3JB9F

Cryo-em structure of the yeast spliceosome at 3.6 angstrom resolution
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
82
structure length
82
Chain Sequence
b'MKLVRFLMKLTNETVSIELKNGTIVHGTITSVDMQMNTHLKAVKMTVKGREPVPVETLSIRGNNIRYYILPDSLPLDTLLID'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pre-mRNA-splicing factor spp42
molecule tags Rna binding protein/rna
publication title Structure of a yeast spliceosome at 3.6-angstrom resolution
pubmed doi rcsb
total genus 10
structure length 82
sequence length 82
chains with identical sequence f
ec nomenclature
pdb deposition date 2015-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3jb9F00
3JCMJ 3RKWA 4HT8A 4JRKA 4C92G 4M7DD 4J6WA 3BY7A 3RUXA 4NL3A 1JRIA 2DTHA 2RB6A 1WQ7A 3M4GA 4NL2A 4M7AF 1I8FA 1WQWA 5GAMf 4M78B 4DQ2A 4M78G 4M77G 1MGQA 2VXFA 4XTVA 3GIBA 3INZA 1Y96A 2K57A 3RIRA 4C92E 4EMHA 5GMKe 3L1AA 4C8QA 5GAN4 3RKYA 3QSUA 4EMKA 3JB9H 4MMKA 4N0AA 4XU3A 3RKXA 2EJFA 3JCMg 1BIAA 1I81A 4M75D 4N0AC 4XTYA 4C8QD 1Y96B 2RD1A 4F7UF 4V2SA 4XU2A 4M7DE 4C8QB 4HT9A 5LJ3e 3JCMW 3JCMQ 2DTIA 4PJOE 1M5Q1 2DZ9A 5GAN8 1I5LA 2HNIA 4M77D 3V7SA 5I21A 3HFNA 5GMKh 2DTOA 3VU3C 1H641 4M75G 4A53A 4M75C 4M7AE 4M7AB 4M7DA 4XTXA 4F7UA 5GMKm 5LJ5d 2QTXA 2DVEA 3JCMb 1KQ1A 3HFOA 4M7DC 3JCMh 4C8QG 5GMKi 3V8KA 5GAMh 4Y91A 1LJOA 4J6YA 2I2LA 4JUVA 5LJ5f 2YLBA 4XQ3A 4C8QE 4PJOF 3AHUA 4C92A 5GANf 4M75B 4M75E 3JCMf 4M7AC 3SWNC 1HK9A 4M7AG 5GAMj 4C92C 3PGGA 4X9CA 3SWNA 2Y90A 3QUIA 3JCMe 2RM4A 5GANe 2DEQA 3EFRA 4M77B 4M77C 5GAMe 1I4K1 1N9RA 4M78C 3QHSA 1X01A 4HA8A 4C92F 4M7AD 5GANj 3BDUA 5LJ3g 5GAOr 3BW1A 1BIBA 3BFMA 5LJ3j 5LJ5j 4PJOG 5GAMg 4M77A 4A54A 4M78A 4XU1A 3JCMV 5GAOn 4M78F 4F7UE 3V7RA 4M77E 5GANh 2YLCA 3HSBA 1B34A 1LOJA 2FB7A 2DKGA 5GAOp 5GAOm 3JCMP 5LJ5h 2E10A 4M7DF 4NOYA 5GMKl 1M8VA 2DJZA 4M75F 5GAMd 4MMLA 3QO3A 5GAOl 1KQ2A 3V8LA 4XTUA 3RESA 4F7UG 2E65A 5LJ3d 1B34B 3L2ZA 5GAN3 2EWNA 4OP0A 2JN0A 4EMKC 2E1HA 5GAOq 4RCBA 4EMKB 5GAN5 1D3BA 4XU0A 2EAYA 4C8QC 2DZCA 2E64A 5LJ3f 3FB9A 3JCMX 3V7CA 2DXUA 1LNXA 2FYKA 5CAIA 1U1TA 1YCYA 4F7UB 1D3BB 2VC8A 5DY9A 2VXEA 3JB9J 3V8JA 3EFSA 4PJOB 3FJPA 4PNOA 5GMKj 4PJOD 5GANd 4M7AA 4M7DB 2YHTA 3JCMd 4JLIA 2RA2A 4WF2A 3SB2A 4JRIA 1U1SA 4M75A 2ZGWA 4M78D 4QVCA 1WPYA 4PJOA 1WNLA 4RCCA 3FIFA 3SWNB 1JBMA 1HXDA 1N9SA 4J6XA 4X9DA 1TH7A 5LJ5g 3JB9G 4PJOC 4J5YA 4C92B 5GANg 3JB9I 3RERA 2EJGA 3JB9F 4C92D 5GAN2 4M7DG 4M77F 2EJ9A 4QVDA 5GAN6 4M78E 4XTZA 5LJ5e 2DXTA 3JCMc 2E41A 4EMGA 4C8QF 2CGHA 4XTWA 5LJ3h 3JB9D 5GAN7
chains in the Genus database with same CATH superfamily
5L8RE 4HXJA 1EIFA 3X24B 4OB1B 3E2UA 5FROA 1XJWB 2VXFA 2RPNA 5FU7B 4EMHA 3QSUA 4DBRA 1NYGA 4MMKA 5FWCA 4XTYA 2HBWA 2HSEB 1PD1A 1SRLA 3MCAB 4KGVB 1M2VA 2F2XA 1E6GA 2DTIA 2SRCA 4MZMA 2EBPA 3EGXB 1DJ7B 3PFSA 5GMKm 8ATCB 1KQ1A 3HFOA 4O5VA 1K73C 4FU6A 3H9NA 1Q95G 3OYHA 3MO8A 4XAXB 1Q86R 4XQ3A 1UECA 1YIJQ 5EC7A 4M7AG 2RH2A 1WGSA 2Y90A 2X3XD 3EFRA 2K9GA 3CCJT 1RUWA 2X4XA 2JMCA 1T3LA 1AVZC 2LMJA 3ZFJA 2D0NA 1UJ0A 2FB7A 4BE0A 4LDYA 3G1JA 4KH0B 2LCSA 2J7IA 2DVJA 2YXYA 2MF2A 3CCLQ 3DKMA 2V8KA 1RAAB 4OP0A 4BY6C 4C8QC 1QKXA 2RQTA 5CO7A 2M0OA 2RHYA 2E6NA 3HTRA 3EG3A 3A8LB 4J9BA 1W2BS 1K73R 1VQ6A 4A4GA 2LJ3A 2BTTA 4PJOB 5AT1B 4R55A 1EZZB 2FEIA 2RA2A 1FX7A 2LRQA 2COZA 1N8RC 4PJOA 3CCLA 4J6XA 3KXTA 2DIQA 3JB9G 3RMSA 2O4XB 5KYWA 5LJ5e 3PIPA 3OSSC 1QVFP 1WHHA 2DTHA 2J6KA 3LLRA 5CKFA 2YUOA 1GXIE 2KYMA 2E12A 1UFFA 2XIDA 1QVPA 4OMFB 1NLOC 3T9NA 4EMKA 2XD0A 3I35A 1BIAA 1MNDA 3EHQA 2X9HA 3CCVQ 2CSQA 3ZL7C 2KE9A 4FSXA 4BI8B 5GAN8 3MEVA 4M77D 2QEXA 3S6WA 1RI0A 1YI2T 1Z9ZA 4M75G 2PTKA 3WVEB 2A37A 5LL6S 2VVKA 4KGXB 2JW4A 2CDTA 2QA4T 2OTLT 4J6YA 1WZOA 2A28A 4DBHA 3PGGA 1UDLA 2BIVA 1K1ZA 1VQ5A 3O8VA 3OYGA 1VIEA 3G6EQ 1M1KC 1R8OB 3QHSA 2QK0A 4EIKA 4E7LA 5LJ3j 2RHUA 2CP0A 2CH4W 4A4FA 1U06A 2ZPEB 1ARKA 2W10A 2JOYA 1AWJA 2J06A 2HQEA 1G3TA 2DKGA 3E1SA 1M8VA 4GLMA 1GBQA 1G3YA 2DL8A 3QO3A 2KT1A 3OYAA 2AK5A 4PLIA 2KT8A 2L3SA 3TSZA 1MUZA 5C6SA 2EGCA 1QKWA 1K9AA 1FMWA 4HVUA 2PVGB 2HD0A 2WSCE 4LD9K 2DERA 4PNOA 1YJNT 3VS3A 1WI7A 3M9QA 2XMFA 5I2SA 3OS2A 3SDZA 1Y57A 2KRMA 2NUZA 1AOJA 2FO0A 2DXTA 1H92A 3FDRA 4IURA 1VQPT 4FM4B 2MCNA 4JJDA 2C0TA 2R5MA 3VS5A 3JCMJ 4J6WA 4D8KA 4FYWB 1ABQA 1K9MC 2KVQG 4E7HA 3FJ5A 4BDYA 3INZA 1AWOA 2RN8A 3OW2P 2AKKA 3CC7Q 4CC7A 2ZPGB 3UT1A 2VYTA 2RQUA 1Y96B 2CP7A 5CVIA 4CC3A 2F5TX 1WJSA 3C12A 3M0SA 3CC4T 2CZ6B 4JRPA 1YI2A 2F1LA 4CC2A 3NFCA 3H8ZA 1TWBA 3CCRT 4N4GA 1YWPA 1ZX6A 3D7SB 3CCRA 1FMVA 5GAMh 1PKSA 2X51A 4X34A 2CZ1B 1IO6A 4M75E 5L23A 5GAMj 1G3SA 4X9CA 4J8OA 3J7AF 2YRVA 3L2WA 4QQ6A 2VB6A 4OGCA 4M77C 3PMIA 1AD5A 2J05A 3OY9A 3LGLA 4C0GA 4ZGDB 2YLCA 1B34A 1Q82U 4BY6B 4RKUE 1RLPC 3QDFA 4MMLA 5GAOq 5GAN5 3EG2A 1VQNQ 4RTWA 1VQ5Q 1TUDA 1B07A 1U1TA 2V8JA 2EQJA 5DM7R 2Y4YA 1RAEB 1VQOT 4IUPA 1VOMA 4PKCC 2RQVA 4JLGA 1QCFA 4TVRA 1SSHA 3OQ5A 1JBMA 2M1HA 1SSFA 4FT2A 4EPCA 3QJ6A 2EVRA 2JUFA 1T0HA 2E41A 4C8QF 5KH6A 3RKWA 2CP2A 1R0BG 4HT8A 3I55A 2KK4A 4C92G 2RB6A 2E3HA 2EQMA 3CCSA 1ABOA 1VQLQ 4DQ2A 1UG1A 4C0ZA 1K9MR 3TCJA 3QWYA 3Q1JA 5FU7C 3QZ9B 4PJJA 4ZN3A 1WIEA 2JT4A 4UC4A 4M75D 2F69A 2EQUA 4RTXA 4V2SA 3TQ7P 2QDLA 3OYEA 4PFPA 3X20B 2KXDA 3M54A 1TG0A 3V7SA 2V1RA 4XTXA 5GJWB 2HKNA 4MDWA 1K0SA 3CMAT 2CT4A 3CQTA 1JXOA 1TTHB 3CBMA 3AHUA 2DK3A 3TU4K 4E7SA 1I4K1 4ZNXA 1VQMQ 2O88A 3MEUA 1MHNA 3RNJA 2NWMA 3BW1A 2JJ9A 3CCET 4J9DA 2E70A 1T0JA 2O01E 1RLQC 4RTUA 3FLGA 3CC2A 2JVVA 3KUFA 5A0LA 1VQLT 2IPOB 2MWOA 2C06A 3M4YA 1M1KR 1LCKA 2GBQA 4FYVB 4WCIA 4C0DB 2X3WD 1D3BB 2PNIA 3EFSA 1ZBJA 3C95A 2OI3A 4JRQA 5KYYA 2FPDA 1Y0MA 1QWFA 5LJ5g 2JNGA 3SHWA 3BE3A 1LVKA 3CCUA 2A3LA 2HMAA 1PKTA 2LNVA 3CCQT 3TSWA 1PM3A 4F16A 1RAFB 1G8XA 2XDDA 1JRIA 3QZ5B 2XICA 4M7AF 1YJ9Q 5GAMf 4QKUA 4XTVA 4JS5A 2CP6A 4JJNK 2JTEA 3RKYA 2DLPA 3JB9H 3VKIA 1OU9A 3RMQA 3SD4A 4LXCA 4C8QD 4E7KA 2B86A 3CPWA 3ZEHA 1GBRA 1C0MA 3JCMQ 2DILA 1T3SA 3M0TA 4B9WA 1ZSZA 5IAYA 3EAEA 3OW2A 3ZBDA 1UGQB 4J9FA 3GNGA 3WXMB 1BCMA 4FW2A 1YIJT 2ZPIB 2HQXA 2LTOA 1ACMB 3PVQA 3JCMe 1W4SA 5GANe 3ME9A 1ZUUA 5GAMe 1YJWA 5KYXB 2D8HA 1E7OA 4AMCA 3GBQA 3HPWA 1X6BA 4ZGEB 1I1JA 2BE9B 1YNZA 2L3PA 4J9GA 2E6ZA 2ZCFB 5IHNA 1KQ2A 1VQNT 4KUDK 1TS9A 2CH4A 2JN0A 3PIOA 2K2MA 5D7UA 4F04B 2A7YA 3V7CA 4B9XA 1YJ9A 3G71Q 1WFWA 3I56Q 3JB9J 2E4HA 1OPKA 3FJPA 1OX9A 3F70A 4M7AA 2EYWA 2DNUA 1M90U 3OYFA 2D6FA 1WHKA 2XU8A 4PJOC 3OSVA 5GANg 3VUZA 1SF9A 2MK5A 2M51A 4Z88A 3REAB 5GAN7 2DIGA 3RBBB 2LCLA 3M55A 2KY9A 2LP5A 3L42A 3EHRA 4HKEA 2MWPA 2BZXA 2QXFA 4E7JA 2GQIA 2OTJA 1XTDA 1BI0A 2HEQA 3X26B 4PLLA 3MP1A 4A4KA 2DD4A 2QEXT 1UEBA 2KAFA 4M7DA 3JCMb 2DVEA 1OQKA 1QCOA 2O9SA 2NLUA 3REBB 1M27C 2FZCB 1WHLA 2QA4Q 5DLQE 4C5GA 3A5ZB 4M78C 2DBKA 2XDPA 4P5NA 3OYBA 1JO8A 4OMLA 4FIBA 1YJNQ 3BFMA 2DD5A 3JCMP 1D0ZA 4FT4A 4C0FA 3SEMA 5GAOl 3RESA 3C94A 1K8AC 5J3BA 3CC7A 1SKUB 2EGAA 3CC7T 4EMKB 4AFSC 2KMTA 4OF1A 3CBOA 2K79A 1YCYA 2EYZA 2JZ2A 3LW5E 1W2BP 1D1CA 3NPFA 2QTVA 2WSFE 4C5HA 5J26A 1VQLA 1U1SA 4HVWA 1M2OA 1ZA1B 4M78D 2CKKA 2GNCA 3CC4A 4KULA 1N9SA 2LQWA 2RHZA 3LH5A 2L8DA 1NBEB 5CKBA 1X75C 2PVDB 3CD6A 1VQ6T 2HL3A 3JB9D 3J80E 4Z89A 3GPLA 4JRKA 5FRMA 2RK2A 3M5AA 4FSSA 5GJVB 1UHCA 2HDAA 1MGQA 2KSSA 3GIBA 5CKDA 4PL6A 1ZUYA 5GMKe 1MMGA 2VGNA 5GAN4 1BI3A 3CEYA 3QIIA 2MI6A 2M9UA 1JU5C 5CIUA 4FYXB 3UWNA 5A0DA 2D8JA 2X35A 1M5Q1 3QXEB 2L3RA 5I21A 1VQKQ 3HKSA 1RACB 1RAIB 1ZQ1A 2DXCA 2P0KA 5M9OA 1KFZA 1H8KA 4LE9A 1IXDA 3MEWA 4JZ3A 3NMZC 2O4XA 5KYYB 4LD6A 4M7AC 3SWNC 4IUTA 4ME7A 1M9SA 2HCKA 3UF4A 2VV5A 1N9RA 1WHJA 1OV3A 2L2PA 2LJ1A 4HA8A 2YRCA 4QQDA 1J3TA 3E9GA 3JCMV 1X2KA 3M0RA 1AWXA 2D9TA 1JJ2S 1ZHIA 5GANh 3HSBA 2EYYA 3HRSA 5GAOp 1AZEA 2E10A 4CI0C 4BE2A 3DB4A 4DOWA 1KD1R 3R6OA 4LUDA 4EMKC 5A0GA 3CCLT 3A8MB 3S3NA 5KE3A 2BE7D 4KT0E 4ELYC 3NHNA 1D0YA 1GRIA 5CCAA 3M0PA 4MZPA 3G4ST 1M90R 1Q86U 1YITT 1VQOA 4JRIA 1KIKA 1QVGA 5HY6A 3OYKA 1KSWA 2EYQA 1BI2A 3OB9A 4WTOB 2F5KA 3PE0A 5A2QE 2M0YA 1KQSA 4QVDA 4M78E 1GCQC 1M1FA 2CGHA 3L2VA 4QVZA 4JPBW 1UGVA 5DLOA 1I8FA 3R6NA 2DM1A 3RR6A 1PG5B 3CPWS 2K57A 3VS4A 2EYXA 2KRNA 2XK0A 4Y92A 2L89A 1NLPC 1RI9A 4FYYB 3L2UA 1JXMA 1VYVA 1NM7A 4HT9A 5LJ3e 4PJOE 1I5OB 2MMPA 1JJ2P 2HKQB 2NUPB 2DETA 1Q7YC 5CKEA 2J6OA 3EG9A 1YIJA 1JEGA 3QG1A 4E2FB 1BU1A 4E7IA 4KUIA 2JTFA 3EFOB 1BIBA 2OTLA 1U5SA 5GAOn 2JXBA 2ESWA 2VGMA 1VQ9A 1BBZA 5LJ5h 4NOYA 1NZ9A 1LPLA 5HCKA 3VJPA 2NUTA 3CCQA 3I56A 2XDBA 1ZSZB 2FYKA 3CCVA 1VUBA 5IT9E 1VQKT 4ANJA 4F7UB 1B3QA 1Q7YU 1PSEA 2LVMA 1EFNA 2VXEA 3URGA 3V8JA 3QDRB 1K73U 5GMKj 3G4SQ 5GANd 2FRYA 4J9EA 3ASKA 2ED1A 2R58A 1IZ6A 1NEBA 1WPYA 1IGQA 4X9DA 1HXDA 1JJ2A 3JB9I 1S72Q 2ECZA 2EJGA 2LQKA 3I5SA 2FPEA 1XOVA 1M3AA 1BYMA 2B8AA 1OX8A 1VQ6Q 4IUUA 4AFQC 1M30A 1WQWA 1FYNA 4VUBA 1ZBXA 4DA4A 2JS0A 4M77G 4ORZA 4A4EA 1Y96A 1M8MA 2COWA 3RIRA 1X43A 1M2VB 1AWWA 4QW2A 5FW9A 1I0CA 2G6FX 1VQ9T 4XU2A 2E5QA 2MYSA 1CSKA 2RF0A 1I5LA 2WSEE 3C0CA 2DRMA 1Q82C 2LC4A 1A0NB 3MEAA 5LJ5d 1N5ZA 4BD3A 2C0IA 5FLXE 4C92A 1SG5A 2ZPHB 4LDWA 2RM4A 4OGEA 2L3QA 2KEAA 2EGEA 2JTMA 3JV3A 2QI2A 3VS7A 4C92F 2VKNA 1SHFA 1WXUA 5GAOr 2IIMA 4M78A 1WHGA 4PFZA 2QQAA 5GAOm 3LWHA 3UATA 1KD1U 3I55T 4J83A 1D1BA 2DL5A 3MKDA 2R5AA 4AT1B 1S1NA 5I2MA 2KXCA 4LDVA 3NTHA 2P0QA 2Y4XA 3EH2A 2QASA 2VC8A 5DY9A 4HCZA 2M02A 4Z02A 2DMOA 3CPWP 3LX7A 3SB2A 1MMNA 2D0QB 2CP5A 2GFAA 3QYHB 1TH7A 2DO3A 1N6AA 2AZSA 3RERA 1H3ZA 4LDXA 3JB9F 3LH0A 1CKBA 1YFNA 2LX9A 2YT6A 1QVFS 3OBYA 5IHKA 1VQ7Q 1NJIR 1I07A 1VIFA 3X25B 4NL3A 1WYXA 4JJCA 1OPLA 1VQMA 2J6FA 3OYDA 3H0HA 4GLKA 9ATCB 2JM9A 4N0AA 1VQ8Q 3JCMg 2DYIA 2E3IA 2RD1A 3KFVA 4C8QB 1WHMA 3PVLA 1G3WA 3I56T 1QWEA 2HNIA 1WLPB 4KRTA 3CCMA 4M75C 3LGFA 1N27A 3DLLA 1OYXA 1ZUKA 4R56A 4M7DC 4FW1A 2V8IA 4QQGA 5GMKi 1WX6A 3VV0A 2ATCB 4Q5WA 1PSFA 2RK1A 2LQ8A 2FG0A 2DEQA 4M77B 1K8AU 3S3OA 4DBQA 1GL5A 5LJ3g 5HK0A 2GFUA 1UJYA 1KJWA 4M77A 2MIOA 3CCQQ 4F7UE 2FHDA 3A1PA 1QCNA 1BKBA 3NGPA 3OYLA 4CC4B 1Y71A 1BK2A 2BUDA 4MDXA 4HCCA 1M3CA 1PRLC 2W0ZA 4AFUC 4ELZC 1D3BA 4BI3A 2DA9A 3GLXA 4KH1B 1Q86C 3S3MA 3HP9A 1SRMA 1LNXA 2GTOA 1YITQ 3OBWA 5I22A 3OA6A 2NUPA 1PC0A 4M7DB 2RI3A 3EGUA 2QQBA 4JLIA 3TREA 3G71T 3META 4OB2B 3CMET 1IGUA 3CCSQ 1MV0B 2K5LA 2NYSA 1QQJA 3CC2Q 1R77A 1O9SA 3NTIA 3GOXA 4EMGA 4XTWA 5LJ3h 5D6YA 2DL3A 2PU9B 2RQRA 1QMCA 1VQMT 2ROLA 1XNIA 2AT1B 3MJXA 3DLMA 3CCUT 3L1AA 2KRSA 1V1CA 2EKOA 4ATOA 1K9MU 3OW2S 2K7AA 3ER0A 2ROTA 3JCMW 1QVGP 1YP5A 2DFUA 5I11A 2CYZB 4NS5A 3VRYA 3VYHB 1VQ4Q 1AT1B 1M90C 4HCKA 2DTOA 3VU3C 1TUGB 1H641 4A53A 2EFIA 4M7AB 2FVUA 2QTXA 3PT9A 3OYCA 3OYMA 3OYIA 4JS4A 3JCMh 2DXBA 4IIOA 5KCOA 3V8KA 1PNJA 4FCYA 3QBYA 1OZ3A 2I2LA 4F17A 2EW3A 1G5VA 4MZTA 1HK9A 5KYXA 6AT1B 5IH2A 1IRXA 3SWNA 3QUIA 2HBPA 1YHQT 4BACA 3H0FA 2DBMA 1UUEA 1WJQA 5LJ5j 3X28B 5FWBA 4PJOG 1C6VX 4A54A 1YJ9T 2QYZA 3V7RA 2DJQA 2LJ0A 5FU6B 8AT1B 1WXBA 2DJZA 2RO0A 2ED0A 4ESRA 5GAMd 3THKA 1KK7A 3M59A 3VS0A 2DX1A 2VUBA 1B34B 1YN8A 3OYYA 2HAXA 2RMOA 5FU6C 4RCBA 1WXTA 2EAYA 1E6HA 1F1BB 1Q81R 1QW1A 1VQOQ 1HYOA 2DXUA 3P8HA 1M1KU 3EH1A 3I5RA 3EGXA 4AFZC 3UPUA 2KGTA 3BDLA 4RG2A 5CQYA 1AHJB 3LYIA 2KQWA 3J81E 1TSFA 2K6DA 1NPRA 3L2QA 3CMEQ 1R0CB 1X2QA 4C92D 2PZ1A 4R0KA 2EJ9A 3EGDB 4RMOA 2VASA 3M0QA 3JCMc 1GCQA 2XI9A 1K76A 1IREB 2WACA 5EG2A 5KYWB 3L2RA 1WQ7A 3CCEQ 2X4YA 2EIFA 4HVVA 3HRTA 3N5BB 2PUKB 4X1VA 4C92E 1GFDA 1KQSS 2LX7A 1XQHA 2ZAEA 3CD6Q 5D6WA 4OMQA 1Q7YR 3PMTA 3HL8A 3CCRQ 2P4RA 2OAUA 7AT1B 3UA7A 2C0OA 2KDSA 5GMKh 3CMAQ 3EG1A 2EQIA 4M7AE 3CC4Q 4IUVA 3FEOA 2QEXQ 5IXBA 4JUVA 2RHXA 3H41A 1IHWA 4AG2C 2AKLA 4LN2A 4M75B 2RI5A 3JCMf 1K8AR 2OTJQ 3RDVA 3JSCA 5KE2A 1Q81C 3G6EA 1TOVA 1UTIA 3WVDB 1OULA 4EDUA 1UE9A 2HL5C 3E19A 5IXFA 3CD6T 4E6RA 4RG8A 1W70A 4M77E 4M7DF 1JQQA 4RUGA 1VQ8T 1HSQA 1Z9QA 2CUDA 2QQ9A 2EQKA 3GF5A 2JMAA 2MAMA 2EPDA 1O75A 2FPFA 2SEMA 1RL2A 2DZCA 1RABB 5LJ3f 2K3XA 5CAIA 1W6XA 2CUBA 1M4ZA 1VA7A 2KR3A 2FZGB 1GCPA 1VQ7T 1W1FA 1VQPA 4N4HA 2RI2A 3E9FA 4RTYA 2ZGWA 1VQ5T 3SFMA 3FIFA 2V1QA 3GNFB 1ZSGA 2OTJT 4RTTA 3GP8A 1ZA2B 2VWFA 4J7FA 2LT4A 2A36A 1P92A 3G4SA 2QGGA 4ZTJA 1OI1A 3BY7A 3P8BB 2F2VA 3M4GA 3MPUB 4ZN1A 4M78G 2LCCA 2CREA 5J39A 4QT7A 4XU3A 1BCOA 4F7UF 1V76A 1NE8A 2KNBB 3DB3A 3OYJA 2DZ9A 2DEUA 4F7UA 1NJIC 1WDXA 1YHQQ 4GBQA 4A4HA 3CCVT 4D8DA 1QVFA 2YLBA 4C8QE 1BI1A 4PJOF 2ENMA 1N8RU 1AEYA 4CRIA 4XK8E 4C92C 3O5ZA 1PWTA 4IIMA 4KGZB 4M4ZA 1BB9A 2CT3A 3ULRB 2YUQA 5GANj 1H3HA 3BDUA 1UB4A 1OU8A 4KBMB 2GF7A 3MP8A 3UDCA 3JRZA 1VQ9Q 2HSPA 4JZ4A 1VQPQ 3QYGB 1YHQA 1PHTA 4XTUA 2RJFA 2AHJB 2QG9B 4BI4A 3VYGA 3FB9A 2P4TA 3OS0A 1OEBA 1U3OA 1D09B 1QVGS 1KG1A 3JCMd 2LQNA 1S72T 3EG9B 1S72A 1UGPB 2K3YA 3MHXA 4F14A 4J5YA 4C92B 5GAN2 4M77F 3QWXX 2RHIA 2FZKB 2KBTA 1CKAA 1NPPA 1KHIA 3JAME 1IB8A 1Q82R 2DE0X 2IG0A 2CS7A 4DEXA 4M78B 4C5EA 1Y7XA 2EKHA 4J9HA 2A0FB 2DPPB 2D1XA 5HK3A 2RNAA 1W2BA 4DEYA 2V26A 2EJFA 3FRNA 4N0AC 1AZGB 1K4US 2LDMA 3CCUQ 4OMOA 1UGRB 1MMDA 3HFNA 4LNPA 1HD3A 1M3BA 4II1A 2OTLQ 2KYBA 2COYA 3CPFA 1X27A 2A08A 3G7ZA 1K0XA 1WA7A 1LJOA 2GQVA 1X6GA 3C4SA 3VS2A 5LJ5f 1MMAA 2ZPBB 4RTZA 1KC8R 2ZZDA 1C1AA 3M58A 2K3BA 3TVTA 2H3JA 3CC2T 3EFOA 1TUCA 3CCST 1X01A 5HKCA 4L5GA 4IUQA 3CMEA 5CKHA 2AIRB 3CCJQ 5GAMg 3CMAA 1QLYA 4XU1A 2NUTB 4M78F 4ZTFA 1VQ4T 3CXCP 1MNEA 2YSQA 2LZ6B 4Z8AA 1NYFA 3FC3A 2YUNA 2R57A 3V8LA 2F2WA 1KD1C 4F7UG 2E1HA 2L5QA 2P0PA 4PJNA 4K11A 2E64A 3JCMX 3A8HB 2PVOB 3CCEA 2QGFB 2YUPA 2K2VA 5ECAA 5FRNA 1VQNA 1TXQA 3KBGA 1YWOA 4QVCA 1WNLA 2H3EB 1Y07A 3U23A 4O6JA 3UA6A 2I0NA 4LDUA 3AT1B 2ABLA 2HZYA 4C5IA 4M7DD 1ZLMA 3VRZA 5KCHA 2DL4A 4J7IA 1X6OA 2PQWA 2BZYA 2QQSA 3H6ZA 2RJEA 2GTJA 2OX7A 5IHIA 3I55Q 1NEGA 1VQ4A 1KC8C 1I81A 3HHTB 4OB3B 4M7DE 5KYUB 5C0MA 3QPHA 4BDZA 3A8OB 1X69A 4DOVA 1KQSP 5KYUA 2YDLA 2Z0WA 1TU0B 3VUBA 2ZPFB 5GANf 1SPKA 4OB0B 5IN1A 2QAZA 2G3RA 4PFOA 1SHGA 1RAGB 4GY5A 5CK9A 5AYFA 2M16A 4M7AD 2PUOB 3OYNA 2DYBA 4HCBA 1VQKA 2RQWA 4JJBA 2CSIA 4E47A 1NJIU 2YWWA 5CR2A 1LOJA 1OOTA 3OS1A 5GMKl 2X4WA 3H0IA 1HJDA 2RJDA 2AZVA 2DAQA 1IHVA 1VYUA 1JB0E 4Y28E 1WJRA 2E65A 4OMNA 5LJ3d 3L2ZA 5GAN3 1QP2A 3M57A 4A63B 1B7TA 1ZSZC 2GGRA 2QDYB 2DF6A 3CXCS 2OAWA 3M0UA 3LWIA 2JM8A 1U8RA 4PJOD 4FL6A 3A8GB 4BE1A 4WF2A 4M75A 4E7ZA 2QQRA 3M56A 4RCCA 4N4IA 1KHCA 3CCJA 2XKOC 4OMPA 3A98A 4AG1C 2KROA 3OS5A 2H8HA 5GAN6 4XTZA 1UGSB 3OMCA 1MV3A 1D0XA 2FRWA 2O31A 2O9VA 3RUXA 2RJCA 3CBPA 4NL2A 1EX4A 1RAHB 1NG2A 5D6XA 1GFCA 2MOXA 4B6MA 2O2OA 3G6ET 2GCXA 4C8QA 2JS2A 2K5IA 3CCMQ 1OZ2A 3I9QA 2FL7A 4BUGA 3IQLA 3RKXA 1YITA 3M53A 5KYNA 1G83A 4RTVA 3P8DA 2K4YA 1YJWT 3PTAA 2MPXC 2P84A 2OJ2A 1YI2Q 3NTKA 1FWZA 4C8QG 3TEEA 1KC8U 1PD0A 4OMMA 2CZ0B 1YJWQ 4Y91A 3VS6A 4ZGJB 1G2BA 4BB7A 2XG8D 4C0DC 2X4JA 2CZ7B 4PK4A 3G71A 1VQ7A 1UHFA 1YBYA 3CCMT 2DRKA 2IVWA 4LUEA 3EGDA 2DL7A 3PNWC 3QJYA 2LNHB 4L59A 2BZ8A 4DBFA 4J9IA 2E5KA 1PCXA 2XHCA 4PJMA 4J9CA 2YRDA 4M75F 1VQ8A 1QP3A 4IKFA 1Q81U 1M1GA 1YJNA 1VYTA 2EWNA 2LT1A 3HRUA 1D1AA 4PJLA 2L0AA 4XU0A 1FMKA 3CXCA 1V29B 1YCSB 1RADB 4OVAA 2QA4A 2K5FA 4JDSA 3VS1A 1SEMA 4D6WA 3MP6A 5CQXA 2YHTA 1N8RR 2BKDN 3SWNB 4YTLA 4L6V5 3EG0A 3OMGA 4M7DG 3QKJA 2KI7A 1FXXA 1PRMC 2HQHA 2CP3A
chains in the Genus database with same CATH topology
5L8RE 4ZTJA 1OI1A 3BY7A 2XDDA 1JRIA 1EIFA 3QZ5B 3P8BB 2XICA 3M4GA 4M7AF 4IUUA 3X24B 1WQWA 5GAMf 4ZN1A 4OB1B 4VUBA 1ZBXA 5FROA 4DA4A 4M78G 4M77G 4XTVA 2VXFA 4JS5A 4A4EA 1Y96A 4JJNK 5FU7B 3RIRA 2LCCA 4EMHA 5J39A 4QW2A 3RKYA 3QSUA 3JB9H 4MMKA 4XU3A 3VKIA 4XTYA 3RMQA 3SD4A 4C8QD 4F7UF 4E7KA 1VQ9T 1NE8A 3MCAB 4XU2A 3CPWA 3DB3A 3ZEHA 2E5QA 3JCMQ 2DTIA 3OYJA 4B9WA 2DZ9A 1I5LA 2WSEE 4MZMA 5IAYA 3EAEA 1DJ7B 1Q82C 3PFSA 3OW2A 3ZBDA 2LC4A 4F7UA 3MEAA 5GMKm 5LJ5d 1NJIC 1KQ1A 3HFOA 4O5VA 1K73C 1UGQB 4FU6A 4A4HA 3CCVT 3GNGA 3OYHA 3MO8A 4XAXB 4BD3A 1QVFA 2YLBA 4XQ3A 5FLXE 4C8QE 3WXMB 1BI1A 4PJOF 4C92A 1N8RU 4M7AG 1YIJT 4CRIA 2RH2A 2ZPHB 1WGSA 2ZPIB 2HQXA 2LTOA 4XK8E 4C92C 2Y90A 4LDWA 3JCMe 2RM4A 1W4SA 5GANe 3ME9A 3EFRA 4OGEA 5GAMe 2JTMA 1YJWA 3CCJT 2QI2A 4C92F 5GANj 3BDUA 2X4XA 5GAOr 1UB4A 3HPWA 4KBMB 4M78A 2GF7A 4ZGEB 2QQAA 3ZFJA 3CCQT 3MP8A 5GAOm 3LWHA 2FB7A 3UDCA 3JRZA 2E6ZA 4BE0A 4LDYA 3I55T 4J83A 1KD1U 2R5AA 3QYGB 1YHQA 2ZCFB 1KQ2A 1VQNT 4KUDK 2MF2A 4XTUA 5I2MA 3DKMA 2RJFA 2V8KA 4OP0A 2JN0A 4LDVA 2AHJB 3PIOA 4BY6C 4C8QC 3NTHA 4BI4A 2P0QA 3VYGA 2A7YA 2Y4XA 3FB9A 2P4TA 3V7CA 4B9XA 3OS0A 5CO7A 1YJ9A 2M0OA 2RHYA 2E6NA 1W2BS 3A8LB 1VQ6A 4A4GA 2VC8A 5DY9A 3JB9J 4PJOB 3FJPA 4HCZA 4R55A 1QVGS 1KG1A 3F70A 4Z02A 4M7AA 3JCMd 2RA2A 1FX7A 2LRQA 3LX7A 3SB2A 1N8RC 3OYFA 1M90U 1S72T 2D6FA 2D0QB 1S72A 1UGPB 2K3YA 3MHXA 4PJOA 3CCLA 2XU8A 2GFAA 3QYHB 4J6XA 3KXTA 4PJOC 2DIQA 1TH7A 2DO3A 3RMSA 3JB9G 4J5YA 4C92B 1N6AA 2O4XB 3OSVA 3VUZA 5GANg 3RERA 1H3ZA 4LDXA 3JB9F 5GAN2 3LH0A 4M77F 2LX9A 1QVFS 5LJ5e 3OBYA 3PIPA 3OSSC 2RHIA 1NPPA 1KHIA 5GAN7 3JAME 2DIGA 2LCLA 1VIFA 3X25B 4NL3A 2IG0A 2DTHA 3M55A 3LLRA 2KY9A 2CS7A 5CKFA 1VQMA 4M78B 4C5EA 1Y7XA 3L42A 1GXIE 3OYDA 2E12A 4GLKA 2XIDA 2DPPB 2MWPA 1QVPA 4HKEA 5HK3A 4OMFB 2QXFA 4E7JA 1W2BA 3T9NA 2OTJA 1XTDA 4EMKA 2XD0A 4N0AA 2EJFA 3FRNA 3JCMg 1BIAA 1BI0A 4N0AC 2RD1A 4C8QB 2LDMA 1G3WA 4FSXA 1UGRB 4PLLA 3X26B 4BI8B 5GAN8 3MP1A 3I56T 2HNIA 3MEVA 4M77D 4A4KA 3HFNA 3S6WA 4II1A 2DD4A 1RI0A 2QEXA 2QEXT 1YI2T 4M75G 3CCMA 1UEBA 2KAFA 4M75C 3CPFA 3LGFA 3WVEB 1N27A 3JCMb 5LL6S 4M7DA 2DVEA 3DLLA 1OYXA 4R56A 4M7DC 3G7ZA 2V8IA 4QQGA 5GMKi 2QA4T 2OTLT 1LJOA 2GQVA 4J6YA 3C4SA 5LJ5f 3VV0A 2ZPBB 4Q5WA 2NLUA 1PSFA 2ZZDA 2RK1A 3M58A 3PGGA 2LQ8A 2BIVA 2H3JA 3CC2T 5DLQE 2DEQA 4M77B 4C5GA 1VQ5A 3A5ZB 3O8VA 1VIEA 3OYGA 3CCST 4M78C 3S3OA 1K8AU 1M1KC 1R8OB 3QHSA 1X01A 5HKCA 4L5GA 2XDPA 4P5NA 4IUQA 3OYBA 5LJ3g 3CMEA 4E7LA 4FIBA 5CKHA 5HK0A 3BFMA 2GFUA 2RHUA 5LJ3j 5GAMg 4M77A 3CMAA 4XU1A 2ZPEB 4A4FA 2DD5A 2JOYA 4M78F 4F7UE 4ZTFA 1VQ4T 2HQEA 1G3TA 2FHDA 2DKGA 3E1SA 3JCMP 1M8VA 1BKBA 1G3YA 4FT4A 4C0FA 3FC3A 3QO3A 2R57A 5GAOl 3V8LA 3RESA 3C94A 3OYLA 5J3BA 4F7UG 1Y71A 3OYAA 3CC7A 1K8AC 1KD1C 3CC7T 2BUDA 4MDXA 2E1HA 4ELZC 4HCCA 2L5QA 4EMKB 4PLIA 1D3BA 2P0PA 4BI3A 3GLXA 1Q86C 3S3MA 2E64A 2KMTA 3HP9A 4OF1A 3JCMX 3CBOA 3A8HB 5C6SA 1LNXA 2PVOB 3CCEA 1YCYA 2JZ2A 3LW5E 2PVGB 2HD0A 2WSCE 4LD9K 3OBWA 3OA6A 2K2VA 4PNOA 2WSFE 4M7DB 2RI3A 1YJNT 4C5HA 2QQBA 4JLIA 3TREA 5FRNA 3G71T 5J26A 1VQNA 3META 1VQLA 1U1SA 3KBGA 4OB2B 3M9QA 4M78D 4QVCA 2CKKA 3CMET 1WNLA 3CC4A 4KULA 5I2SA 1Y07A 2K5LA 1N9SA 4O6JA 3OS2A 2RHZA 3SDZA 2L8DA 1O9SA 5CKBA 1X75C 2PVDB 3NTIA 3GOXA 2DXTA 4EMGA 3FDRA 4IURA 1VQ6T 4XTWA 1VQPT 3CD6A 5LJ3h 4FM4B 4LDUA 5D6YA 3JB9D 2R5MA 3J80E 3GPLA 3JCMJ 2PU9B 4JRKA 4C5IA 5FRMA 4M7DD 4J6WA 5KCHA 2RK2A 1VQMT 1XNIA 3M5AA 4J7IA 1X6OA 1K9MC 2KVQG 4E7HA 1MGQA 2PQWA 4BDYA 2KSSA 2QQSA 3DLMA 3INZA 5CKDA 3GIBA 3H6ZA 4PL6A 5GMKe 2RJEA 3L1AA 3CCUT 2VGNA 5GAN4 1BI3A 2EKOA 3CEYA 4ATOA 1K9MU 2ZPGB 3QIIA 1VQ4A 2MI6A 1KC8C 3OW2S 1I81A 3UT1A 2VYTA 1Y96B 3ER0A 3HHTB 5CVIA 4OB3B 4M7DE 2M9UA 5CIUA 3UWNA 2F5TX 5A0DA 3JCMW 2X35A 1WJSA 3C12A 1M5Q1 3QXEB 3CC4T 2CYZB 4NS5A 2CZ6B 3VYHB 2L3RA 5C0MA 5I21A 4JRPA 3QPHA 4BDZA 1YI2A 2DTOA 1M90C 3A8OB 3VU3C 3HKSA 1H641 3H8ZA 3NFCA 2EFIA 4A53A 4M7AB 4DOVA 2FVUA 2QTXA 3PT9A 3OYCA 3CCRT 3OYMA 4N4GA 3OYIA 3JCMh 4JS4A 2DXBA 3CCRA 5KCOA 3V8KA 5GAMh 1ZQ1A 2DXCA 3QBYA 4X34A 1OZ3A 2I2LA 2P0KA 5M9OA 3VUBA 3MEWA 2CZ1B 2ZPFB 5GANf 4OB0B 2O4XA 4MZTA 4M75E 4LD6A 5IN1A 3SWNC 1HK9A 4M7AC 5GAMj 4IUTA 4ME7A 1G3SA 1M9SA 2G3RA 4X9CA 3SWNA 3QUIA 4J8OA 3J7AF 2VV5A 2YRVA 2HBPA 4QQ6A 3L2WA 4GY5A 4BACA 1YHQT 4OGCA 4M77C 5CK9A 1N9RA 5AYFA 2M16A 4HA8A 4QQDA 3PMIA 3E9GA 2PUOB 3OYNA 4M7AD 1WJQA 5LJ5j 3X28B 3OY9A 4HCBA 4PJOG 1VQKA 4A54A 1YJ9T 3JCMV 3LGLA 4E47A 1JJ2S 2D9TA 4C0GA 1ZHIA 1NJIU 4ZGDB 3V7RA 5GANh 2YLCA 5FU6B 5CR2A 1B34A 1LOJA 3HRSA 5GAOp 4BY6B 1Q82U 3HSBA 3OS1A 2E10A 4CI0C 5GMKl 4RKUE 2X4WA 4BE2A 2RJDA 2DJZA 2RO0A 2DAQA 3DB4A 5GAMd 4MMLA 1JB0E 4Y28E 3M59A 1WJRA 2E65A 5LJ3d 2VUBA 1B34B 4DOWA 3L2ZA 3R6OA 5GAN3 3OYYA 4EMKC 5A0GA 2HAXA 5FU6C 1QP2A 3M57A 4RCBA 5GAN5 3A8MB 5GAOq 2EAYA 3CCLT 5KE3A 3S3NA 4KT0E 4ELYC 1QW1A 2DXUA 1G5VA 2QDYB 1U1TA 3P8HA 5CCAA 2V8JA 3CXCS 2EQJA 4MZPA 5DM7R 3LWIA 2Y4YA 3G4ST 1M1KU 1Q86U 1VQOT 4IUPA 3UPUA 1YITT 1U8RA 4PJOD 1VQOA 3BDLA 4PKCC 4FL6A 4RG2A 3A8GB 4BE1A 4JLGA 4WF2A 5CQYA 4JRIA 4M75A 4TVRA 2QQRA 1AHJB 3LYIA 1QVGA 3M56A 2KQWA 4RCCA 5HY6A 3J81E 4N4IA 3OYKA 1KHCA 1JBMA 3OQ5A 3CCJA 2XKOC 1NPRA 3L2QA 2M1HA 1SSFA 2EYQA 4FT2A 4EPCA 1BI2A 3OB9A 2F5KA 4C92D 3OS5A 3QJ6A 5A2QE 4RMOA 2EJ9A 1KQSA 4QVDA 5GAN6 4M78E 2JUFA 4XTZA 3JCMc 1UGSB 1M1FA 2E41A 4C8QF 2CGHA 5KH6A 2XI9A 3OMCA 3L2VA 3RKWA 4QVZA 1IREB 2WACA 4HT8A 5EG2A 2KK4A 3I55A 4C92G 3RUXA 3L2RA 2RB6A 1WQ7A 2EQMA 2RJCA 3CBPA 4NL2A 5DLOA 3CCSA 1I8FA 5D6XA 4DQ2A 2X4YA 2EIFA 4C0ZA 3HRTA 3TCJA 3G6ET 3CPWS 2K57A 2PUKB 3N5BB 4C92E 2GCXA 3Q1JA 5FU7C 4C8QA 2K5IA 1KQSS 2XK0A 1OZ2A 3QZ9B 2L89A 4ZN3A 2FL7A 4BUGA 3RKXA 1YITA 4UC4A 3L2UA 1XQHA 4M75D 2F69A 2EQUA 4V2SA 3M53A 3OYEA 3X20B 4HT9A 5D6WA 5LJ3e 3PMTA 3HL8A 4PJOE 3M54A 3P8DA 2K4YA 3V7SA 2MMPA 2OAUA 5GMKh 3PTAA 1YJWT 2KDSA 4M7AE 4XTXA 4IUVA 3FEOA 3NTKA 1FWZA 4MDWA 3TEEA 4C8QG 1KC8U 1P92A 1Q7YC 2CZ0B 5CKEA 4Y91A 3CMAT 4JUVA 2RHXA 3CBMA 4ZGJB 4C0DC 4BB7A 2XG8D 3AHUA 4M75B 2RI5A 2X4JA 3JCMf 2DK3A 2CZ7B 1YIJA 3G71A 1VQ7A 1YBYA 3TU4K 3JSCA 5KE2A 3CCMT 2IVWA 1Q81C 3G6EA 1I4K1 3QG1A 4E7IA 3PNWC 4KUIA 3QJYA 2JTFA 3WVDB 3MEUA 1MHNA 4EDUA 3BW1A 3E19A 1BIBA 4L59A 2OTLA 3CCET 5GAOn 2E70A 3CD6T 2VGMA 4M77E 4RG8A 2O01E 1VQ9A 4M7DF 2XHCA 5LJ5h 4NOYA 1VQ8T 1NZ9A 4M75F 1VQ8A 3VJPA 2QQ9A 1QP3A 2EQKA 3GF5A 3FLGA 3CCQA 3I56A 3CC2A 1Q81U 2JVVA 4IKFA 1M1GA 3KUFA 5A0LA 2MAMA 1YJNA 1O75A 2EWNA 2LT1A 3HRUA 1VQLT 4XU0A 2XDBA 1RL2A 2DZCA 2MWOA 1V29B 3CXCA 2C06A 3M4YA 5LJ3f 1BYMA 2K3XA 5CAIA 2FYKA 4OVAA 3CCVA 1VUBA 2QA4A 5IT9E 1VQKT 1M4ZA 4F7UB 4C0DB 1D3BB 2K5FA 1Q7YU 1PSEA 2LVMA 2VXEA 3URGA 4JDSA 3V8JA 3EFSA 1VQ7T 3QDRB 4D6WA 1VQPA 1K73U 5GMKj 4N4HA 3MP6A 5GANd 5CQXA 2YHTA 3C95A 2RI2A 4JRQA 3E9FA 2BKDN 3ASKA 2R58A 2ZGWA 1IZ6A 1VQ5T 1WPYA 3SFMA 3FIFA 3SWNB 4YTLA 4L6V5 1HXDA 2JNGA 4X9DA 5LJ5g 1JJ2A 3OMGA 3JB9I 3GNFB 2EJGA 3QKJA 2LQKA 4M7DG 2OTJT 3GP8A 3CCUA 1FXXA 4J7FA 2A3LA 2LT4A 1XOVA 2LNVA 3G4SA 2B8AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JCM J;  3RKW A;  4HT8 A;  4JRK A;  4C92 G;  4M7D D;  4J6W A;  3BY7 A;  3RUX A;  4NL3 A;  1JRI A;  2DTH A;  2RB6 A;  1WQ7 A;  3M4G A;  4NL2 A;  4M7A F;  1I8F A;  1WQW A;  5GAM f;  4M78 B;  4DQ2 A;  4M78 G;  4M77 G;  1MGQ A;  2VXF A;  4XTV A;  3GIB A;  3INZ A;  1Y96 A;  2K57 A;  3RIR A;  4C92 E;  4EMH A;  5GMK e;  3L1A A;  4C8Q A;  5GAN 4;  3RKY A;  3QSU A;  4EMK A;  3JB9 H;  4MMK A;  4N0A A;  4XU3 A;  3RKX A;  2EJF A;  3JCM g;  1BIA A;  1I81 A;  4M75 D;  4N0A C;  4XTY A;  4C8Q D;  1Y96 B;  2RD1 A;  4F7U F;  4V2S A;  4XU2 A;  4M7D E;  4C8Q B;  4HT9 A;  5LJ3 e;  3JCM W;  3JCM Q;  2DTI A;  4PJO E;  1M5Q 1;  2DZ9 A;  5GAN 8;  1I5L A;  2HNI A;  4M77 D;  3V7S A;  5I21 A;  3HFN A;  5GMK h;  2DTO A;  3VU3 C;  1H64 1;  4M75 G;  4A53 A;  4M75 C;  4M7A E;  4M7A B;  4M7D A;  4XTX A;  4F7U A;  5GMK m;  5LJ5 d;  2QTX A;  2DVE A;  3JCM b;  1KQ1 A;  3HFO A;  4M7D C;  3JCM h;  4C8Q G;  5GMK i;  3V8K A;  5GAM h;  4Y91 A;  1LJO A;  4J6Y A;  2I2L A;  4JUV A;  5LJ5 f;  2YLB A;  4XQ3 A;  4C8Q E;  4PJO F;  3AHU A;  4C92 A;  5GAN f;  4M75 B;  4M75 E;  3JCM f;  4M7A C;  3SWN C;  1HK9 A;  4M7A G;  5GAM j;  4C92 C;  3PGG A;  4X9C A;  3SWN A;  2Y90 A;  3QUI A;  3JCM e;  2RM4 A;  5GAN e;  2DEQ A;  3EFR A;  4M77 B;  4M77 C;  5GAM e;  1I4K 1;  1N9R A;  4M78 C;  3QHS A;  1X01 A;  4HA8 A;  4C92 F;  4M7A D;  5GAN j;  3BDU A;  5LJ3 g;  5GAO r;  3BW1 A;  1BIB A;  3BFM A;  5LJ3 j;  5LJ5 j;  4PJO G;  5GAM g;  4M77 A;  4A54 A;  4M78 A;  4XU1 A;  3JCM V;  5GAO n;  4M78 F;  4F7U E;  3V7R A;  4M77 E;  5GAN h;  2YLC A;  3HSB A;  1B34 A;  1LOJ A;  2FB7 A;  2DKG A;  5GAO p;  5GAO m;  3JCM P;  5LJ5 h;  2E10 A;  4M7D F;  4NOY A;  5GMK l;  1M8V A;  2DJZ A;  4M75 F;  5GAM d;  4MML A;  3QO3 A;  5GAO l;  1KQ2 A;  3V8L A;  4XTU A;  3RES A;  4F7U G;  2E65 A;  5LJ3 d;  1B34 B;  3L2Z A;  5GAN 3;  2EWN A;  4OP0 A;  2JN0 A;  4EMK C;  2E1H A;  5GAO q;  4RCB A;  4EMK B;  5GAN 5;  1D3B A;  4XU0 A;  2EAY A;  4C8Q C;  2DZC A;  2E64 A;  5LJ3 f;  3FB9 A;  3JCM X;  3V7C A;  2DXU A;  1LNX A;  2FYK A;  5CAI A;  1U1T A;  1YCY A;  4F7U B;  1D3B B;  2VC8 A;  5DY9 A;  2VXE A;  3JB9 J;  3V8J A;  3EFS A;  4PJO B;  3FJP A;  4PNO A;  5GMK j;  4PJO D;  5GAN d;  4M7A A;  4M7D B;  2YHT A;  3JCM d;  4JLI A;  2RA2 A;  4WF2 A;  3SB2 A;  4JRI A;  1U1S A;  4M75 A;  2ZGW A;  4M78 D;  4QVC A;  1WPY A;  4PJO A;  1WNL A;  4RCC A;  3FIF A;  3SWN B;  1JBM A;  1HXD A;  1N9S A;  4J6X A;  4X9D A;  1TH7 A;  5LJ5 g;  3JB9 G;  4PJO C;  4J5Y A;  4C92 B;  5GAN g;  3JB9 I;  3RER A;  2EJG A;  3JB9 F;  4C92 D;  5GAN 2;  4M7D G;  4M77 F;  2EJ9 A;  4QVD A;  5GAN 6;  4M78 E;  4XTZ A;  5LJ5 e;  2DXT A;  3JCM c;  2E41 A;  4EMG A;  4C8Q F;  2CGH A;  4XTW A;  5LJ3 h;  3JB9 D;  5GAN 7; 
#chains in the Genus database with same CATH topology
 5L8R E;  4HXJ A;  1EIF A;  3X24 B;  4OB1 B;  3E2U A;  5FRO A;  1XJW B;  2VXF A;  2RPN A;  5FU7 B;  4EMH A;  3QSU A;  4DBR A;  1NYG A;  4MMK A;  5FWC A;  4XTY A;  2HBW A;  2HSE B;  1PD1 A;  1SRL A;  3MCA B;  4KGV B;  1M2V A;  2F2X A;  1E6G A;  2DTI A;  2SRC A;  4MZM A;  2EBP A;  3EGX B;  1DJ7 B;  3PFS A;  5GMK m;  8ATC B;  1KQ1 A;  3HFO A;  4O5V A;  1K73 C;  4FU6 A;  3H9N A;  1Q95 G;  3OYH A;  3MO8 A;  4XAX B;  1Q86 R;  4XQ3 A;  1UEC A;  1YIJ Q;  5EC7 A;  4M7A G;  2RH2 A;  1WGS A;  2Y90 A;  2X3X D;  3EFR A;  2K9G A;  3CCJ T;  1RUW A;  2X4X A;  2JMC A;  1T3L A;  1AVZ C;  2LMJ A;  3ZFJ A;  2D0N A;  1UJ0 A;  2FB7 A;  4BE0 A;  4LDY A;  3G1J A;  4KH0 B;  2LCS A;  2J7I A;  2DVJ A;  2YXY A;  2MF2 A;  3CCL Q;  3DKM A;  2V8K A;  1RAA B;  4OP0 A;  4BY6 C;  4C8Q C;  1QKX A;  2RQT A;  5CO7 A;  2M0O A;  2RHY A;  2E6N A;  3HTR A;  3EG3 A;  3A8L B;  4J9B A;  1W2B S;  1K73 R;  1VQ6 A;  4A4G A;  2LJ3 A;  2BTT A;  4PJO B;  5AT1 B;  4R55 A;  1EZZ B;  2FEI A;  2RA2 A;  1FX7 A;  2LRQ A;  2COZ A;  1N8R C;  4PJO A;  3CCL A;  4J6X A;  3KXT A;  2DIQ A;  3JB9 G;  3RMS A;  2O4X B;  5KYW A;  5LJ5 e;  3PIP A;  3OSS C;  1QVF P;  1WHH A;  2DTH A;  2J6K A;  3LLR A;  5CKF A;  2YUO A;  1GXI E;  2KYM A;  2E12 A;  1UFF A;  2XID A;  1QVP A;  4OMF B;  1NLO C;  3T9N A;  4EMK A;  2XD0 A;  3I35 A;  1BIA A;  1MND A;  3EHQ A;  2X9H A;  3CCV Q;  2CSQ A;  3ZL7 C;  2KE9 A;  4FSX A;  4BI8 B;  5GAN 8;  3MEV A;  4M77 D;  2QEX A;  3S6W A;  1RI0 A;  1YI2 T;  1Z9Z A;  4M75 G;  2PTK A;  3WVE B;  2A37 A;  5LL6 S;  2VVK A;  4KGX B;  2JW4 A;  2CDT A;  2QA4 T;  2OTL T;  4J6Y A;  1WZO A;  2A28 A;  4DBH A;  3PGG A;  1UDL A;  2BIV A;  1K1Z A;  1VQ5 A;  3O8V A;  3OYG A;  1VIE A;  3G6E Q;  1M1K C;  1R8O B;  3QHS A;  2QK0 A;  4EIK A;  4E7L A;  5LJ3 j;  2RHU A;  2CP0 A;  2CH4 W;  4A4F A;  1U06 A;  2ZPE B;  1ARK A;  2W10 A;  2JOY A;  1AWJ A;  2J06 A;  2HQE A;  1G3T A;  2DKG A;  3E1S A;  1M8V A;  4GLM A;  1GBQ A;  1G3Y A;  2DL8 A;  3QO3 A;  2KT1 A;  3OYA A;  2AK5 A;  4PLI A;  2KT8 A;  2L3S A;  3TSZ A;  1MUZ A;  5C6S A;  2EGC A;  1QKW A;  1K9A A;  1FMW A;  4HVU A;  2PVG B;  2HD0 A;  2WSC E;  4LD9 K;  2DER A;  4PNO A;  1YJN T;  3VS3 A;  1WI7 A;  3M9Q A;  2XMF A;  5I2S A;  3OS2 A;  3SDZ A;  1Y57 A;  2KRM A;  2NUZ A;  1AOJ A;  2FO0 A;  2DXT A;  1H92 A;  3FDR A;  4IUR A;  1VQP T;  4FM4 B;  2MCN A;  4JJD A;  2C0T A;  2R5M A;  3VS5 A;  3JCM J;  4J6W A;  4D8K A;  4FYW B;  1ABQ A;  1K9M C;  2KVQ G;  4E7H A;  3FJ5 A;  4BDY A;  3INZ A;  1AWO A;  2RN8 A;  3OW2 P;  2AKK A;  3CC7 Q;  4CC7 A;  2ZPG B;  3UT1 A;  2VYT A;  2RQU A;  1Y96 B;  2CP7 A;  5CVI A;  4CC3 A;  2F5T X;  1WJS A;  3C12 A;  3M0S A;  3CC4 T;  2CZ6 B;  4JRP A;  1YI2 A;  2F1L A;  4CC2 A;  3NFC A;  3H8Z A;  1TWB A;  3CCR T;  4N4G A;  1YWP A;  1ZX6 A;  3D7S B;  3CCR A;  1FMV A;  5GAM h;  1PKS A;  2X51 A;  4X34 A;  2CZ1 B;  1IO6 A;  4M75 E;  5L23 A;  5GAM j;  1G3S A;  4X9C A;  4J8O A;  3J7A F;  2YRV A;  3L2W A;  4QQ6 A;  2VB6 A;  4OGC A;  4M77 C;  3PMI A;  1AD5 A;  2J05 A;  3OY9 A;  3LGL A;  4C0G A;  4ZGD B;  2YLC A;  1B34 A;  1Q82 U;  4BY6 B;  4RKU E;  1RLP C;  3QDF A;  4MML A;  5GAO q;  5GAN 5;  3EG2 A;  1VQN Q;  4RTW A;  1VQ5 Q;  1TUD A;  1B07 A;  1U1T A;  2V8J A;  2EQJ A;  5DM7 R;  2Y4Y A;  1RAE B;  1VQO T;  4IUP A;  1VOM A;  4PKC C;  2RQV A;  4JLG A;  1QCF A;  4TVR A;  1SSH A;  3OQ5 A;  1JBM A;  2M1H A;  1SSF A;  4FT2 A;  4EPC A;  3QJ6 A;  2EVR A;  2JUF A;  1T0H A;  2E41 A;  4C8Q F;  5KH6 A;  3RKW A;  2CP2 A;  1R0B G;  4HT8 A;  3I55 A;  2KK4 A;  4C92 G;  2RB6 A;  2E3H A;  2EQM A;  3CCS A;  1ABO A;  1VQL Q;  4DQ2 A;  1UG1 A;  4C0Z A;  1K9M R;  3TCJ A;  3QWY A;  3Q1J A;  5FU7 C;  3QZ9 B;  4PJJ A;  4ZN3 A;  1WIE A;  2JT4 A;  4UC4 A;  4M75 D;  2F69 A;  2EQU A;  4RTX A;  4V2S A;  3TQ7 P;  2QDL A;  3OYE A;  4PFP A;  3X20 B;  2KXD A;  3M54 A;  1TG0 A;  3V7S A;  2V1R A;  4XTX A;  5GJW B;  2HKN A;  4MDW A;  1K0S A;  3CMA T;  2CT4 A;  3CQT A;  1JXO A;  1TTH B;  3CBM A;  3AHU A;  2DK3 A;  3TU4 K;  4E7S A;  1I4K 1;  4ZNX A;  1VQM Q;  2O88 A;  3MEU A;  1MHN A;  3RNJ A;  2NWM A;  3BW1 A;  2JJ9 A;  3CCE T;  4J9D A;  2E70 A;  1T0J A;  2O01 E;  1RLQ C;  4RTU A;  3FLG A;  3CC2 A;  2JVV A;  3KUF A;  5A0L A;  1VQL T;  2IPO B;  2MWO A;  2C06 A;  3M4Y A;  1M1K R;  1LCK A;  2GBQ A;  4FYV B;  4WCI A;  4C0D B;  2X3W D;  1D3B B;  2PNI A;  3EFS A;  1ZBJ A;  3C95 A;  2OI3 A;  4JRQ A;  5KYY A;  2FPD A;  1Y0M A;  1QWF A;  5LJ5 g;  2JNG A;  3SHW A;  3BE3 A;  1LVK A;  3CCU A;  2A3L A;  2HMA A;  1PKT A;  2LNV A;  3CCQ T;  3TSW A;  1PM3 A;  4F16 A;  1RAF B;  1G8X A;  2XDD A;  1JRI A;  3QZ5 B;  2XIC A;  4M7A F;  1YJ9 Q;  5GAM f;  4QKU A;  4XTV A;  4JS5 A;  2CP6 A;  4JJN K;  2JTE A;  3RKY A;  2DLP A;  3JB9 H;  3VKI A;  1OU9 A;  3RMQ A;  3SD4 A;  4LXC A;  4C8Q D;  4E7K A;  2B86 A;  3CPW A;  3ZEH A;  1GBR A;  1C0M A;  3JCM Q;  2DIL A;  1T3S A;  3M0T A;  4B9W A;  1ZSZ A;  5IAY A;  3EAE A;  3OW2 A;  3ZBD A;  1UGQ B;  4J9F A;  3GNG A;  3WXM B;  1BCM A;  4FW2 A;  1YIJ T;  2ZPI B;  2HQX A;  2LTO A;  1ACM B;  3PVQ A;  3JCM e;  1W4S A;  5GAN e;  3ME9 A;  1ZUU A;  5GAM e;  1YJW A;  5KYX B;  2D8H A;  1E7O A;  4AMC A;  3GBQ A;  3HPW A;  1X6B A;  4ZGE B;  1I1J A;  2BE9 B;  1YNZ A;  2L3P A;  4J9G A;  2E6Z A;  2ZCF B;  5IHN A;  1KQ2 A;  1VQN T;  4KUD K;  1TS9 A;  2CH4 A;  2JN0 A;  3PIO A;  2K2M A;  5D7U A;  4F04 B;  2A7Y A;  3V7C A;  4B9X A;  1YJ9 A;  3G71 Q;  1WFW A;  3I56 Q;  3JB9 J;  2E4H A;  1OPK A;  3FJP A;  1OX9 A;  3F70 A;  4M7A A;  2EYW A;  2DNU A;  1M90 U;  3OYF A;  2D6F A;  1WHK A;  2XU8 A;  4PJO C;  3OSV A;  5GAN g;  3VUZ A;  1SF9 A;  2MK5 A;  2M51 A;  4Z88 A;  3REA B;  5GAN 7;  2DIG A;  3RBB B;  2LCL A;  3M55 A;  2KY9 A;  2LP5 A;  3L42 A;  3EHR A;  4HKE A;  2MWP A;  2BZX A;  2QXF A;  4E7J A;  2GQI A;  2OTJ A;  1XTD A;  1BI0 A;  2HEQ A;  3X26 B;  4PLL A;  3MP1 A;  4A4K A;  2DD4 A;  2QEX T;  1UEB A;  2KAF A;  4M7D A;  3JCM b;  2DVE A;  1OQK A;  1QCO A;  2O9S A;  2NLU A;  3REB B;  1M27 C;  2FZC B;  1WHL A;  2QA4 Q;  5DLQ E;  4C5G A;  3A5Z B;  4M78 C;  2DBK A;  2XDP A;  4P5N A;  3OYB A;  1JO8 A;  4OML A;  4FIB A;  1YJN Q;  3BFM A;  2DD5 A;  3JCM P;  1D0Z A;  4FT4 A;  4C0F A;  3SEM A;  5GAO l;  3RES A;  3C94 A;  1K8A C;  5J3B A;  3CC7 A;  1SKU B;  2EGA A;  3CC7 T;  4EMK B;  4AFS C;  2KMT A;  4OF1 A;  3CBO A;  2K79 A;  1YCY A;  2EYZ A;  2JZ2 A;  3LW5 E;  1W2B P;  1D1C A;  3NPF A;  2QTV A;  2WSF E;  4C5H A;  5J26 A;  1VQL A;  1U1S A;  4HVW A;  1M2O A;  1ZA1 B;  4M78 D;  2CKK A;  2GNC A;  3CC4 A;  4KUL A;  1N9S A;  2LQW A;  2RHZ A;  3LH5 A;  2L8D A;  1NBE B;  5CKB A;  1X75 C;  2PVD B;  3CD6 A;  1VQ6 T;  2HL3 A;  3JB9 D;  3J80 E;  4Z89 A;  3GPL A;  4JRK A;  5FRM A;  2RK2 A;  3M5A A;  4FSS A;  5GJV B;  1UHC A;  2HDA A;  1MGQ A;  2KSS A;  3GIB A;  5CKD A;  4PL6 A;  1ZUY A;  5GMK e;  1MMG A;  2VGN A;  5GAN 4;  1BI3 A;  3CEY A;  3QII A;  2MI6 A;  2M9U A;  1JU5 C;  5CIU A;  4FYX B;  3UWN A;  5A0D A;  2D8J A;  2X35 A;  1M5Q 1;  3QXE B;  2L3R A;  5I21 A;  1VQK Q;  3HKS A;  1RAC B;  1RAI B;  1ZQ1 A;  2DXC A;  2P0K A;  5M9O A;  1KFZ A;  1H8K A;  4LE9 A;  1IXD A;  3MEW A;  4JZ3 A;  3NMZ C;  2O4X A;  5KYY B;  4LD6 A;  4M7A C;  3SWN C;  4IUT A;  4ME7 A;  1M9S A;  2HCK A;  3UF4 A;  2VV5 A;  1N9R A;  1WHJ A;  1OV3 A;  2L2P A;  2LJ1 A;  4HA8 A;  2YRC A;  4QQD A;  1J3T A;  3E9G A;  3JCM V;  1X2K A;  3M0R A;  1AWX A;  2D9T A;  1JJ2 S;  1ZHI A;  5GAN h;  3HSB A;  2EYY A;  3HRS A;  5GAO p;  1AZE A;  2E10 A;  4CI0 C;  4BE2 A;  3DB4 A;  4DOW A;  1KD1 R;  3R6O A;  4LUD A;  4EMK C;  5A0G A;  3CCL T;  3A8M B;  3S3N A;  5KE3 A;  2BE7 D;  4KT0 E;  4ELY C;  3NHN A;  1D0Y A;  1GRI A;  5CCA A;  3M0P A;  4MZP A;  3G4S T;  1M90 R;  1Q86 U;  1YIT T;  1VQO A;  4JRI A;  1KIK A;  1QVG A;  5HY6 A;  3OYK A;  1KSW A;  2EYQ A;  1BI2 A;  3OB9 A;  4WTO B;  2F5K A;  3PE0 A;  5A2Q E;  2M0Y A;  1KQS A;  4QVD A;  4M78 E;  1GCQ C;  1M1F A;  2CGH A;  3L2V A;  4QVZ A;  4JPB W;  1UGV A;  5DLO A;  1I8F A;  3R6N A;  2DM1 A;  3RR6 A;  1PG5 B;  3CPW S;  2K57 A;  3VS4 A;  2EYX A;  2KRN A;  2XK0 A;  4Y92 A;  2L89 A;  1NLP C;  1RI9 A;  4FYY B;  3L2U A;  1JXM A;  1VYV A;  1NM7 A;  4HT9 A;  5LJ3 e;  4PJO E;  1I5O B;  2MMP A;  1JJ2 P;  2HKQ B;  2NUP B;  2DET A;  1Q7Y C;  5CKE A;  2J6O A;  3EG9 A;  1YIJ A;  1JEG A;  3QG1 A;  4E2F B;  1BU1 A;  4E7I A;  4KUI A;  2JTF A;  3EFO B;  1BIB A;  2OTL A;  1U5S A;  5GAO n;  2JXB A;  2ESW A;  2VGM A;  1VQ9 A;  1BBZ A;  5LJ5 h;  4NOY A;  1NZ9 A;  1LPL A;  5HCK A;  3VJP A;  2NUT A;  3CCQ A;  3I56 A;  2XDB A;  1ZSZ B;  2FYK A;  3CCV A;  1VUB A;  5IT9 E;  1VQK T;  4ANJ A;  4F7U B;  1B3Q A;  1Q7Y U;  1PSE A;  2LVM A;  1EFN A;  2VXE A;  3URG A;  3V8J A;  3QDR B;  1K73 U;  5GMK j;  3G4S Q;  5GAN d;  2FRY A;  4J9E A;  3ASK A;  2ED1 A;  2R58 A;  1IZ6 A;  1NEB A;  1WPY A;  1IGQ A;  4X9D A;  1HXD A;  1JJ2 A;  3JB9 I;  1S72 Q;  2ECZ A;  2EJG A;  2LQK A;  3I5S A;  2FPE A;  1XOV A;  1M3A A;  1BYM A;  2B8A A;  1OX8 A;  1VQ6 Q;  4IUU A;  4AFQ C;  1M30 A;  1WQW A;  1FYN A;  4VUB A;  1ZBX A;  4DA4 A;  2JS0 A;  4M77 G;  4ORZ A;  4A4E A;  1Y96 A;  1M8M A;  2COW A;  3RIR A;  1X43 A;  1M2V B;  1AWW A;  4QW2 A;  5FW9 A;  1I0C A;  2G6F X;  1VQ9 T;  4XU2 A;  2E5Q A;  2MYS A;  1CSK A;  2RF0 A;  1I5L A;  2WSE E;  3C0C A;  2DRM A;  1Q82 C;  2LC4 A;  1A0N B;  3MEA A;  5LJ5 d;  1N5Z A;  4BD3 A;  2C0I A;  5FLX E;  4C92 A;  1SG5 A;  2ZPH B;  4LDW A;  2RM4 A;  4OGE A;  2L3Q A;  2KEA A;  2EGE A;  2JTM A;  3JV3 A;  2QI2 A;  3VS7 A;  4C92 F;  2VKN A;  1SHF A;  1WXU A;  5GAO r;  2IIM A;  4M78 A;  1WHG A;  4PFZ A;  2QQA A;  5GAO m;  3LWH A;  3UAT A;  1KD1 U;  3I55 T;  4J83 A;  1D1B A;  2DL5 A;  3MKD A;  2R5A A;  4AT1 B;  1S1N A;  5I2M A;  2KXC A;  4LDV A;  3NTH A;  2P0Q A;  2Y4X A;  3EH2 A;  2QAS A;  2VC8 A;  5DY9 A;  4HCZ A;  2M02 A;  4Z02 A;  2DMO A;  3CPW P;  3LX7 A;  3SB2 A;  1MMN A;  2D0Q B;  2CP5 A;  2GFA A;  3QYH B;  1TH7 A;  2DO3 A;  1N6A A;  2AZS A;  3RER A;  1H3Z A;  4LDX A;  3JB9 F;  3LH0 A;  1CKB A;  1YFN A;  2LX9 A;  2YT6 A;  1QVF S;  3OBY A;  5IHK A;  1VQ7 Q;  1NJI R;  1I07 A;  1VIF A;  3X25 B;  4NL3 A;  1WYX A;  4JJC A;  1OPL A;  1VQM A;  2J6F A;  3OYD A;  3H0H A;  4GLK A;  9ATC B;  2JM9 A;  4N0A A;  1VQ8 Q;  3JCM g;  2DYI A;  2E3I A;  2RD1 A;  3KFV A;  4C8Q B;  1WHM A;  3PVL A;  1G3W A;  3I56 T;  1QWE A;  2HNI A;  1WLP B;  4KRT A;  3CCM A;  4M75 C;  3LGF A;  1N27 A;  3DLL A;  1OYX A;  1ZUK A;  4R56 A;  4M7D C;  4FW1 A;  2V8I A;  4QQG A;  5GMK i;  1WX6 A;  3VV0 A;  2ATC B;  4Q5W A;  1PSF A;  2RK1 A;  2LQ8 A;  2FG0 A;  2DEQ A;  4M77 B;  1K8A U;  3S3O A;  4DBQ A;  1GL5 A;  5LJ3 g;  5HK0 A;  2GFU A;  1UJY A;  1KJW A;  4M77 A;  2MIO A;  3CCQ Q;  4F7U E;  2FHD A;  3A1P A;  1QCN A;  1BKB A;  3NGP A;  3OYL A;  4CC4 B;  1Y71 A;  1BK2 A;  2BUD A;  4MDX A;  4HCC A;  1M3C A;  1PRL C;  2W0Z A;  4AFU C;  4ELZ C;  1D3B A;  4BI3 A;  2DA9 A;  3GLX A;  4KH1 B;  1Q86 C;  3S3M A;  3HP9 A;  1SRM A;  1LNX A;  2GTO A;  1YIT Q;  3OBW A;  5I22 A;  3OA6 A;  2NUP A;  1PC0 A;  4M7D B;  2RI3 A;  3EGU A;  2QQB A;  4JLI A;  3TRE A;  3G71 T;  3MET A;  4OB2 B;  3CME T;  1IGU A;  3CCS Q;  1MV0 B;  2K5L A;  2NYS A;  1QQJ A;  3CC2 Q;  1R77 A;  1O9S A;  3NTI A;  3GOX A;  4EMG A;  4XTW A;  5LJ3 h;  5D6Y A;  2DL3 A;  2PU9 B;  2RQR A;  1QMC A;  1VQM T;  2ROL A;  1XNI A;  2AT1 B;  3MJX A;  3DLM A;  3CCU T;  3L1A A;  2KRS A;  1V1C A;  2EKO A;  4ATO A;  1K9M U;  3OW2 S;  2K7A A;  3ER0 A;  2ROT A;  3JCM W;  1QVG P;  1YP5 A;  2DFU A;  5I11 A;  2CYZ B;  4NS5 A;  3VRY A;  3VYH B;  1VQ4 Q;  1AT1 B;  1M90 C;  4HCK A;  2DTO A;  3VU3 C;  1TUG B;  1H64 1;  4A53 A;  2EFI A;  4M7A B;  2FVU A;  2QTX A;  3PT9 A;  3OYC A;  3OYM A;  3OYI A;  4JS4 A;  3JCM h;  2DXB A;  4IIO A;  5KCO A;  3V8K A;  1PNJ A;  4FCY A;  3QBY A;  1OZ3 A;  2I2L A;  4F17 A;  2EW3 A;  1G5V A;  4MZT A;  1HK9 A;  5KYX A;  6AT1 B;  5IH2 A;  1IRX A;  3SWN A;  3QUI A;  2HBP A;  1YHQ T;  4BAC A;  3H0F A;  2DBM A;  1UUE A;  1WJQ A;  5LJ5 j;  3X28 B;  5FWB A;  4PJO G;  1C6V X;  4A54 A;  1YJ9 T;  2QYZ A;  3V7R A;  2DJQ A;  2LJ0 A;  5FU6 B;  8AT1 B;  1WXB A;  2DJZ A;  2RO0 A;  2ED0 A;  4ESR A;  5GAM d;  3THK A;  1KK7 A;  3M59 A;  3VS0 A;  2DX1 A;  2VUB A;  1B34 B;  1YN8 A;  3OYY A;  2HAX A;  2RMO A;  5FU6 C;  4RCB A;  1WXT A;  2EAY A;  1E6H A;  1F1B B;  1Q81 R;  1QW1 A;  1VQO Q;  1HYO A;  2DXU A;  3P8H A;  1M1K U;  3EH1 A;  3I5R A;  3EGX A;  4AFZ C;  3UPU A;  2KGT A;  3BDL A;  4RG2 A;  5CQY A;  1AHJ B;  3LYI A;  2KQW A;  3J81 E;  1TSF A;  2K6D A;  1NPR A;  3L2Q A;  3CME Q;  1R0C B;  1X2Q A;  4C92 D;  2PZ1 A;  4R0K A;  2EJ9 A;  3EGD B;  4RMO A;  2VAS A;  3M0Q A;  3JCM c;  1GCQ A;  2XI9 A;  1K76 A;  1IRE B;  2WAC A;  5EG2 A;  5KYW B;  3L2R A;  1WQ7 A;  3CCE Q;  2X4Y A;  2EIF A;  4HVV A;  3HRT A;  3N5B B;  2PUK B;  4X1V A;  4C92 E;  1GFD A;  1KQS S;  2LX7 A;  1XQH A;  2ZAE A;  3CD6 Q;  5D6W A;  4OMQ A;  1Q7Y R;  3PMT A;  3HL8 A;  3CCR Q;  2P4R A;  2OAU A;  7AT1 B;  3UA7 A;  2C0O A;  2KDS A;  5GMK h;  3CMA Q;  3EG1 A;  2EQI A;  4M7A E;  3CC4 Q;  4IUV A;  3FEO A;  2QEX Q;  5IXB A;  4JUV A;  2RHX A;  3H41 A;  1IHW A;  4AG2 C;  2AKL A;  4LN2 A;  4M75 B;  2RI5 A;  3JCM f;  1K8A R;  2OTJ Q;  3RDV A;  3JSC A;  5KE2 A;  1Q81 C;  3G6E A;  1TOV A;  1UTI A;  3WVD B;  1OUL A;  4EDU A;  1UE9 A;  2HL5 C;  3E19 A;  5IXF A;  3CD6 T;  4E6R A;  4RG8 A;  1W70 A;  4M77 E;  4M7D F;  1JQQ A;  4RUG A;  1VQ8 T;  1HSQ A;  1Z9Q A;  2CUD A;  2QQ9 A;  2EQK A;  3GF5 A;  2JMA A;  2MAM A;  2EPD A;  1O75 A;  2FPF A;  2SEM A;  1RL2 A;  2DZC A;  1RAB B;  5LJ3 f;  2K3X A;  5CAI A;  1W6X A;  2CUB A;  1M4Z A;  1VA7 A;  2KR3 A;  2FZG B;  1GCP A;  1VQ7 T;  1W1F A;  1VQP A;  4N4H A;  2RI2 A;  3E9F A;  4RTY A;  2ZGW A;  1VQ5 T;  3SFM A;  3FIF A;  2V1Q A;  3GNF B;  1ZSG A;  2OTJ T;  4RTT A;  3GP8 A;  1ZA2 B;  2VWF A;  4J7F A;  2LT4 A;  2A36 A;  1P92 A;  3G4S A;  2QGG A;  4ZTJ A;  1OI1 A;  3BY7 A;  3P8B B;  2F2V A;  3M4G A;  3MPU B;  4ZN1 A;  4M78 G;  2LCC A;  2CRE A;  5J39 A;  4QT7 A;  4XU3 A;  1BCO A;  4F7U F;  1V76 A;  1NE8 A;  2KNB B;  3DB3 A;  3OYJ A;  2DZ9 A;  2DEU A;  4F7U A;  1NJI C;  1WDX A;  1YHQ Q;  4GBQ A;  4A4H A;  3CCV T;  4D8D A;  1QVF A;  2YLB A;  4C8Q E;  1BI1 A;  4PJO F;  2ENM A;  1N8R U;  1AEY A;  4CRI A;  4XK8 E;  4C92 C;  3O5Z A;  1PWT A;  4IIM A;  4KGZ B;  4M4Z A;  1BB9 A;  2CT3 A;  3ULR B;  2YUQ A;  5GAN j;  1H3H A;  3BDU A;  1UB4 A;  1OU8 A;  4KBM B;  2GF7 A;  3MP8 A;  3UDC A;  3JRZ A;  1VQ9 Q;  2HSP A;  4JZ4 A;  1VQP Q;  3QYG B;  1YHQ A;  1PHT A;  4XTU A;  2RJF A;  2AHJ B;  2QG9 B;  4BI4 A;  3VYG A;  3FB9 A;  2P4T A;  3OS0 A;  1OEB A;  1U3O A;  1D09 B;  1QVG S;  1KG1 A;  3JCM d;  2LQN A;  1S72 T;  3EG9 B;  1S72 A;  1UGP B;  2K3Y A;  3MHX A;  4F14 A;  4J5Y A;  4C92 B;  5GAN 2;  4M77 F;  3QWX X;  2RHI A;  2FZK B;  2KBT A;  1CKA A;  1NPP A;  1KHI A;  3JAM E;  1IB8 A;  1Q82 R;  2DE0 X;  2IG0 A;  2CS7 A;  4DEX A;  4M78 B;  4C5E A;  1Y7X A;  2EKH A;  4J9H A;  2A0F B;  2DPP B;  2D1X A;  5HK3 A;  2RNA A;  1W2B A;  4DEY A;  2V26 A;  2EJF A;  3FRN A;  4N0A C;  1AZG B;  1K4U S;  2LDM A;  3CCU Q;  4OMO A;  1UGR B;  1MMD A;  3HFN A;  4LNP A;  1HD3 A;  1M3B A;  4II1 A;  2OTL Q;  2KYB A;  2COY A;  3CPF A;  1X27 A;  2A08 A;  3G7Z A;  1K0X A;  1WA7 A;  1LJO A;  2GQV A;  1X6G A;  3C4S A;  3VS2 A;  5LJ5 f;  1MMA A;  2ZPB B;  4RTZ A;  1KC8 R;  2ZZD A;  1C1A A;  3M58 A;  2K3B A;  3TVT A;  2H3J A;  3CC2 T;  3EFO A;  1TUC A;  3CCS T;  1X01 A;  5HKC A;  4L5G A;  4IUQ A;  3CME A;  5CKH A;  2AIR B;  3CCJ Q;  5GAM g;  3CMA A;  1QLY A;  4XU1 A;  2NUT B;  4M78 F;  4ZTF A;  1VQ4 T;  3CXC P;  1MNE A;  2YSQ A;  2LZ6 B;  4Z8A A;  1NYF A;  3FC3 A;  2YUN A;  2R57 A;  3V8L A;  2F2W A;  1KD1 C;  4F7U G;  2E1H A;  2L5Q A;  2P0P A;  4PJN A;  4K11 A;  2E64 A;  3JCM X;  3A8H B;  2PVO B;  3CCE A;  2QGF B;  2YUP A;  2K2V A;  5ECA A;  5FRN A;  1VQN A;  1TXQ A;  3KBG A;  1YWO A;  4QVC A;  1WNL A;  2H3E B;  1Y07 A;  3U23 A;  4O6J A;  3UA6 A;  2I0N A;  4LDU A;  3AT1 B;  2ABL A;  2HZY A;  4C5I A;  4M7D D;  1ZLM A;  3VRZ A;  5KCH A;  2DL4 A;  4J7I A;  1X6O A;  2PQW A;  2BZY A;  2QQS A;  3H6Z A;  2RJE A;  2GTJ A;  2OX7 A;  5IHI A;  3I55 Q;  1NEG A;  1VQ4 A;  1KC8 C;  1I81 A;  3HHT B;  4OB3 B;  4M7D E;  5KYU B;  5C0M A;  3QPH A;  4BDZ A;  3A8O B;  1X69 A;  4DOV A;  1KQS P;  5KYU A;  2YDL A;  2Z0W A;  1TU0 B;  3VUB A;  2ZPF B;  5GAN f;  1SPK A;  4OB0 B;  5IN1 A;  2QAZ A;  2G3R A;  4PFO A;  1SHG A;  1RAG B;  4GY5 A;  5CK9 A;  5AYF A;  2M16 A;  4M7A D;  2PUO B;  3OYN A;  2DYB A;  4HCB A;  1VQK A;  2RQW A;  4JJB A;  2CSI A;  4E47 A;  1NJI U;  2YWW A;  5CR2 A;  1LOJ A;  1OOT A;  3OS1 A;  5GMK l;  2X4W A;  3H0I A;  1HJD A;  2RJD A;  2AZV A;  2DAQ A;  1IHV A;  1VYU A;  1JB0 E;  4Y28 E;  1WJR A;  2E65 A;  4OMN A;  5LJ3 d;  3L2Z A;  5GAN 3;  1QP2 A;  3M57 A;  4A63 B;  1B7T A;  1ZSZ C;  2GGR A;  2QDY B;  2DF6 A;  3CXC S;  2OAW A;  3M0U A;  3LWI A;  2JM8 A;  1U8R A;  4PJO D;  4FL6 A;  3A8G B;  4BE1 A;  4WF2 A;  4M75 A;  4E7Z A;  2QQR A;  3M56 A;  4RCC A;  4N4I A;  1KHC A;  3CCJ A;  2XKO C;  4OMP A;  3A98 A;  4AG1 C;  2KRO A;  3OS5 A;  2H8H A;  5GAN 6;  4XTZ A;  1UGS B;  3OMC A;  1MV3 A;  1D0X A;  2FRW A;  2O31 A;  2O9V A;  3RUX A;  2RJC A;  3CBP A;  4NL2 A;  1EX4 A;  1RAH B;  1NG2 A;  5D6X A;  1GFC A;  2MOX A;  4B6M A;  2O2O A;  3G6E T;  2GCX A;  4C8Q A;  2JS2 A;  2K5I A;  3CCM Q;  1OZ2 A;  3I9Q A;  2FL7 A;  4BUG A;  3IQL A;  3RKX A;  1YIT A;  3M53 A;  5KYN A;  1G83 A;  4RTV A;  3P8D A;  2K4Y A;  1YJW T;  3PTA A;  2MPX C;  2P84 A;  2OJ2 A;  1YI2 Q;  3NTK A;  1FWZ A;  4C8Q G;  3TEE A;  1KC8 U;  1PD0 A;  4OMM A;  2CZ0 B;  1YJW Q;  4Y91 A;  3VS6 A;  4ZGJ B;  1G2B A;  4BB7 A;  2XG8 D;  4C0D C;  2X4J A;  2CZ7 B;  4PK4 A;  3G71 A;  1VQ7 A;  1UHF A;  1YBY A;  3CCM T;  2DRK A;  2IVW A;  4LUE A;  3EGD A;  2DL7 A;  3PNW C;  3QJY A;  2LNH B;  4L59 A;  2BZ8 A;  4DBF A;  4J9I A;  2E5K A;  1PCX A;  2XHC A;  4PJM A;  4J9C A;  2YRD A;  4M75 F;  1VQ8 A;  1QP3 A;  4IKF A;  1Q81 U;  1M1G A;  1YJN A;  1VYT A;  2EWN A;  2LT1 A;  3HRU A;  1D1A A;  4PJL A;  2L0A A;  4XU0 A;  1FMK A;  3CXC A;  1V29 B;  1YCS B;  1RAD B;  4OVA A;  2QA4 A;  2K5F A;  4JDS A;  3VS1 A;  1SEM A;  4D6W A;  3MP6 A;  5CQX A;  2YHT A;  1N8R R;  2BKD N;  3SWN B;  4YTL A;  4L6V 5;  3EG0 A;  3OMG A;  4M7D G;  3QKJ A;  2KI7 A;  1FXX A;  1PRM C;  2HQH A;  2CP3 A; 
#chains in the Genus database with same CATH homology
 5L8R E;  4ZTJ A;  1OI1 A;  3BY7 A;  2XDD A;  1JRI A;  1EIF A;  3QZ5 B;  3P8B B;  2XIC A;  3M4G A;  4M7A F;  4IUU A;  3X24 B;  1WQW A;  5GAM f;  4ZN1 A;  4OB1 B;  4VUB A;  1ZBX A;  5FRO A;  4DA4 A;  4M78 G;  4M77 G;  4XTV A;  2VXF A;  4JS5 A;  4A4E A;  1Y96 A;  4JJN K;  5FU7 B;  3RIR A;  2LCC A;  4EMH A;  5J39 A;  4QW2 A;  3RKY A;  3QSU A;  3JB9 H;  4MMK A;  4XU3 A;  3VKI A;  4XTY A;  3RMQ A;  3SD4 A;  4C8Q D;  4F7U F;  4E7K A;  1VQ9 T;  1NE8 A;  3MCA B;  4XU2 A;  3CPW A;  3DB3 A;  3ZEH A;  2E5Q A;  3JCM Q;  2DTI A;  3OYJ A;  4B9W A;  2DZ9 A;  1I5L A;  2WSE E;  4MZM A;  5IAY A;  3EAE A;  1DJ7 B;  1Q82 C;  3PFS A;  3OW2 A;  3ZBD A;  2LC4 A;  4F7U A;  3MEA A;  5GMK m;  5LJ5 d;  1NJI C;  1KQ1 A;  3HFO A;  4O5V A;  1K73 C;  1UGQ B;  4FU6 A;  4A4H A;  3CCV T;  3GNG A;  3OYH A;  3MO8 A;  4XAX B;  4BD3 A;  1QVF A;  2YLB A;  4XQ3 A;  5FLX E;  4C8Q E;  3WXM B;  1BI1 A;  4PJO F;  4C92 A;  1N8R U;  4M7A G;  1YIJ T;  4CRI A;  2RH2 A;  2ZPH B;  1WGS A;  2ZPI B;  2HQX A;  2LTO A;  4XK8 E;  4C92 C;  2Y90 A;  4LDW A;  3JCM e;  2RM4 A;  1W4S A;  5GAN e;  3ME9 A;  3EFR A;  4OGE A;  5GAM e;  2JTM A;  1YJW A;  3CCJ T;  2QI2 A;  4C92 F;  5GAN j;  3BDU A;  2X4X A;  5GAO r;  1UB4 A;  3HPW A;  4KBM B;  4M78 A;  2GF7 A;  4ZGE B;  2QQA A;  3ZFJ A;  3CCQ T;  3MP8 A;  5GAO m;  3LWH A;  2FB7 A;  3UDC A;  3JRZ A;  2E6Z A;  4BE0 A;  4LDY A;  3I55 T;  4J83 A;  1KD1 U;  2R5A A;  3QYG B;  1YHQ A;  2ZCF B;  1KQ2 A;  1VQN T;  4KUD K;  2MF2 A;  4XTU A;  5I2M A;  3DKM A;  2RJF A;  2V8K A;  4OP0 A;  2JN0 A;  4LDV A;  2AHJ B;  3PIO A;  4BY6 C;  4C8Q C;  3NTH A;  4BI4 A;  2P0Q A;  3VYG A;  2A7Y A;  2Y4X A;  3FB9 A;  2P4T A;  3V7C A;  4B9X A;  3OS0 A;  5CO7 A;  1YJ9 A;  2M0O A;  2RHY A;  2E6N A;  1W2B S;  3A8L B;  1VQ6 A;  4A4G A;  2VC8 A;  5DY9 A;  3JB9 J;  4PJO B;  3FJP A;  4HCZ A;  4R55 A;  1QVG S;  1KG1 A;  3F70 A;  4Z02 A;  4M7A A;  3JCM d;  2RA2 A;  1FX7 A;  2LRQ A;  3LX7 A;  3SB2 A;  1N8R C;  3OYF A;  1M90 U;  1S72 T;  2D6F A;  2D0Q B;  1S72 A;  1UGP B;  2K3Y A;  3MHX A;  4PJO A;  3CCL A;  2XU8 A;  2GFA A;  3QYH B;  4J6X A;  3KXT A;  4PJO C;  2DIQ A;  1TH7 A;  2DO3 A;  3RMS A;  3JB9 G;  4J5Y A;  4C92 B;  1N6A A;  2O4X B;  3OSV A;  3VUZ A;  5GAN g;  3RER A;  1H3Z A;  4LDX A;  3JB9 F;  5GAN 2;  3LH0 A;  4M77 F;  2LX9 A;  1QVF S;  5LJ5 e;  3OBY A;  3PIP A;  3OSS C;  2RHI A;  1NPP A;  1KHI A;  5GAN 7;  3JAM E;  2DIG A;  2LCL A;  1VIF A;  3X25 B;  4NL3 A;  2IG0 A;  2DTH A;  3M55 A;  3LLR A;  2KY9 A;  2CS7 A;  5CKF A;  1VQM A;  4M78 B;  4C5E A;  1Y7X A;  3L42 A;  1GXI E;  3OYD A;  2E12 A;  4GLK A;  2XID A;  2DPP B;  2MWP A;  1QVP A;  4HKE A;  5HK3 A;  4OMF B;  2QXF A;  4E7J A;  1W2B A;  3T9N A;  2OTJ A;  1XTD A;  4EMK A;  2XD0 A;  4N0A A;  2EJF A;  3FRN A;  3JCM g;  1BIA A;  1BI0 A;  4N0A C;  2RD1 A;  4C8Q B;  2LDM A;  1G3W A;  4FSX A;  1UGR B;  4PLL A;  3X26 B;  4BI8 B;  5GAN 8;  3MP1 A;  3I56 T;  2HNI A;  3MEV A;  4M77 D;  4A4K A;  3HFN A;  3S6W A;  4II1 A;  2DD4 A;  1RI0 A;  2QEX A;  2QEX T;  1YI2 T;  4M75 G;  3CCM A;  1UEB A;  2KAF A;  4M75 C;  3CPF A;  3LGF A;  3WVE B;  1N27 A;  3JCM b;  5LL6 S;  4M7D A;  2DVE A;  3DLL A;  1OYX A;  4R56 A;  4M7D C;  3G7Z A;  2V8I A;  4QQG A;  5GMK i;  2QA4 T;  2OTL T;  1LJO A;  2GQV A;  4J6Y A;  3C4S A;  5LJ5 f;  3VV0 A;  2ZPB B;  4Q5W A;  2NLU A;  1PSF A;  2ZZD A;  2RK1 A;  3M58 A;  3PGG A;  2LQ8 A;  2BIV A;  2H3J A;  3CC2 T;  5DLQ E;  2DEQ A;  4M77 B;  4C5G A;  1VQ5 A;  3A5Z B;  3O8V A;  1VIE A;  3OYG A;  3CCS T;  4M78 C;  3S3O A;  1K8A U;  1M1K C;  1R8O B;  3QHS A;  1X01 A;  5HKC A;  4L5G A;  2XDP A;  4P5N A;  4IUQ A;  3OYB A;  5LJ3 g;  3CME A;  4E7L A;  4FIB A;  5CKH A;  5HK0 A;  3BFM A;  2GFU A;  2RHU A;  5LJ3 j;  5GAM g;  4M77 A;  3CMA A;  4XU1 A;  2ZPE B;  4A4F A;  2DD5 A;  2JOY A;  4M78 F;  4F7U E;  4ZTF A;  1VQ4 T;  2HQE A;  1G3T A;  2FHD A;  2DKG A;  3E1S A;  3JCM P;  1M8V A;  1BKB A;  1G3Y A;  4FT4 A;  4C0F A;  3FC3 A;  3QO3 A;  2R57 A;  5GAO l;  3V8L A;  3RES A;  3C94 A;  3OYL A;  5J3B A;  4F7U G;  1Y71 A;  3OYA A;  3CC7 A;  1K8A C;  1KD1 C;  3CC7 T;  2BUD A;  4MDX A;  2E1H A;  4ELZ C;  4HCC A;  2L5Q A;  4EMK B;  4PLI A;  1D3B A;  2P0P A;  4BI3 A;  3GLX A;  1Q86 C;  3S3M A;  2E64 A;  2KMT A;  3HP9 A;  4OF1 A;  3JCM X;  3CBO A;  3A8H B;  5C6S A;  1LNX A;  2PVO B;  3CCE A;  1YCY A;  2JZ2 A;  3LW5 E;  2PVG B;  2HD0 A;  2WSC E;  4LD9 K;  3OBW A;  3OA6 A;  2K2V A;  4PNO A;  2WSF E;  4M7D B;  2RI3 A;  1YJN T;  4C5H A;  2QQB A;  4JLI A;  3TRE A;  5FRN A;  3G71 T;  5J26 A;  1VQN A;  3MET A;  1VQL A;  1U1S A;  3KBG A;  4OB2 B;  3M9Q A;  4M78 D;  4QVC A;  2CKK A;  3CME T;  1WNL A;  3CC4 A;  4KUL A;  5I2S A;  1Y07 A;  2K5L A;  1N9S A;  4O6J A;  3OS2 A;  2RHZ A;  3SDZ A;  2L8D A;  1O9S A;  5CKB A;  1X75 C;  2PVD B;  3NTI A;  3GOX A;  2DXT A;  4EMG A;  3FDR A;  4IUR A;  1VQ6 T;  4XTW A;  1VQP T;  3CD6 A;  5LJ3 h;  4FM4 B;  4LDU A;  5D6Y A;  3JB9 D;  2R5M A;  3J80 E;  3GPL A;  3JCM J;  2PU9 B;  4JRK A;  4C5I A;  5FRM A;  4M7D D;  4J6W A;  5KCH A;  2RK2 A;  1VQM T;  1XNI A;  3M5A A;  4J7I A;  1X6O A;  1K9M C;  2KVQ G;  4E7H A;  1MGQ A;  2PQW A;  4BDY A;  2KSS A;  2QQS A;  3DLM A;  3INZ A;  5CKD A;  3GIB A;  3H6Z A;  4PL6 A;  5GMK e;  2RJE A;  3L1A A;  3CCU T;  2VGN A;  5GAN 4;  1BI3 A;  2EKO A;  3CEY A;  4ATO A;  1K9M U;  2ZPG B;  3QII A;  1VQ4 A;  2MI6 A;  1KC8 C;  3OW2 S;  1I81 A;  3UT1 A;  2VYT A;  1Y96 B;  3ER0 A;  3HHT B;  5CVI A;  4OB3 B;  4M7D E;  2M9U A;  5CIU A;  3UWN A;  2F5T X;  5A0D A;  3JCM W;  2X35 A;  1WJS A;  3C12 A;  1M5Q 1;  3QXE B;  3CC4 T;  2CYZ B;  4NS5 A;  2CZ6 B;  3VYH B;  2L3R A;  5C0M A;  5I21 A;  4JRP A;  3QPH A;  4BDZ A;  1YI2 A;  2DTO A;  1M90 C;  3A8O B;  3VU3 C;  3HKS A;  1H64 1;  3H8Z A;  3NFC A;  2EFI A;  4A53 A;  4M7A B;  4DOV A;  2FVU A;  2QTX A;  3PT9 A;  3OYC A;  3CCR T;  3OYM A;  4N4G A;  3OYI A;  3JCM h;  4JS4 A;  2DXB A;  3CCR A;  5KCO A;  3V8K A;  5GAM h;  1ZQ1 A;  2DXC A;  3QBY A;  4X34 A;  1OZ3 A;  2I2L A;  2P0K A;  5M9O A;  3VUB A;  3MEW A;  2CZ1 B;  2ZPF B;  5GAN f;  4OB0 B;  2O4X A;  4MZT A;  4M75 E;  4LD6 A;  5IN1 A;  3SWN C;  1HK9 A;  4M7A C;  5GAM j;  4IUT A;  4ME7 A;  1G3S A;  1M9S A;  2G3R A;  4X9C A;  3SWN A;  3QUI A;  4J8O A;  3J7A F;  2VV5 A;  2YRV A;  2HBP A;  4QQ6 A;  3L2W A;  4GY5 A;  4BAC A;  1YHQ T;  4OGC A;  4M77 C;  5CK9 A;  1N9R A;  5AYF A;  2M16 A;  4HA8 A;  4QQD A;  3PMI A;  3E9G A;  2PUO B;  3OYN A;  4M7A D;  1WJQ A;  5LJ5 j;  3X28 B;  3OY9 A;  4HCB A;  4PJO G;  1VQK A;  4A54 A;  1YJ9 T;  3JCM V;  3LGL A;  4E47 A;  1JJ2 S;  2D9T A;  4C0G A;  1ZHI A;  1NJI U;  4ZGD B;  3V7R A;  5GAN h;  2YLC A;  5FU6 B;  5CR2 A;  1B34 A;  1LOJ A;  3HRS A;  5GAO p;  4BY6 B;  1Q82 U;  3HSB A;  3OS1 A;  2E10 A;  4CI0 C;  5GMK l;  4RKU E;  2X4W A;  4BE2 A;  2RJD A;  2DJZ A;  2RO0 A;  2DAQ A;  3DB4 A;  5GAM d;  4MML A;  1JB0 E;  4Y28 E;  3M59 A;  1WJR A;  2E65 A;  5LJ3 d;  2VUB A;  1B34 B;  4DOW A;  3L2Z A;  3R6O A;  5GAN 3;  3OYY A;  4EMK C;  5A0G A;  2HAX A;  5FU6 C;  1QP2 A;  3M57 A;  4RCB A;  5GAN 5;  3A8M B;  5GAO q;  2EAY A;  3CCL T;  5KE3 A;  3S3N A;  4KT0 E;  4ELY C;  1QW1 A;  2DXU A;  1G5V A;  2QDY B;  1U1T A;  3P8H A;  5CCA A;  2V8J A;  3CXC S;  2EQJ A;  4MZP A;  5DM7 R;  3LWI A;  2Y4Y A;  3G4S T;  1M1K U;  1Q86 U;  1VQO T;  4IUP A;  3UPU A;  1YIT T;  1U8R A;  4PJO D;  1VQO A;  3BDL A;  4PKC C;  4FL6 A;  4RG2 A;  3A8G B;  4BE1 A;  4JLG A;  4WF2 A;  5CQY A;  4JRI A;  4M75 A;  4TVR A;  2QQR A;  1AHJ B;  3LYI A;  1QVG A;  3M56 A;  2KQW A;  4RCC A;  5HY6 A;  3J81 E;  4N4I A;  3OYK A;  1KHC A;  1JBM A;  3OQ5 A;  3CCJ A;  2XKO C;  1NPR A;  3L2Q A;  2M1H A;  1SSF A;  2EYQ A;  4FT2 A;  4EPC A;  1BI2 A;  3OB9 A;  2F5K A;  4C92 D;  3OS5 A;  3QJ6 A;  5A2Q E;  4RMO A;  2EJ9 A;  1KQS A;  4QVD A;  5GAN 6;  4M78 E;  2JUF A;  4XTZ A;  3JCM c;  1UGS B;  1M1F A;  2E41 A;  4C8Q F;  2CGH A;  5KH6 A;  2XI9 A;  3OMC A;  3L2V A;  3RKW A;  4QVZ A;  1IRE B;  2WAC A;  4HT8 A;  5EG2 A;  2KK4 A;  3I55 A;  4C92 G;  3RUX A;  3L2R A;  2RB6 A;  1WQ7 A;  2EQM A;  2RJC A;  3CBP A;  4NL2 A;  5DLO A;  3CCS A;  1I8F A;  5D6X A;  4DQ2 A;  2X4Y A;  2EIF A;  4C0Z A;  3HRT A;  3TCJ A;  3G6E T;  3CPW S;  2K57 A;  2PUK B;  3N5B B;  4C92 E;  2GCX A;  3Q1J A;  5FU7 C;  4C8Q A;  2K5I A;  1KQS S;  2XK0 A;  1OZ2 A;  3QZ9 B;  2L89 A;  4ZN3 A;  2FL7 A;  4BUG A;  3RKX A;  1YIT A;  4UC4 A;  3L2U A;  1XQH A;  4M75 D;  2F69 A;  2EQU A;  4V2S A;  3M53 A;  3OYE A;  3X20 B;  4HT9 A;  5D6W A;  5LJ3 e;  3PMT A;  3HL8 A;  4PJO E;  3M54 A;  3P8D A;  2K4Y A;  3V7S A;  2MMP A;  2OAU A;  5GMK h;  3PTA A;  1YJW T;  2KDS A;  4M7A E;  4XTX A;  4IUV A;  3FEO A;  3NTK A;  1FWZ A;  4MDW A;  3TEE A;  4C8Q G;  1KC8 U;  1P92 A;  1Q7Y C;  2CZ0 B;  5CKE A;  4Y91 A;  3CMA T;  4JUV A;  2RHX A;  3CBM A;  4ZGJ B;  4C0D C;  4BB7 A;  2XG8 D;  3AHU A;  4M75 B;  2RI5 A;  2X4J A;  3JCM f;  2DK3 A;  2CZ7 B;  1YIJ A;  3G71 A;  1VQ7 A;  1YBY A;  3TU4 K;  3JSC A;  5KE2 A;  3CCM T;  2IVW A;  1Q81 C;  3G6E A;  1I4K 1;  3QG1 A;  4E7I A;  3PNW C;  4KUI A;  3QJY A;  2JTF A;  3WVD B;  3MEU A;  1MHN A;  4EDU A;  3BW1 A;  3E19 A;  1BIB A;  4L59 A;  2OTL A;  3CCE T;  5GAO n;  2E70 A;  3CD6 T;  2VGM A;  4M77 E;  4RG8 A;  2O01 E;  1VQ9 A;  4M7D F;  2XHC A;  5LJ5 h;  4NOY A;  1VQ8 T;  1NZ9 A;  4M75 F;  1VQ8 A;  3VJP A;  2QQ9 A;  1QP3 A;  2EQK A;  3GF5 A;  3FLG A;  3CCQ A;  3I56 A;  3CC2 A;  1Q81 U;  2JVV A;  4IKF A;  1M1G A;  3KUF A;  5A0L A;  2MAM A;  1YJN A;  1O75 A;  2EWN A;  2LT1 A;  3HRU A;  1VQL T;  4XU0 A;  2XDB A;  1RL2 A;  2DZC A;  2MWO A;  1V29 B;  3CXC A;  2C06 A;  3M4Y A;  5LJ3 f;  1BYM A;  2K3X A;  5CAI A;  2FYK A;  4OVA A;  3CCV A;  1VUB A;  2QA4 A;  5IT9 E;  1VQK T;  1M4Z A;  4F7U B;  4C0D B;  1D3B B;  2K5F A;  1Q7Y U;  1PSE A;  2LVM A;  2VXE A;  3URG A;  4JDS A;  3V8J A;  3EFS A;  1VQ7 T;  3QDR B;  4D6W A;  1VQP A;  1K73 U;  5GMK j;  4N4H A;  3MP6 A;  5GAN d;  5CQX A;  2YHT A;  3C95 A;  2RI2 A;  4JRQ A;  3E9F A;  2BKD N;  3ASK A;  2R58 A;  2ZGW A;  1IZ6 A;  1VQ5 T;  1WPY A;  3SFM A;  3FIF A;  3SWN B;  4YTL A;  4L6V 5;  1HXD A;  2JNG A;  4X9D A;  5LJ5 g;  1JJ2 A;  3OMG A;  3JB9 I;  3GNF B;  2EJG A;  3QKJ A;  2LQK A;  4M7D G;  2OTJ T;  3GP8 A;  3CCU A;  1FXX A;  4J7F A;  2A3L A;  2LT4 A;  1XOV A;  2LNV A;  3G4S A;  2B8A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...