3JB9F

Cryo-em structure of the yeast spliceosome at 3.6 angstrom resolution
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
82
structure length
82
Chain Sequence
MKLVRFLMKLTNETVSIELKNGTIVHGTITSVDMQMNTHLKAVKMTVKGREPVPVETLSIRGNNIRYYILPDSLPLDTLLID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pre-mRNA-splicing factor spp42
publication title Structure of a yeast spliceosome at 3.6-angstrom resolution
pubmed doi rcsb
molecule tags Rna binding protein/rna
total genus 10
structure length 82
sequence length 82
chains with identical sequence f
ec nomenclature
pdb deposition date 2015-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3jb9F00
2JN0A 4XU0A 3RESA 3V7SA 3RUXA 4MMKA 5LJ3g 4PJOF 3JCMe 5GAN3 1MGQA 3JB9F 3QUIA 4C8QG 3JCMb 2E65A 4C92A 4XQ3A 4JUVA 3JCMc 4XTVA 4M77G 5LJ3d 3V7CA 5GAN8 5GAOq 4N0AC 2DXTA 3V8JA 1WPYA 2VXFA 2VC8A 4JRKA 3SWNA 3QO3A 5LJ3h 5CAIA 4M7DF 2RD1A 3EFSA 1D3BA 4XTUA 4M7AB 2E1HA 5GANd 4V2SA 3RERA 2RB6A 4C92D 1U1TA 3BDUA 4C8QC 2RA2A 4F7UA 4M77C 1LJOA 5LJ5e 4EMKC 1U1SA 1X01A 2E64A 3JB9I 1I5LA 4M7AF 4M7DB 4PJOE 2ZGWA 2QTXA 4XTZA 4M75G 2E41A 5GMKh 4MMLA 5GAOm 1JBMA 3BW1A 5LJ3j 1B34B 4WF2A 5GAN7 4J6YA 4RCCA 4M7DE 3RIRA 3JCMX 2YLBA 4M78G 3RKYA 1WQ7A 4PJOA 3HFOA 4A53A 4C92G 3RKXA 3AHUA 4M7AA 3GIBA 2DKGA 4M75C 4XU1A 3HFNA 4M77F 5LJ5f 4XTYA 3VU3C 5GANg 5GAN2 5GAOr 4XTWA 4M7DA 1YCYA 5GAMj 2Y90A 3QSUA 4PJOD 3JCMg 5GMKl 4PJOB 4M78C 5GMKj 5GMKi 4QVDA 4C92C 4F7UG 4A54A 5GMKm 4M7AD 4EMKB 3JCMd 5GANh 2DZ9A 3SWNC 1B34A 4M7DD 4JLIA 5GAMf 3FB9A 5GAN5 5GAN4 3SB2A 2DEQA 4C8QE 4J6XA 4M75F 3JCMP 5GAOl 4M77E 4N0AA 1JRIA 5LJ5g 2HNIA 2DZCA 3JCMQ 4XU3A 4NL2A 1WQWA 3L2ZA 4RCBA 4EMHA 2I2LA 3QHSA 4M7AG 4M78F 5LJ5d 4M75B 4C92F 5GAMe 2EJGA 5GANj 5GMKe 1BIAA 3L1AA 3INZA 4C8QF 4M77A 5DY9A 4J5YA 3RKWA 1KQ1A 4EMKA 1TH7A 1M5Q1 2E10A 3BFMA 4M78B 4X9DA 5LJ3f 3JB9J 3JB9H 1I4K1 4M7AC 4M75E 5GAN6 2DTOA 2FB7A 2DTHA 4C8QB 4F7UF 2EWNA 3JB9D 4PNOA 2K57A 4M77B 4DQ2A 4X9CA 2VXEA 3BY7A 1I8FA 4M78E 3JCMh 5LJ3e 3FJPA 4C92E 4OP0A 3HSBA 4HA8A 1HK9A 1I81A 4M75A 5GAOp 1WNLA 3V7RA 1N9RA 5GANe 4HT9A 2DXUA 4XU2A 4PJOG 4HT8A 4QVCA 4M78A 1Y96B 3JCMJ 3PGGA 3JB9G 5GAOn 3JCMW 4M75D 4F7UE 4Y91A 1M8VA 1HXDA 4NOYA 4C8QA 5LJ5h 2YHTA 4XTXA 4M7DG 4NL3A 4M78D 4J6WA 5GAMg 3V8LA 4PJOC 4C92B 2DJZA 3EFRA 4JRIA 4C8QD 3JCMV 2EJFA 2RM4A 5GAMd 2EJ9A 2YLCA 4M77D 3SWNB 5GANf 1BIBA 3JCMf 3FIFA 2DTIA 1D3BB 2FYKA 5GAMh 1LNXA 4M7DC 4M7AE 3M4GA 1KQ2A 1H641 1Y96A 2DVEA 4F7UB 1N9SA 5LJ5j 2CGHA 4EMGA 2EAYA 1LOJA 3V8KA 5I21A
chains in the Genus database with same CATH superfamily
3EGDA 2HQHA 3RUXA 2MYSA 3PE0A 4ZTFA 5GAN8 1VIFA 4K11A 4N0AC 2CT3A 3TCJA 2VXFA 4OMOA 5D6WA 2A3LA 3REAB 4C8QC 1M2VB 2LX7A 2D0QB 3PIOA 1VUBA 2RF0A 4IIOA 3M53A 1IREB 2JTFA 1M30A 5GAN2 3RMQA 5EG2A 3TQ7P 2LQWA 2X4YA 4R0KA 5IAYA 2E5QA 2PUOB 2EIFA 4PK4A 3HPWA 4PFOA 2MCNA 1Z9ZA 3HRTA 4C8QE 2E6NA 2XU8A 4N0AA 2BE7D 3QZ9B 1WJRA 3OSSC 3PT9A 2XMFA 1U8RA 2LNHB 1M27C 1WLPB 2EQUA 1EX4A 1KD1R 1K73R 2JJ9A 2NUPB 5C6SA 3C94A 2HD0A 4PNOA 1AWOA 2VASA 4OGCA 1NPRA 4J7IA 3CCRT 1S1NA 4Z89A 4A4EA 1N9RA 3OYHA 1BI0A 3HTRA 2LQKA 3QJYA 3G71T 1W1FA 2DETA 1ABQA 4N4GA 3UPUA 2KNBB 2DJZA 1AZEA 1TUGB 2I0NA 4Y28E 2DPPB 2DTIA 2FYKA 4FW2A 2F2XA 1M3CA 1YJWT 4KULA 2GTOA 2ZAEA 1KK7A 1Q82U 1QMCA 1M3AA 1D1CA 1YNZA 4J9EA 2VYTA 1VQ8Q 4HCCA 1OZ2A 2V8KA 3P8DA 1QCNA 4JS5A 2XDBA 5GANd 2RB6A 2G3RA 1XOVA 1Y7XA 4RUGA 4L5GA 4E7JA 1Q82R 4X34A 3PFSA 5D6XA 2QQSA 1AEYA 2PVDB 1QKWA 1WHLA 5FRNA 2KXCA 5M9OA 2KMTA 2L3QA 4CC4B 2EYQA 2XKOC 1XTDA 1VQMA 4FYVB 3WXMB 1LCKA 2OTJQ 2CP5A 2DNUA 2X4XA 4PJJA 3H0FA 5IHNA 1TUDA 1UG1A 1SPKA 4ORZA 3CCQA 1QW1A 1NJIR 2I2LA 4M78F 2QTVA 2HSEB 1OZ3A 2LNVA 1E6GA 1FYNA 2YUQA 2WACA 2A0FB 3ZBDA 2F5TX 4J7FA 4HVUA 2DTHA 2RQTA 2EKHA 1U5SA 4E7ZA 5CKFA 2KI7A 4E6RA 2QG9B 2CP2A 3QPHA 4DA4A 1VQNQ 1H8KA 2IVWA 3CC2Q 5GAOn 4M75D 3E9FA 3L42A 1WHGA 3OYLA 2DD4A 2CH4A 1K4US 1PSEA 3R6OA 3V8LA 3OA6A 4JRIA 1N5ZA 1MHNA 3UDCA 4C0ZA 2VWFA 3FIFA 2GF7A 3PMIA 1OEBA 4LUDA 5KE2A 5GJVB 1LOJA 3UA6A 5FLXE 5CIUA 4MMKA 3EG9B 4VUBA 3H0IA 2YWWA 2XHCA 3SEMA 5LJ3h 5CQXA 3KXTA 2DFUA 2RA2A 4ZNXA 1V29B 4D8DA 2QTXA 1P92A 1VQ8T 3BW1A 3G4SQ 2R5MA 4J6YA 2ZPIB 3RKXA 4KGZB 2JS0A 4M78C 3EGXB 4M7AD 3EG1A 4A54A 1ZA1B 5GANh 4F17A 2F2WA 2JMCA 5GAN5 2EGEA 1KC8C 4A63B 2QA4Q 1UJYA 2OTJT 4C92F 3QWXX 4ME7A 4YTLA 2QDYB 2MWOA 2RJCA 1TXQA 2KR3A 2CREA 1AOJA 1K76A 1T3SA 2BZ8A 3OYMA 2VV5A 5I22A 2ESWA 4JRPA 4BY6B 3MEVA 4M78E 3ZL7C 2KEAA 1RADB 4OMMA 4OP0A 3NTIA 5GANe 2O01E 1ZBJA 4CI0C 2LT1A 2J06A 5L8RE 4M78A 4QVCA 4L59A 1UUEA 1T0JA 3E9GA 4Y91A 5IH2A 3CMEA 3CCEA 1TWBA 4KBMB 2FRWA 2EJFA 1SF9A 2RI2A 1VQNT 3CC2T 1PM3A 1D1BA 4KH0B 3CD6A 4OF1A 2RO0A 4EPCA 3V7SA 1M90C 3H41A 2KRNA 2LZ6B 3JAME 4ZGJB 2DIGA 2DYIA 2DJQA 4F7UA 3QG1A 1ZUKA 1ZSZC 5ECAA 3OS2A 4MMLA 1X27A 1JBMA 5LJ3j 2NUZA 1WFWA 1TS9A 2X51A 2B86A 3RKYA 3FDRA 1MNDA 1OU8A 2F5KA 1X75C 2D1XA 5CK9A 3CCJT 4QVZA 4PJOB 3OMCA 3VS7A 4BD3A 2DRMA 1C6VX 4C92C 4F7UG 2MK5A 1JJ2P 2BZYA 2XG8D 2O4XB 1AT1B 3G4ST 4RTUA 2DLPA 2DAQA 2O9VA 1W2BS 1SRLA 3OS5A 4RTZA 2DEQA 3N5BB 2DZCA 1NM7A 2RNAA 1WQWA 3Q1JA 3QHSA 1ZUUA 1SSHA 2EJGA 5GANj 5DY9A 1ZSZA 1OQKA 5HKCA 2Y4YA 1CKAA 4M77B 2QA4T 4J9IA 1S72Q 2ZPHB 3C0CA 4C92E 4HA8A 2KRSA 3A5ZB 2L3PA 4Y92A 1KFZA 5KYXA 2M51A 4RTYA 1K9MR 3PGGA 1KHCA 1QVGP 1M4ZA 3ASKA 3CXCP 1YIJQ 1RUWA 2VB6A 1M9SA 2ZPFB 2IG0A 3FEOA 2CP7A 3JCMV 5HY6A 3M4GA 3PIPA 2QEXQ 1N8RR 3BE3A 3NTKA 2W10A 2JN0A 2YXYA 1QCFA 4QKUA 1WYXA 1JO8A 1M2VA 1XJWB 4ELZC 1RL2A 4N4HA 5KH6A 4BI8B 1I5LA 3X24B 1QQJA 2KT8A 4C0DB 4M75G 1VQ7Q 3DLMA 4LXCA 4ZGEB 1WXTA 1Y57A 3CBOA 3UF4A 2FZCB 1Q86U 3AT1B 1AZGB 3OYGA 4E7SA 3JCMg 3S3NA 4IKFA 4QVDA 1KQSP 4EMKB 2DZ9A 1R77A 1B34A 1IHWA 1VQ4Q 2H3JA 3CCUQ 3LW5E 2IIMA 4LD9K 2EVRA 3M55A 1R0CB 1SKUB 2NUPA 3FLGA 1YIJA 1ZBXA 3RR6A 4RTXA 3CC4Q 2D0NA 2CZ7B 2VKNA 2O2OA 3QYHB 2X4WA 4C8QF 2EYWA 1TH7A 4LDXA 3FC3A 3S6WA 1OX9A 3TEEA 3CBMA 2RQRA 4J9FA 2FB7A 1BBZA 1Q81R 3CPWP 2AZVA 3BY7A 2DYBA 2RHXA 4DBQA 1HK9A 4DBRA 3I55Q 2BE9B 3MEAA 1YHQA 5A2QE 1SSFA 2CP0A 2DL8A 1ABOA 3JRZA 3JB9G 2FRYA 2EGAA 2H3EB 2Z0WA 2A36A 1S72T 3A8OB 4E47A 1QVFP 4LE9A 2EBPA 3SD4A 3SWNB 3X25B 1VYTA 1VQ7A 5GAMh 3P8BB 2DERA 1LNXA 4JRQA 1OX8A 3MEUA 2CGHA 2EQMA 2P4RA 2P0PA 1YIJT 2J6OA 3VS3A 3VYGA 3DB4A 1IXDA 2JTEA 2QASA 1ZA2B 4JUVA 1Q95G 1D1AA 2RMOA 1UGPB 1WPYA 1ZHIA 4JRKA 5CAIA 2LJ0A 2KDSA 2DBMA 3OQ5A 1O9SA 2E1HA 2QEXT 1UEBA 1VQ4A 1U1TA 2EYZA 1RLPC 3JB9I 1W6XA 1W2BA 2LCSA 1I1JA 3CC4A 2GFUA 1IB8A 4A53A 3X20B 4FYXB 9ATCB 2RQWA 3HFNA 1G5VA 2K5LA 5GAOr 5HCKA 1JB0E 2L3SA 1VQ7T 3F70A 5FU6B 3E19A 4JLIA 3VUZA 3IQLA 5J39A 1VQ5Q 5FU7B 1H3ZA 4J6XA 3CCRA 2RH2A 4JPBW 2PNIA 4X1VA 1AD5A 1X69A 2CT4A 4M75B 5LJ5d 4QQ6A 4RTVA 1Z9QA 3C4SA 3INZA 3RKWA 3G71A 2OI3A 5LJ3f 1VQ4T 3JB9H 4J83A 2P0QA 2CSIA 1MV3A 4PKCC 4RG2A 2C0TA 1KD1U 2EPDA 3CCUT 1K73U 2XDPA 3JSCA 2K2MA 2QGGA 3L2UA 1M8MA 3I56Q 3CC4T 1OI1A 4ZN1A 2GCXA 1YJWA 3MJXA 4OMQA 4HT8A 3H0HA 2XIDA 2NUTA 2DA9A 1M1KC 1YN8A 1UB4A 4C8QA 2KQWA 4M78D 1QWFA 3I55T 1BU1A 1WGSA 4BE1A 5GANf 4RKUE 1I0CA 1VYVA 1NYFA 3MHXA 1K0XA 3A98A 1YI2Q 4QW2A 4XU0A 4Q5WA 4PJOF 4GY5A 2RJFA 1VQKQ 3M57A 4C8QG 4LD6A 2L0AA 2LP5A 4XQ3A 3JCMc 1X2QA 2LJ1A 5LJ3d 2C06A 2E4HA 2VC8A 4M7DF 1LVKA 1I07A 2M0OA 4M7AB 3ULRB 4RTTA 2M16A 2XI9A 3O5ZA 2E64A 3LH5A 1SHFA 4OMNA 4BY6C 1KSWA 1M2OA 2QQ9A 3VV0A 3MP6A 4FT2A 5CKDA 2A28A 1B7TA 2MOXA 5KYUB 3I5SA 3AHUA 4M77F 3WVDB 2L3RA 1IZ6A 3OW2P 3QSUA 2K3YA 1TG0A 1NEBA 4BDYA 1SEMA 1GL5A 2K5FA 3P8HA 3DLLA 1WJQA 1MMNA 3REBB 3FJ5A 1BYMA 3X26B 1E6HA 3CCMQ 1CKBA 5AYFA 3VRYA 1ACMB 1DJ7B 4JDSA 1NJIU 3QKJA 3T9NA 3CCSQ 1VQ5T 2K57A 1G3SA 1T0HA 3CQTA 1OPLA 2CYZB 2K2VA 3EH1A 1IGQA 5J26A 4KUDK 4FU6A 1VQPQ 1QP2A 4HT9A 2KK4A 1X6OA 3TU4K 1V1CA 3JCMW 2E6ZA 1WHHA 2BTTA 3SFMA 2OAUA 3EGDB 5LJ5h 1PWTA 2YHTA 4HCKA 5KYYA 2CUBA 4PJOC 3I56T 3VS2A 4BE0A 2AT1B 2FHDA 1E7OA 4J9CA 4M7DC 2OAWA 3CPFA 4AFSC 5CCAA 2KGTA 5KE3A 1PHTA 3EHQA 1K0SA 1C1AA 2PVOB 1VQ8A 5CQYA 4PL6A 4XTVA 2NLUA 1NBEB 2KXDA 2PVGB 4XTUA 2HL5C 5LL6S 4NS5A 3BDUA 1YI2T 4M77C 5LJ5e 1X01A 4PJOE 4XTZA 1VQKT 3CC7Q 4M7DE 4BACA 4PJOA 5DLQE 5CKHA 2DXBA 2OTJA 2KVQG 2HZYA 4FM4B 3VKIA 4M7DA 3M59A 1G3YA 2AKLA 2SRCA 4WCIA 3HRUA 2YUOA 1C0MA 3H9NA 2R5AA 4MZTA 3CCJQ 2M9UA 2HSPA 4M77E 1YWOA 3OYFA 5A0LA 2JM9A 2EFIA 2J05A 3M58A 4M77A 3BFMA 2J6KA 1YBYA 4UC4A 1JJ2S 3JB9D 3A8HB 2DTOA 3KFVA 1KJWA 2DVJA 1AHJB 3OYBA 2FPDA 1I8FA 1WHKA 3CCMT 5LJ3e 2M1HA 4C0DC 3OY9A 1Q7YC 3L2VA 1WNLA 1PD1A 3MO8A 1Q86C 2X9HA 3M9QA 1VQNA 4IUQA 2DK3A 3CC2A 4C0FA 1PC0A 3CCST 4JZ3A 3L2WA 2OX7A 3EG2A 1VQOQ 1PKSA 2DO3A 1YJ9Q 1AWWA 4OVAA 2JTMA 1PD0A 2MMPA 3CC7A 1VQPT 1K8AC 2FL7A 1RAFB 3MP8A 1Y96A 2DVEA 3URGA 5LJ5j 2A08A 2G6FX 1QVGS 3HKSA 2K3BA 4OB3B 3CXCS 1M1KR 2F69A 2Y4XA 4J9HA 2AZSA 2NYSA 1VQ9Q 3CCJA 2HL3A 2K9GA 1UDLA 3VYHB 3G4SA 2D8HA 4WF2A 4HVVA 2JM8A 5IHKA 1OULA 1EIFA 2RHIA 3JCMX 3EHRA 4M78G 3M56A 4E7HA 4XU1A 1OYXA 1YJNQ 4XTYA 1VQ6Q 2QXFA 2RN8A 1M3BA 1NE8A 2DE0X 3CC7T 5J3BA 2WSCE 2R58A 4FSXA 5CKBA 3SWNC 5KYWA 3UT1A 5GAMf 2D9TA 2RPNA 4C5IA 2QA4A 1YITQ 2SEMA 5FWBA 4A4KA 4XAXB 1B3QA 1A0NB 4RCBA 4EMHA 4GLMA 2DF6A 1PCXA 2ED0A 3NMZC 4MZMA 4DOWA 1M5Q1 2X3XD 2L2PA 2KSSA 3GOXA 1KQSS 3EFOA 2F2VA 2EWNA 2CZ0B 3S3OA 4HKEA 2LDMA 2OTLQ 2LMJA 4X9CA 3RBBB 1BI2A 3FJPA 4KRTA 2V8JA 1RAHB 1U06A 2HMAA 3V7RA 1BKBA 4KGXB 2DXUA 4ZN3A 2COZA 3VS5A 2AHJB 3LLRA 2CDTA 5FRMA 1K9MU 4NL3A 2KE9A 3OYCA 1SHGA 2EQIA 4R56A 3VS0A 3EFRA 3CPWS 1G8XA 4C8QD 2FPFA 5GAMd 5FU6C 5DM7R 2KROA 3TREA 2E3HA 2MAMA 3QXEB 5FU7C 4DOVA 2D6FA 2EAYA 2F1LA 1VQOT 2DEUA 3PNWC 1N8RU 1YJ9T 1G3TA 2XICA 3LYIA 4C92A 1FX7A 1KD1C 2RJEA 4F14A 2ZZDA 1IO6A 1D3BA 1FMWA 1QVFS 5FW9A 2JOYA 1JQQA 1TTHB 3PMTA 2ROTA 2V26A 3BDLA 5GMKh 1RACB 2O31A 2DXCA 3PVQA 1AVZC 4RCCA 2HKQB 4C92G 1VQ9T 2HBPA 1PRLC 4PFPA 1U3OA 2QQAA 4AT1B 4FYWB 4MDWA 1VQLQ 2ZCFB 4LDWA 2Y90A 1T3LA 2QQRA 2V8IA 1JJ2A 1LPLA 2YRVA 2LC4A 3OS1A 1JXOA 5I11A 5GAN4 3QZ5B 5A0GA 1OPKA 1WDXA 2COWA 3G6EQ 3EGUA 2HNIA 1GFCA 2ZPBB 1VIEA 3M0UA 1YJNT 2MI6A 2GBQA 1VQ6T 3OYDA 2B8AA 3QBYA 5GMKe 3L1AA 1EFNA 1YCSB 2JW4A 3CBPA 4M78B 2J7IA 4L6V5 3D7SB 4M7AC 1YITT 2CP3A 3A1PA 1S72A 1BI1A 3HHTB 1Q82C 1Q81U 2EKOA 3CCLT 2FEIA 3DB3A 1ZUYA 3J80E 4XU2A 1UHCA 3WVEB 1KC8U 3OMGA 1QVGA 1OOTA 1OV3A 3C95A 4N4IA 2FZGB 2V1RA 2MF2A 3CXCA 1QKXA 1M1FA 1GBQA 2ENMA 2BKDN 2KYBA 2OTLT 4DBHA 3CCVQ 2O9SA 3META 3VS4A 2K79A 2QEXA 4HCZA 3OBYA 1RI9A 1Q7YR 2E12A 4M7AE 1JU5C 8AT1B 4F7UB 1N9SA 1KC8R 2CZ6B 4BDZA 4KH1B 4ANJA 2HQXA 1R0BG 2BUDA 2P4TA 5GAOq 1MMDA 4HCBA 2X3WD 1X6GA 1UGQB 3GBQA 3UA7A 1LJOA 1K8AR 5D6YA 2E5KA 3MEWA 5KYUA 4JJCA 2CKKA 3X28B 2P84A 3M0RA 2FPEA 3LX7A 5KCOA 3LGFA 5LJ5f 1W70A 4XTWA 4PJOD 4MDXA 5L23A 3GNFB 5GMKj 1WI7A 3OYJA 1KQSA 2A7YA 2O88A 3RNJA 3JV3A 1RABB 1NLOC 4M7DD 1VA7A 3CCUA 4PFZA 2JVVA 4BB7A 3JCMP 4PLLA 3JCMQ 4NL2A 1VQLT 4OB2B 4ZTJA 3RMSA 1M90R 5GAMe 3OW2S 1BB9A 2YUNA 5KYXB 2M02A 2EW3A 2LRQA 1ZSGA 2R57A 4B9XA 3CPWA 1Y07A 3G6ET 8ATCB 3LGLA 3I55A 4AG1C 5EC7A 1K1ZA 2GGRA 1UGSB 2CZ1B 1WHMA 3HL8A 3GP8A 3J7AF 1ZLMA 4AFZC 3OYAA 2L8DA 4B6MA 2FZKB 1G83A 2VUBA 2XD0A 2WSEE 1QVFA 3MKDA 1G3WA 2YLCA 4E7KA 2VVKA 3QJ6A 4ELYC 2GQIA 1UFFA 2PZ1A 3DKMA 3RESA 2H8HA 3I5RA 2ECZA 3CCVT 1PNJA 2DL3A 4HXJA 4LDUA 3O8VA 1X6BA 4V2SA 4QT7A 2CP6A 1QCOA 2K7AA 5GJWB 2RI3A 1CSKA 5KCHA 2BIVA 4C5GA 2AKKA 1XNIA 2K4YA 2KBTA 3EG9A 5D7UA 4Z02A 1B34B 3CEYA 1ZX6A 4II1A 2AK5A 2YLBA 2PQWA 1WQ7A 3A8GB 1TOVA 3TSWA 5CR2A 3M0SA 1K9AA 2YSQA 2IPOB 2V1QA 5GAMj 1VQMQ 1AWXA 3OYNA 3RDVA 5KYNA 2M0YA 2HEQA 1VQ5A 3M0TA 1WJSA 4CC7A 3SB2A 1H92A 2EGCA 2GTJA 3J81E 3CCQQ 1J3TA 2LCCA 3M0QA 5IXBA 1UECA 4J9DA 3EGXA 1NZ9A 2QK0A 4IUTA 3L2QA 1I4K1 1JEGA 1NLPC 4J9GA 2C0OA 3VS6A 1KIKA 4DQ2A 3I56A 2GFAA 2HQEA 1I81A 4MZPA 1JXMA 1TUCA 1KG1A 3QDFA 1M8VA 1UGVA 1HXDA 2JUFA 1MMGA 1ZQ1A 4BE2A 1GCPA 4BI4A 1FWZA 3KBGA 4JJNK 3SHWA 4J9BA 1PKTA 4LDYA 1XQHA 2FO0A 3VUBA 1UHFA 4F16A 2PTKA 1BIBA 2HAXA 1KQ2A 3KUFA 1YI2A 3OYEA 3LWHA 2WSFE 5CKEA 1D09B 1VQKA 2VGMA 1UTIA 2RI5A 3QUIA 2JXBA 3UWNA 2AIRB 4PLIA 1UJ0A 4ESRA 3MPUB 3QO3A 2K6DA 4P5NA 3MP1A 3RERA 4C92D 3THKA 4Z8AA 2EQJA 3QYGB 2E41A 5IN1A 5GAOm 2MPXC 2YDLA 4QQDA 4IURA 1K9MC 2LJ3A 1WX6A 4OMPA 1RI0A 2GNCA 1BK2A 3OW2A 2DMOA 3GLXA 1SRMA 1GFDA 5GMKi 4OMLA 1WZOA 4E7IA 1D0YA 2JT4A 1BCOA 4AG2C 1FXXA 1NYGA 4LN2A 1N8RC 4DEYA 5I2SA 2HBWA 3CCMA 5LJ5g 1TU0B 2K5IA 1VQMT 2DIQA 4BUGA 1BIAA 4J5YA 4OB0B 2O4XA 3EG0A 3CCSA 5DLOA 2NUTB 4C8QB 4F7UF 3E1SA 3VS1A 1G2BA 1V76A 2EYYA 1RAIB 2VXEA 2DL4A 3CCQT 4CC2A 1NPPA 4C5EA 1VQPA 3ZEHA 5GAOp 3HRSA 2COYA 1R8OB 3QWYA 4PJOG 1BCMA 3EG3A 4R55A 2KRMA 1FMKA 4NOYA 3CMEQ 2CUDA 1N6AA 4M7DG 1IGUA 3CCEQ 2RK2A 3C12A 4FW1A 5C0MA 2EJ9A 2EYXA 3NGPA 3MCAB 3JCMf 1TSFA 4EMGA 3GPLA 3TSZA 4C5HA 3CD6Q 1M1GA 4JS4A 4FCYA 5LJ3g 1MNEA 2PU9B 2BZXA 2E65A 1YWPA 1AWJA 1WA7A 4M77G 1WXBA 1QLYA 4AFUC 5IT9E 2RD1A 3VRZA 1M1KU 1B07A 1Q81C 3H8ZA 2GQVA 1RAAB 4BI3A 3LWIA 4EMKC 4IIMA 2ZGWA 2JMAA 3CMAQ 4FSSA 3A8LB 1X43A 3M4YA 2RQUA 5GAN7 4CC3A 6AT1B 3I35A 1RLQC 2YT6A 1WXUA 2C0IA 4B9WA 1IRXA 5GANg 2RHYA 5GMKl 3UATA 3OSVA 7AT1B 2ATCB 5IXFA 3NPFA 3G7ZA 2E70A 1SG5A 2L5QA 1BI3A 3JCMd 2CH4W 4A4GA 3S3MA 3M0PA 4M75F 5AT1B 3ER0A 1QWEA 4IUVA 1GXIE 4PJLA 3OYIA 1N27A 4KGVB 4J8OA 3QDRB 4EMKA 1GRIA 2E10A 4X9DA 4GLKA 4A4FA 4TVRA 2L89A 2KYMA 4C0GA 5GAN6 2XK0A 2KAFA 2DD5A 5KYYB 2E3IA 1KHIA 4OGEA 1HSQA 4ATOA 1NEGA 5FROA 4F7UE 3EH2A 1VQOA 4A4HA 3CCLQ 2HDAA 1YJ9A 1W4SA 5CVIA 3FRNA 4JLGA 5HK3A 4FT4A 3CMAA 2RM4A 2LT4A 2LTOA 2X4JA 4DEXA 2XDDA 2DBKA 1PRMC 2ABLA 5FWCA 4HVWA 5I21A 3CMET 3R6NA 4E7LA 1WIEA 3CCET 5GAN3 1MGQA 3JB9F 4M7AF 3ME9A 3JCMb 4AMCA 4FL6A 1VQ9A 2CS7A 3SWNA 3VJPA 4DBFA 4D8KA 4OMFB 3OYYA 4M4ZA 4PJNA 1YFNA 1FMVA 2DL7A 4GBQA 3CD6T 4M7DB 2CSQA 4JJDA 1RAGB 2NWMA 1MV0B 1O75A 3OYKA 4FYYB 2FG0A 1QVPA 2X35A 2K3XA 1YJNA 4OB1B 2DKGA 2FVUA 4M75C 4Z88A 4D6WA 1VQ6A 4RMOA 1K73C 3VU3C 3GF5A 2W0ZA 1HJDA 3CMAT 3OS0A 3SDZA 1I5OB 5A0DA 3FB9A 1YITA 3QIIA 1JRIA 4JZ4A 2A37A 4XU3A 1YP5A 3L2ZA 3CCLA 4LUEA 2DM1A 4RTWA 2J6FA 1H3HA 4O5VA 3JB9J 2MWPA 3ZFJA 2ED1A 2QI2A 2LX9A 4M75E 3OB9A 2OTLA 2DILA 1MUZA 2LVMA 2QGFB 2JS2A 2KT1A 3JCMh 3HSBA 1Y71A 4M75A 4FIBA 5I2MA 4RG8A 1YHQQ 4PJMA 1Y96B 3NHNA 1GCQC 3NTHA 1HYOA 4XTXA 2QDLA 2YRDA 2DL5A 1MMAA 1OU9A 2YRCA 4E2FB 4EDUA 4EIKA 2LCLA 3TVTA 4WTOB 1Q7YU 2OJ2A 3JCMe 4AFQC 1VYUA 2MIOA 3V7CA 3V8JA 2DXTA 3M5AA 1UE9A 3E2UA 1X2KA 3EFSA 2ZPEB 3L2RA 1D0XA 4ZGDB 2HCKA 5IHIA 1U1SA 4QQGA 4KUIA 1GCQA 1W2BP 2LQ8A 1Q86R 1K8AU 3H6ZA 5KYWB 3RIRA 2QAZA 3U23A 2KY9A 1ARKA 3HFOA 1NJIC 4M7AA 3GIBA 1HD3A 1VQLA 5CO7A 3PTAA 1EZZB 1YCYA 4IUPA 3G1JA 2DRKA 5GMKm 3A8MB 1GBRA 4KT0E 3EFOB 3G6EA 2RHUA 3I9QA 2LQNA 2PUKB 4O6JA 5GAOl 2RHZA 1WHJA 1UGRB 3GNGA 3CCRQ 2P0KA 4M7AG 3M54A 2RQVA 1PG5B 2RK1A 3EAEA 1VOMA 3PVLA 1KQ1A 3NFCA 1QP3A 1M90U 2D8JA 3G71Q 1ZSZB 2JZ2A 1NG2A 1F1BB 4F04B 2DX1A 1IHVA 4IUUA 4XK8E 2ROLA 4JJBA 1Y0MA 3JCMJ 2RJDA 1YJWQ 4LNPA 1PSFA 1D0ZA 2EQKA 1RAEB 3HP9A 3LH0A 2VGNA 5HK0A 3CCVA 2QYZA 4J6WA 5GAMg 4C92B 4LDVA 2HKNA 2QQBA 3OBWA 4M77D 2ZPGB 4CRIA 1YHQT 1D3BB 2JNGA 2YUPA 1H641 3V8KA
chains in the Genus database with same CATH topology
2JN0A 1VQKA 2VGMA 3RUXA 2RI5A 1QVGS 3HKSA 3QUIA 4ZTFA 4OB3B 5GAN8 3CXCS 1VIFA 3UWNA 2F69A 4N0AC 4PLIA 3TCJA 2VXFA 2Y4XA 3QO3A 4ELZC 5D6WA 2A3LA 4P5NA 3MP1A 3RERA 1RL2A 4C92D 4N4HA 3CCJA 4C8QC 5KH6A 4BI8B 1I5LA 3X24B 2EQJA 3QYGB 2D0QB 4C0DB 3PIOA 1VUBA 4M75G 3VYHB 2E41A 3G4SA 5IN1A 5GAOm 3DLMA 4WF2A 4ZGEB 3JCMX 1EIFA 2RHIA 4QQDA 4M78G 4IURA 3CBOA 1K9MC 3M53A 3M56A 1Q86U 1RI0A 4XU1A 1IREB 4E7HA 2JTFA 1OYXA 3OW2A 4XTYA 5GAN2 3OYGA 3RMQA 2QXFA 5EG2A 3JCMg 1NE8A 2X4YA 3GLXA 5IAYA 3S3NA 5GMKi 4QVDA 4IKFA 2E5QA 3CC7T 5J3BA 4E7IA 4EMKB 2PUOB 2EIFA 2WSCE 2DZ9A 2R58A 3HPWA 1B34A 4FSXA 5CKBA 3SWNC 3UT1A 5GAMf 1FXXA 2D9TA 2H3JA 4C5IA 3HRTA 1N8RC 4C8QE 2QA4A 3LW5E 2E6NA 4LD9K 2XU8A 4N0AA 5I2SA 3CCMA 4A4KA 3QZ9B 3M55A 4XAXB 5LJ5g 1WJRA 3OSSC 4RCBA 3PT9A 4EMHA 2K5IA 3FLGA 1YIJA 1ZBXA 2DIQA 1VQMT 1U8RA 2CZ7B 2EQUA 3QYHB 4BUGA 1BIAA 2X4WA 4C8QF 4J5YA 4OB0B 2O4XA 1TH7A 4MZMA 3CCSA 4DOWA 1M5Q1 5C6SA 3FC3A 4LDXA 3S6WA 2KSSA 3C94A 3TEEA 3GOXA 3CBMA 5DLOA 1KQSS 2FB7A 4C8QB 4F7UF 2EWNA 2CZ0B 2HD0A 4PNOA 3E1SA 3S3OA 4HKEA 2LDMA 4OGCA 1NPRA 2VXEA 3BY7A 4J7IA 4X9CA 3CCRT 3CCQT 1BI2A 1NPPA 2RHXA 3FJPA 2V8JA 1HK9A 4C5EA 1VQPA 3ZEHA 5GAOp 3MEAA 3HRSA 4A4EA 1YHQA 3V7RA 1N9RA 1BKBA 5A2QE 3OYHA 1R8OB 1SSFA 2DXUA 4PJOG 1BI0A 3JRZA 4R55A 2LQKA 3QJYA 3G71T 3JB9G 4ZN3A 4NOYA 2AHJB 3LLRA 1N6AA 5FRMA 4M7DG 4N4GA 1K9MU 4NL3A 2RK2A 1S72T 3C12A 3UPUA 3OYCA 2DJZA 4R56A 3CPWS 3A8OB 3EFRA 4E47A 4C8QD 3SD4A 5C0MA 2EJ9A 4Y28E 5FU6C 2DPPB 3SWNB 5DM7R 3X25B 5GAMd 3MCAB 3JCMf 1VQ7A 2DTIA 3P8BB 2FYKA 5GAMh 1LNXA 4JRQA 1YJWT 3TREA 4KULA 3QXEB 2MAMA 3MEUA 5FU7C 1Q82U 2CGHA 2EQMA 4DOVA 2P0PA 2EAYA 4C5HA 4EMGA 3GPLA 1YIJT 2D6FA 1VQOT 1M1GA 4JS4A 3VYGA 3PNWC 5LJ3g 1N8RU 1YJ9T 1G3TA 2XICA 2PU9B 2VYTA 3DB4A 3LYIA 4HCCA 1OZ2A 2E65A 4C92A 1FX7A 2V8KA 4JUVA 4M77G 1KD1C 2RJEA 1UGPB 1WPYA 1ZHIA 3P8DA 2ZZDA 4JRKA 5CAIA 4JS5A 2RD1A 5IT9E 2KDSA 2XDBA 1D3BA 3OQ5A 5GANd 1O9SA 2E1HA 2QEXT 1M1KU 1QVFS 1UEBA 2RB6A 1VQ4A 2G3RA 1U1TA 1Q81C 3H8ZA 1XOVA 1Y7XA 2GQVA 4BI3A 3JB9I 2JOYA 4L5GA 4EMKC 3LWIA 4E7JA 4X34A 1VQ4T 2ZGWA 3PFSA 3A8LB 3PMTA 3M4YA 5D6XA 1W2BA 2QQSA 5GMKh 3BDLA 2PVDB 2DXCA 3CC4A 5GAN7 4RCCA 5FRNA 2GFUA 5M9OA 4A53A 2KMTA 4C92G 1VQ9T 3X20B 2HBPA 2EYQA 2XKOC 4B9WA 1XTDA 3HFNA 1VQMA 2K5LA 1G5VA 2QQAA 4MDWA 5GANg 3WXMB 5GAOr 1JB0E 2ZCFB 4LDWA 2Y90A 2RHYA 5GMKl 2QQRA 3OSVA 2X4XA 2V8IA 1JJ2A 3G7ZA 2E70A 2YRVA 1VQ7T 2L5QA 2LC4A 3F70A 1BI3A 5FU6B 3JCMd 3E19A 3OS1A 4A4GA 4JLIA 3VUZA 3S3MA 5J39A 5GAN4 3QZ5B 5A0GA 5FU7B 1H3ZA 4J6XA 4M75F 3CCRA 3CCQA 2HNIA 2ZPBB 3ER0A 1VIEA 2RH2A 1YJNT 1QW1A 4IUVA 2MI6A 1GXIE 3OYIA 2I2LA 1VQ6T 3OYDA 4M78F 1N27A 2B8AA 5LJ5d 4M75B 3QBYA 4J8OA 4QQ6A 3QDRB 1OZ3A 5GMKe 2LNVA 3C4SA 3INZA 3L1AA 2WACA 3RKWA 4EMKA 3G71A 3CBPA 5LJ3f 2E10A 4X9DA 4M78B 3ZBDA 4GLKA 4J83A 2F5TX 2P0QA 4J7FA 4L6V5 4TVRA 4PKCC 4A4FA 2L89A 4RG2A 4M7AC 4C0GA 5GAN6 2XK0A 3CCUT 2DTHA 1K73U 1KD1U 2KAFA 1YITT 2DD5A 1S72A 2XDPA 3JSCA 1BI1A 3HHTB 1Q82C 3L2UA 3CC4T 1Q81U 1OI1A 2EKOA 1KHIA 4OGEA 5CKFA 3CCLT 4ZN1A 3DB3A 2GCXA 4ATOA 1YJWA 3J80E 3QPHA 4XU2A 4DA4A 4HT8A 2IVWA 5FROA 3WVEB 3OMGA 1KC8U 1QVGA 2XIDA 5GAOn 3C95A 4M75D 4N4IA 4F7UE 1VQOA 2MF2A 3E9FA 4A4HA 3L42A 1UB4A 4C8QA 1M1FA 3OYLA 2DD4A 3CXCA 2KQWA 1YJ9A 2OTLT 2BKDN 1W4SA 5CVIA 4M78D 1PSEA 3FRNA 3R6OA 4JLGA 3V8LA 5HK3A 3OA6A 4FT4A 4JRIA 1WGSA 3I55T 4BE1A 3META 3CMAA 2RM4A 2LT4A 5GANf 2LTOA 1MHNA 2X4JA 3UDCA 4RKUE 4C0ZA 2QEXA 4HCZA 3FIFA 3OBYA 2XDDA 2E12A 4M7AE 2GF7A 3PMIA 3MHXA 4F7UB 1N9SA 5KE2A 1LOJA 2CZ6B 5I21A 3CMET 5FLXE 4BDZA 4QW2A 4XU0A 4E7LA 4Q5WA 5CIUA 3CCET 4MMKA 4VUBA 4PJOF 2HQXA 2RJFA 1MGQA 4GY5A 5GAN3 3JB9F 3M57A 2BUDA 3ME9A 4C8QG 4LD6A 2P4TA 4XQ3A 3JCMc 3JCMb 5GAOq 4M7AF 4FL6A 5LJ3d 2XHCA 2C06A 1VQ9A 2CS7A 2VC8A 3SWNA 5CQXA 5LJ3h 4M7DF 4HCBA 3KXTA 2M0OA 4M7AB 3VJPA 1UGQB 4OMFB 3OYYA 2M16A 2RA2A 2XI9A 3CD6T 1LJOA 4M7DB 2E64A 1V29B 5D6YA 3MEWA 4BY6C 2CKKA 2QQ9A 2QTXA 3VV0A 1P92A 3X28B 1VQ8T 1O75A 3BW1A 3MP6A 4FT2A 5CKDA 2R5MA 4J6YA 3OYKA 2ZPIB 1QVPA 3RKXA 3AHUA 2X35A 3LX7A 2K3XA 5KCOA 3LGFA 1YJNA 4OB1B 2DKGA 2FVUA 4M75C 4D6WA 4M77F 1VQ6A 3WVDB 2L3RA 1IZ6A 5LJ5f 3VU3C 4RMOA 1K73C 4XTWA 3QSUA 3GF5A 4PJOD 4MDXA 3CMAT 4M78C 2K3YA 3GNFB 5GMKj 4M7AD 3OYJA 4A54A 1KQSA 2A7YA 5GANh 4BDYA 3OS0A 3SDZA 4M7DD 2K5FA 3P8HA 3CCUA 5A0DA 3FB9A 5GAN5 1YITA 2JVVA 4BB7A 3QIIA 3V8KA 3DLLA 1WJQA 3JCMP 1BYMA 1KC8C 1JRIA 3X26B 4PLLA 3JCMQ 4XU3A 4NL2A 1VQLT 3L2ZA 4OB2B 4ZTJA 3RMSA 2OTJT 3CCLA 5AYFA 4C92F 5GAMe 4ME7A 4YTLA 2QDYB 2MWOA 2RJCA 3OW2S 1DJ7B 4JDSA 1NJIU 4O5VA 2LRQA 3QKJA 2MWPA 3JB9J 2R57A 3T9NA 3ZFJA 4B9XA 2QI2A 1VQ5T 2LX9A 4M75E 3OB9A 2OTLA 3OYMA 3CPWA 1Y07A 2K57A 1G3SA 3G6ET 2LVMA 2VV5A 4JRPA 4BY6B 3MEVA 3LGLA 2CYZB 3JB9H 4M78E 2K2VA 3JCMh 3I55A 4OP0A 1Y71A 3HSBA 5J26A 3NTIA 4KUDK 4M75A 4FU6A 1UGSB 2CZ1B 4FIBA 5I2MA 5GANe 2O01E 3HL8A 4RG8A 1QP2A 4CI0C 2LT1A 4HT9A 2KK4A 3GP8A 1M1KC 1X6OA 5L8RE 4QVCA 4M78A 1Y96B 3J7AF 3NTHA 4L59A 3OYAA 3TU4K 3JCMW 3E9GA 4Y91A 2E6ZA 3CMEA 3SFMA 2L8DA 2OAUA 5LJ5h 3CCEA 2YHTA 4XTXA 4PJOC 3I56T 2VUBA 4KBMB 2XD0A 2WSEE 1QVFA 2EJFA 4BE0A 1G3WA 2YLCA 4E7KA 2FHDA 2RI2A 4M7DC 4ELYC 3QJ6A 3CPFA 1VQNT 3CC2T 5CCAA 3CD6A 4OF1A 2RO0A 5KE3A 4EDUA 4EPCA 2LCLA 3DKMA 1Q7YU 3RESA 2PVOB 3V7SA 1VQ8A 5CQYA 3JCMe 1M90C 3CCVT 4PL6A 4XTVA 3V7CA 3JAME 4LDUA 2DXTA 3M5AA 3V8JA 2NLUA 3O8VA 4ZGJB 2DIGA 2PVGB 3EFSA 2ZPEB 4XTUA 3L2RA 4ZGDB 4V2SA 5LL6S 2RI3A 4NS5A 3BDUA 5KCHA 2BIVA 4F7UA 3QG1A 4C5GA 1YI2T 4M77C 5LJ5e 1U1SA 1X01A 1XNIA 4QQGA 4KUIA 4PJOE 2K4YA 4XTZA 1VQKT 3OS2A 2LQ8A 4MMLA 4Z02A 1JBMA 1K8AU 3H6ZA 1B34B 3CEYA 4II1A 5LJ3j 4M7DE 3RIRA 4BACA 2YLBA 2PQWA 3RKYA 1WQ7A 2KY9A 3A8GB 3HFOA 5CKHA 5DLQE 1NJIC 3FDRA 4PJOA 4M7AA 3GIBA 2F5KA 1VQLA 5CO7A 5CR2A 3PTAA 1X75C 2DXBA 2OTJA 2KVQG 4FM4B 3VKIA 5CK9A 1YCYA 3CCJT 3M59A 4IUPA 4QVZA 5GAMj 3OYNA 4M7DA 1G3YA 4PJOB 3OMCA 4BD3A 5GMKm 4C92C 4F7UG 3HRUA 3A8MB 2XG8D 2O4XB 3G4ST 2R5AA 4MZTA 1VQ5A 4KT0E 2DAQA 1WJSA 3G6EA 2RHUA 3OS5A 1W2BS 2M9UA 3SB2A 2DEQA 2PUKB 3N5BB 4O6JA 2RHZA 4M77E 5GAOl 3OYFA 1UGRB 3J81E 2DZCA 5A0LA 3GNGA 1WQWA 2EFIA 3Q1JA 2LCCA 3QHSA 2P0KA 4M7AG 3M54A 2EJGA 5GANj 2RK1A 3EAEA 3M58A 1NZ9A 4M77A 5DY9A 1KQ1A 3NFCA 1QP3A 4IUTA 3BFMA 3L2QA 1M90U 1YBYA 1I4K1 4UC4A 1JJ2S 5HKCA 2Y4YA 3A8HB 2DTOA 3JB9D 4M77B 4DQ2A 2QA4T 1AHJB 3I56A 3OYBA 2GFAA 2JZ2A 2ZPHB 1I8FA 3CCMT 5LJ3e 2M1HA 2HQEA 4C0DC 4C92E 3OY9A 1Q7YC 4HA8A 3A5ZB 1I81A 4MZPA 3L2VA 1WNLA 3MO8A 1Q86C 3M9QA 1VQNA 4IUUA 4IUQA 2DK3A 4XK8E 3CC2A 4C0FA 3JCMJ 2RJDA 3PGGA 1KHCA 3CCST 1KG1A 1PSFA 1M8VA 2EQKA 3L2WA 1M4ZA 1HXDA 3ASKA 2JUFA 3HP9A 3LH0A 1ZQ1A 2VGNA 4BE2A 4BI4A 1FWZA 1M9SA 2DO3A 3KBGA 5HK0A 2ZPFB 3CCVA 4JJNK 4J6WA 5GAMg 4C92B 4LDVA 1XQHA 4LDYA 2IG0A 2QQBA 3FEOA 3OBWA 3JCMV 4OVAA 3VUBA 4M77D 2ZPGB 2JTMA 2MMPA 1VQPT 3CC7A 4CRIA 1BIBA 1YHQT 1K8AC 2HAXA 1D3BB 2JNGA 2FL7A 5HY6A 3M4GA 3PIPA 3KUFA 3MP8A 1YI2A 1H641 1Y96A 1KQ2A 2DVEA 3OYEA 3NTKA 3URGA 3LWHA 5LJ5j 2WSFE 5CKEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JN0 A;  4XU0 A;  3RES A;  3V7S A;  3RUX A;  4MMK A;  5LJ3 g;  4PJO F;  3JCM e;  5GAN 3;  1MGQ A;  3JB9 F;  3QUI A;  4C8Q G;  3JCM b;  2E65 A;  4C92 A;  4XQ3 A;  4JUV A;  3JCM c;  4XTV A;  4M77 G;  5LJ3 d;  3V7C A;  5GAN 8;  5GAO q;  4N0A C;  2DXT A;  3V8J A;  1WPY A;  2VXF A;  2VC8 A;  4JRK A;  3SWN A;  3QO3 A;  5LJ3 h;  5CAI A;  4M7D F;  2RD1 A;  3EFS A;  1D3B A;  4XTU A;  4M7A B;  2E1H A;  5GAN d;  4V2S A;  3RER A;  2RB6 A;  4C92 D;  1U1T A;  3BDU A;  4C8Q C;  2RA2 A;  4F7U A;  4M77 C;  1LJO A;  5LJ5 e;  4EMK C;  1U1S A;  1X01 A;  2E64 A;  3JB9 I;  1I5L A;  4M7A F;  4M7D B;  4PJO E;  2ZGW A;  2QTX A;  4XTZ A;  4M75 G;  2E41 A;  5GMK h;  4MML A;  5GAO m;  1JBM A;  3BW1 A;  5LJ3 j;  1B34 B;  4WF2 A;  5GAN 7;  4J6Y A;  4RCC A;  4M7D E;  3RIR A;  3JCM X;  2YLB A;  4M78 G;  3RKY A;  1WQ7 A;  4PJO A;  3HFO A;  4A53 A;  4C92 G;  3RKX A;  3AHU A;  4M7A A;  3GIB A;  2DKG A;  4M75 C;  4XU1 A;  3HFN A;  4M77 F;  5LJ5 f;  4XTY A;  3VU3 C;  5GAN g;  5GAN 2;  5GAO r;  4XTW A;  4M7D A;  1YCY A;  5GAM j;  2Y90 A;  3QSU A;  4PJO D;  3JCM g;  5GMK l;  4PJO B;  4M78 C;  5GMK j;  5GMK i;  4QVD A;  4C92 C;  4F7U G;  4A54 A;  5GMK m;  4M7A D;  4EMK B;  3JCM d;  5GAN h;  2DZ9 A;  3SWN C;  1B34 A;  4M7D D;  4JLI A;  5GAM f;  3FB9 A;  5GAN 5;  5GAN 4;  3SB2 A;  2DEQ A;  4C8Q E;  4J6X A;  4M75 F;  3JCM P;  5GAO l;  4M77 E;  4N0A A;  1JRI A;  5LJ5 g;  2HNI A;  2DZC A;  3JCM Q;  4XU3 A;  4NL2 A;  1WQW A;  3L2Z A;  4RCB A;  4EMH A;  2I2L A;  3QHS A;  4M7A G;  4M78 F;  5LJ5 d;  4M75 B;  4C92 F;  5GAM e;  2EJG A;  5GAN j;  5GMK e;  1BIA A;  3L1A A;  3INZ A;  4C8Q F;  4M77 A;  5DY9 A;  4J5Y A;  3RKW A;  1KQ1 A;  4EMK A;  1TH7 A;  1M5Q 1;  2E10 A;  3BFM A;  4M78 B;  4X9D A;  5LJ3 f;  3JB9 J;  3JB9 H;  1I4K 1;  4M7A C;  4M75 E;  5GAN 6;  2DTO A;  2FB7 A;  2DTH A;  4C8Q B;  4F7U F;  2EWN A;  3JB9 D;  4PNO A;  2K57 A;  4M77 B;  4DQ2 A;  4X9C A;  2VXE A;  3BY7 A;  1I8F A;  4M78 E;  3JCM h;  5LJ3 e;  3FJP A;  4C92 E;  4OP0 A;  3HSB A;  4HA8 A;  1HK9 A;  1I81 A;  4M75 A;  5GAO p;  1WNL A;  3V7R A;  1N9R A;  5GAN e;  4HT9 A;  2DXU A;  4XU2 A;  4PJO G;  4HT8 A;  4QVC A;  4M78 A;  1Y96 B;  3JCM J;  3PGG A;  3JB9 G;  5GAO n;  3JCM W;  4M75 D;  4F7U E;  4Y91 A;  1M8V A;  1HXD A;  4NOY A;  4C8Q A;  5LJ5 h;  2YHT A;  4XTX A;  4M7D G;  4NL3 A;  4M78 D;  4J6W A;  5GAM g;  3V8L A;  4PJO C;  4C92 B;  2DJZ A;  3EFR A;  4JRI A;  4C8Q D;  3JCM V;  2EJF A;  2RM4 A;  5GAM d;  2EJ9 A;  2YLC A;  4M77 D;  3SWN B;  5GAN f;  1BIB A;  3JCM f;  3FIF A;  2DTI A;  1D3B B;  2FYK A;  5GAM h;  1LNX A;  4M7D C;  4M7A E;  3M4G A;  1KQ2 A;  1H64 1;  1Y96 A;  2DVE A;  4F7U B;  1N9S A;  5LJ5 j;  2CGH A;  4EMG A;  2EAY A;  1LOJ A;  3V8K A;  5I21 A; 
#chains in the Genus database with same CATH topology
 3EGD A;  2HQH A;  3RUX A;  2MYS A;  3PE0 A;  4ZTF A;  5GAN 8;  1VIF A;  4K11 A;  4N0A C;  2CT3 A;  3TCJ A;  2VXF A;  4OMO A;  5D6W A;  2A3L A;  3REA B;  4C8Q C;  1M2V B;  2LX7 A;  2D0Q B;  3PIO A;  1VUB A;  2RF0 A;  4IIO A;  3M53 A;  1IRE B;  2JTF A;  1M30 A;  5GAN 2;  3RMQ A;  5EG2 A;  3TQ7 P;  2LQW A;  2X4Y A;  4R0K A;  5IAY A;  2E5Q A;  2PUO B;  2EIF A;  4PK4 A;  3HPW A;  4PFO A;  2MCN A;  1Z9Z A;  3HRT A;  4C8Q E;  2E6N A;  2XU8 A;  4N0A A;  2BE7 D;  3QZ9 B;  1WJR A;  3OSS C;  3PT9 A;  2XMF A;  1U8R A;  2LNH B;  1M27 C;  1WLP B;  2EQU A;  1EX4 A;  1KD1 R;  1K73 R;  2JJ9 A;  2NUP B;  5C6S A;  3C94 A;  2HD0 A;  4PNO A;  1AWO A;  2VAS A;  4OGC A;  1NPR A;  4J7I A;  3CCR T;  1S1N A;  4Z89 A;  4A4E A;  1N9R A;  3OYH A;  1BI0 A;  3HTR A;  2LQK A;  3QJY A;  3G71 T;  1W1F A;  2DET A;  1ABQ A;  4N4G A;  3UPU A;  2KNB B;  2DJZ A;  1AZE A;  1TUG B;  2I0N A;  4Y28 E;  2DPP B;  2DTI A;  2FYK A;  4FW2 A;  2F2X A;  1M3C A;  1YJW T;  4KUL A;  2GTO A;  2ZAE A;  1KK7 A;  1Q82 U;  1QMC A;  1M3A A;  1D1C A;  1YNZ A;  4J9E A;  2VYT A;  1VQ8 Q;  4HCC A;  1OZ2 A;  2V8K A;  3P8D A;  1QCN A;  4JS5 A;  2XDB A;  5GAN d;  2RB6 A;  2G3R A;  1XOV A;  1Y7X A;  4RUG A;  4L5G A;  4E7J A;  1Q82 R;  4X34 A;  3PFS A;  5D6X A;  2QQS A;  1AEY A;  2PVD B;  1QKW A;  1WHL A;  5FRN A;  2KXC A;  5M9O A;  2KMT A;  2L3Q A;  4CC4 B;  2EYQ A;  2XKO C;  1XTD A;  1VQM A;  4FYV B;  3WXM B;  1LCK A;  2OTJ Q;  2CP5 A;  2DNU A;  2X4X A;  4PJJ A;  3H0F A;  5IHN A;  1TUD A;  1UG1 A;  1SPK A;  4ORZ A;  3CCQ A;  1QW1 A;  1NJI R;  2I2L A;  4M78 F;  2QTV A;  2HSE B;  1OZ3 A;  2LNV A;  1E6G A;  1FYN A;  2YUQ A;  2WAC A;  2A0F B;  3ZBD A;  2F5T X;  4J7F A;  4HVU A;  2DTH A;  2RQT A;  2EKH A;  1U5S A;  4E7Z A;  5CKF A;  2KI7 A;  4E6R A;  2QG9 B;  2CP2 A;  3QPH A;  4DA4 A;  1VQN Q;  1H8K A;  2IVW A;  3CC2 Q;  5GAO n;  4M75 D;  3E9F A;  3L42 A;  1WHG A;  3OYL A;  2DD4 A;  2CH4 A;  1K4U S;  1PSE A;  3R6O A;  3V8L A;  3OA6 A;  4JRI A;  1N5Z A;  1MHN A;  3UDC A;  4C0Z A;  2VWF A;  3FIF A;  2GF7 A;  3PMI A;  1OEB A;  4LUD A;  5KE2 A;  5GJV B;  1LOJ A;  3UA6 A;  5FLX E;  5CIU A;  4MMK A;  3EG9 B;  4VUB A;  3H0I A;  2YWW A;  2XHC A;  3SEM A;  5LJ3 h;  5CQX A;  3KXT A;  2DFU A;  2RA2 A;  4ZNX A;  1V29 B;  4D8D A;  2QTX A;  1P92 A;  1VQ8 T;  3BW1 A;  3G4S Q;  2R5M A;  4J6Y A;  2ZPI B;  3RKX A;  4KGZ B;  2JS0 A;  4M78 C;  3EGX B;  4M7A D;  3EG1 A;  4A54 A;  1ZA1 B;  5GAN h;  4F17 A;  2F2W A;  2JMC A;  5GAN 5;  2EGE A;  1KC8 C;  4A63 B;  2QA4 Q;  1UJY A;  2OTJ T;  4C92 F;  3QWX X;  4ME7 A;  4YTL A;  2QDY B;  2MWO A;  2RJC A;  1TXQ A;  2KR3 A;  2CRE A;  1AOJ A;  1K76 A;  1T3S A;  2BZ8 A;  3OYM A;  2VV5 A;  5I22 A;  2ESW A;  4JRP A;  4BY6 B;  3MEV A;  4M78 E;  3ZL7 C;  2KEA A;  1RAD B;  4OMM A;  4OP0 A;  3NTI A;  5GAN e;  2O01 E;  1ZBJ A;  4CI0 C;  2LT1 A;  2J06 A;  5L8R E;  4M78 A;  4QVC A;  4L59 A;  1UUE A;  1T0J A;  3E9G A;  4Y91 A;  5IH2 A;  3CME A;  3CCE A;  1TWB A;  4KBM B;  2FRW A;  2EJF A;  1SF9 A;  2RI2 A;  1VQN T;  3CC2 T;  1PM3 A;  1D1B A;  4KH0 B;  3CD6 A;  4OF1 A;  2RO0 A;  4EPC A;  3V7S A;  1M90 C;  3H41 A;  2KRN A;  2LZ6 B;  3JAM E;  4ZGJ B;  2DIG A;  2DYI A;  2DJQ A;  4F7U A;  3QG1 A;  1ZUK A;  1ZSZ C;  5ECA A;  3OS2 A;  4MML A;  1X27 A;  1JBM A;  5LJ3 j;  2NUZ A;  1WFW A;  1TS9 A;  2X51 A;  2B86 A;  3RKY A;  3FDR A;  1MND A;  1OU8 A;  2F5K A;  1X75 C;  2D1X A;  5CK9 A;  3CCJ T;  4QVZ A;  4PJO B;  3OMC A;  3VS7 A;  4BD3 A;  2DRM A;  1C6V X;  4C92 C;  4F7U G;  2MK5 A;  1JJ2 P;  2BZY A;  2XG8 D;  2O4X B;  1AT1 B;  3G4S T;  4RTU A;  2DLP A;  2DAQ A;  2O9V A;  1W2B S;  1SRL A;  3OS5 A;  4RTZ A;  2DEQ A;  3N5B B;  2DZC A;  1NM7 A;  2RNA A;  1WQW A;  3Q1J A;  3QHS A;  1ZUU A;  1SSH A;  2EJG A;  5GAN j;  5DY9 A;  1ZSZ A;  1OQK A;  5HKC A;  2Y4Y A;  1CKA A;  4M77 B;  2QA4 T;  4J9I A;  1S72 Q;  2ZPH B;  3C0C A;  4C92 E;  4HA8 A;  2KRS A;  3A5Z B;  2L3P A;  4Y92 A;  1KFZ A;  5KYX A;  2M51 A;  4RTY A;  1K9M R;  3PGG A;  1KHC A;  1QVG P;  1M4Z A;  3ASK A;  3CXC P;  1YIJ Q;  1RUW A;  2VB6 A;  1M9S A;  2ZPF B;  2IG0 A;  3FEO A;  2CP7 A;  3JCM V;  5HY6 A;  3M4G A;  3PIP A;  2QEX Q;  1N8R R;  3BE3 A;  3NTK A;  2W10 A;  2JN0 A;  2YXY A;  1QCF A;  4QKU A;  1WYX A;  1JO8 A;  1M2V A;  1XJW B;  4ELZ C;  1RL2 A;  4N4H A;  5KH6 A;  4BI8 B;  1I5L A;  3X24 B;  1QQJ A;  2KT8 A;  4C0D B;  4M75 G;  1VQ7 Q;  3DLM A;  4LXC A;  4ZGE B;  1WXT A;  1Y57 A;  3CBO A;  3UF4 A;  2FZC B;  1Q86 U;  3AT1 B;  1AZG B;  3OYG A;  4E7S A;  3JCM g;  3S3N A;  4IKF A;  4QVD A;  1KQS P;  4EMK B;  2DZ9 A;  1R77 A;  1B34 A;  1IHW A;  1VQ4 Q;  2H3J A;  3CCU Q;  3LW5 E;  2IIM A;  4LD9 K;  2EVR A;  3M55 A;  1R0C B;  1SKU B;  2NUP A;  3FLG A;  1YIJ A;  1ZBX A;  3RR6 A;  4RTX A;  3CC4 Q;  2D0N A;  2CZ7 B;  2VKN A;  2O2O A;  3QYH B;  2X4W A;  4C8Q F;  2EYW A;  1TH7 A;  4LDX A;  3FC3 A;  3S6W A;  1OX9 A;  3TEE A;  3CBM A;  2RQR A;  4J9F A;  2FB7 A;  1BBZ A;  1Q81 R;  3CPW P;  2AZV A;  3BY7 A;  2DYB A;  2RHX A;  4DBQ A;  1HK9 A;  4DBR A;  3I55 Q;  2BE9 B;  3MEA A;  1YHQ A;  5A2Q E;  1SSF A;  2CP0 A;  2DL8 A;  1ABO A;  3JRZ A;  3JB9 G;  2FRY A;  2EGA A;  2H3E B;  2Z0W A;  2A36 A;  1S72 T;  3A8O B;  4E47 A;  1QVF P;  4LE9 A;  2EBP A;  3SD4 A;  3SWN B;  3X25 B;  1VYT A;  1VQ7 A;  5GAM h;  3P8B B;  2DER A;  1LNX A;  4JRQ A;  1OX8 A;  3MEU A;  2CGH A;  2EQM A;  2P4R A;  2P0P A;  1YIJ T;  2J6O A;  3VS3 A;  3VYG A;  3DB4 A;  1IXD A;  2JTE A;  2QAS A;  1ZA2 B;  4JUV A;  1Q95 G;  1D1A A;  2RMO A;  1UGP B;  1WPY A;  1ZHI A;  4JRK A;  5CAI A;  2LJ0 A;  2KDS A;  2DBM A;  3OQ5 A;  1O9S A;  2E1H A;  2QEX T;  1UEB A;  1VQ4 A;  1U1T A;  2EYZ A;  1RLP C;  3JB9 I;  1W6X A;  1W2B A;  2LCS A;  1I1J A;  3CC4 A;  2GFU A;  1IB8 A;  4A53 A;  3X20 B;  4FYX B;  9ATC B;  2RQW A;  3HFN A;  1G5V A;  2K5L A;  5GAO r;  5HCK A;  1JB0 E;  2L3S A;  1VQ7 T;  3F70 A;  5FU6 B;  3E19 A;  4JLI A;  3VUZ A;  3IQL A;  5J39 A;  1VQ5 Q;  5FU7 B;  1H3Z A;  4J6X A;  3CCR A;  2RH2 A;  4JPB W;  2PNI A;  4X1V A;  1AD5 A;  1X69 A;  2CT4 A;  4M75 B;  5LJ5 d;  4QQ6 A;  4RTV A;  1Z9Q A;  3C4S A;  3INZ A;  3RKW A;  3G71 A;  2OI3 A;  5LJ3 f;  1VQ4 T;  3JB9 H;  4J83 A;  2P0Q A;  2CSI A;  1MV3 A;  4PKC C;  4RG2 A;  2C0T A;  1KD1 U;  2EPD A;  3CCU T;  1K73 U;  2XDP A;  3JSC A;  2K2M A;  2QGG A;  3L2U A;  1M8M A;  3I56 Q;  3CC4 T;  1OI1 A;  4ZN1 A;  2GCX A;  1YJW A;  3MJX A;  4OMQ A;  4HT8 A;  3H0H A;  2XID A;  2NUT A;  2DA9 A;  1M1K C;  1YN8 A;  1UB4 A;  4C8Q A;  2KQW A;  4M78 D;  1QWF A;  3I55 T;  1BU1 A;  1WGS A;  4BE1 A;  5GAN f;  4RKU E;  1I0C A;  1VYV A;  1NYF A;  3MHX A;  1K0X A;  3A98 A;  1YI2 Q;  4QW2 A;  4XU0 A;  4Q5W A;  4PJO F;  4GY5 A;  2RJF A;  1VQK Q;  3M57 A;  4C8Q G;  4LD6 A;  2L0A A;  2LP5 A;  4XQ3 A;  3JCM c;  1X2Q A;  2LJ1 A;  5LJ3 d;  2C06 A;  2E4H A;  2VC8 A;  4M7D F;  1LVK A;  1I07 A;  2M0O A;  4M7A B;  3ULR B;  4RTT A;  2M16 A;  2XI9 A;  3O5Z A;  2E64 A;  3LH5 A;  1SHF A;  4OMN A;  4BY6 C;  1KSW A;  1M2O A;  2QQ9 A;  3VV0 A;  3MP6 A;  4FT2 A;  5CKD A;  2A28 A;  1B7T A;  2MOX A;  5KYU B;  3I5S A;  3AHU A;  4M77 F;  3WVD B;  2L3R A;  1IZ6 A;  3OW2 P;  3QSU A;  2K3Y A;  1TG0 A;  1NEB A;  4BDY A;  1SEM A;  1GL5 A;  2K5F A;  3P8H A;  3DLL A;  1WJQ A;  1MMN A;  3REB B;  3FJ5 A;  1BYM A;  3X26 B;  1E6H A;  3CCM Q;  1CKB A;  5AYF A;  3VRY A;  1ACM B;  1DJ7 B;  4JDS A;  1NJI U;  3QKJ A;  3T9N A;  3CCS Q;  1VQ5 T;  2K57 A;  1G3S A;  1T0H A;  3CQT A;  1OPL A;  2CYZ B;  2K2V A;  3EH1 A;  1IGQ A;  5J26 A;  4KUD K;  4FU6 A;  1VQP Q;  1QP2 A;  4HT9 A;  2KK4 A;  1X6O A;  3TU4 K;  1V1C A;  3JCM W;  2E6Z A;  1WHH A;  2BTT A;  3SFM A;  2OAU A;  3EGD B;  5LJ5 h;  1PWT A;  2YHT A;  4HCK A;  5KYY A;  2CUB A;  4PJO C;  3I56 T;  3VS2 A;  4BE0 A;  2AT1 B;  2FHD A;  1E7O A;  4J9C A;  4M7D C;  2OAW A;  3CPF A;  4AFS C;  5CCA A;  2KGT A;  5KE3 A;  1PHT A;  3EHQ A;  1K0S A;  1C1A A;  2PVO B;  1VQ8 A;  5CQY A;  4PL6 A;  4XTV A;  2NLU A;  1NBE B;  2KXD A;  2PVG B;  4XTU A;  2HL5 C;  5LL6 S;  4NS5 A;  3BDU A;  1YI2 T;  4M77 C;  5LJ5 e;  1X01 A;  4PJO E;  4XTZ A;  1VQK T;  3CC7 Q;  4M7D E;  4BAC A;  4PJO A;  5DLQ E;  5CKH A;  2DXB A;  2OTJ A;  2KVQ G;  2HZY A;  4FM4 B;  3VKI A;  4M7D A;  3M59 A;  1G3Y A;  2AKL A;  2SRC A;  4WCI A;  3HRU A;  2YUO A;  1C0M A;  3H9N A;  2R5A A;  4MZT A;  3CCJ Q;  2M9U A;  2HSP A;  4M77 E;  1YWO A;  3OYF A;  5A0L A;  2JM9 A;  2EFI A;  2J05 A;  3M58 A;  4M77 A;  3BFM A;  2J6K A;  1YBY A;  4UC4 A;  1JJ2 S;  3JB9 D;  3A8H B;  2DTO A;  3KFV A;  1KJW A;  2DVJ A;  1AHJ B;  3OYB A;  2FPD A;  1I8F A;  1WHK A;  3CCM T;  5LJ3 e;  2M1H A;  4C0D C;  3OY9 A;  1Q7Y C;  3L2V A;  1WNL A;  1PD1 A;  3MO8 A;  1Q86 C;  2X9H A;  3M9Q A;  1VQN A;  4IUQ A;  2DK3 A;  3CC2 A;  4C0F A;  1PC0 A;  3CCS T;  4JZ3 A;  3L2W A;  2OX7 A;  3EG2 A;  1VQO Q;  1PKS A;  2DO3 A;  1YJ9 Q;  1AWW A;  4OVA A;  2JTM A;  1PD0 A;  2MMP A;  3CC7 A;  1VQP T;  1K8A C;  2FL7 A;  1RAF B;  3MP8 A;  1Y96 A;  2DVE A;  3URG A;  5LJ5 j;  2A08 A;  2G6F X;  1QVG S;  3HKS A;  2K3B A;  4OB3 B;  3CXC S;  1M1K R;  2F69 A;  2Y4X A;  4J9H A;  2AZS A;  2NYS A;  1VQ9 Q;  3CCJ A;  2HL3 A;  2K9G A;  1UDL A;  3VYH B;  3G4S A;  2D8H A;  4WF2 A;  4HVV A;  2JM8 A;  5IHK A;  1OUL A;  1EIF A;  2RHI A;  3JCM X;  3EHR A;  4M78 G;  3M56 A;  4E7H A;  4XU1 A;  1OYX A;  1YJN Q;  4XTY A;  1VQ6 Q;  2QXF A;  2RN8 A;  1M3B A;  1NE8 A;  2DE0 X;  3CC7 T;  5J3B A;  2WSC E;  2R58 A;  4FSX A;  5CKB A;  3SWN C;  5KYW A;  3UT1 A;  5GAM f;  2D9T A;  2RPN A;  4C5I A;  2QA4 A;  1YIT Q;  2SEM A;  5FWB A;  4A4K A;  4XAX B;  1B3Q A;  1A0N B;  4RCB A;  4EMH A;  4GLM A;  2DF6 A;  1PCX A;  2ED0 A;  3NMZ C;  4MZM A;  4DOW A;  1M5Q 1;  2X3X D;  2L2P A;  2KSS A;  3GOX A;  1KQS S;  3EFO A;  2F2V A;  2EWN A;  2CZ0 B;  3S3O A;  4HKE A;  2LDM A;  2OTL Q;  2LMJ A;  4X9C A;  3RBB B;  1BI2 A;  3FJP A;  4KRT A;  2V8J A;  1RAH B;  1U06 A;  2HMA A;  3V7R A;  1BKB A;  4KGX B;  2DXU A;  4ZN3 A;  2COZ A;  3VS5 A;  2AHJ B;  3LLR A;  2CDT A;  5FRM A;  1K9M U;  4NL3 A;  2KE9 A;  3OYC A;  1SHG A;  2EQI A;  4R56 A;  3VS0 A;  3EFR A;  3CPW S;  1G8X A;  4C8Q D;  2FPF A;  5GAM d;  5FU6 C;  5DM7 R;  2KRO A;  3TRE A;  2E3H A;  2MAM A;  3QXE B;  5FU7 C;  4DOV A;  2D6F A;  2EAY A;  2F1L A;  1VQO T;  2DEU A;  3PNW C;  1N8R U;  1YJ9 T;  1G3T A;  2XIC A;  3LYI A;  4C92 A;  1FX7 A;  1KD1 C;  2RJE A;  4F14 A;  2ZZD A;  1IO6 A;  1D3B A;  1FMW A;  1QVF S;  5FW9 A;  2JOY A;  1JQQ A;  1TTH B;  3PMT A;  2ROT A;  2V26 A;  3BDL A;  5GMK h;  1RAC B;  2O31 A;  2DXC A;  3PVQ A;  1AVZ C;  4RCC A;  2HKQ B;  4C92 G;  1VQ9 T;  2HBP A;  1PRL C;  4PFP A;  1U3O A;  2QQA A;  4AT1 B;  4FYW B;  4MDW A;  1VQL Q;  2ZCF B;  4LDW A;  2Y90 A;  1T3L A;  2QQR A;  2V8I A;  1JJ2 A;  1LPL A;  2YRV A;  2LC4 A;  3OS1 A;  1JXO A;  5I11 A;  5GAN 4;  3QZ5 B;  5A0G A;  1OPK A;  1WDX A;  2COW A;  3G6E Q;  3EGU A;  2HNI A;  1GFC A;  2ZPB B;  1VIE A;  3M0U A;  1YJN T;  2MI6 A;  2GBQ A;  1VQ6 T;  3OYD A;  2B8A A;  3QBY A;  5GMK e;  3L1A A;  1EFN A;  1YCS B;  2JW4 A;  3CBP A;  4M78 B;  2J7I A;  4L6V 5;  3D7S B;  4M7A C;  1YIT T;  2CP3 A;  3A1P A;  1S72 A;  1BI1 A;  3HHT B;  1Q82 C;  1Q81 U;  2EKO A;  3CCL T;  2FEI A;  3DB3 A;  1ZUY A;  3J80 E;  4XU2 A;  1UHC A;  3WVE B;  1KC8 U;  3OMG A;  1QVG A;  1OOT A;  1OV3 A;  3C95 A;  4N4I A;  2FZG B;  2V1R A;  2MF2 A;  3CXC A;  1QKX A;  1M1F A;  1GBQ A;  2ENM A;  2BKD N;  2KYB A;  2OTL T;  4DBH A;  3CCV Q;  2O9S A;  3MET A;  3VS4 A;  2K79 A;  2QEX A;  4HCZ A;  3OBY A;  1RI9 A;  1Q7Y R;  2E12 A;  4M7A E;  1JU5 C;  8AT1 B;  4F7U B;  1N9S A;  1KC8 R;  2CZ6 B;  4BDZ A;  4KH1 B;  4ANJ A;  2HQX A;  1R0B G;  2BUD A;  2P4T A;  5GAO q;  1MMD A;  4HCB A;  2X3W D;  1X6G A;  1UGQ B;  3GBQ A;  3UA7 A;  1LJO A;  1K8A R;  5D6Y A;  2E5K A;  3MEW A;  5KYU A;  4JJC A;  2CKK A;  3X28 B;  2P84 A;  3M0R A;  2FPE A;  3LX7 A;  5KCO A;  3LGF A;  5LJ5 f;  1W70 A;  4XTW A;  4PJO D;  4MDX A;  5L23 A;  3GNF B;  5GMK j;  1WI7 A;  3OYJ A;  1KQS A;  2A7Y A;  2O88 A;  3RNJ A;  3JV3 A;  1RAB B;  1NLO C;  4M7D D;  1VA7 A;  3CCU A;  4PFZ A;  2JVV A;  4BB7 A;  3JCM P;  4PLL A;  3JCM Q;  4NL2 A;  1VQL T;  4OB2 B;  4ZTJ A;  3RMS A;  1M90 R;  5GAM e;  3OW2 S;  1BB9 A;  2YUN A;  5KYX B;  2M02 A;  2EW3 A;  2LRQ A;  1ZSG A;  2R57 A;  4B9X A;  3CPW A;  1Y07 A;  3G6E T;  8ATC B;  3LGL A;  3I55 A;  4AG1 C;  5EC7 A;  1K1Z A;  2GGR A;  1UGS B;  2CZ1 B;  1WHM A;  3HL8 A;  3GP8 A;  3J7A F;  1ZLM A;  4AFZ C;  3OYA A;  2L8D A;  4B6M A;  2FZK B;  1G83 A;  2VUB A;  2XD0 A;  2WSE E;  1QVF A;  3MKD A;  1G3W A;  2YLC A;  4E7K A;  2VVK A;  3QJ6 A;  4ELY C;  2GQI A;  1UFF A;  2PZ1 A;  3DKM A;  3RES A;  2H8H A;  3I5R A;  2ECZ A;  3CCV T;  1PNJ A;  2DL3 A;  4HXJ A;  4LDU A;  3O8V A;  1X6B A;  4V2S A;  4QT7 A;  2CP6 A;  1QCO A;  2K7A A;  5GJW B;  2RI3 A;  1CSK A;  5KCH A;  2BIV A;  4C5G A;  2AKK A;  1XNI A;  2K4Y A;  2KBT A;  3EG9 A;  5D7U A;  4Z02 A;  1B34 B;  3CEY A;  1ZX6 A;  4II1 A;  2AK5 A;  2YLB A;  2PQW A;  1WQ7 A;  3A8G B;  1TOV A;  3TSW A;  5CR2 A;  3M0S A;  1K9A A;  2YSQ A;  2IPO B;  2V1Q A;  5GAM j;  1VQM Q;  1AWX A;  3OYN A;  3RDV A;  5KYN A;  2M0Y A;  2HEQ A;  1VQ5 A;  3M0T A;  1WJS A;  4CC7 A;  3SB2 A;  1H92 A;  2EGC A;  2GTJ A;  3J81 E;  3CCQ Q;  1J3T A;  2LCC A;  3M0Q A;  5IXB A;  1UEC A;  4J9D A;  3EGX A;  1NZ9 A;  2QK0 A;  4IUT A;  3L2Q A;  1I4K 1;  1JEG A;  1NLP C;  4J9G A;  2C0O A;  3VS6 A;  1KIK A;  4DQ2 A;  3I56 A;  2GFA A;  2HQE A;  1I81 A;  4MZP A;  1JXM A;  1TUC A;  1KG1 A;  3QDF A;  1M8V A;  1UGV A;  1HXD A;  2JUF A;  1MMG A;  1ZQ1 A;  4BE2 A;  1GCP A;  4BI4 A;  1FWZ A;  3KBG A;  4JJN K;  3SHW A;  4J9B A;  1PKT A;  4LDY A;  1XQH A;  2FO0 A;  3VUB A;  1UHF A;  4F16 A;  2PTK A;  1BIB A;  2HAX A;  1KQ2 A;  3KUF A;  1YI2 A;  3OYE A;  3LWH A;  2WSF E;  5CKE A;  1D09 B;  1VQK A;  2VGM A;  1UTI A;  2RI5 A;  3QUI A;  2JXB A;  3UWN A;  2AIR B;  4PLI A;  1UJ0 A;  4ESR A;  3MPU B;  3QO3 A;  2K6D A;  4P5N A;  3MP1 A;  3RER A;  4C92 D;  3THK A;  4Z8A A;  2EQJ A;  3QYG B;  2E41 A;  5IN1 A;  5GAO m;  2MPX C;  2YDL A;  4QQD A;  4IUR A;  1K9M C;  2LJ3 A;  1WX6 A;  4OMP A;  1RI0 A;  2GNC A;  1BK2 A;  3OW2 A;  2DMO A;  3GLX A;  1SRM A;  1GFD A;  5GMK i;  4OML A;  1WZO A;  4E7I A;  1D0Y A;  2JT4 A;  1BCO A;  4AG2 C;  1FXX A;  1NYG A;  4LN2 A;  1N8R C;  4DEY A;  5I2S A;  2HBW A;  3CCM A;  5LJ5 g;  1TU0 B;  2K5I A;  1VQM T;  2DIQ A;  4BUG A;  1BIA A;  4J5Y A;  4OB0 B;  2O4X A;  3EG0 A;  3CCS A;  5DLO A;  2NUT B;  4C8Q B;  4F7U F;  3E1S A;  3VS1 A;  1G2B A;  1V76 A;  2EYY A;  1RAI B;  2VXE A;  2DL4 A;  3CCQ T;  4CC2 A;  1NPP A;  4C5E A;  1VQP A;  3ZEH A;  5GAO p;  3HRS A;  2COY A;  1R8O B;  3QWY A;  4PJO G;  1BCM A;  3EG3 A;  4R55 A;  2KRM A;  1FMK A;  4NOY A;  3CME Q;  2CUD A;  1N6A A;  4M7D G;  1IGU A;  3CCE Q;  2RK2 A;  3C12 A;  4FW1 A;  5C0M A;  2EJ9 A;  2EYX A;  3NGP A;  3MCA B;  3JCM f;  1TSF A;  4EMG A;  3GPL A;  3TSZ A;  4C5H A;  3CD6 Q;  1M1G A;  4JS4 A;  4FCY A;  5LJ3 g;  1MNE A;  2PU9 B;  2BZX A;  2E65 A;  1YWP A;  1AWJ A;  1WA7 A;  4M77 G;  1WXB A;  1QLY A;  4AFU C;  5IT9 E;  2RD1 A;  3VRZ A;  1M1K U;  1B07 A;  1Q81 C;  3H8Z A;  2GQV A;  1RAA B;  4BI3 A;  3LWI A;  4EMK C;  4IIM A;  2ZGW A;  2JMA A;  3CMA Q;  4FSS A;  3A8L B;  1X43 A;  3M4Y A;  2RQU A;  5GAN 7;  4CC3 A;  6AT1 B;  3I35 A;  1RLQ C;  2YT6 A;  1WXU A;  2C0I A;  4B9W A;  1IRX A;  5GAN g;  2RHY A;  5GMK l;  3UAT A;  3OSV A;  7AT1 B;  2ATC B;  5IXF A;  3NPF A;  3G7Z A;  2E70 A;  1SG5 A;  2L5Q A;  1BI3 A;  3JCM d;  2CH4 W;  4A4G A;  3S3M A;  3M0P A;  4M75 F;  5AT1 B;  3ER0 A;  1QWE A;  4IUV A;  1GXI E;  4PJL A;  3OYI A;  1N27 A;  4KGV B;  4J8O A;  3QDR B;  4EMK A;  1GRI A;  2E10 A;  4X9D A;  4GLK A;  4A4F A;  4TVR A;  2L89 A;  2KYM A;  4C0G A;  5GAN 6;  2XK0 A;  2KAF A;  2DD5 A;  5KYY B;  2E3I A;  1KHI A;  4OGE A;  1HSQ A;  4ATO A;  1NEG A;  5FRO A;  4F7U E;  3EH2 A;  1VQO A;  4A4H A;  3CCL Q;  2HDA A;  1YJ9 A;  1W4S A;  5CVI A;  3FRN A;  4JLG A;  5HK3 A;  4FT4 A;  3CMA A;  2RM4 A;  2LT4 A;  2LTO A;  2X4J A;  4DEX A;  2XDD A;  2DBK A;  1PRM C;  2ABL A;  5FWC A;  4HVW A;  5I21 A;  3CME T;  3R6N A;  4E7L A;  1WIE A;  3CCE T;  5GAN 3;  1MGQ A;  3JB9 F;  4M7A F;  3ME9 A;  3JCM b;  4AMC A;  4FL6 A;  1VQ9 A;  2CS7 A;  3SWN A;  3VJP A;  4DBF A;  4D8K A;  4OMF B;  3OYY A;  4M4Z A;  4PJN A;  1YFN A;  1FMV A;  2DL7 A;  4GBQ A;  3CD6 T;  4M7D B;  2CSQ A;  4JJD A;  1RAG B;  2NWM A;  1MV0 B;  1O75 A;  3OYK A;  4FYY B;  2FG0 A;  1QVP A;  2X35 A;  2K3X A;  1YJN A;  4OB1 B;  2DKG A;  2FVU A;  4M75 C;  4Z88 A;  4D6W A;  1VQ6 A;  4RMO A;  1K73 C;  3VU3 C;  3GF5 A;  2W0Z A;  1HJD A;  3CMA T;  3OS0 A;  3SDZ A;  1I5O B;  5A0D A;  3FB9 A;  1YIT A;  3QII A;  1JRI A;  4JZ4 A;  2A37 A;  4XU3 A;  1YP5 A;  3L2Z A;  3CCL A;  4LUE A;  2DM1 A;  4RTW A;  2J6F A;  1H3H A;  4O5V A;  3JB9 J;  2MWP A;  3ZFJ A;  2ED1 A;  2QI2 A;  2LX9 A;  4M75 E;  3OB9 A;  2OTL A;  2DIL A;  1MUZ A;  2LVM A;  2QGF B;  2JS2 A;  2KT1 A;  3JCM h;  3HSB A;  1Y71 A;  4M75 A;  4FIB A;  5I2M A;  4RG8 A;  1YHQ Q;  4PJM A;  1Y96 B;  3NHN A;  1GCQ C;  3NTH A;  1HYO A;  4XTX A;  2QDL A;  2YRD A;  2DL5 A;  1MMA A;  1OU9 A;  2YRC A;  4E2F B;  4EDU A;  4EIK A;  2LCL A;  3TVT A;  4WTO B;  1Q7Y U;  2OJ2 A;  3JCM e;  4AFQ C;  1VYU A;  2MIO A;  3V7C A;  3V8J A;  2DXT A;  3M5A A;  1UE9 A;  3E2U A;  1X2K A;  3EFS A;  2ZPE B;  3L2R A;  1D0X A;  4ZGD B;  2HCK A;  5IHI A;  1U1S A;  4QQG A;  4KUI A;  1GCQ A;  1W2B P;  2LQ8 A;  1Q86 R;  1K8A U;  3H6Z A;  5KYW B;  3RIR A;  2QAZ A;  3U23 A;  2KY9 A;  1ARK A;  3HFO A;  1NJI C;  4M7A A;  3GIB A;  1HD3 A;  1VQL A;  5CO7 A;  3PTA A;  1EZZ B;  1YCY A;  4IUP A;  3G1J A;  2DRK A;  5GMK m;  3A8M B;  1GBR A;  4KT0 E;  3EFO B;  3G6E A;  2RHU A;  3I9Q A;  2LQN A;  2PUK B;  4O6J A;  5GAO l;  2RHZ A;  1WHJ A;  1UGR B;  3GNG A;  3CCR Q;  2P0K A;  4M7A G;  3M54 A;  2RQV A;  1PG5 B;  2RK1 A;  3EAE A;  1VOM A;  3PVL A;  1KQ1 A;  3NFC A;  1QP3 A;  1M90 U;  2D8J A;  3G71 Q;  1ZSZ B;  2JZ2 A;  1NG2 A;  1F1B B;  4F04 B;  2DX1 A;  1IHV A;  4IUU A;  4XK8 E;  2ROL A;  4JJB A;  1Y0M A;  3JCM J;  2RJD A;  1YJW Q;  4LNP A;  1PSF A;  1D0Z A;  2EQK A;  1RAE B;  3HP9 A;  3LH0 A;  2VGN A;  5HK0 A;  3CCV A;  2QYZ A;  4J6W A;  5GAM g;  4C92 B;  4LDV A;  2HKN A;  2QQB A;  3OBW A;  4M77 D;  2ZPG B;  4CRI A;  1YHQ T;  1D3B B;  2JNG A;  2YUP A;  1H64 1;  3V8K A; 
#chains in the Genus database with same CATH homology
 2JN0 A;  1VQK A;  2VGM A;  3RUX A;  2RI5 A;  1QVG S;  3HKS A;  3QUI A;  4ZTF A;  4OB3 B;  5GAN 8;  3CXC S;  1VIF A;  3UWN A;  2F69 A;  4N0A C;  4PLI A;  3TCJ A;  2VXF A;  2Y4X A;  3QO3 A;  4ELZ C;  5D6W A;  2A3L A;  4P5N A;  3MP1 A;  3RER A;  1RL2 A;  4C92 D;  4N4H A;  3CCJ A;  4C8Q C;  5KH6 A;  4BI8 B;  1I5L A;  3X24 B;  2EQJ A;  3QYG B;  2D0Q B;  4C0D B;  3PIO A;  1VUB A;  4M75 G;  3VYH B;  2E41 A;  3G4S A;  5IN1 A;  5GAO m;  3DLM A;  4WF2 A;  4ZGE B;  3JCM X;  1EIF A;  2RHI A;  4QQD A;  4M78 G;  4IUR A;  3CBO A;  1K9M C;  3M53 A;  3M56 A;  1Q86 U;  1RI0 A;  4XU1 A;  1IRE B;  4E7H A;  2JTF A;  1OYX A;  3OW2 A;  4XTY A;  5GAN 2;  3OYG A;  3RMQ A;  2QXF A;  5EG2 A;  3JCM g;  1NE8 A;  2X4Y A;  3GLX A;  5IAY A;  3S3N A;  5GMK i;  4QVD A;  4IKF A;  2E5Q A;  3CC7 T;  5J3B A;  4E7I A;  4EMK B;  2PUO B;  2EIF A;  2WSC E;  2DZ9 A;  2R58 A;  3HPW A;  1B34 A;  4FSX A;  5CKB A;  3SWN C;  3UT1 A;  5GAM f;  1FXX A;  2D9T A;  2H3J A;  4C5I A;  3HRT A;  1N8R C;  4C8Q E;  2QA4 A;  3LW5 E;  2E6N A;  4LD9 K;  2XU8 A;  4N0A A;  5I2S A;  3CCM A;  4A4K A;  3QZ9 B;  3M55 A;  4XAX B;  5LJ5 g;  1WJR A;  3OSS C;  4RCB A;  3PT9 A;  4EMH A;  2K5I A;  3FLG A;  1YIJ A;  1ZBX A;  2DIQ A;  1VQM T;  1U8R A;  2CZ7 B;  2EQU A;  3QYH B;  4BUG A;  1BIA A;  2X4W A;  4C8Q F;  4J5Y A;  4OB0 B;  2O4X A;  1TH7 A;  4MZM A;  3CCS A;  4DOW A;  1M5Q 1;  5C6S A;  3FC3 A;  4LDX A;  3S6W A;  2KSS A;  3C94 A;  3TEE A;  3GOX A;  3CBM A;  5DLO A;  1KQS S;  2FB7 A;  4C8Q B;  4F7U F;  2EWN A;  2CZ0 B;  2HD0 A;  4PNO A;  3E1S A;  3S3O A;  4HKE A;  2LDM A;  4OGC A;  1NPR A;  2VXE A;  3BY7 A;  4J7I A;  4X9C A;  3CCR T;  3CCQ T;  1BI2 A;  1NPP A;  2RHX A;  3FJP A;  2V8J A;  1HK9 A;  4C5E A;  1VQP A;  3ZEH A;  5GAO p;  3MEA A;  3HRS A;  4A4E A;  1YHQ A;  3V7R A;  1N9R A;  1BKB A;  5A2Q E;  3OYH A;  1R8O B;  1SSF A;  2DXU A;  4PJO G;  1BI0 A;  3JRZ A;  4R55 A;  2LQK A;  3QJY A;  3G71 T;  3JB9 G;  4ZN3 A;  4NOY A;  2AHJ B;  3LLR A;  1N6A A;  5FRM A;  4M7D G;  4N4G A;  1K9M U;  4NL3 A;  2RK2 A;  1S72 T;  3C12 A;  3UPU A;  3OYC A;  2DJZ A;  4R56 A;  3CPW S;  3A8O B;  3EFR A;  4E47 A;  4C8Q D;  3SD4 A;  5C0M A;  2EJ9 A;  4Y28 E;  5FU6 C;  2DPP B;  3SWN B;  5DM7 R;  3X25 B;  5GAM d;  3MCA B;  3JCM f;  1VQ7 A;  2DTI A;  3P8B B;  2FYK A;  5GAM h;  1LNX A;  4JRQ A;  1YJW T;  3TRE A;  4KUL A;  3QXE B;  2MAM A;  3MEU A;  5FU7 C;  1Q82 U;  2CGH A;  2EQM A;  4DOV A;  2P0P A;  2EAY A;  4C5H A;  4EMG A;  3GPL A;  1YIJ T;  2D6F A;  1VQO T;  1M1G A;  4JS4 A;  3VYG A;  3PNW C;  5LJ3 g;  1N8R U;  1YJ9 T;  1G3T A;  2XIC A;  2PU9 B;  2VYT A;  3DB4 A;  3LYI A;  4HCC A;  1OZ2 A;  2E65 A;  4C92 A;  1FX7 A;  2V8K A;  4JUV A;  4M77 G;  1KD1 C;  2RJE A;  1UGP B;  1WPY A;  1ZHI A;  3P8D A;  2ZZD A;  4JRK A;  5CAI A;  4JS5 A;  2RD1 A;  5IT9 E;  2KDS A;  2XDB A;  1D3B A;  3OQ5 A;  5GAN d;  1O9S A;  2E1H A;  2QEX T;  1M1K U;  1QVF S;  1UEB A;  2RB6 A;  1VQ4 A;  2G3R A;  1U1T A;  1Q81 C;  3H8Z A;  1XOV A;  1Y7X A;  2GQV A;  4BI3 A;  3JB9 I;  2JOY A;  4L5G A;  4EMK C;  3LWI A;  4E7J A;  4X34 A;  1VQ4 T;  2ZGW A;  3PFS A;  3A8L B;  3PMT A;  3M4Y A;  5D6X A;  1W2B A;  2QQS A;  5GMK h;  3BDL A;  2PVD B;  2DXC A;  3CC4 A;  5GAN 7;  4RCC A;  5FRN A;  2GFU A;  5M9O A;  4A53 A;  2KMT A;  4C92 G;  1VQ9 T;  3X20 B;  2HBP A;  2EYQ A;  2XKO C;  4B9W A;  1XTD A;  3HFN A;  1VQM A;  2K5L A;  1G5V A;  2QQA A;  4MDW A;  5GAN g;  3WXM B;  5GAO r;  1JB0 E;  2ZCF B;  4LDW A;  2Y90 A;  2RHY A;  5GMK l;  2QQR A;  3OSV A;  2X4X A;  2V8I A;  1JJ2 A;  3G7Z A;  2E70 A;  2YRV A;  1VQ7 T;  2L5Q A;  2LC4 A;  3F70 A;  1BI3 A;  5FU6 B;  3JCM d;  3E19 A;  3OS1 A;  4A4G A;  4JLI A;  3VUZ A;  3S3M A;  5J39 A;  5GAN 4;  3QZ5 B;  5A0G A;  5FU7 B;  1H3Z A;  4J6X A;  4M75 F;  3CCR A;  3CCQ A;  2HNI A;  2ZPB B;  3ER0 A;  1VIE A;  2RH2 A;  1YJN T;  1QW1 A;  4IUV A;  2MI6 A;  1GXI E;  3OYI A;  2I2L A;  1VQ6 T;  3OYD A;  4M78 F;  1N27 A;  2B8A A;  5LJ5 d;  4M75 B;  3QBY A;  4J8O A;  4QQ6 A;  3QDR B;  1OZ3 A;  5GMK e;  2LNV A;  3C4S A;  3INZ A;  3L1A A;  2WAC A;  3RKW A;  4EMK A;  3G71 A;  3CBP A;  5LJ3 f;  2E10 A;  4X9D A;  4M78 B;  3ZBD A;  4GLK A;  4J83 A;  2F5T X;  2P0Q A;  4J7F A;  4L6V 5;  4TVR A;  4PKC C;  4A4F A;  2L89 A;  4RG2 A;  4M7A C;  4C0G A;  5GAN 6;  2XK0 A;  3CCU T;  2DTH A;  1K73 U;  1KD1 U;  2KAF A;  1YIT T;  2DD5 A;  1S72 A;  2XDP A;  3JSC A;  1BI1 A;  3HHT B;  1Q82 C;  3L2U A;  3CC4 T;  1Q81 U;  1OI1 A;  2EKO A;  1KHI A;  4OGE A;  5CKF A;  3CCL T;  4ZN1 A;  3DB3 A;  2GCX A;  4ATO A;  1YJW A;  3J80 E;  3QPH A;  4XU2 A;  4DA4 A;  4HT8 A;  2IVW A;  5FRO A;  3WVE B;  3OMG A;  1KC8 U;  1QVG A;  2XID A;  5GAO n;  3C95 A;  4M75 D;  4N4I A;  4F7U E;  1VQO A;  2MF2 A;  3E9F A;  4A4H A;  3L42 A;  1UB4 A;  4C8Q A;  1M1F A;  3OYL A;  2DD4 A;  3CXC A;  2KQW A;  1YJ9 A;  2OTL T;  2BKD N;  1W4S A;  5CVI A;  4M78 D;  1PSE A;  3FRN A;  3R6O A;  4JLG A;  3V8L A;  5HK3 A;  3OA6 A;  4FT4 A;  4JRI A;  1WGS A;  3I55 T;  4BE1 A;  3MET A;  3CMA A;  2RM4 A;  2LT4 A;  5GAN f;  2LTO A;  1MHN A;  2X4J A;  3UDC A;  4RKU E;  4C0Z A;  2QEX A;  4HCZ A;  3FIF A;  3OBY A;  2XDD A;  2E12 A;  4M7A E;  2GF7 A;  3PMI A;  3MHX A;  4F7U B;  1N9S A;  5KE2 A;  1LOJ A;  2CZ6 B;  5I21 A;  3CME T;  5FLX E;  4BDZ A;  4QW2 A;  4XU0 A;  4E7L A;  4Q5W A;  5CIU A;  3CCE T;  4MMK A;  4VUB A;  4PJO F;  2HQX A;  2RJF A;  1MGQ A;  4GY5 A;  5GAN 3;  3JB9 F;  3M57 A;  2BUD A;  3ME9 A;  4C8Q G;  4LD6 A;  2P4T A;  4XQ3 A;  3JCM c;  3JCM b;  5GAO q;  4M7A F;  4FL6 A;  5LJ3 d;  2XHC A;  2C06 A;  1VQ9 A;  2CS7 A;  2VC8 A;  3SWN A;  5CQX A;  5LJ3 h;  4M7D F;  4HCB A;  3KXT A;  2M0O A;  4M7A B;  3VJP A;  1UGQ B;  4OMF B;  3OYY A;  2M16 A;  2RA2 A;  2XI9 A;  3CD6 T;  1LJO A;  4M7D B;  2E64 A;  1V29 B;  5D6Y A;  3MEW A;  4BY6 C;  2CKK A;  2QQ9 A;  2QTX A;  3VV0 A;  1P92 A;  3X28 B;  1VQ8 T;  1O75 A;  3BW1 A;  3MP6 A;  4FT2 A;  5CKD A;  2R5M A;  4J6Y A;  3OYK A;  2ZPI B;  1QVP A;  3RKX A;  3AHU A;  2X35 A;  3LX7 A;  2K3X A;  5KCO A;  3LGF A;  1YJN A;  4OB1 B;  2DKG A;  2FVU A;  4M75 C;  4D6W A;  4M77 F;  1VQ6 A;  3WVD B;  2L3R A;  1IZ6 A;  5LJ5 f;  3VU3 C;  4RMO A;  1K73 C;  4XTW A;  3QSU A;  3GF5 A;  4PJO D;  4MDX A;  3CMA T;  4M78 C;  2K3Y A;  3GNF B;  5GMK j;  4M7A D;  3OYJ A;  4A54 A;  1KQS A;  2A7Y A;  5GAN h;  4BDY A;  3OS0 A;  3SDZ A;  4M7D D;  2K5F A;  3P8H A;  3CCU A;  5A0D A;  3FB9 A;  5GAN 5;  1YIT A;  2JVV A;  4BB7 A;  3QII A;  3V8K A;  3DLL A;  1WJQ A;  3JCM P;  1BYM A;  1KC8 C;  1JRI A;  3X26 B;  4PLL A;  3JCM Q;  4XU3 A;  4NL2 A;  1VQL T;  3L2Z A;  4OB2 B;  4ZTJ A;  3RMS A;  2OTJ T;  3CCL A;  5AYF A;  4C92 F;  5GAM e;  4ME7 A;  4YTL A;  2QDY B;  2MWO A;  2RJC A;  3OW2 S;  1DJ7 B;  4JDS A;  1NJI U;  4O5V A;  2LRQ A;  3QKJ A;  2MWP A;  3JB9 J;  2R57 A;  3T9N A;  3ZFJ A;  4B9X A;  2QI2 A;  1VQ5 T;  2LX9 A;  4M75 E;  3OB9 A;  2OTL A;  3OYM A;  3CPW A;  1Y07 A;  2K57 A;  1G3S A;  3G6E T;  2LVM A;  2VV5 A;  4JRP A;  4BY6 B;  3MEV A;  3LGL A;  2CYZ B;  3JB9 H;  4M78 E;  2K2V A;  3JCM h;  3I55 A;  4OP0 A;  1Y71 A;  3HSB A;  5J26 A;  3NTI A;  4KUD K;  4M75 A;  4FU6 A;  1UGS B;  2CZ1 B;  4FIB A;  5I2M A;  5GAN e;  2O01 E;  3HL8 A;  4RG8 A;  1QP2 A;  4CI0 C;  2LT1 A;  4HT9 A;  2KK4 A;  3GP8 A;  1M1K C;  1X6O A;  5L8R E;  4QVC A;  4M78 A;  1Y96 B;  3J7A F;  3NTH A;  4L59 A;  3OYA A;  3TU4 K;  3JCM W;  3E9G A;  4Y91 A;  2E6Z A;  3CME A;  3SFM A;  2L8D A;  2OAU A;  5LJ5 h;  3CCE A;  2YHT A;  4XTX A;  4PJO C;  3I56 T;  2VUB A;  4KBM B;  2XD0 A;  2WSE E;  1QVF A;  2EJF A;  4BE0 A;  1G3W A;  2YLC A;  4E7K A;  2FHD A;  2RI2 A;  4M7D C;  4ELY C;  3QJ6 A;  3CPF A;  1VQN T;  3CC2 T;  5CCA A;  3CD6 A;  4OF1 A;  2RO0 A;  5KE3 A;  4EDU A;  4EPC A;  2LCL A;  3DKM A;  1Q7Y U;  3RES A;  2PVO B;  3V7S A;  1VQ8 A;  5CQY A;  3JCM e;  1M90 C;  3CCV T;  4PL6 A;  4XTV A;  3V7C A;  3JAM E;  4LDU A;  2DXT A;  3M5A A;  3V8J A;  2NLU A;  3O8V A;  4ZGJ B;  2DIG A;  2PVG B;  3EFS A;  2ZPE B;  4XTU A;  3L2R A;  4ZGD B;  4V2S A;  5LL6 S;  2RI3 A;  4NS5 A;  3BDU A;  5KCH A;  2BIV A;  4F7U A;  3QG1 A;  4C5G A;  1YI2 T;  4M77 C;  5LJ5 e;  1U1S A;  1X01 A;  1XNI A;  4QQG A;  4KUI A;  4PJO E;  2K4Y A;  4XTZ A;  1VQK T;  3OS2 A;  2LQ8 A;  4MML A;  4Z02 A;  1JBM A;  1K8A U;  3H6Z A;  1B34 B;  3CEY A;  4II1 A;  5LJ3 j;  4M7D E;  3RIR A;  4BAC A;  2YLB A;  2PQW A;  3RKY A;  1WQ7 A;  2KY9 A;  3A8G B;  3HFO A;  5CKH A;  5DLQ E;  1NJI C;  3FDR A;  4PJO A;  4M7A A;  3GIB A;  2F5K A;  1VQL A;  5CO7 A;  5CR2 A;  3PTA A;  1X75 C;  2DXB A;  2OTJ A;  2KVQ G;  4FM4 B;  3VKI A;  5CK9 A;  1YCY A;  3CCJ T;  3M59 A;  4IUP A;  4QVZ A;  5GAM j;  3OYN A;  4M7D A;  1G3Y A;  4PJO B;  3OMC A;  4BD3 A;  5GMK m;  4C92 C;  4F7U G;  3HRU A;  3A8M B;  2XG8 D;  2O4X B;  3G4S T;  2R5A A;  4MZT A;  1VQ5 A;  4KT0 E;  2DAQ A;  1WJS A;  3G6E A;  2RHU A;  3OS5 A;  1W2B S;  2M9U A;  3SB2 A;  2DEQ A;  2PUK B;  3N5B B;  4O6J A;  2RHZ A;  4M77 E;  5GAO l;  3OYF A;  1UGR B;  3J81 E;  2DZC A;  5A0L A;  3GNG A;  1WQW A;  2EFI A;  3Q1J A;  2LCC A;  3QHS A;  2P0K A;  4M7A G;  3M54 A;  2EJG A;  5GAN j;  2RK1 A;  3EAE A;  3M58 A;  1NZ9 A;  4M77 A;  5DY9 A;  1KQ1 A;  3NFC A;  1QP3 A;  4IUT A;  3BFM A;  3L2Q A;  1M90 U;  1YBY A;  1I4K 1;  4UC4 A;  1JJ2 S;  5HKC A;  2Y4Y A;  3A8H B;  2DTO A;  3JB9 D;  4M77 B;  4DQ2 A;  2QA4 T;  1AHJ B;  3I56 A;  3OYB A;  2GFA A;  2JZ2 A;  2ZPH B;  1I8F A;  3CCM T;  5LJ3 e;  2M1H A;  2HQE A;  4C0D C;  4C92 E;  3OY9 A;  1Q7Y C;  4HA8 A;  3A5Z B;  1I81 A;  4MZP A;  3L2V A;  1WNL A;  3MO8 A;  1Q86 C;  3M9Q A;  1VQN A;  4IUU A;  4IUQ A;  2DK3 A;  4XK8 E;  3CC2 A;  4C0F A;  3JCM J;  2RJD A;  3PGG A;  1KHC A;  3CCS T;  1KG1 A;  1PSF A;  1M8V A;  2EQK A;  3L2W A;  1M4Z A;  1HXD A;  3ASK A;  2JUF A;  3HP9 A;  3LH0 A;  1ZQ1 A;  2VGN A;  4BE2 A;  4BI4 A;  1FWZ A;  1M9S A;  2DO3 A;  3KBG A;  5HK0 A;  2ZPF B;  3CCV A;  4JJN K;  4J6W A;  5GAM g;  4C92 B;  4LDV A;  1XQH A;  4LDY A;  2IG0 A;  2QQB A;  3FEO A;  3OBW A;  3JCM V;  4OVA A;  3VUB A;  4M77 D;  2ZPG B;  2JTM A;  2MMP A;  1VQP T;  3CC7 A;  4CRI A;  1BIB A;  1YHQ T;  1K8A C;  2HAX A;  1D3B B;  2JNG A;  2FL7 A;  5HY6 A;  3M4G A;  3PIP A;  3KUF A;  3MP8 A;  1YI2 A;  1H64 1;  1Y96 A;  1KQ2 A;  2DVE A;  3OYE A;  3NTK A;  3URG A;  3LWH A;  5LJ5 j;  2WSF E;  5CKE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...