3JB9G

Cryo-em structure of the yeast spliceosome at 3.6 angstrom resolution
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
97
structure length
95
Chain Sequence
RLEEYEFSAGPLSVLQQAVKNHDQVLINCRNNKKLLARVKAFDRHSNMVLENVKEMWTEKKRTASGGKAINKDRFISKMFLRGDGVVLVVRIPSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pre-mRNA-splicing factor spp42
publication title Structure of a yeast spliceosome at 3.6-angstrom resolution
pubmed doi rcsb
molecule tags Rna binding protein/rna
total genus 17
structure length 95
sequence length 97
chains with identical sequence l
ec nomenclature
pdb deposition date 2015-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3jb9G00
5GAOq 3SWNB 2VXEA 3BDUA 3HSBA 5GMKe 4DQ2A 5GANj 4C92B 3JB9F 4XU3A 3JCMd 1D3BA 3JCMW 4A54A 2DKGA 4M77E 4EMHA 5GAN8 4EMKB 4M77F 3JCMg 2VC8A 4M75B 5GMKj 4NL3A 2DEQA 4NL2A 4WF2A 3RKWA 5GAN5 1LOJA 1M5Q1 4PJOB 4C92D 3QSUA 1U1TA 1WQ7A 4J6WA 2DTHA 4M7AG 3JCMe 2EWNA 2I2LA 1X01A 3RIRA 5LJ3d 5LJ3f 1I81A 3GIBA 2DVEA 4J6YA 4M75D 3SWNA 1BIBA 4M7DB 4XTYA 2FYKA 3V8JA 4C8QE 4M78E 1N9SA 4NOYA 4XU2A 4C92A 3EFRA 2EJFA 2E41A 4C8QF 4M78F 4EMGA 4JRIA 5GAMg 3SWNC 5GAN7 5GAN4 3JB9I 4J6XA 4PJOD 4EMKA 2E65A 4F7UB 4C92C 5LJ5d 3BY7A 3FB9A 4M75A 5I21A 5LJ5f 4XU0A 5GMKi 5GAN6 4PNOA 5GAOr 4EMKC 2DTOA 4XTXA 5GMKh 4XU1A 3RESA 4M75C 2RD1A 4M7DD 4PJOA 4C92G 5GAMe 1I8FA 2DXTA 4Y91A 2E1HA 3JCMQ 1HK9A 3AHUA 3RERA 2CGHA 4HT8A 4PJOC 2DTIA 2DZ9A 3FJPA 3QHSA 4M75G 3EFSA 3HFOA 2RM4A 3V8KA 4M7DA 4M7AB 2EAYA 1YCYA 5GAMj 3V7CA 2FB7A 3V8LA 4PJOG 4M7DC 3L2ZA 4HT9A 4F7UA 2DJZA 2E64A 3M4GA 2DXUA 1U1SA 2JN0A 5LJ3g 4M77B 4RCCA 2E10A 5GANh 4M7DG 3JCMV 3QO3A 2K57A 4XTZA 4M7AD 3FIFA 4JUVA 5GANf 3V7RA 4X9DA 2YLBA 2YHTA 4F7UG 4C92E 5LJ5g 3JB9D 4XQ3A 1I5LA 3JCMc 4C92F 4OP0A 5LJ3e 2VXFA 4J5YA 4QVCA 4RCBA 4M77D 1JRIA 5GAOl 3JCMb 4M7AA 3BFMA 4M75E 1Y96B 1N9RA 1HXDA 1WNLA 4X9CA 4M75F 4QVDA 5GAMh 4M7AC 4C8QB 4M78B 5LJ3j 1WPYA 2RA2A 5CAIA 5LJ5e 4PJOE 4XTWA 2EJGA 1B34B 4M77A 4PJOF 5GMKl 3JCMP 3JB9J 3JB9H 4JLIA 2DZCA 1WQWA 5GAOn 4N0AA 5GAN3 3V7SA 3PGGA 2EJ9A 1KQ1A 4M77C 1LNXA 3JCMh 5LJ5j 1JBMA 4M7DE 3BW1A 3JB9G 3JCMf 4N0AC 4MMLA 5GAOm 4M7DF 3SB2A 3JCMJ 4C8QD 3INZA 4M78D 5GANd 4M77G 4F7UE 3HFNA 5DY9A 2Y90A 2RB6A 4F7UF 1D3BB 1I4K1 5GANg 1Y96A 2ZGWA 4HA8A 1KQ2A 1TH7A 4V2SA 4A53A 4C8QA 5GMKm 4M78A 4XTVA 3RKXA 1M8VA 2YLCA 3L1AA 3JCMX 1B34A 5LJ3h 1MGQA 4C8QC 5GAN2 4M78C 1LJOA 4JRKA 5GAMd 1H641 5GAMf 3VU3C 5GANe 5GAOp 4XTUA 3QUIA 2QTXA 2HNIA 3RUXA 4M7AE 4MMKA 3RKYA 4C8QG 5LJ5h 4M78G 4M7AF 1BIAA
chains in the Genus database with same CATH superfamily
5CIUA 1WGSA 2AIRB 3CMAA 5GJWB 1D09B 3S6WA 3EG3A 3TVTA 3GLXA 3OYFA 1I1JA 3A8LB 1V76A 1ZLMA 2JTMA 4GLMA 2OTJT 4YTLA 2KK4A 1T3LA 2RHUA 4DBFA 5LJ3f 4E7LA 3MEVA 4MZPA 1VQ7A 1X2QA 3EG9A 4C0ZA 5DLQE 5GAN4 3SWNC 2DAQA 4PFPA 3BY7A 5LJ5d 5LL6S 4JZ4A 5GMKi 3QPHA 3MJXA 4NS5A 1C6VX 1VYVA 2X4WA 2M02A 1WLPB 3ME9A 4BE1A 3TEEA 1RAIB 3M59A 1YCYA 1BI1A 1WHHA 1ZUKA 4OVAA 4M7DC 2DD4A 4FW2A 2HBPA 2RHYA 3NPFA 1N5ZA 4ME7A 3OSVA 2OX7A 1VQ5T 1KD1C 2KVQG 1XQHA 2CREA 2PVDB 3MKDA 3M54A 3ZBDA 2OTLA 4HVVA 1K8AU 4M7AC 1MV0B 3TSWA 1YHQA 4IUQA 4M77A 4DA4A 1ZSZA 2WSEE 3CCLQ 2MMPA 4CI0C 1PSEA 1I07A 1YN8A 1D3BB 1MNDA 1Y96A 3NTHA 4ESRA 1YIJA 3NTKA 1Q81U 1WDXA 1JXMA 2RNAA 3OW2A 3I9QA 3RMQA 3KBGA 1WXBA 4M78C 1NJIU 5GAMf 3MP8A 4XTUA 5J26A 2E6ZA 5LJ5h 2XDPA 3CC4A 1O75A 1ZA2B 1YITT 2AZVA 4DQ2A 2D0QB 2K7AA 3JB9F 4A4GA 4IUPA 4A54A 1PC0A 2IIMA 2FVUA 4II1A 4PJNA 4ZN3A 3JCMg 5D6WA 3GOXA 1YJ9Q 5IN1A 4AG1C 1U1TA 4LE9A 3AT1B 2BE7D 1X01A 1ZX6A 1FMVA 3M0SA 2X9HA 4N4GA 1PWTA 2O31A 3EFRA 1B3QA 2EJFA 5KCHA 1M8MA 4QVZA 4J6XA 2ZPFB 5CKEA 1Q86C 4JJBA 2QA4A 4JS4A 4ANJA 4IUVA 2HSEB 3LYIA 4Y91A 3M5AA 3OS0A 3V8KA 2CZ0B 3A1PA 2M0YA 5M9OA 4EIKA 3PIPA 3CCMT 4OGEA 1PRLC 2COYA 4FSSA 3S3MA 1BI2A 3G1JA 4BY6C 4J7IA 4AT1B 4M7DG 3X26B 3QO3A 3UATA 3UA6A 1M3BA 5EG2A 4C92F 1ZA1B 4ELYC 5LJ3e 2BZYA 5GAOl 1V1CA 3JCMb 2KBTA 2M9UA 2JJ9A 3J80E 5LJ3j 2EYQA 3A8OB 1R0BG 3D7SB 3CCJA 1KQ1A 2QQRA 1JBMA 3FJ5A 2MIOA 3GNFB 2CP5A 5DY9A 1K8AC 4F7UF 1I4K1 3OYBA 3L2WA 3UPUA 1F1BB 2J7IA 2RI2A 3T9NA 2KY9A 1FXXA 1S1NA 4HVWA 5IH2A 3CC2A 2DETA 1SPKA 1MGQA 4JRKA 4O6JA 1XTDA 1UJYA 1SHFA 1PRMC 1VA7A 1ZUUA 4BUGA 4M78G 3CMET 1Z9ZA 5CCAA 4E7SA 3VUZA 3QZ9B 2K2VA 4K11A 1VQLT 2LTOA 2E3IA 3HPWA 4C5IA 2CP0A 1W2BA 3DB3A 4PJMA 2RN8A 2DX1A 3QJYA 4PJOB 1ABQA 1BU1A 1CKBA 3NTIA 1MMGA 2KQWA 1I0CA 1K73R 1BI0A 1NLOC 3RBBB 2L5QA 3CC7Q 3RIRA 2O01E 1AEYA 4XU2A 3LGLA 4PJOD 4QQ6A 3FB9A 5CVIA 1UDLA 2XHCA 4HXJA 1QP2A 5HY6A 5GAMe 3HKSA 3H0HA 1K9MU 2CSQA 3I56A 3EGDA 2QGFB 4A63B 1X2KA 2DPPB 2RF0A 5GAMj 4ZNXA 4LDWA 1O9SA 2VGMA 1RADB 4XK8E 1OULA 4MZTA 1U1SA 2DXUA 2QDYB 1YJWQ 1IXDA 5D7UA 1FX7A 3X20B 2W0ZA 1NEBA 1QVFA 2JVVA 5KH6A 4RMOA 3VV0A 1IGUA 1PKSA 5FW9A 4BACA 1VQOT 4DBRA 1N9RA 1EIFA 3MEAA 2H3JA 1OQKA 3EG1A 1SRMA 4OF1A 4E7KA 3CEYA 3CD6T 2D6FA 2COZA 1OU8A 4PL6A 3SHWA 4PJJA 2AKKA 1YJNT 4M7DE 2MCNA 1GCQC 2QQBA 2EYZA 3HRTA 3OYNA 1ZUYA 5GMKm 4HCCA 2HKNA 2P0PA 3TSZA 1M2VA 1M90U 1QQJA 1TTHB 3M53A 3LW5E 3VU3C 1XJWB 2QTXA 4KT0E 4RTWA 3CCRT 1TG0A 4M7AE 2GBQA 5KYUA 1N8RU 1K0XA 3M57A 5GAOq 1BI3A 3E1SA 4E7HA 4MDXA 4M75B 2HQEA 1M1KU 3TREA 3NHNA 2X4XA 3CCLA 2GNCA 2DL4A 1AWWA 1ZHIA 2J6OA 2FPEA 4M75D 2EKOA 4M78E 4C8QF 2KT1A 2P0KA 5LJ5f 2DMOA 2J06A 2J05A 4PNOA 5GAOr 5GMKh 1OZ3A 3JRZA 3H9NA 3CMAT 3AHUA 1Y0MA 1FYNA 2ZPIB 2DTIA 3C4SA 1R8OB 1Y57A 2XK0A 3H8ZA 1WFWA 2PQWA 3NGPA 1M9SA 3EFOB 1YJ9A 1KC8U 2L89A 3VS0A 1GL5A 5KYXB 1R0CB 2BUDA 1T3SA 1OX9A 2K6DA 2OI3A 3NMZC 1AHJB 3O5ZA 3HTRA 5CKDA 3VJPA 4ELZC 2DZCA 5GAN3 4AFQC 3C95A 3BW1A 2JT4A 2O9VA 3REBB 3GPLA 1BB9A 2FRWA 4A4KA 5A0LA 2Y90A 2L3PA 2HQXA 1UGQB 3CC4Q 3RMSA 2YDLA 3MEWA 1TUCA 2HBWA 2NUTA 2OTLT 2YRDA 1KQSP 3QWYA 3EH2A 2CP6A 1D0YA 1M1FA 2XG8D 3CXCA 3L2VA 2DKGA 4M77F 4L6V5 2VC8A 4JLGA 2JTEA 2YT6A 1M90C 2K3XA 1JO8A 2BKDN 2FZCB 5KYWB 2DILA 1YIJT 2CDTA 5IHIA 1WI7A 3EG0A 1BBZA 3HRSA 2QAZA 1WXUA 5AT1B 5I21A 5KYYB 1VQNT 1M1KC 3PE0A 3GP8A 1I8FA 2DXTA 2VVKA 2DE0X 1M3CA 4HT8A 4PJOC 3HFOA 2RI5A 4GY5A 1W4SA 5J39A 4DOWA 2AZSA 4C0GA 2PNIA 4Y92A 2LCSA 2PZ1A 2DJZA 3S3OA 2NUPB 2MF2A 5EC7A 1YI2Q 2O88A 3QBYA 2KRNA 4IUTA 2DFUA 1U06A 4Q5WA 4UC4A 1VQ8T 5L8RE 2CT4A 4LUEA 1UECA 1MUZA 3CC7A 1QCFA 5I2SA 5AYFA 4JRPA 1KD1U 1YNZA 2K3BA 5LJ5e 2K79A 1KC8C 3A8GB 1W70A 4N0AA 1SSFA 3J81E 2G6FX 5LJ5j 1Q82R 2LCCA 1UJ0A 1VIEA 1D1CA 3EHQA 2XU8A 5IAYA 1MV3A 5D6YA 1RLPC 1VQ6Q 3WVEB 3GNGA 1KQ2A 4A53A 2P4TA 3DB4A 1YJWA 4FW1A 1M3AA 3JCMX 1B34A 2DIQA 2E12A 3C94A 4CC3A 2RHIA 1P92A 2I0NA 4MMKA 1JJ2S 1C0MA 4ATOA 2RJFA 2R5MA 1WHJA 2L3SA 5CQYA 1KG1A 2EYWA 1OI1A 1G8XA 4EMKB 5I2MA 1AD5A 2NWMA 3UA7A 4FL6A 4J6WA 2OTJQ 4OMPA 4J9GA 3V8JA 5FRNA 4EMGA 2ESWA 2VUBA 4OB1B 1X6BA 4KRTA 2WSFE 3PNWC 1ZSGA 2R58A 1WJSA 4XTXA 2QEXQ 4M75C 4OGCA 2CH4W 1JU5C 1SHGA 1Q86U 2A28A 4FT2A 4DEXA 2XKOC 3DKMA 3NFCA 2H8HA 4PJOG 2AKLA 3C12A 1RUWA 2RJEA 3H6ZA 3I35A 2CP3A 2HSPA 1BK2A 4LD6A 3X28B 2HL3A 2XI9A 2LQ8A 3M58A 3THKA 2ZPEB 4BDYA 2RHZA 2JS2A 3G4ST 1TXQA 1U3OA 3CBMA 3JB9D 5KYNA 2CP7A 2WACA 2HKQB 2JMAA 3VKIA 2YUNA 4X9CA 1OPKA 1D0XA 4JJNK 2A37A 2FEIA 2BE9B 1UTIA 2LJ3A 3G71Q 2SRCA 5IT9E 1SF9A 2RQWA 2A08A 4R0KA 2RB6A 1VQKQ 1NG2A 4RTVA 3UT1A 3OW2P 1AWXA 2A7YA 1AVZC 4J83A 2V26A 1X69A 3EHRA 1K9MR 1FWZA 4LDXA 2ABLA 1W1FA 1D1BA 3BDUA 3SD4A 4C92B 5FU6B 5GAN8 4EMHA 3MCAB 5HKCA 2KXCA 3OYYA 2F2WA 3EGXB 1I5OB 3CBPA 3RKWA 1LOJA 1IO6A 2MAMA 4C92D 3I55Q 2MYSA 3MP1A 3SWNA 4A4EA 3OYLA 1VYUA 3P8BB 2ZZDA 2X4JA 2M0OA 2X3XD 5CKFA 4F7UB 3CCST 2HMAA 3VRZA 4RTTA 3VUBA 2KI7A 2O2OA 2XDDA 1QVGS 3OYGA 2O4XA 5C0MA 4M75G 2FPFA 4M7DA 2KYMA 5IHKA 1JB0E 4RTXA 3G7ZA 2E64A 3G6ET 1J3TA 1NPPA 3CCMQ 3CPFA 2CP2A 5LJ3g 5HK0A 4PK4A 3MHXA 5GANf 4QKUA 1AWOA 1JJ2A 1NYGA 3OYCA 4IKFA 1H3ZA 3FRNA 2VXFA 4QVCA 4M7AA 2FRYA 4OMNA 2VB6A 2LNHB 1T0HA 2RA2A 4PJOE 1UG1A 4L5GA 3LWIA 1EZZB 3ASKA 1OZ2A 1WQWA 1NLPC 2ED0A 4EPCA 8ATCB 3JCMJ 1VUBA 3INZA 3MO8A 3DLLA 1BCMA 4KH0B 1UHCA 2YUOA 1YI2A 5FRMA 2GTOA 2FG0A 4M78A 1RAGB 2DYBA 3L1AA 1RLQC 2KYBA 2J6FA 4PFOA 2E3HA 1IHVA 1S72Q 3U23A 2DIGA 4M7AG 2DK3A 3ZFJA 5GMKe 3RDVA 3S3NA 1W2BP 1G3WA 4LDUA 1QVPA 2C0IA 1TWBA 2ROLA 5DLOA 1M30A 3E2UA 5GMKj 4NL3A 1VQPQ 4WF2A 1OYXA 3FEOA 2XICA 2P84A 1I81A 2DVEA 3MP6A 5ECAA 4FCYA 2IG0A 1VQ6A 4XTYA 1N27A 2FO0A 5A0DA 2E41A 5GAMg 1Q7YC 2H3EB 4EMKC 1E6HA 2CH4A 2K2MA 4IURA 2DYIA 3LH0A 4OMOA 4X1VA 3L2UA 2JUFA 1D0ZA 2MOXA 3CCVQ 2EBPA 2R5AA 1NBEB 4HT9A 2K3YA 1GRIA 1PSFA 1SG5A 2VKNA 1QVFP 2D8JA 4KULA 3V7RA 1VYTA 2DL3A 3JAME 2OTJA 5CKBA 2F2VA 3CCET 5A2QE 4M75E 2HQHA 2B8AA 1VQOQ 1TU0B 2DNUA 4C8QB 4B6MA 4XTWA 2QEXA 3X25B 3OYMA 2EQMA 1G83A 2EJ9A 4RTUA 3VYHB 3CCQQ 1JXOA 2GQVA 4TVRA 4KGVB 5GAOm 2KR3A 1YJNQ 4C8QD 3CCUT 4F04B 1K9AA 2PUOB 3M0RA 2F1LA 4C0DB 1Q82C 1MMAA 1PHTA 1M8VA 1QVGA 2DM1A 1WHKA 1LJOA 1AWJA 5GANe 2HNIA 1EX4A 3RKYA 1VQMT 1LPLA 3FLGA 3CCRQ 2LCLA 1RAHB 5GANj 3EG9B 4WCIA 1PG5B 1Y7XA 3QG1A 1D1AA 3X24B 3WXMB 1VQ9Q 2QYZA 3L2QA 3G71A 1KQSS 2EWNA 1KK7A 2I2LA 4BI4A 2JZ2A 2BZXA 2FYKA 1VQKA 2QXFA 3OQ5A 5GAOp 2RK1A 1RL2A 4C92C 5DM7R 5FU6C 4XU0A 3R6NA 4BE2A 2RD1A 1C1AA 3JCMQ 2M51A 1X6GA 2CZ7B 1VQ4T 2L3QA 4CC7A 1OEBA 1RAAB 2VV5A 2NUZA 2DBMA 3L42A 3UDCA 1G3SA 1YITA 2FB7A 1Y71A 2R57A 5CQXA 2RQUA 3Q1JA 3R6OA 4RKUE 4M77B 2PTKA 4FYXB 1KJWA 3JCMV 1ZSZB 2LT1A 3I55A 1UB4A 4LXCA 2E5QA 3FDRA 3JCMc 4C5GA 2O9SA 4M77D 1JRIA 2DL7A 1Y96B 1H8KA 1FMWA 2JM9A 2KXDA 3M0TA 1IRXA 1WPYA 2DBKA 2RMOA 2FZGB 1GCQA 2ZAEA 3JB9G 1VQ7T 4KH1B 3CPWP 3OMGA 5GANd 4D8KA 1IGQA 2L3RA 2CSIA 2RK2A 1RI0A 1BKBA 2CUDA 3CCMA 2GQIA 4PLIA 1X43A 2ENMA 3PMIA 2L2PA 5HK3A 1H641 4EDUA 1Q86R 4FYYB 2GTJA 1XNIA 3VS7A 2KMTA 3CXCP 2VXEA 4RTYA 4KBMB 1D3BA 2RH2A 2JS0A 1SRLA 1ZBXA 5IXFA 1M27C 1U8RA 1QWEA 4WTOB 3M9QA 3LWHA 2DL8A 2DTHA 4B9WA 1HD3A 4E7IA 4A4HA 2LZ6B 4NOYA 4J9EA 1HJDA 2FL7A 3PVQA 2E65A 1YHQT 3REAB 4JJCA 2KAFA 2MWOA 1K73U 2DTOA 4OB2B 1VQNQ 1PCXA 2KT8A 1S72A 4C92G 2EYXA 2CZ1B 3J7AF 4IIOA 3FJPA 2QI2A 3ZL7C 1GFDA 2RQVA 2E6NA 1K8AR 2LNVA 1AT1B 1VQPA 1DJ7B 2LJ1A 5GANh 4C5HA 3FIFA 4RG2A 4PFZA 5FWCA 4X9DA 2XMFA 6AT1B 3CC4T 4F7UG 5LJ5g 1VQ8Q 1I5LA 1PM3A 2ZCFB 1UGRB 2A0FB 4RCBA 2VWFA 1LVKA 2E5KA 1PD1A 4J9FA 4Z02A 3P8HA 3JB9J 1Q81R 1WJRA 2ATCB 1WIEA 1KQSA 1G3TA 1NJIR 5KCOA 4M7DF 2MPXC 1X6OA 3OS5A 2V1RA 3CCVA 4E7ZA 4CC2A 4FSXA 1TS9A 4XTVA 1N6AA 3CBOA 2QA4T 2F5KA 1V29B 1NE8A 4C8QC 4BE0A 2DXBA 1BCOA 2BZ8A 3RUXA 3QXEB 4X34A 4M7AF 1H3HA 3FC3A 4PLLA 1VQOA 1WX6A 2J6KA 3VS1A 4BDZA 2LT4A 2GGRA 2AHJB 4C0DC 2QASA 1OV3A 4ZGJB 1IHWA 2RO0A 3CCQA 4IIMA 4D8DA 5FWBA 1WHMA 4Z89A 1YI2T 4D6WA 1YJNA 2QQ9A 3EGDB 4J6YA 3QWXX 2Y4YA 5IHNA 4M78F 2HEQA 4KGZB 4A4FA 1QKWA 4HCBA 1TUGB 4AG2C 3ULRB 3CCJT 3H0FA 3OS2A 2V8IA 1UFFA 4PJOA 2QTVA 4B9XA 2E1HA 3VS3A 2E70A 3PIOA 4JRQA 1ARKA 1NZ9A 1UGPB 2DZ9A 3CCRA 1AZGB 1TUDA 2DRKA 3QYGB 4Z8AA 2F2XA 5FROA 2KEAA 4FIBA 4C5EA 3L2ZA 2EQIA 3GBQA 4PJLA 3CC2T 4J9IA 3JV3A 2EVRA 3QKJA 1K73C 1K76A 1ABOA 1VQ9A 1VQ6T 4E7JA 4OB3B 1YP5A 2K5FA 1UEBA 4C92E 3OYHA 2D8HA 2OAWA 2DD5A 2EQJA 3A5ZB 2JNGA 4J9DA 1RAFB 2AT1B 1GFCA 1VOMA 1M2VB 2EJGA 2LQNA 2ZPGB 2VYTA 2LX7A 3UWNA 4M77C 3JCMf 1ZSZC 5KYUB 2HCKA 4BD3A 3A98A 4F7UE 2E4HA 2K4YA 1VQ5Q 2GF7A 1TH7A 3RKXA 4FM4B 3CQTA 3I56T 2P4RA 4C8QG 3QIIA 1QCNA 2YUQA 4C0FA 4ORZA 2QEXT 2LQKA 1GXIE 1FMKA 4J9CA 1KSWA 2B86A 4NL2A 2DF6A 7AT1B 2D9TA 3VRYA 1VIFA 3VS2A 1BIBA 1R77A 1RABB 4FT4A 1W2BS 3OBWA 2P0QA 1G3YA 4M75A 1AZEA 3CCSQ 1YITQ 2C06A 1Q7YU 1IREB 4ZN1A 2RI3A 2LQWA 2CKKA 4M4ZA 3TQ7P 4ZGDB 2EAYA 2DA9A 3V8LA 3KXTA 3G71T 4HCZA 1RAEB 2E10A 3G6EQ 2W10A 3OB9A 1JJ2P 4JUVA 1VQKT 2YLBA 2YHTA 3A8HB 4LDVA 2FHDA 1WYXA 1MMDA 2QG9B 4MDWA 5A0GA 2EPDA 4JS5A 1WZOA 2HDAA 2L8DA 2G3RA 3PVLA 3OA6A 1B7TA 3EFOA 4RG8A 2NUTB 1YCSB 2RQRA 4JJDA 3CCLT 1QVFS 1VQNA 2K9GA 2KRSA 2RHXA 3V7SA 3EH1A 5KYXA 3L2RA 3OYDA 1M90R 1NPRA 4MMLA 5HCKA 1KHIA 1RI9A 4M77G 4HVUA 4GLKA 2BTTA 3OYAA 1N8RR 2COWA 2XD0A 2ZGWA 4HA8A 2K5LA 3I55T 4V2SA 1WHGA 4BI8B 3VS6A 5CK9A 3UF4A 5GAN2 1Q82U 2OJ2A 2DJQA 5C6SA 3META 1M1KR 1MHNA 1VQ8A 3I5RA 4XAXB 5I11A 2D1XA 3OMCA 4FYWB 2MK5A 2YWWA 2KGTA 2CYZB 3KFVA 2M1HA 2KRMA 4R55A 1YJ9T 4O5VA 5FLXE 1G5VA 2VASA 3VS5A 4Y28E 2ZPBB 3HRUA 3O8VA 3QYHB 4F17A 3JCMe 1NEGA 2EGEA 3GIBA 4KUIA 4C8QE 1B07A 4DBQA 1M1GA 2Y4XA 2L0AA 5CKHA 3CMEQ 2D0NA 2QQAA 3M0QA 1GBRA 4XU1A 4FYVB 3I5SA 4J8OA 2HL5C 1VQLQ 2XIDA 1KC8R 3N5BB 5KYWA 3E9GA 3TCJA 3M56A 3QHSA 2EW3A 1OX8A 1PNJA 2F5TX 3C0CA 2CS7A 4F14A 4QT7A 4E2FB 2JMCA 2A36A 3LX7A 4OMMA 5KYYA 1G2BA 4RCCA 3PFSA 2K57A 3IQLA 3QDRB 2ECZA 4ZTJA 4RTZA 4OP0A 1SKUB 3RR6A 3BFMA 1S72T 1M2OA 2DLPA 4ZGEB 3CCEQ 2NUPA 1ZQ1A 5KE2A 1B34B 3JB9H 5GMKl 3TU4K 2V1QA 2LRQA 1RACB 2C0OA 3LLRA 3SB2A 2PUKB 3WVDB 1Q81C 4VUBA 1VQPT 3OYKA 1ZBJA 1JEGA 3CCUQ 5GANg 2MI6A 1NJIC 4OMQA 1JQQA 2EYYA 4F16A 2LC4A 1QVGP 2DL5A 2LVMA 2GFUA 4LDYA 3CPWS 3G4SA 4AFUC 2CT3A 3CD6Q 3HSBA 1VQMQ 5GJVB 2Z0WA 3JCMd 4JZ3A 4M77E 3E9FA 4ZTFA 2LJ0A 3EGUA 3RNJA 1TSFA 1ACMB 2F69A 3QDFA 3CCVT 4QQDA 1Q95G 3SEMA 3CC7T 1WQ7A 4JPBW 5FU7B 5LJ3d 3CXCS 2X35A 1YBYA 1VQ5A 1E7OA 2IVWA 4EMKA 1X75C 2JOYA 3LGFA 3OY9A 3RESA 1QMCA 3PT9A 2C0TA 4E6RA 3RERA 1NM7A 2OAUA 3HL8A 2IPOB 1VQ4Q 1Y07A 3CCQT 1YJWT 1TOVA 1KD1R 1QKXA 4JDSA 2MWPA 1WHLA 2PU9B 3HP9A 3H0IA 3M55A 4OMLA 1WJQA 2JXBA 3EAEA 2EFIA 3HHTB 4J5YA 2V8JA 1HXDA 1WNLA 4QVDA 3CMAQ 1UGSB 1PKTA 5CAIA 3CCSA 2DO3A 4PJOF 2DEUA 2QQSA 1LNXA 3JCMh 3GF5A 2HZYA 2M16A 1VQ7Q 3HFNA 2DVJA 4CRIA 3KUFA 1VQ9T 4AFSC 3SDZA 2EGCA 3QJ6A 1HYOA 3EG2A 2YLCA 3A8MB 3G6EA 1XOVA 4N4IA 5LJ3h 2QDLA 5I22A 1YWOA 5GAMd 2RJCA 2JTFA 1KIKA 1OU9A 2CUBA 2EKHA 1SEMA 3SWNB 1K4US 4XU3A 2RJDA 3JCMW 1MNEA 2XDBA 2DEQA 1SSHA 4RUGA 1M5Q1 5J3BA 4LN2A 1K1ZA 2VGNA 2DXCA 3VS4A 2O4XB 4J9HA 2YRCA 4KGXB 2FZKB 4M7DB 1X27A 3M0UA 4C92A 2OTLQ 4Z88A 4OB0B 4JRIA 5GAN7 3JB9I 3F70A 1GCPA 3OYEA 1K9MC 3EGXA 5GAN6 1YHQQ 2GCXA 2CZ6B 2RPNA 4M7DD 3BE3A 4CC4B 2CGHA 2YSQA 1E6GA 1U5SA 3LH5A 1LCKA 2ED1A 4M7AB 1UGVA 3V7CA 4AFZC 4QW2A 1KHCA 3OBYA 4F7UA 1YIJQ 3M4GA 1IZ6A 1H92A 2JN0A 1K0SA 1T0JA 5KE3A 2NLUA 3P8DA 4XTZA 2DERA 4M7AD 4P5NA 2HD0A 2YUPA 4IUUA 3CPWA 1KFZA 3SFMA 1M4ZA 2K5IA 2LDMA 5L23A 4XQ3A 1UE9A 2V8KA 1BYMA 3M4YA 3OS1A 4FU6A 5GAMh 4M75F 4HKEA 2KNBB 3QZ5B 4M78B 4J7FA 3CMEA 4QQGA 4L59A 2HAXA 4JLIA 2ROTA 1OOTA 2SEMA 1VQLA 3DLMA 3PGGA 4N0AC 2RQTA 4M78D 2KROA 1AOJA 4OMFB 4HCKA 1N8RC 2QA4Q 1Q7YR 1YFNA 2NYSA 2X51A 3QUIA 4DEYA 3PTAA 4LNPA 1CSKA 1WXTA 1QWFA 1CKAA 2YRVA 1OPLA 3OSSC 1EFNA 3CCEA 4DBHA 4PKCC 4J9BA 3PMTA 2BIVA 1Z9QA 1IB8A 5GAN5 2LX9A 3QSUA 4BB7A 4KUDK 2FPDA 3H41A 1QCOA 1N9SA 3CCUA 3M0PA 3BDLA 2KE9A 2GFAA 4BY6B 4DOVA 2X4YA 1PD0A 3MPUB 9ATCB 1W6XA 3VYGA 2X3WD 5CO7A 3MEUA 4BI3A 3OW2S 3CCJQ 2JM8A 1HK9A 1QP3A 3OYJA 1WA7A 2PVOB 3EFSA 3CD6A 1UHFA 5FU7C 2RM4A 1VQMA 2PVGB 5D6XA 2JW4A 4AMCA 3E19A 2EGAA 1YWPA 2WSCE 2EIFA 4N4HA 3JSCA 3CC2Q 2KSSA 2DRMA 3ER0A 1HSQA 2A3LA 1NYFA 1QLYA 2AK5A 2EQUA 3URGA 1QW1A 4R56A 5CR2A 1UUEA 3ZEHA 2EQKA 5IXBA 3JCMP 5GAOn 3OYIA 2LMJA 4LUDA 1MMNA 2QK0A 1VQ4A 2ZPHB 4GBQA 4E47A 1A0NB 2KDSA 4MZMA 8AT1B 3G4SQ 4C8QA 2QGGA 4LD9K 2YXYA 1GBQA 2LP5A 3I56Q 1BIAA
chains in the Genus database with same CATH topology
2LCLA 3OMCA 5GANj 1M1FA 2XG8D 5CIUA 1WGSA 3CXCA 3L2VA 3CMAA 2DKGA 3S6WA 2CYZB 3GLXA 2M1HA 4M77F 1Y7XA 3OYFA 4L6V5 2VC8A 3QG1A 4JLGA 4R55A 1YJ9T 4O5VA 5FLXE 1M90C 3X24B 2K3XA 3A8LB 1G5VA 3WXMB 2JTMA 2BKDN 3L2QA 4Y28E 2OTJT 3G71A 2ZPBB 3HRUA 3O8VA 4YTLA 2KK4A 3QYHB 1KQSS 1YIJT 2RHUA 3JCMe 2EWNA 2I2LA 4BI4A 5LJ3f 4E7LA 3GIBA 3MEVA 2JZ2A 4KUIA 4MZPA 1VQ7A 2FYKA 4C8QE 1VQKA 2QXFA 3OQ5A 4C0ZA 2RK1A 5DLQE 5GAN4 5GAOp 1RL2A 3SWNC 1M1GA 2Y4XA 2DAQA 4C92C 5DM7R 5LJ5d 3BY7A 3HRSA 5CKHA 5FU6C 5LL6S 5I21A 4XU0A 5GMKi 3QPHA 1VQNT 2QQAA 1M1KC 4NS5A 4BE2A 4XU1A 4XAXB 2RD1A 2X4WA 3GP8A 4J8OA 1I8FA 2DXTA 3JCMQ 2XIDA 3N5BB 3E9GA 3ME9A 3TCJA 3M56A 4HT8A 4PJOC 2CZ7B 3QHSA 1VQ4T 4BE1A 3HFOA 2RI5A 3TEEA 4GY5A 3M59A 2VV5A 1W4SA 5J39A 1YCYA 1BI1A 2F5TX 3L42A 1G3SA 3UDCA 4C0GA 4DOWA 2FB7A 1YITA 1Y71A 2CS7A 2R57A 4M7DC 4OVAA 5CQXA 2DD4A 2DJZA 3S3OA 2MF2A 2RHYA 2HBPA 3Q1JA 3QBYA 3R6OA 3LX7A 4RKUE 4IUTA 4M77B 4RCCA 4ME7A 4Q5WA 3OSVA 4UC4A 3JCMV 3PFSA 2K57A 3QDRB 2LT1A 3I55A 1UB4A 1VQ5T 1KD1C 5L8RE 2KVQG 1VQ8T 1XQHA 3CC7A 2E5QA 4ZTJA 3FDRA 3JCMc 2PVDB 4OP0A 4C5GA 5I2SA 3M54A 3ZBDA 4M77D 1JRIA 2OTLA 5AYFA 4JRPA 1KD1U 3BFMA 1Y96B 1K8AU 1S72T 4ZGEB 4M7AC 1ZQ1A 1WPYA 5LJ5e 5KE2A 1YHQA 4IUQA 1B34B 4M77A 5GMKl 1KC8C 3JB9H 3TU4K 4DA4A 3A8GB 2LRQA 1SSFA 4N0AA 3J81E 2WSEE 2MMPA 5LJ5j 4CI0C 3LLRA 1PSEA 2LCCA 3JB9G 1VQ7T 1VIEA 3SB2A 2XU8A 3OMGA 2PUKB 3WVDB 5GANd 4VUBA 5IAYA 1VQPT 3OYKA 1Q81C 5D6YA 2L3RA 1D3BB 5GANg 1Y96A 2MI6A 2RK2A 1RI0A 3GNGA 3NTHA 3WVEB 1NJIC 1KQ2A 1BKBA 1YIJA 3NTKA 4A53A 1Q81U 2LC4A 2P4TA 3DB4A 3CCMA 1YJWA 4PLIA 3OW2A 3JCMX 1B34A 3RMQA 2DIQA 3KBGA 3PMIA 2E12A 3C94A 4M78C 1NJIU 5HK3A 2RHIA 1H641 4EDUA 5GAMf 1P92A 2GFUA 2LVMA 4LDYA 3MP8A 4MMKA 1XNIA 3CPWS 4XTUA 5J26A 2E6ZA 5LJ5h 2XDPA 3G4SA 1JJ2S 3CC4A 2KMTA 1O75A 1YITT 2VXEA 3HSBA 4ATOA 2RJFA 4KBMB 4DQ2A 2D0QB 2R5MA 5CQYA 3JB9F 4A4GA 1D3BA 2RH2A 3JCMd 4IUPA 4A54A 1OI1A 4M77E 1KG1A 2FVUA 3E9FA 1ZBXA 4II1A 4EMKB 4ZN3A 4ZTFA 3JCMg 5I2MA 1U8RA 5D6WA 3GOXA 2F69A 5IN1A 3CCVT 3M9QA 4QQDA 3CC7T 4FL6A 1U1TA 1WQ7A 4J6WA 5FU7B 3LWHA 2DTHA 1X01A 5LJ3d 4B9WA 3CXCS 4E7IA 2X35A 1YBYA 3V8JA 4N4GA 4NOYA 4A4HA 1VQ5A 3EFRA 2EJFA 5KCHA 4EMGA 2IVWA 2VUBA 5FRNA 4OB1B 4QVZA 2FL7A 2WSFE 4J6XA 2E65A 2ZPFB 4EMKA 1YHQT 1X75C 2JOYA 3LGFA 3PNWC 2KAFA 5CKEA 3OY9A 1Q86C 2R58A 2MWOA 2QA4A 1K73U 1WJSA 2DTOA 4XTXA 4JS4A 4IUVA 3RESA 4M75C 4OB2B 3PT9A 1S72A 4C92G 3LYIA 4OGCA 2CZ1B 3J7AF 4PJOD 4Y91A 3RERA 2OAUA 3HL8A 1Q86U 3FJPA 3M5AA 4FT2A 3OS0A 2XKOC 3V8KA 2QI2A 2CZ0B 3DKMA 1Y07A 3NFCA 5M9OA 4PJOG 3C12A 3CCQT 3PIPA 1YJWT 3CCMT 2RJEA 3H6ZA 4OGEA 2E6NA 4JDSA 4LD6A 2LNVA 2MWPA 3X28B 2PU9B 3S3MA 1VQPA 1DJ7B 1BI2A 4BY6C 2XI9A 4J7IA 3HP9A 5GANh 4C5HA 2LQ8A 3X26B 4M7DG 3M55A 3M58A 3QO3A 3FIFA 4RG2A 2ZPEB 4BDYA 4X9DA 2RHZA 3G4ST 3CC4T 4F7UG 3CBMA 1WJQA 5LJ5g 3JB9D 5EG2A 1I5LA 2WACA 3EAEA 4C92F 4ELYC 2EFIA 3HHTB 2ZCFB 5LJ3e 1UGRB 4J5YA 4RCBA 5GAOl 3JCMb 2V8JA 2M9UA 3VKIA 4X9CA 1HXDA 1WNLA 4QVDA 3J80E 1UGSB 5LJ3j 5CAIA 2EYQA 3CCSA 2DO3A 3A8OB 4Z02A 3P8HA 4PJOF 4JJNK 3JB9J 3CCJA 1WJRA 2QQSA 1KQ1A 2QQRA 1LNXA 3JCMh 1KQSA 1G3TA 1JBMA 3GF5A 5KCOA 5IT9E 4M7DF 1X6OA 3OS5A 2M16A 3CCVA 3HFNA 3GNFB 1VQ9T 4CRIA 3KUFA 4FSXA 5DY9A 2RB6A 4F7UF 1I4K1 3SDZA 1K8AC 3OYBA 3L2WA 3UPUA 3UT1A 2A7YA 2RI2A 3T9NA 4XTVA 1N6AA 3CBOA 2KY9A 4J83A 1FXXA 3QJ6A 2QA4T 2YLCA 2F5KA 3A8MB 1XOVA 4N4IA 5LJ3h 1V29B 1MGQA 3G6EA 1NE8A 4C8QC 3CC2A 4BE0A 2DXBA 4JRKA 5GAMd 4O6JA 1XTDA 2RJCA 1FWZA 2JTFA 3RUXA 3QXEB 4BUGA 4LDXA 4X34A 4M78G 3CMET 4M7AF 5CCAA 3SWNB 3BDUA 3VUZA 3QZ9B 3SD4A 2K2VA 4C92B 5FU6B 4XU3A 2RJDA 4PLLA 3FC3A 3JCMW 1VQOA 1VQLT 2LTOA 5GAN8 4EMHA 4BDZA 2XDBA 3MCAB 3HPWA 4C5IA 2LT4A 5HKCA 3OYYA 2AHJB 3DB3A 1W2BA 4C0DC 4ZGJB 2DEQA 3CBPA 3RKWA 1LOJA 1M5Q1 2RO0A 3QJYA 5J3BA 4PJOB 3CCQA 3NTIA 2KQWA 2MAMA 2VGNA 2DXCA 4C92D 1BI0A 2O4XB 1YI2T 2L5QA 4D6WA 1YJNA 3MP1A 3RIRA 2QQ9A 2O01E 4J6YA 3SWNA 4A4EA 4M7DB 3OYLA 4XU2A 4C92A 2Y4YA 4M78F 3LGLA 3P8BB 4JRIA 4OB0B 4A4FA 5GAN7 3F70A 2ZZDA 3JB9I 2X4JA 2M0OA 4F7UB 5CKFA 3CCST 4QQ6A 3OYEA 4HCBA 1K9MC 3FB9A 5CVIA 5GAN6 3CCJT 3VUBA 2GCXA 3OS2A 2V8IA 2CZ6B 4M7DD 2XHCA 2XDDA 1QVGS 4B9XA 4PJOA 1QP2A 5HY6A 5GAMe 3HKSA 2E1HA 3OYGA 1K9MU 2E70A 2O4XA 2CGHA 3PIOA 5C0MA 4JRQA 1NZ9A 1UGPB 3I56A 2DZ9A 4M75G 3CCRA 4M7DA 2DPPB 4M7AB 1JB0E 5GAMj 3V7CA 4LDWA 2VGMA 1O9SA 3QYGB 5FROA 3G7ZA 4FIBA 4QW2A 1KHCA 3OBYA 3L2ZA 4XK8E 4C5EA 4F7UA 2E64A 3M4GA 3G6ET 3CC2T 1NPPA 1IZ6A 1U1SA 2DXUA 2QDYB 4MZTA 2JN0A 3CPFA 3QKJA 5LJ3g 1K73C 5HK0A 1VQ9A 5KE3A 1FX7A 2NLUA 3P8DA 3X20B 1VQ6T 4XTZA 4E7JA 4M7AD 4OB3B 3MHXA 5GANf 4P5NA 2K5FA 2HD0A 1UEBA 4IUUA 3CPWA 1QVFA 1JJ2A 3SFMA 1M4ZA 2JVVA 2K5IA 2LDMA 4C92E 5KH6A 3OYHA 4XQ3A 4RMOA 3VV0A 3OYCA 4IKFA 2DD5A 3FRNA 1H3ZA 2VXFA 2V8KA 1BYMA 4QVCA 3M4YA 4BACA 1VQOT 4M7AA 3OS1A 2EQJA 1N9RA 1EIFA 3A5ZB 4FU6A 3MEAA 4HKEA 4M75F 2JNGA 5GAMh 2H3JA 3QZ5B 4M78B 4J7FA 3CMEA 2RA2A 4OF1A 4E7KA 4QQGA 4PJOE 4L5GA 3LWIA 2EJGA 3CEYA 3CD6T 2ZPGB 3ASKA 4L59A 4JLIA 2HAXA 2VYTA 2D6FA 1OZ2A 1WQWA 4PL6A 3UWNA 1VQLA 3DLMA 3PGGA 4M77C 4EPCA 1YJNT 4M7DE 3JCMf 4N0AC 3JCMJ 1VUBA 3INZA 4M78D 4BD3A 2QQBA 3MO8A 4F7UE 2K4YA 3HRTA 3DLLA 3OYNA 2GF7A 1TH7A 1YI2A 5FRMA 5GMKm 4M78A 3RKXA 2P0PA 4HCCA 3L1AA 4FM4B 4OMFB 1N8RC 1M90U 3M53A 3LW5E 3VU3C 3I56T 3QUIA 2QTXA 4KT0E 3CCRT 4M7AE 2DIGA 4C8QG 3QIIA 3PTAA 4M7AG 1N8RU 2DK3A 4C0FA 3M57A 5GAOq 3ZFJA 5GMKe 2QEXT 1BI3A 2YRVA 3E1SA 3OSSC 2LQKA 4E7HA 3S3NA 1G3WA 3CCEA 1GXIE 4LDUA 1QVPA 4PKCC 3PMTA 4MDXA 4M75B 2BIVA 5DLOA 5GMKj 4NL3A 4NL2A 4WF2A 1OYXA 5GAN5 2HQEA 1M1KU 3FEOA 3TREA 2X4XA 3CCLA 2LX9A 3QSUA 2D9TA 2XICA 4BB7A 4KUDK 1ZHIA 1VIFA 1I81A 2DVEA 3MP6A 4M75D 1BIBA 2IG0A 1VQ6A 4XTYA 2EKOA 1N27A 1N9SA 4M78E 3CCUA 5A0DA 4FT4A 2E41A 4C8QF 3BDLA 5GAMg 1W2BS 3OBWA 2P0KA 2GFAA 4BY6B 4DOVA 2X4YA 2P0QA 1Q7YC 5LJ5f 1G3YA 4M75A 3VYGA 5CO7A 3MEUA 4PNOA 4BI3A 5GAOr 4EMKC 2C06A 3OW2S 5GMKh 1OZ3A 4IURA 3JRZA 1Q7YU 3CMAT 1HK9A 1QP3A 3AHUA 1IREB 3LH0A 4ZN1A 2RI3A 3OYJA 2ZPIB 2DTIA 2PVOB 1R8OB 3C4SA 2CKKA 3EFSA 3CD6A 3L2UA 2JUFA 2XK0A 5FU7C 2RM4A 1VQMA 4ZGDB 2EAYA 2PVGB 3H8ZA 5D6XA 2R5AA 3V8LA 2PQWA 3E19A 3KXTA 4HT9A 3G71T 2K3YA 4HCZA 1M9SA 2WSCE 1PSFA 2EIFA 4N4HA 2E10A 3JSCA 1YJ9A 2KSSA 1KC8U 3OB9A 2L89A 4JUVA 3ER0A 1VQKT 4KULA 3V7RA 2YLBA 2A3LA 2YHTA 3JAME 2OTJA 2BUDA 5CKBA 3A8HB 4LDVA 2FHDA 2EQUA 4MDWA 3URGA 3CCET 5A0GA 5A2QE 1QW1A 4M75E 4R56A 2B8AA 5CR2A 4JS5A 1AHJB 2L8DA 4C8QB 2G3RA 3ZEHA 3OA6A 4RG8A 2EQKA 4XTWA 3VJPA 5CKDA 4ELZC 2QEXA 3JCMP 1QVFS 3CCLT 2DZCA 3X25B 5GAOn 1VQNA 3OYMA 2EQMA 5GAN3 2RHXA 3V7SA 2EJ9A 3OYIA 3VYHB 3L2RA 3OYDA 3C95A 3BW1A 1NPRA 2GQVA 4TVRA 4MMLA 5GAOm 4C8QD 1KHIA 3CCUT 3GPLA 4M77G 1VQ4A 2ZPHB 4E47A 4A4KA 2PUOB 4GLKA 2KDSA 2Y90A 5A0LA 3OYAA 4MZMA 4C0DB 2HQXA 1Q82C 2XD0A 2ZGWA 4HA8A 1UGQB 2K5LA 3I55T 3RMSA 4V2SA 4BI8B 4C8QA 5CK9A 1M8VA 3MEWA 4LD9K 1QVGA 5GAN2 1Q82U 1LJOA 2OTLT 5C6SA 5GANe 3META 2HNIA 1MHNA 3RKYA 1VQ8A 1VQMT 1BIAA 3FLGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GAO q;  3SWN B;  2VXE A;  3BDU A;  3HSB A;  5GMK e;  4DQ2 A;  5GAN j;  4C92 B;  3JB9 F;  4XU3 A;  3JCM d;  1D3B A;  3JCM W;  4A54 A;  2DKG A;  4M77 E;  4EMH A;  5GAN 8;  4EMK B;  4M77 F;  3JCM g;  2VC8 A;  4M75 B;  5GMK j;  4NL3 A;  2DEQ A;  4NL2 A;  4WF2 A;  3RKW A;  5GAN 5;  1LOJ A;  1M5Q 1;  4PJO B;  4C92 D;  3QSU A;  1U1T A;  1WQ7 A;  4J6W A;  2DTH A;  4M7A G;  3JCM e;  2EWN A;  2I2L A;  1X01 A;  3RIR A;  5LJ3 d;  5LJ3 f;  1I81 A;  3GIB A;  2DVE A;  4J6Y A;  4M75 D;  3SWN A;  1BIB A;  4M7D B;  4XTY A;  2FYK A;  3V8J A;  4C8Q E;  4M78 E;  1N9S A;  4NOY A;  4XU2 A;  4C92 A;  3EFR A;  2EJF A;  2E41 A;  4C8Q F;  4M78 F;  4EMG A;  4JRI A;  5GAM g;  3SWN C;  5GAN 7;  5GAN 4;  3JB9 I;  4J6X A;  4PJO D;  4EMK A;  2E65 A;  4F7U B;  4C92 C;  5LJ5 d;  3BY7 A;  3FB9 A;  4M75 A;  5I21 A;  5LJ5 f;  4XU0 A;  5GMK i;  5GAN 6;  4PNO A;  5GAO r;  4EMK C;  2DTO A;  4XTX A;  5GMK h;  4XU1 A;  3RES A;  4M75 C;  2RD1 A;  4M7D D;  4PJO A;  4C92 G;  5GAM e;  1I8F A;  2DXT A;  4Y91 A;  2E1H A;  3JCM Q;  1HK9 A;  3AHU A;  3RER A;  2CGH A;  4HT8 A;  4PJO C;  2DTI A;  2DZ9 A;  3FJP A;  3QHS A;  4M75 G;  3EFS A;  3HFO A;  2RM4 A;  3V8K A;  4M7D A;  4M7A B;  2EAY A;  1YCY A;  5GAM j;  3V7C A;  2FB7 A;  3V8L A;  4PJO G;  4M7D C;  3L2Z A;  4HT9 A;  4F7U A;  2DJZ A;  2E64 A;  3M4G A;  2DXU A;  1U1S A;  2JN0 A;  5LJ3 g;  4M77 B;  4RCC A;  2E10 A;  5GAN h;  4M7D G;  3JCM V;  3QO3 A;  2K57 A;  4XTZ A;  4M7A D;  3FIF A;  4JUV A;  5GAN f;  3V7R A;  4X9D A;  2YLB A;  2YHT A;  4F7U G;  4C92 E;  5LJ5 g;  3JB9 D;  4XQ3 A;  1I5L A;  3JCM c;  4C92 F;  4OP0 A;  5LJ3 e;  2VXF A;  4J5Y A;  4QVC A;  4RCB A;  4M77 D;  1JRI A;  5GAO l;  3JCM b;  4M7A A;  3BFM A;  4M75 E;  1Y96 B;  1N9R A;  1HXD A;  1WNL A;  4X9C A;  4M75 F;  4QVD A;  5GAM h;  4M7A C;  4C8Q B;  4M78 B;  5LJ3 j;  1WPY A;  2RA2 A;  5CAI A;  5LJ5 e;  4PJO E;  4XTW A;  2EJG A;  1B34 B;  4M77 A;  4PJO F;  5GMK l;  3JCM P;  3JB9 J;  3JB9 H;  4JLI A;  2DZC A;  1WQW A;  5GAO n;  4N0A A;  5GAN 3;  3V7S A;  3PGG A;  2EJ9 A;  1KQ1 A;  4M77 C;  1LNX A;  3JCM h;  5LJ5 j;  1JBM A;  4M7D E;  3BW1 A;  3JB9 G;  3JCM f;  4N0A C;  4MML A;  5GAO m;  4M7D F;  3SB2 A;  3JCM J;  4C8Q D;  3INZ A;  4M78 D;  5GAN d;  4M77 G;  4F7U E;  3HFN A;  5DY9 A;  2Y90 A;  2RB6 A;  4F7U F;  1D3B B;  1I4K 1;  5GAN g;  1Y96 A;  2ZGW A;  4HA8 A;  1KQ2 A;  1TH7 A;  4V2S A;  4A53 A;  4C8Q A;  5GMK m;  4M78 A;  4XTV A;  3RKX A;  1M8V A;  2YLC A;  3L1A A;  3JCM X;  1B34 A;  5LJ3 h;  1MGQ A;  4C8Q C;  5GAN 2;  4M78 C;  1LJO A;  4JRK A;  5GAM d;  1H64 1;  5GAM f;  3VU3 C;  5GAN e;  5GAO p;  4XTU A;  3QUI A;  2QTX A;  2HNI A;  3RUX A;  4M7A E;  4MMK A;  3RKY A;  4C8Q G;  5LJ5 h;  4M78 G;  4M7A F;  1BIA A; 
#chains in the Genus database with same CATH topology
 5CIU A;  1WGS A;  2AIR B;  3CMA A;  5GJW B;  1D09 B;  3S6W A;  3EG3 A;  3TVT A;  3GLX A;  3OYF A;  1I1J A;  3A8L B;  1V76 A;  1ZLM A;  2JTM A;  4GLM A;  2OTJ T;  4YTL A;  2KK4 A;  1T3L A;  2RHU A;  4DBF A;  5LJ3 f;  4E7L A;  3MEV A;  4MZP A;  1VQ7 A;  1X2Q A;  3EG9 A;  4C0Z A;  5DLQ E;  5GAN 4;  3SWN C;  2DAQ A;  4PFP A;  3BY7 A;  5LJ5 d;  5LL6 S;  4JZ4 A;  5GMK i;  3QPH A;  3MJX A;  4NS5 A;  1C6V X;  1VYV A;  2X4W A;  2M02 A;  1WLP B;  3ME9 A;  4BE1 A;  3TEE A;  1RAI B;  3M59 A;  1YCY A;  1BI1 A;  1WHH A;  1ZUK A;  4OVA A;  4M7D C;  2DD4 A;  4FW2 A;  2HBP A;  2RHY A;  3NPF A;  1N5Z A;  4ME7 A;  3OSV A;  2OX7 A;  1VQ5 T;  1KD1 C;  2KVQ G;  1XQH A;  2CRE A;  2PVD B;  3MKD A;  3M54 A;  3ZBD A;  2OTL A;  4HVV A;  1K8A U;  4M7A C;  1MV0 B;  3TSW A;  1YHQ A;  4IUQ A;  4M77 A;  4DA4 A;  1ZSZ A;  2WSE E;  3CCL Q;  2MMP A;  4CI0 C;  1PSE A;  1I07 A;  1YN8 A;  1D3B B;  1MND A;  1Y96 A;  3NTH A;  4ESR A;  1YIJ A;  3NTK A;  1Q81 U;  1WDX A;  1JXM A;  2RNA A;  3OW2 A;  3I9Q A;  3RMQ A;  3KBG A;  1WXB A;  4M78 C;  1NJI U;  5GAM f;  3MP8 A;  4XTU A;  5J26 A;  2E6Z A;  5LJ5 h;  2XDP A;  3CC4 A;  1O75 A;  1ZA2 B;  1YIT T;  2AZV A;  4DQ2 A;  2D0Q B;  2K7A A;  3JB9 F;  4A4G A;  4IUP A;  4A54 A;  1PC0 A;  2IIM A;  2FVU A;  4II1 A;  4PJN A;  4ZN3 A;  3JCM g;  5D6W A;  3GOX A;  1YJ9 Q;  5IN1 A;  4AG1 C;  1U1T A;  4LE9 A;  3AT1 B;  2BE7 D;  1X01 A;  1ZX6 A;  1FMV A;  3M0S A;  2X9H A;  4N4G A;  1PWT A;  2O31 A;  3EFR A;  1B3Q A;  2EJF A;  5KCH A;  1M8M A;  4QVZ A;  4J6X A;  2ZPF B;  5CKE A;  1Q86 C;  4JJB A;  2QA4 A;  4JS4 A;  4ANJ A;  4IUV A;  2HSE B;  3LYI A;  4Y91 A;  3M5A A;  3OS0 A;  3V8K A;  2CZ0 B;  3A1P A;  2M0Y A;  5M9O A;  4EIK A;  3PIP A;  3CCM T;  4OGE A;  1PRL C;  2COY A;  4FSS A;  3S3M A;  1BI2 A;  3G1J A;  4BY6 C;  4J7I A;  4AT1 B;  4M7D G;  3X26 B;  3QO3 A;  3UAT A;  3UA6 A;  1M3B A;  5EG2 A;  4C92 F;  1ZA1 B;  4ELY C;  5LJ3 e;  2BZY A;  5GAO l;  1V1C A;  3JCM b;  2KBT A;  2M9U A;  2JJ9 A;  3J80 E;  5LJ3 j;  2EYQ A;  3A8O B;  1R0B G;  3D7S B;  3CCJ A;  1KQ1 A;  2QQR A;  1JBM A;  3FJ5 A;  2MIO A;  3GNF B;  2CP5 A;  5DY9 A;  1K8A C;  4F7U F;  1I4K 1;  3OYB A;  3L2W A;  3UPU A;  1F1B B;  2J7I A;  2RI2 A;  3T9N A;  2KY9 A;  1FXX A;  1S1N A;  4HVW A;  5IH2 A;  3CC2 A;  2DET A;  1SPK A;  1MGQ A;  4JRK A;  4O6J A;  1XTD A;  1UJY A;  1SHF A;  1PRM C;  1VA7 A;  1ZUU A;  4BUG A;  4M78 G;  3CME T;  1Z9Z A;  5CCA A;  4E7S A;  3VUZ A;  3QZ9 B;  2K2V A;  4K11 A;  1VQL T;  2LTO A;  2E3I A;  3HPW A;  4C5I A;  2CP0 A;  1W2B A;  3DB3 A;  4PJM A;  2RN8 A;  2DX1 A;  3QJY A;  4PJO B;  1ABQ A;  1BU1 A;  1CKB A;  3NTI A;  1MMG A;  2KQW A;  1I0C A;  1K73 R;  1BI0 A;  1NLO C;  3RBB B;  2L5Q A;  3CC7 Q;  3RIR A;  2O01 E;  1AEY A;  4XU2 A;  3LGL A;  4PJO D;  4QQ6 A;  3FB9 A;  5CVI A;  1UDL A;  2XHC A;  4HXJ A;  1QP2 A;  5HY6 A;  5GAM e;  3HKS A;  3H0H A;  1K9M U;  2CSQ A;  3I56 A;  3EGD A;  2QGF B;  4A63 B;  1X2K A;  2DPP B;  2RF0 A;  5GAM j;  4ZNX A;  4LDW A;  1O9S A;  2VGM A;  1RAD B;  4XK8 E;  1OUL A;  4MZT A;  1U1S A;  2DXU A;  2QDY B;  1YJW Q;  1IXD A;  5D7U A;  1FX7 A;  3X20 B;  2W0Z A;  1NEB A;  1QVF A;  2JVV A;  5KH6 A;  4RMO A;  3VV0 A;  1IGU A;  1PKS A;  5FW9 A;  4BAC A;  1VQO T;  4DBR A;  1N9R A;  1EIF A;  3MEA A;  2H3J A;  1OQK A;  3EG1 A;  1SRM A;  4OF1 A;  4E7K A;  3CEY A;  3CD6 T;  2D6F A;  2COZ A;  1OU8 A;  4PL6 A;  3SHW A;  4PJJ A;  2AKK A;  1YJN T;  4M7D E;  2MCN A;  1GCQ C;  2QQB A;  2EYZ A;  3HRT A;  3OYN A;  1ZUY A;  5GMK m;  4HCC A;  2HKN A;  2P0P A;  3TSZ A;  1M2V A;  1M90 U;  1QQJ A;  1TTH B;  3M53 A;  3LW5 E;  3VU3 C;  1XJW B;  2QTX A;  4KT0 E;  4RTW A;  3CCR T;  1TG0 A;  4M7A E;  2GBQ A;  5KYU A;  1N8R U;  1K0X A;  3M57 A;  5GAO q;  1BI3 A;  3E1S A;  4E7H A;  4MDX A;  4M75 B;  2HQE A;  1M1K U;  3TRE A;  3NHN A;  2X4X A;  3CCL A;  2GNC A;  2DL4 A;  1AWW A;  1ZHI A;  2J6O A;  2FPE A;  4M75 D;  2EKO A;  4M78 E;  4C8Q F;  2KT1 A;  2P0K A;  5LJ5 f;  2DMO A;  2J06 A;  2J05 A;  4PNO A;  5GAO r;  5GMK h;  1OZ3 A;  3JRZ A;  3H9N A;  3CMA T;  3AHU A;  1Y0M A;  1FYN A;  2ZPI B;  2DTI A;  3C4S A;  1R8O B;  1Y57 A;  2XK0 A;  3H8Z A;  1WFW A;  2PQW A;  3NGP A;  1M9S A;  3EFO B;  1YJ9 A;  1KC8 U;  2L89 A;  3VS0 A;  1GL5 A;  5KYX B;  1R0C B;  2BUD A;  1T3S A;  1OX9 A;  2K6D A;  2OI3 A;  3NMZ C;  1AHJ B;  3O5Z A;  3HTR A;  5CKD A;  3VJP A;  4ELZ C;  2DZC A;  5GAN 3;  4AFQ C;  3C95 A;  3BW1 A;  2JT4 A;  2O9V A;  3REB B;  3GPL A;  1BB9 A;  2FRW A;  4A4K A;  5A0L A;  2Y90 A;  2L3P A;  2HQX A;  1UGQ B;  3CC4 Q;  3RMS A;  2YDL A;  3MEW A;  1TUC A;  2HBW A;  2NUT A;  2OTL T;  2YRD A;  1KQS P;  3QWY A;  3EH2 A;  2CP6 A;  1D0Y A;  1M1F A;  2XG8 D;  3CXC A;  3L2V A;  2DKG A;  4M77 F;  4L6V 5;  2VC8 A;  4JLG A;  2JTE A;  2YT6 A;  1M90 C;  2K3X A;  1JO8 A;  2BKD N;  2FZC B;  5KYW B;  2DIL A;  1YIJ T;  2CDT A;  5IHI A;  1WI7 A;  3EG0 A;  1BBZ A;  3HRS A;  2QAZ A;  1WXU A;  5AT1 B;  5I21 A;  5KYY B;  1VQN T;  1M1K C;  3PE0 A;  3GP8 A;  1I8F A;  2DXT A;  2VVK A;  2DE0 X;  1M3C A;  4HT8 A;  4PJO C;  3HFO A;  2RI5 A;  4GY5 A;  1W4S A;  5J39 A;  4DOW A;  2AZS A;  4C0G A;  2PNI A;  4Y92 A;  2LCS A;  2PZ1 A;  2DJZ A;  3S3O A;  2NUP B;  2MF2 A;  5EC7 A;  1YI2 Q;  2O88 A;  3QBY A;  2KRN A;  4IUT A;  2DFU A;  1U06 A;  4Q5W A;  4UC4 A;  1VQ8 T;  5L8R E;  2CT4 A;  4LUE A;  1UEC A;  1MUZ A;  3CC7 A;  1QCF A;  5I2S A;  5AYF A;  4JRP A;  1KD1 U;  1YNZ A;  2K3B A;  5LJ5 e;  2K79 A;  1KC8 C;  3A8G B;  1W70 A;  4N0A A;  1SSF A;  3J81 E;  2G6F X;  5LJ5 j;  1Q82 R;  2LCC A;  1UJ0 A;  1VIE A;  1D1C A;  3EHQ A;  2XU8 A;  5IAY A;  1MV3 A;  5D6Y A;  1RLP C;  1VQ6 Q;  3WVE B;  3GNG A;  1KQ2 A;  4A53 A;  2P4T A;  3DB4 A;  1YJW A;  4FW1 A;  1M3A A;  3JCM X;  1B34 A;  2DIQ A;  2E12 A;  3C94 A;  4CC3 A;  2RHI A;  1P92 A;  2I0N A;  4MMK A;  1JJ2 S;  1C0M A;  4ATO A;  2RJF A;  2R5M A;  1WHJ A;  2L3S A;  5CQY A;  1KG1 A;  2EYW A;  1OI1 A;  1G8X A;  4EMK B;  5I2M A;  1AD5 A;  2NWM A;  3UA7 A;  4FL6 A;  4J6W A;  2OTJ Q;  4OMP A;  4J9G A;  3V8J A;  5FRN A;  4EMG A;  2ESW A;  2VUB A;  4OB1 B;  1X6B A;  4KRT A;  2WSF E;  3PNW C;  1ZSG A;  2R58 A;  1WJS A;  4XTX A;  2QEX Q;  4M75 C;  4OGC A;  2CH4 W;  1JU5 C;  1SHG A;  1Q86 U;  2A28 A;  4FT2 A;  4DEX A;  2XKO C;  3DKM A;  3NFC A;  2H8H A;  4PJO G;  2AKL A;  3C12 A;  1RUW A;  2RJE A;  3H6Z A;  3I35 A;  2CP3 A;  2HSP A;  1BK2 A;  4LD6 A;  3X28 B;  2HL3 A;  2XI9 A;  2LQ8 A;  3M58 A;  3THK A;  2ZPE B;  4BDY A;  2RHZ A;  2JS2 A;  3G4S T;  1TXQ A;  1U3O A;  3CBM A;  3JB9 D;  5KYN A;  2CP7 A;  2WAC A;  2HKQ B;  2JMA A;  3VKI A;  2YUN A;  4X9C A;  1OPK A;  1D0X A;  4JJN K;  2A37 A;  2FEI A;  2BE9 B;  1UTI A;  2LJ3 A;  3G71 Q;  2SRC A;  5IT9 E;  1SF9 A;  2RQW A;  2A08 A;  4R0K A;  2RB6 A;  1VQK Q;  1NG2 A;  4RTV A;  3UT1 A;  3OW2 P;  1AWX A;  2A7Y A;  1AVZ C;  4J83 A;  2V26 A;  1X69 A;  3EHR A;  1K9M R;  1FWZ A;  4LDX A;  2ABL A;  1W1F A;  1D1B A;  3BDU A;  3SD4 A;  4C92 B;  5FU6 B;  5GAN 8;  4EMH A;  3MCA B;  5HKC A;  2KXC A;  3OYY A;  2F2W A;  3EGX B;  1I5O B;  3CBP A;  3RKW A;  1LOJ A;  1IO6 A;  2MAM A;  4C92 D;  3I55 Q;  2MYS A;  3MP1 A;  3SWN A;  4A4E A;  3OYL A;  1VYU A;  3P8B B;  2ZZD A;  2X4J A;  2M0O A;  2X3X D;  5CKF A;  4F7U B;  3CCS T;  2HMA A;  3VRZ A;  4RTT A;  3VUB A;  2KI7 A;  2O2O A;  2XDD A;  1QVG S;  3OYG A;  2O4X A;  5C0M A;  4M75 G;  2FPF A;  4M7D A;  2KYM A;  5IHK A;  1JB0 E;  4RTX A;  3G7Z A;  2E64 A;  3G6E T;  1J3T A;  1NPP A;  3CCM Q;  3CPF A;  2CP2 A;  5LJ3 g;  5HK0 A;  4PK4 A;  3MHX A;  5GAN f;  4QKU A;  1AWO A;  1JJ2 A;  1NYG A;  3OYC A;  4IKF A;  1H3Z A;  3FRN A;  2VXF A;  4QVC A;  4M7A A;  2FRY A;  4OMN A;  2VB6 A;  2LNH B;  1T0H A;  2RA2 A;  4PJO E;  1UG1 A;  4L5G A;  3LWI A;  1EZZ B;  3ASK A;  1OZ2 A;  1WQW A;  1NLP C;  2ED0 A;  4EPC A;  8ATC B;  3JCM J;  1VUB A;  3INZ A;  3MO8 A;  3DLL A;  1BCM A;  4KH0 B;  1UHC A;  2YUO A;  1YI2 A;  5FRM A;  2GTO A;  2FG0 A;  4M78 A;  1RAG B;  2DYB A;  3L1A A;  1RLQ C;  2KYB A;  2J6F A;  4PFO A;  2E3H A;  1IHV A;  1S72 Q;  3U23 A;  2DIG A;  4M7A G;  2DK3 A;  3ZFJ A;  5GMK e;  3RDV A;  3S3N A;  1W2B P;  1G3W A;  4LDU A;  1QVP A;  2C0I A;  1TWB A;  2ROL A;  5DLO A;  1M30 A;  3E2U A;  5GMK j;  4NL3 A;  1VQP Q;  4WF2 A;  1OYX A;  3FEO A;  2XIC A;  2P84 A;  1I81 A;  2DVE A;  3MP6 A;  5ECA A;  4FCY A;  2IG0 A;  1VQ6 A;  4XTY A;  1N27 A;  2FO0 A;  5A0D A;  2E41 A;  5GAM g;  1Q7Y C;  2H3E B;  4EMK C;  1E6H A;  2CH4 A;  2K2M A;  4IUR A;  2DYI A;  3LH0 A;  4OMO A;  4X1V A;  3L2U A;  2JUF A;  1D0Z A;  2MOX A;  3CCV Q;  2EBP A;  2R5A A;  1NBE B;  4HT9 A;  2K3Y A;  1GRI A;  1PSF A;  1SG5 A;  2VKN A;  1QVF P;  2D8J A;  4KUL A;  3V7R A;  1VYT A;  2DL3 A;  3JAM E;  2OTJ A;  5CKB A;  2F2V A;  3CCE T;  5A2Q E;  4M75 E;  2HQH A;  2B8A A;  1VQO Q;  1TU0 B;  2DNU A;  4C8Q B;  4B6M A;  4XTW A;  2QEX A;  3X25 B;  3OYM A;  2EQM A;  1G83 A;  2EJ9 A;  4RTU A;  3VYH B;  3CCQ Q;  1JXO A;  2GQV A;  4TVR A;  4KGV B;  5GAO m;  2KR3 A;  1YJN Q;  4C8Q D;  3CCU T;  4F04 B;  1K9A A;  2PUO B;  3M0R A;  2F1L A;  4C0D B;  1Q82 C;  1MMA A;  1PHT A;  1M8V A;  1QVG A;  2DM1 A;  1WHK A;  1LJO A;  1AWJ A;  5GAN e;  2HNI A;  1EX4 A;  3RKY A;  1VQM T;  1LPL A;  3FLG A;  3CCR Q;  2LCL A;  1RAH B;  5GAN j;  3EG9 B;  4WCI A;  1PG5 B;  1Y7X A;  3QG1 A;  1D1A A;  3X24 B;  3WXM B;  1VQ9 Q;  2QYZ A;  3L2Q A;  3G71 A;  1KQS S;  2EWN A;  1KK7 A;  2I2L A;  4BI4 A;  2JZ2 A;  2BZX A;  2FYK A;  1VQK A;  2QXF A;  3OQ5 A;  5GAO p;  2RK1 A;  1RL2 A;  4C92 C;  5DM7 R;  5FU6 C;  4XU0 A;  3R6N A;  4BE2 A;  2RD1 A;  1C1A A;  3JCM Q;  2M51 A;  1X6G A;  2CZ7 B;  1VQ4 T;  2L3Q A;  4CC7 A;  1OEB A;  1RAA B;  2VV5 A;  2NUZ A;  2DBM A;  3L42 A;  3UDC A;  1G3S A;  1YIT A;  2FB7 A;  1Y71 A;  2R57 A;  5CQX A;  2RQU A;  3Q1J A;  3R6O A;  4RKU E;  4M77 B;  2PTK A;  4FYX B;  1KJW A;  3JCM V;  1ZSZ B;  2LT1 A;  3I55 A;  1UB4 A;  4LXC A;  2E5Q A;  3FDR A;  3JCM c;  4C5G A;  2O9S A;  4M77 D;  1JRI A;  2DL7 A;  1Y96 B;  1H8K A;  1FMW A;  2JM9 A;  2KXD A;  3M0T A;  1IRX A;  1WPY A;  2DBK A;  2RMO A;  2FZG B;  1GCQ A;  2ZAE A;  3JB9 G;  1VQ7 T;  4KH1 B;  3CPW P;  3OMG A;  5GAN d;  4D8K A;  1IGQ A;  2L3R A;  2CSI A;  2RK2 A;  1RI0 A;  1BKB A;  2CUD A;  3CCM A;  2GQI A;  4PLI A;  1X43 A;  2ENM A;  3PMI A;  2L2P A;  5HK3 A;  1H64 1;  4EDU A;  1Q86 R;  4FYY B;  2GTJ A;  1XNI A;  3VS7 A;  2KMT A;  3CXC P;  2VXE A;  4RTY A;  4KBM B;  1D3B A;  2RH2 A;  2JS0 A;  1SRL A;  1ZBX A;  5IXF A;  1M27 C;  1U8R A;  1QWE A;  4WTO B;  3M9Q A;  3LWH A;  2DL8 A;  2DTH A;  4B9W A;  1HD3 A;  4E7I A;  4A4H A;  2LZ6 B;  4NOY A;  4J9E A;  1HJD A;  2FL7 A;  3PVQ A;  2E65 A;  1YHQ T;  3REA B;  4JJC A;  2KAF A;  2MWO A;  1K73 U;  2DTO A;  4OB2 B;  1VQN Q;  1PCX A;  2KT8 A;  1S72 A;  4C92 G;  2EYX A;  2CZ1 B;  3J7A F;  4IIO A;  3FJP A;  2QI2 A;  3ZL7 C;  1GFD A;  2RQV A;  2E6N A;  1K8A R;  2LNV A;  1AT1 B;  1VQP A;  1DJ7 B;  2LJ1 A;  5GAN h;  4C5H A;  3FIF A;  4RG2 A;  4PFZ A;  5FWC A;  4X9D A;  2XMF A;  6AT1 B;  3CC4 T;  4F7U G;  5LJ5 g;  1VQ8 Q;  1I5L A;  1PM3 A;  2ZCF B;  1UGR B;  2A0F B;  4RCB A;  2VWF A;  1LVK A;  2E5K A;  1PD1 A;  4J9F A;  4Z02 A;  3P8H A;  3JB9 J;  1Q81 R;  1WJR A;  2ATC B;  1WIE A;  1KQS A;  1G3T A;  1NJI R;  5KCO A;  4M7D F;  2MPX C;  1X6O A;  3OS5 A;  2V1R A;  3CCV A;  4E7Z A;  4CC2 A;  4FSX A;  1TS9 A;  4XTV A;  1N6A A;  3CBO A;  2QA4 T;  2F5K A;  1V29 B;  1NE8 A;  4C8Q C;  4BE0 A;  2DXB A;  1BCO A;  2BZ8 A;  3RUX A;  3QXE B;  4X34 A;  4M7A F;  1H3H A;  3FC3 A;  4PLL A;  1VQO A;  1WX6 A;  2J6K A;  3VS1 A;  4BDZ A;  2LT4 A;  2GGR A;  2AHJ B;  4C0D C;  2QAS A;  1OV3 A;  4ZGJ B;  1IHW A;  2RO0 A;  3CCQ A;  4IIM A;  4D8D A;  5FWB A;  1WHM A;  4Z89 A;  1YI2 T;  4D6W A;  1YJN A;  2QQ9 A;  3EGD B;  4J6Y A;  3QWX X;  2Y4Y A;  5IHN A;  4M78 F;  2HEQ A;  4KGZ B;  4A4F A;  1QKW A;  4HCB A;  1TUG B;  4AG2 C;  3ULR B;  3CCJ T;  3H0F A;  3OS2 A;  2V8I A;  1UFF A;  4PJO A;  2QTV A;  4B9X A;  2E1H A;  3VS3 A;  2E70 A;  3PIO A;  4JRQ A;  1ARK A;  1NZ9 A;  1UGP B;  2DZ9 A;  3CCR A;  1AZG B;  1TUD A;  2DRK A;  3QYG B;  4Z8A A;  2F2X A;  5FRO A;  2KEA A;  4FIB A;  4C5E A;  3L2Z A;  2EQI A;  3GBQ A;  4PJL A;  3CC2 T;  4J9I A;  3JV3 A;  2EVR A;  3QKJ A;  1K73 C;  1K76 A;  1ABO A;  1VQ9 A;  1VQ6 T;  4E7J A;  4OB3 B;  1YP5 A;  2K5F A;  1UEB A;  4C92 E;  3OYH A;  2D8H A;  2OAW A;  2DD5 A;  2EQJ A;  3A5Z B;  2JNG A;  4J9D A;  1RAF B;  2AT1 B;  1GFC A;  1VOM A;  1M2V B;  2EJG A;  2LQN A;  2ZPG B;  2VYT A;  2LX7 A;  3UWN A;  4M77 C;  3JCM f;  1ZSZ C;  5KYU B;  2HCK A;  4BD3 A;  3A98 A;  4F7U E;  2E4H A;  2K4Y A;  1VQ5 Q;  2GF7 A;  1TH7 A;  3RKX A;  4FM4 B;  3CQT A;  3I56 T;  2P4R A;  4C8Q G;  3QII A;  1QCN A;  2YUQ A;  4C0F A;  4ORZ A;  2QEX T;  2LQK A;  1GXI E;  1FMK A;  4J9C A;  1KSW A;  2B86 A;  4NL2 A;  2DF6 A;  7AT1 B;  2D9T A;  3VRY A;  1VIF A;  3VS2 A;  1BIB A;  1R77 A;  1RAB B;  4FT4 A;  1W2B S;  3OBW A;  2P0Q A;  1G3Y A;  4M75 A;  1AZE A;  3CCS Q;  1YIT Q;  2C06 A;  1Q7Y U;  1IRE B;  4ZN1 A;  2RI3 A;  2LQW A;  2CKK A;  4M4Z A;  3TQ7 P;  4ZGD B;  2EAY A;  2DA9 A;  3V8L A;  3KXT A;  3G71 T;  4HCZ A;  1RAE B;  2E10 A;  3G6E Q;  2W10 A;  3OB9 A;  1JJ2 P;  4JUV A;  1VQK T;  2YLB A;  2YHT A;  3A8H B;  4LDV A;  2FHD A;  1WYX A;  1MMD A;  2QG9 B;  4MDW A;  5A0G A;  2EPD A;  4JS5 A;  1WZO A;  2HDA A;  2L8D A;  2G3R A;  3PVL A;  3OA6 A;  1B7T A;  3EFO A;  4RG8 A;  2NUT B;  1YCS B;  2RQR A;  4JJD A;  3CCL T;  1QVF S;  1VQN A;  2K9G A;  2KRS A;  2RHX A;  3V7S A;  3EH1 A;  5KYX A;  3L2R A;  3OYD A;  1M90 R;  1NPR A;  4MML A;  5HCK A;  1KHI A;  1RI9 A;  4M77 G;  4HVU A;  4GLK A;  2BTT A;  3OYA A;  1N8R R;  2COW A;  2XD0 A;  2ZGW A;  4HA8 A;  2K5L A;  3I55 T;  4V2S A;  1WHG A;  4BI8 B;  3VS6 A;  5CK9 A;  3UF4 A;  5GAN 2;  1Q82 U;  2OJ2 A;  2DJQ A;  5C6S A;  3MET A;  1M1K R;  1MHN A;  1VQ8 A;  3I5R A;  4XAX B;  5I11 A;  2D1X A;  3OMC A;  4FYW B;  2MK5 A;  2YWW A;  2KGT A;  2CYZ B;  3KFV A;  2M1H A;  2KRM A;  4R55 A;  1YJ9 T;  4O5V A;  5FLX E;  1G5V A;  2VAS A;  3VS5 A;  4Y28 E;  2ZPB B;  3HRU A;  3O8V A;  3QYH B;  4F17 A;  3JCM e;  1NEG A;  2EGE A;  3GIB A;  4KUI A;  4C8Q E;  1B07 A;  4DBQ A;  1M1G A;  2Y4X A;  2L0A A;  5CKH A;  3CME Q;  2D0N A;  2QQA A;  3M0Q A;  1GBR A;  4XU1 A;  4FYV B;  3I5S A;  4J8O A;  2HL5 C;  1VQL Q;  2XID A;  1KC8 R;  3N5B B;  5KYW A;  3E9G A;  3TCJ A;  3M56 A;  3QHS A;  2EW3 A;  1OX8 A;  1PNJ A;  2F5T X;  3C0C A;  2CS7 A;  4F14 A;  4QT7 A;  4E2F B;  2JMC A;  2A36 A;  3LX7 A;  4OMM A;  5KYY A;  1G2B A;  4RCC A;  3PFS A;  2K57 A;  3IQL A;  3QDR B;  2ECZ A;  4ZTJ A;  4RTZ A;  4OP0 A;  1SKU B;  3RR6 A;  3BFM A;  1S72 T;  1M2O A;  2DLP A;  4ZGE B;  3CCE Q;  2NUP A;  1ZQ1 A;  5KE2 A;  1B34 B;  3JB9 H;  5GMK l;  3TU4 K;  2V1Q A;  2LRQ A;  1RAC B;  2C0O A;  3LLR A;  3SB2 A;  2PUK B;  3WVD B;  1Q81 C;  4VUB A;  1VQP T;  3OYK A;  1ZBJ A;  1JEG A;  3CCU Q;  5GAN g;  2MI6 A;  1NJI C;  4OMQ A;  1JQQ A;  2EYY A;  4F16 A;  2LC4 A;  1QVG P;  2DL5 A;  2LVM A;  2GFU A;  4LDY A;  3CPW S;  3G4S A;  4AFU C;  2CT3 A;  3CD6 Q;  3HSB A;  1VQM Q;  5GJV B;  2Z0W A;  3JCM d;  4JZ3 A;  4M77 E;  3E9F A;  4ZTF A;  2LJ0 A;  3EGU A;  3RNJ A;  1TSF A;  1ACM B;  2F69 A;  3QDF A;  3CCV T;  4QQD A;  1Q95 G;  3SEM A;  3CC7 T;  1WQ7 A;  4JPB W;  5FU7 B;  5LJ3 d;  3CXC S;  2X35 A;  1YBY A;  1VQ5 A;  1E7O A;  2IVW A;  4EMK A;  1X75 C;  2JOY A;  3LGF A;  3OY9 A;  3RES A;  1QMC A;  3PT9 A;  2C0T A;  4E6R A;  3RER A;  1NM7 A;  2OAU A;  3HL8 A;  2IPO B;  1VQ4 Q;  1Y07 A;  3CCQ T;  1YJW T;  1TOV A;  1KD1 R;  1QKX A;  4JDS A;  2MWP A;  1WHL A;  2PU9 B;  3HP9 A;  3H0I A;  3M55 A;  4OML A;  1WJQ A;  2JXB A;  3EAE A;  2EFI A;  3HHT B;  4J5Y A;  2V8J A;  1HXD A;  1WNL A;  4QVD A;  3CMA Q;  1UGS B;  1PKT A;  5CAI A;  3CCS A;  2DO3 A;  4PJO F;  2DEU A;  2QQS A;  1LNX A;  3JCM h;  3GF5 A;  2HZY A;  2M16 A;  1VQ7 Q;  3HFN A;  2DVJ A;  4CRI A;  3KUF A;  1VQ9 T;  4AFS C;  3SDZ A;  2EGC A;  3QJ6 A;  1HYO A;  3EG2 A;  2YLC A;  3A8M B;  3G6E A;  1XOV A;  4N4I A;  5LJ3 h;  2QDL A;  5I22 A;  1YWO A;  5GAM d;  2RJC A;  2JTF A;  1KIK A;  1OU9 A;  2CUB A;  2EKH A;  1SEM A;  3SWN B;  1K4U S;  4XU3 A;  2RJD A;  3JCM W;  1MNE A;  2XDB A;  2DEQ A;  1SSH A;  4RUG A;  1M5Q 1;  5J3B A;  4LN2 A;  1K1Z A;  2VGN A;  2DXC A;  3VS4 A;  2O4X B;  4J9H A;  2YRC A;  4KGX B;  2FZK B;  4M7D B;  1X27 A;  3M0U A;  4C92 A;  2OTL Q;  4Z88 A;  4OB0 B;  4JRI A;  5GAN 7;  3JB9 I;  3F70 A;  1GCP A;  3OYE A;  1K9M C;  3EGX A;  5GAN 6;  1YHQ Q;  2GCX A;  2CZ6 B;  2RPN A;  4M7D D;  3BE3 A;  4CC4 B;  2CGH A;  2YSQ A;  1E6G A;  1U5S A;  3LH5 A;  1LCK A;  2ED1 A;  4M7A B;  1UGV A;  3V7C A;  4AFZ C;  4QW2 A;  1KHC A;  3OBY A;  4F7U A;  1YIJ Q;  3M4G A;  1IZ6 A;  1H92 A;  2JN0 A;  1K0S A;  1T0J A;  5KE3 A;  2NLU A;  3P8D A;  4XTZ A;  2DER A;  4M7A D;  4P5N A;  2HD0 A;  2YUP A;  4IUU A;  3CPW A;  1KFZ A;  3SFM A;  1M4Z A;  2K5I A;  2LDM A;  5L23 A;  4XQ3 A;  1UE9 A;  2V8K A;  1BYM A;  3M4Y A;  3OS1 A;  4FU6 A;  5GAM h;  4M75 F;  4HKE A;  2KNB B;  3QZ5 B;  4M78 B;  4J7F A;  3CME A;  4QQG A;  4L59 A;  2HAX A;  4JLI A;  2ROT A;  1OOT A;  2SEM A;  1VQL A;  3DLM A;  3PGG A;  4N0A C;  2RQT A;  4M78 D;  2KRO A;  1AOJ A;  4OMF B;  4HCK A;  1N8R C;  2QA4 Q;  1Q7Y R;  1YFN A;  2NYS A;  2X51 A;  3QUI A;  4DEY A;  3PTA A;  4LNP A;  1CSK A;  1WXT A;  1QWF A;  1CKA A;  2YRV A;  1OPL A;  3OSS C;  1EFN A;  3CCE A;  4DBH A;  4PKC C;  4J9B A;  3PMT A;  2BIV A;  1Z9Q A;  1IB8 A;  5GAN 5;  2LX9 A;  3QSU A;  4BB7 A;  4KUD K;  2FPD A;  3H41 A;  1QCO A;  1N9S A;  3CCU A;  3M0P A;  3BDL A;  2KE9 A;  2GFA A;  4BY6 B;  4DOV A;  2X4Y A;  1PD0 A;  3MPU B;  9ATC B;  1W6X A;  3VYG A;  2X3W D;  5CO7 A;  3MEU A;  4BI3 A;  3OW2 S;  3CCJ Q;  2JM8 A;  1HK9 A;  1QP3 A;  3OYJ A;  1WA7 A;  2PVO B;  3EFS A;  3CD6 A;  1UHF A;  5FU7 C;  2RM4 A;  1VQM A;  2PVG B;  5D6X A;  2JW4 A;  4AMC A;  3E19 A;  2EGA A;  1YWP A;  2WSC E;  2EIF A;  4N4H A;  3JSC A;  3CC2 Q;  2KSS A;  2DRM A;  3ER0 A;  1HSQ A;  2A3L A;  1NYF A;  1QLY A;  2AK5 A;  2EQU A;  3URG A;  1QW1 A;  4R56 A;  5CR2 A;  1UUE A;  3ZEH A;  2EQK A;  5IXB A;  3JCM P;  5GAO n;  3OYI A;  2LMJ A;  4LUD A;  1MMN A;  2QK0 A;  1VQ4 A;  2ZPH B;  4GBQ A;  4E47 A;  1A0N B;  2KDS A;  4MZM A;  8AT1 B;  3G4S Q;  4C8Q A;  2QGG A;  4LD9 K;  2YXY A;  1GBQ A;  2LP5 A;  3I56 Q;  1BIA A; 
#chains in the Genus database with same CATH homology
 2LCL A;  3OMC A;  5GAN j;  1M1F A;  2XG8 D;  5CIU A;  1WGS A;  3CXC A;  3L2V A;  3CMA A;  2DKG A;  3S6W A;  2CYZ B;  3GLX A;  2M1H A;  4M77 F;  1Y7X A;  3OYF A;  4L6V 5;  2VC8 A;  3QG1 A;  4JLG A;  4R55 A;  1YJ9 T;  4O5V A;  5FLX E;  1M90 C;  3X24 B;  2K3X A;  3A8L B;  1G5V A;  3WXM B;  2JTM A;  2BKD N;  3L2Q A;  4Y28 E;  2OTJ T;  3G71 A;  2ZPB B;  3HRU A;  3O8V A;  4YTL A;  2KK4 A;  3QYH B;  1KQS S;  1YIJ T;  2RHU A;  3JCM e;  2EWN A;  2I2L A;  4BI4 A;  5LJ3 f;  4E7L A;  3GIB A;  3MEV A;  2JZ2 A;  4KUI A;  4MZP A;  1VQ7 A;  2FYK A;  4C8Q E;  1VQK A;  2QXF A;  3OQ5 A;  4C0Z A;  2RK1 A;  5DLQ E;  5GAN 4;  5GAO p;  1RL2 A;  3SWN C;  1M1G A;  2Y4X A;  2DAQ A;  4C92 C;  5DM7 R;  5LJ5 d;  3BY7 A;  3HRS A;  5CKH A;  5FU6 C;  5LL6 S;  5I21 A;  4XU0 A;  5GMK i;  3QPH A;  1VQN T;  2QQA A;  1M1K C;  4NS5 A;  4BE2 A;  4XU1 A;  4XAX B;  2RD1 A;  2X4W A;  3GP8 A;  4J8O A;  1I8F A;  2DXT A;  3JCM Q;  2XID A;  3N5B B;  3E9G A;  3ME9 A;  3TCJ A;  3M56 A;  4HT8 A;  4PJO C;  2CZ7 B;  3QHS A;  1VQ4 T;  4BE1 A;  3HFO A;  2RI5 A;  3TEE A;  4GY5 A;  3M59 A;  2VV5 A;  1W4S A;  5J39 A;  1YCY A;  1BI1 A;  2F5T X;  3L42 A;  1G3S A;  3UDC A;  4C0G A;  4DOW A;  2FB7 A;  1YIT A;  1Y71 A;  2CS7 A;  2R57 A;  4M7D C;  4OVA A;  5CQX A;  2DD4 A;  2DJZ A;  3S3O A;  2MF2 A;  2RHY A;  2HBP A;  3Q1J A;  3QBY A;  3R6O A;  3LX7 A;  4RKU E;  4IUT A;  4M77 B;  4RCC A;  4ME7 A;  4Q5W A;  3OSV A;  4UC4 A;  3JCM V;  3PFS A;  2K57 A;  3QDR B;  2LT1 A;  3I55 A;  1UB4 A;  1VQ5 T;  1KD1 C;  5L8R E;  2KVQ G;  1VQ8 T;  1XQH A;  3CC7 A;  2E5Q A;  4ZTJ A;  3FDR A;  3JCM c;  2PVD B;  4OP0 A;  4C5G A;  5I2S A;  3M54 A;  3ZBD A;  4M77 D;  1JRI A;  2OTL A;  5AYF A;  4JRP A;  1KD1 U;  3BFM A;  1Y96 B;  1K8A U;  1S72 T;  4ZGE B;  4M7A C;  1ZQ1 A;  1WPY A;  5LJ5 e;  5KE2 A;  1YHQ A;  4IUQ A;  1B34 B;  4M77 A;  5GMK l;  1KC8 C;  3JB9 H;  3TU4 K;  4DA4 A;  3A8G B;  2LRQ A;  1SSF A;  4N0A A;  3J81 E;  2WSE E;  2MMP A;  5LJ5 j;  4CI0 C;  3LLR A;  1PSE A;  2LCC A;  3JB9 G;  1VQ7 T;  1VIE A;  3SB2 A;  2XU8 A;  3OMG A;  2PUK B;  3WVD B;  5GAN d;  4VUB A;  5IAY A;  1VQP T;  3OYK A;  1Q81 C;  5D6Y A;  2L3R A;  1D3B B;  5GAN g;  1Y96 A;  2MI6 A;  2RK2 A;  1RI0 A;  3GNG A;  3NTH A;  3WVE B;  1NJI C;  1KQ2 A;  1BKB A;  1YIJ A;  3NTK A;  4A53 A;  1Q81 U;  2LC4 A;  2P4T A;  3DB4 A;  3CCM A;  1YJW A;  4PLI A;  3OW2 A;  3JCM X;  1B34 A;  3RMQ A;  2DIQ A;  3KBG A;  3PMI A;  2E12 A;  3C94 A;  4M78 C;  1NJI U;  5HK3 A;  2RHI A;  1H64 1;  4EDU A;  5GAM f;  1P92 A;  2GFU A;  2LVM A;  4LDY A;  3MP8 A;  4MMK A;  1XNI A;  3CPW S;  4XTU A;  5J26 A;  2E6Z A;  5LJ5 h;  2XDP A;  3G4S A;  1JJ2 S;  3CC4 A;  2KMT A;  1O75 A;  1YIT T;  2VXE A;  3HSB A;  4ATO A;  2RJF A;  4KBM B;  4DQ2 A;  2D0Q B;  2R5M A;  5CQY A;  3JB9 F;  4A4G A;  1D3B A;  2RH2 A;  3JCM d;  4IUP A;  4A54 A;  1OI1 A;  4M77 E;  1KG1 A;  2FVU A;  3E9F A;  1ZBX A;  4II1 A;  4EMK B;  4ZN3 A;  4ZTF A;  3JCM g;  5I2M A;  1U8R A;  5D6W A;  3GOX A;  2F69 A;  5IN1 A;  3CCV T;  3M9Q A;  4QQD A;  3CC7 T;  4FL6 A;  1U1T A;  1WQ7 A;  4J6W A;  5FU7 B;  3LWH A;  2DTH A;  1X01 A;  5LJ3 d;  4B9W A;  3CXC S;  4E7I A;  2X35 A;  1YBY A;  3V8J A;  4N4G A;  4NOY A;  4A4H A;  1VQ5 A;  3EFR A;  2EJF A;  5KCH A;  4EMG A;  2IVW A;  2VUB A;  5FRN A;  4OB1 B;  4QVZ A;  2FL7 A;  2WSF E;  4J6X A;  2E65 A;  2ZPF B;  4EMK A;  1YHQ T;  1X75 C;  2JOY A;  3LGF A;  3PNW C;  2KAF A;  5CKE A;  3OY9 A;  1Q86 C;  2R58 A;  2MWO A;  2QA4 A;  1K73 U;  1WJS A;  2DTO A;  4XTX A;  4JS4 A;  4IUV A;  3RES A;  4M75 C;  4OB2 B;  3PT9 A;  1S72 A;  4C92 G;  3LYI A;  4OGC A;  2CZ1 B;  3J7A F;  4PJO D;  4Y91 A;  3RER A;  2OAU A;  3HL8 A;  1Q86 U;  3FJP A;  3M5A A;  4FT2 A;  3OS0 A;  2XKO C;  3V8K A;  2QI2 A;  2CZ0 B;  3DKM A;  1Y07 A;  3NFC A;  5M9O A;  4PJO G;  3C12 A;  3CCQ T;  3PIP A;  1YJW T;  3CCM T;  2RJE A;  3H6Z A;  4OGE A;  2E6N A;  4JDS A;  4LD6 A;  2LNV A;  2MWP A;  3X28 B;  2PU9 B;  3S3M A;  1VQP A;  1DJ7 B;  1BI2 A;  4BY6 C;  2XI9 A;  4J7I A;  3HP9 A;  5GAN h;  4C5H A;  2LQ8 A;  3X26 B;  4M7D G;  3M55 A;  3M58 A;  3QO3 A;  3FIF A;  4RG2 A;  2ZPE B;  4BDY A;  4X9D A;  2RHZ A;  3G4S T;  3CC4 T;  4F7U G;  3CBM A;  1WJQ A;  5LJ5 g;  3JB9 D;  5EG2 A;  1I5L A;  2WAC A;  3EAE A;  4C92 F;  4ELY C;  2EFI A;  3HHT B;  2ZCF B;  5LJ3 e;  1UGR B;  4J5Y A;  4RCB A;  5GAO l;  3JCM b;  2V8J A;  2M9U A;  3VKI A;  4X9C A;  1HXD A;  1WNL A;  4QVD A;  3J80 E;  1UGS B;  5LJ3 j;  5CAI A;  2EYQ A;  3CCS A;  2DO3 A;  3A8O B;  4Z02 A;  3P8H A;  4PJO F;  4JJN K;  3JB9 J;  3CCJ A;  1WJR A;  2QQS A;  1KQ1 A;  2QQR A;  1LNX A;  3JCM h;  1KQS A;  1G3T A;  1JBM A;  3GF5 A;  5KCO A;  5IT9 E;  4M7D F;  1X6O A;  3OS5 A;  2M16 A;  3CCV A;  3HFN A;  3GNF B;  1VQ9 T;  4CRI A;  3KUF A;  4FSX A;  5DY9 A;  2RB6 A;  4F7U F;  1I4K 1;  3SDZ A;  1K8A C;  3OYB A;  3L2W A;  3UPU A;  3UT1 A;  2A7Y A;  2RI2 A;  3T9N A;  4XTV A;  1N6A A;  3CBO A;  2KY9 A;  4J83 A;  1FXX A;  3QJ6 A;  2QA4 T;  2YLC A;  2F5K A;  3A8M B;  1XOV A;  4N4I A;  5LJ3 h;  1V29 B;  1MGQ A;  3G6E A;  1NE8 A;  4C8Q C;  3CC2 A;  4BE0 A;  2DXB A;  4JRK A;  5GAM d;  4O6J A;  1XTD A;  2RJC A;  1FWZ A;  2JTF A;  3RUX A;  3QXE B;  4BUG A;  4LDX A;  4X34 A;  4M78 G;  3CME T;  4M7A F;  5CCA A;  3SWN B;  3BDU A;  3VUZ A;  3QZ9 B;  3SD4 A;  2K2V A;  4C92 B;  5FU6 B;  4XU3 A;  2RJD A;  4PLL A;  3FC3 A;  3JCM W;  1VQO A;  1VQL T;  2LTO A;  5GAN 8;  4EMH A;  4BDZ A;  2XDB A;  3MCA B;  3HPW A;  4C5I A;  2LT4 A;  5HKC A;  3OYY A;  2AHJ B;  3DB3 A;  1W2B A;  4C0D C;  4ZGJ B;  2DEQ A;  3CBP A;  3RKW A;  1LOJ A;  1M5Q 1;  2RO0 A;  3QJY A;  5J3B A;  4PJO B;  3CCQ A;  3NTI A;  2KQW A;  2MAM A;  2VGN A;  2DXC A;  4C92 D;  1BI0 A;  2O4X B;  1YI2 T;  2L5Q A;  4D6W A;  1YJN A;  3MP1 A;  3RIR A;  2QQ9 A;  2O01 E;  4J6Y A;  3SWN A;  4A4E A;  4M7D B;  3OYL A;  4XU2 A;  4C92 A;  2Y4Y A;  4M78 F;  3LGL A;  3P8B B;  4JRI A;  4OB0 B;  4A4F A;  5GAN 7;  3F70 A;  2ZZD A;  3JB9 I;  2X4J A;  2M0O A;  4F7U B;  5CKF A;  3CCS T;  4QQ6 A;  3OYE A;  4HCB A;  1K9M C;  3FB9 A;  5CVI A;  5GAN 6;  3CCJ T;  3VUB A;  2GCX A;  3OS2 A;  2V8I A;  2CZ6 B;  4M7D D;  2XHC A;  2XDD A;  1QVG S;  4B9X A;  4PJO A;  1QP2 A;  5HY6 A;  5GAM e;  3HKS A;  2E1H A;  3OYG A;  1K9M U;  2E70 A;  2O4X A;  2CGH A;  3PIO A;  5C0M A;  4JRQ A;  1NZ9 A;  1UGP B;  3I56 A;  2DZ9 A;  4M75 G;  3CCR A;  4M7D A;  2DPP B;  4M7A B;  1JB0 E;  5GAM j;  3V7C A;  4LDW A;  2VGM A;  1O9S A;  3QYG B;  5FRO A;  3G7Z A;  4FIB A;  4QW2 A;  1KHC A;  3OBY A;  3L2Z A;  4XK8 E;  4C5E A;  4F7U A;  2E64 A;  3M4G A;  3G6E T;  3CC2 T;  1NPP A;  1IZ6 A;  1U1S A;  2DXU A;  2QDY B;  4MZT A;  2JN0 A;  3CPF A;  3QKJ A;  5LJ3 g;  1K73 C;  5HK0 A;  1VQ9 A;  5KE3 A;  1FX7 A;  2NLU A;  3P8D A;  3X20 B;  1VQ6 T;  4XTZ A;  4E7J A;  4M7A D;  4OB3 B;  3MHX A;  5GAN f;  4P5N A;  2K5F A;  2HD0 A;  1UEB A;  4IUU A;  3CPW A;  1QVF A;  1JJ2 A;  3SFM A;  1M4Z A;  2JVV A;  2K5I A;  2LDM A;  4C92 E;  5KH6 A;  3OYH A;  4XQ3 A;  4RMO A;  3VV0 A;  3OYC A;  4IKF A;  2DD5 A;  3FRN A;  1H3Z A;  2VXF A;  2V8K A;  1BYM A;  4QVC A;  3M4Y A;  4BAC A;  1VQO T;  4M7A A;  3OS1 A;  2EQJ A;  1N9R A;  1EIF A;  3A5Z B;  4FU6 A;  3MEA A;  4HKE A;  4M75 F;  2JNG A;  5GAM h;  2H3J A;  3QZ5 B;  4M78 B;  4J7F A;  3CME A;  2RA2 A;  4OF1 A;  4E7K A;  4QQG A;  4PJO E;  4L5G A;  3LWI A;  2EJG A;  3CEY A;  3CD6 T;  2ZPG B;  3ASK A;  4L59 A;  4JLI A;  2HAX A;  2VYT A;  2D6F A;  1OZ2 A;  1WQW A;  4PL6 A;  3UWN A;  1VQL A;  3DLM A;  3PGG A;  4M77 C;  4EPC A;  1YJN T;  4M7D E;  3JCM f;  4N0A C;  3JCM J;  1VUB A;  3INZ A;  4M78 D;  4BD3 A;  2QQB A;  3MO8 A;  4F7U E;  2K4Y A;  3HRT A;  3DLL A;  3OYN A;  2GF7 A;  1TH7 A;  1YI2 A;  5FRM A;  5GMK m;  4M78 A;  3RKX A;  2P0P A;  4HCC A;  3L1A A;  4FM4 B;  4OMF B;  1N8R C;  1M90 U;  3M53 A;  3LW5 E;  3VU3 C;  3I56 T;  3QUI A;  2QTX A;  4KT0 E;  3CCR T;  4M7A E;  2DIG A;  4C8Q G;  3QII A;  3PTA A;  4M7A G;  1N8R U;  2DK3 A;  4C0F A;  3M57 A;  5GAO q;  3ZFJ A;  5GMK e;  2QEX T;  1BI3 A;  2YRV A;  3E1S A;  3OSS C;  2LQK A;  4E7H A;  3S3N A;  1G3W A;  3CCE A;  1GXI E;  4LDU A;  1QVP A;  4PKC C;  3PMT A;  4MDX A;  4M75 B;  2BIV A;  5DLO A;  5GMK j;  4NL3 A;  4NL2 A;  4WF2 A;  1OYX A;  5GAN 5;  2HQE A;  1M1K U;  3FEO A;  3TRE A;  2X4X A;  3CCL A;  2LX9 A;  3QSU A;  2D9T A;  2XIC A;  4BB7 A;  4KUD K;  1ZHI A;  1VIF A;  1I81 A;  2DVE A;  3MP6 A;  4M75 D;  1BIB A;  2IG0 A;  1VQ6 A;  4XTY A;  2EKO A;  1N27 A;  1N9S A;  4M78 E;  3CCU A;  5A0D A;  4FT4 A;  2E41 A;  4C8Q F;  3BDL A;  5GAM g;  1W2B S;  3OBW A;  2P0K A;  2GFA A;  4BY6 B;  4DOV A;  2X4Y A;  2P0Q A;  1Q7Y C;  5LJ5 f;  1G3Y A;  4M75 A;  3VYG A;  5CO7 A;  3MEU A;  4PNO A;  4BI3 A;  5GAO r;  4EMK C;  2C06 A;  3OW2 S;  5GMK h;  1OZ3 A;  4IUR A;  3JRZ A;  1Q7Y U;  3CMA T;  1HK9 A;  1QP3 A;  3AHU A;  1IRE B;  3LH0 A;  4ZN1 A;  2RI3 A;  3OYJ A;  2ZPI B;  2DTI A;  2PVO B;  1R8O B;  3C4S A;  2CKK A;  3EFS A;  3CD6 A;  3L2U A;  2JUF A;  2XK0 A;  5FU7 C;  2RM4 A;  1VQM A;  4ZGD B;  2EAY A;  2PVG B;  3H8Z A;  5D6X A;  2R5A A;  3V8L A;  2PQW A;  3E19 A;  3KXT A;  4HT9 A;  3G71 T;  2K3Y A;  4HCZ A;  1M9S A;  2WSC E;  1PSF A;  2EIF A;  4N4H A;  2E10 A;  3JSC A;  1YJ9 A;  2KSS A;  1KC8 U;  3OB9 A;  2L89 A;  4JUV A;  3ER0 A;  1VQK T;  4KUL A;  3V7R A;  2YLB A;  2A3L A;  2YHT A;  3JAM E;  2OTJ A;  2BUD A;  5CKB A;  3A8H B;  4LDV A;  2FHD A;  2EQU A;  4MDW A;  3URG A;  3CCE T;  5A0G A;  5A2Q E;  1QW1 A;  4M75 E;  4R56 A;  2B8A A;  5CR2 A;  4JS5 A;  1AHJ B;  2L8D A;  4C8Q B;  2G3R A;  3ZEH A;  3OA6 A;  4RG8 A;  2EQK A;  4XTW A;  3VJP A;  5CKD A;  4ELZ C;  2QEX A;  3JCM P;  1QVF S;  3CCL T;  2DZC A;  3X25 B;  5GAO n;  1VQN A;  3OYM A;  2EQM A;  5GAN 3;  2RHX A;  3V7S A;  2EJ9 A;  3OYI A;  3VYH B;  3L2R A;  3OYD A;  3C95 A;  3BW1 A;  1NPR A;  2GQV A;  4TVR A;  4MML A;  5GAO m;  4C8Q D;  1KHI A;  3CCU T;  3GPL A;  4M77 G;  1VQ4 A;  2ZPH B;  4E47 A;  4A4K A;  2PUO B;  4GLK A;  2KDS A;  2Y90 A;  5A0L A;  3OYA A;  4MZM A;  4C0D B;  2HQX A;  1Q82 C;  2XD0 A;  2ZGW A;  4HA8 A;  1UGQ B;  2K5L A;  3I55 T;  3RMS A;  4V2S A;  4BI8 B;  4C8Q A;  5CK9 A;  1M8V A;  3MEW A;  4LD9 K;  1QVG A;  5GAN 2;  1Q82 U;  1LJO A;  2OTL T;  5C6S A;  5GAN e;  3MET A;  2HNI A;  1MHN A;  3RKY A;  1VQ8 A;  1VQM T;  1BIA A;  3FLG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...