4F38A 1Y66A 2WM9B 1GRRA 2PRYA 2PS0A 3AF2A 1ZNWA 4FGJA 5C37A 1B7GO 1N8TA 5KYTA 3CRZA 2G8NA 2WFMA 2QBYB 5T4HA 3GAZA 5L3GA 1W2BF 3DL2A 4WZZA 5ALFA 4Q93A 4AI8A 3DDZX 1KEPA 2HG5C 4RA6B 3U3DA 1QRTA 3OI7A 1I8TA 2FZEA 1OY1A 4G4WA 3JWHA 1M54A 2JLRA 3M9XA 1VKZA 5ULLA 3BJZA 1M2HA 2WTXA 2G25A 1UDCA 3JAWB 2YIMA 3OJFA 5B37A 3FOFC 1EE1A 4DUPA 3DB1A 1E2JA 3AKCA 3M82A 4ZVPA 1JECA 2ACWA 1IN1A 2HNBA 4PAWA 5JR3A 4H31A 2AIFA 3VO9A 1F60A 2DBRA 4I55A 1W4CA 2C4MA 1AF4A 2HXGA 1W1WA 2JGUA 3H4VA 5HA5A 3GHYA 4ERHA 1X7ZB 2FZCA 4MUJA 2ZWIA 3NTLA 3QU7A 4AKSA 4Q1DA 1OFVA 5H70A 1BS3A 3S02A 2BISA 2PD3A 4FYYA 4RNCA 4C4TA 4IHJB 3T61A 1XMOO 4JI8B 1QR2A 3SBEA 4C0JA 2GBIA 3AKZA 2ID8A 3GBSA 4HTFA 3AG3C 3NHJA 1D4ZA 1KJWA 5JXWA 3G6KA 3BEOA 3HI4A 4UASA 1Z45A 5UKDA 2X0IA 1O95D 4DJEC 1LDMA 1J07A 1Q7YH 3A4YA 3DXYA 2F9ZC 1H2KA 2ODNA 2OMKA 3D7LA 1GM7A 1DBFA 4K3AA 3ELCA 1M8PA 2CCJA 2N46A 3KQOA 3L40A 4S1PA 2HRBA 1JQ5A 2XYQA 2J33A 3W7XA 3M4NA 3TLKA 3G8AA 4FK8A 5ALVA 3RAFC 2DJ5A 3BVPA 3PZRA 3VTIC 2QKCA 5EP3A 5AI5A 5ESXA 3UHAA 4E13A 4FYKA 5HXUA 3EPHA 4N48A 1I7NA 2N9UA 4OUKX 2DZDA 3C1UA 4EABA 2D00A 1NZJA 3Q72A 3OMIB 4ZT6A 3SBDA 1BD3A 4BO9A 1Y6FA 1J09A 1I3OA 3OKCA 5F51A 4U63A 3WSTA 4CM7A 2HF7A 1WPRA 1Q20A 4TRNA 1NVTA 5FI5A 3QWIA 4N23A 1PUIA 2QX6A 5D3KA 1L9XA 3TL2A 2XZPA 1KUQA 1U7HA 2XTJA 3COPA 2ADPA 2H1FA 4NECA 4HDAA 1UC9A 4NWIA 5SV2A 3DHYA 2PJRA 3K30A 4G9GA 4YP1A 1WD7A 2G5GX 4X6UA 1KJIA 1UEJA 5HVNA 2P9TA 3CLRC 1YRLA 5B1HA 5KKAA 3W0LB 4ZK6A 3ZJ4A 4F2GA 2P5OA 3A6PC 4B4VA 5KHGA 3S68A 4CTOA 1REQB 2XD4A 5FBRB 4D8XA 4NR0A 1C3OA 3DPSA 1R88A 3EA4A 2ZJ6A 2YIAA 2XDQB 4P93A 2XNDG 1GAQA 2LE0A 3KB1A 4NG5A 5EFOA 1H0HA 3E58A 4PAMA 3HRHA 4TS9A 4YCMA 3UCXA 4Z9AA 1DG9A 2FPXA 4XPIA 3BFKA 5BQXA 5JRJA 1RBMA 3NWJA 4IOLA 3DDSA 4DC1A 2IYUA 2Q7OE 1ADJA 2JATA 5JE8A 1SBTA 1B76A 3IOBA 4LV5B 2H5IA 4QE7A 4RJJA 3QXHA 4CM4A 5L4LA 2YJ5A 2DFDA 1G16A 2L0XA 1JJ2U 3H9BA 5IBCA 2JJQA 4FT4A 2ITDC 1V5IA 3DFIA 2EP5A 3MWEA 4F4DA 3ICQB 4J94A 3H1EA 3NNDA 2GPJA 4RVFA 4BWVA 1D4FA 2BZ0A 2CXSA 4O59O 2VP9A 5K4HA 2GXAA 3T5TA 3HVJA 3NWBA 4G6ZA 1L5HB 3MVEA 2PZLA 3A25A 3CJTA 3G7UA 2ZXWB 2FK8A 2NV6A 4ENRA 3QWHA 3LHDA 3PZBA 4F4FA 4YRAA 4MVWA 2X0NA 1HFEL 1WZCA 4LRTB 4NOKA 4R51A 1G55A 3WI7A 3GZNB 1X9HA 2QG4A 2VQSA 2QZ4A 4KN5A 2Z95A 1Y1LA 3MTAA 1NTOA 3KQKA 4YJ2B 1UI9A 1V5GA 3ZJZA 1L5LA 3LMKA 1M57C 2RGYA 3QTBA 4LHEA 3MWDA 5ALPA 4PLZA 4UHBA 2QT9A 1KBZA 1UM9B 2JC3A 2QTOA 1JQDA 4K1LA 2YMLA 5B1AC 4YRKA 3CCVF 4UTRA 3KEQA 3QEMB 3CCEF 1FXVA 4M1EA 1KOFA 2Y76A 3EPLA 4JS0A 3CZ9A 4X85A 2Q2WA 1Z6XA 2Z5VA 2X7HA 3KETA 2X2FA 4Y3UA 1RLUA 1EXMA 3OQBA 4EG1A 3H1PA 1T9KA 3O74A 3WBFA 2Y48A 4JLWA 4G0PA 4F3TA 4LDNA 4WF9V 4JFRA 2AEMA 3VOSA 4GL4A 3NHBA 3HJWC 4KMOA 3BL6A 1NUUA 2GAOA 4CMHA 1A7UA 2IZ0A 4OK6A 1MC4A 3ORHA 2OGSA 1K6MA 3B52X 4MHTA 2ILVA 2F1IA 2FUG6 2VPPA 3BJRA 2G63A 4P7GA 4FGSA 3TQIA 1GQQA 3ZMVA 3I1JA 2PU7A 2VF2A 3OKAA 1CQXA 1M33A 4QVIA 2IBTA 4FCVA 1TZKA 3ZRWB 1QHGA 4G4JA 1PYDA 3L7DA 4GQIA 1HT1E 1Q6ZA 1UC4B 1LRKA 5A4AA 2AN1A 1SKYE 2ASEA 2P1ZA 2DWOA 2VHCA 2ZGVA 3LCCA 1X9IA 4OMCA 1KWGA 2TSYB 1NC1A 1PFKA 1TJ5A 1WB5A 4IKPA 4LJYA 4R9VA 5HUQA 1QFZA 4G23A 3OEEG 3PYLA 3PT9A 3N6XA 1GN2A 3BHMA 4DLLA 1V5EA 1XZIA 2W9XA 2HA5A 4HSGA 1CUSA 3ED1A 3LXMA 4YS6A 4ALNA 2J9FA 2PDAA 2FG7C 4G5SA 5EKUA 3ZCXA 1NIPA 2NO9A 3ZQ6A 3COZA 2O8FB 4GWLA 3R0VA 3NUQA 2QLTA 3ERCA 1K86A 2YVLA 3NEAA 1WETA 3STXA 4CM5A 3SWWA 2I4RA 1N9GA 4FI3F 2HK6A 4ODIA 2VTVA 5HUJA 4KBYA 3KB6A 4UVGA 2QRJA 2BYTA 2C2AA 3CC8A 1U2TA 1JR2A 3KFLA 13PKA 4ZALA 1S01A 2R8BA 4DBLE 3NHSA 221PA 1CZUA 3QOWA 1Q8IA 1TA9A 5G0SA 1VMEA 5JDIC 4NUTA 1W9HA 5LZ8A 2Z6UA 1ULBA 4QSHA 4ZWNA 4QNMA 2C0PA 5G4VC 2TMKA 2BHRA 3EY9A 3O75A 1ODEA 1OZHA 1WSAA 3KAQA 4K35A 1XA0A 2FTKA 4L15A 4H4DA 3QEOA 5CHEA 2NU7A 4QGHA 1DP4A 2C83A 2ARHA 5HIJA 3OE7D 1BC5A 1GY8A 3LD9A 3OFJA 4UZFA 3SCZA 2I6GA 3TJMA 4GBJA 1ORRA 2OAP1 4MA4A 3RS0A 4WJLA 2CXRA 3SJAC 5HZMA 1VPDA 3OIUA 3JATB 3TCUA 1CUHA 4CDNA 2XHZA 4BE7B 2IOFK 5KUTA 2QRKA 1JE1A 2NU8B 3AHIA 1H1LB 2JVKA 1B3QA 3K0CA 3VAZA 3WYBA 3ZKWA 3X2EA 2VYQA 3FHJA 3BRCA 2HMWA 1HDYA 1UBSB 2QRMA 2G9NA 1KYWA 2BRUA 3LL7A 2IYNA 3B6JA 1HDJA 4DV6O 1NBMG 2PGOA 3HXKA 3P9NA 1JKXA 3ABQB 3FOBA 1MPXA 3R0QA 4S3MA 2PT6A 3VQXA 1N2CA 1G0NA 3CIFA 3WJRA 3VKUA 4QTYA 1IOLA 4XUDA 5EZQA 1BH6A 1IY1A 1D9XA 5COAA 3RKRA 4P81A 3ZHOA 1V3UA 4CEHA 3NB0A 5EI5A 1Y81A 3M99B 1NRWA 4YRFA 2IIQA 4QHYA 5H16A 2V7QG 4KE9A 5IABA 5ICGA 2DHRA 1QHHA 1XOIA 1VSUA 3N0VA 2ZIUB 3O3CA 3TQOA 4ZCLA 1BMTA 1KYOF 1HDGO 3HR8A 4I0WB 4Q21A 3L2OB 3R3SA 4UNIA 2WSSG 5DTQA 1W40A 1QYWA 2DPLA 1AX9A 2LFRA 4JZ2A 2N1BA 4K86A 5LXTF 3R8FA 1AB6A 5KHJA 1MJFA 1U04A 2AC4A 4ZYWA 3BE4A 4YLYA 1NLFA 5CA0F 4CKCB 3KSDO 3EARA 4OQDA 1OF1A 1U9JA 4HI0E 4IM7A 2HNAA 2G9ZA 1CZRA 1CIVA 4UHEA 4B3GA 3C90A 2H2IA 1FFBA 2V74B 2FXVA 2WU8A 3O5AA 1QO0D 4DMCA 4WZAE 3ZJTA 1OI3A 1EUCB 4D80A 3IDQA 2HMSA 4ZQIA 3FYDA 5CRIA 5KYVA 4QO7A 4TUYB 4IFIA 3RBVA 1NMUB 1G8AA 3JQGB 1GV0A 3RUCA 3CG6A 1G59A 1NLYA 3S7ZA 3LWVC 1ZNXA 1UK8A 5F52A 2R7LA 4GLFA 1TUBA 1O3YA 4ECEA 2F3SA 4FGWA 1BDHA 1JVBA 1D5WA 1PYGA 3MS2A 4WZBE 2Q7XA 3UANA 3KOXA 2BH2A 2P5SA 1I1QB 1WB9A 3ACBA 3DDHA 4KW7A 1YIDA 2GPWA 3ITDA 3AHJA 4QKQA 3R5SA 1GCOA 1WU7A 4JROA 3VZCA 2E6KA 1Z6PA 2KB1A 2WR8A 4GZMA 5F7JA 2NXCA 2YWFA 1XKLA 2RC5A 4X44A 2C84A 1KZ7B 5DU2A 2Z3ZA 2VJKA 3AM5A 3CT6A 3QRWA 3E3NA 4M9RA 4PSDA 1TAUA 4ZHWA 2I6SA 4TSFG 1ODJA 1P2FA 2AJBA 3D8UA 3K6JA 4PIMA 3HTNA 4B2LA 3BQNB 2WC1A 3U4QA 5C8ZA 3IQIX 3G17A 2B3DA 3QPCA 4R1QA 2GM4A 3K04A 3K6RA 1MVLA 4PXSA 3GGPA 4WVFA 3QFRA 5KO2A 1TTPB 2V9PA 3BMXA 1ZNYA 4FWBA 4EATA 4XIJA 2V8BA 2CZWA 3FHLA 3BD7A 3D8BA 4RADA 3VR4A 4CNBA 5FWXB 2BLLA 4H6PA 4X8LA 3OO1A 3ENWA 2MYTA 5T41A 3WDMA 2EJRA 3OKFA 4J0FA 1WV1A 2PKQO 1L5NA 2A30A 4JLVA 4X6YA 4XEUA 3IE1A 4IICA 3VQTA 5CG2A 2ZR7A 3SXUA 4JI2B 1U6IA 4BAZA 2Z0AA 4ETIA 4HZGA 4RUKA 3LYHA 3R41A 1E2GA 1Z16A 1F4VA 5JS7A 1H9BA 2VJPA 2XADA 1N4CA 4V0RA 2CNNA 4F91B 3CGWA 1SBIA 1WULS 4RKYA 5AM0A 3TZEA 4F72A 4MA5A 4BFZA 2KYRA 1KQFA 3LRTA 1XWFA 4J2OA 1HE4A 3FYCA 4X6LA 2CWDA 4XUCA 1E4VA 3A3PA 4HWPA 4ZKIA 1R00A 4FDVA 4HB4A 3QLJA 1VA4A 2HZBA 4OMFG 3H18A 3I32A 1HNWB 2EJTA 1KQOA 4ZVMA 1KE1A 1L7BA 2O2CA 4HDNB 2FSPA 2IHVA 1KJJA 4OQLA 4KPEC 1VKRA 2XMRA 1MEOA 4G5QA 3HWX1 1HC7A 1X94A 4Q7KA 3X44A 4AWXA 5CD9A 2YS7A 3U3XA 1JSZA 2A3QA 1T3SA 3TEJA 4Z1MG 5MN6A 5DNDA 4GKKO 5J59A 3AG5A 4OQPA 1Y82A 3WHIA 2V7QD 4BNDA 5J43A 4RF3A 2R62A 5HFAA 2ZR8A 2P4UA 2RCVA 5T64A 1ZH0A 3QMMA 4KLRA 3I45A 2BFDA 3OQIB 2R87A 4S05A 4W9NC 1R6XA 3KQQA 2WP8J 2UAGA 4W4TA 3RG2A 5JAMA 5E79Z 1FEZA 5CVUA 5GJWC 3REGA 4K6KA 4K03A 4S1VA 4ZCRA 5CBKA 4RQEA 1IM2A 1NTKH 1U8UA 1OLXA 3E9QA 1LBEA 3EG5A 4MS4A 1N3YA 3MDOA 4NS4A 4PS0A 4MR7B 2QMOA 5HQTA 5DCVA 1QCEA 1E77A 3K8ZA 5ANRB 5EIFA 5F2EA 4RV9A 5HK9A 1CJKC 4MKHA 3LXXA 4G9EA 3DO6A 3ETCA 1U40A 1YJBA 3EOZA 1P4AA