3JB9J

Cryo-em structure of the yeast spliceosome at 3.6 angstrom resolution
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
73
structure length
73
Chain Sequence
b'KAGAPDLKKYLDRQVFVQLNGSRKVYGVLRGYDIFLNIVLEDSIEEKVDGEKVKIGSVAIRGNSVIMIETLDK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pre-mRNA-splicing factor spp42
publication title Structure of a yeast spliceosome at 3.6-angstrom resolution
pubmed doi rcsb
molecule tags Rna binding protein/rna
total genus 9
structure length 73
sequence length 73
chains with identical sequence o
ec nomenclature
pdb deposition date 2015-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3jb9J00
3QSUA 4OP0A 1B34A 2HNIA 3HSBA 1M8VA 1D3BA 4EMKB 3L2ZA 3SWNC 3JCMf 4C92G 3EFSA 2EJFA 4DQ2A 5LJ5g 1I8FA 2ZGWA 1MGQA 1BIAA 5GAMj 3AHUA 4XTWA 4M7AD 4M7AF 3JCMX 5GAOp 2E1HA 3JCMh 5GANd 2RM4A 1JBMA 4XU1A 1X01A 1M5Q1 2RA2A 3BFMA 4C92C 1TH7A 2YLBA 2EJ9A 4M78B 1HXDA 2VC8A 2EJGA 4M7AG 5GAMd 3PGGA 1N9RA 3BY7A 4JRIA 4X9DA 3V7RA 2E65A 4F7UE 5LJ5e 3V8KA 3JCMQ 4M7AA 5GAN6 4F7UB 4X9CA 3VU3C 4M7AC 4C92D 2DTOA 4C92F 4M75C 3RKWA 4C8QC 5LJ3f 1YCYA 4XTXA 1BIBA 4PJOE 4QVCA 3SWNA 2FYKA 1I5LA 3JCMe 1WQWA 4J6YA 5LJ3h 4MMKA 4RCBA 4M77E 4C92A 1Y96B 4EMKC 2DVEA 3QO3A 3BDUA 4C8QD 4M7DD 4C8QF 4M75D 4M7DF 4M75F 4HA8A 2DXTA 1LOJA 4M78G 4M77B 4NL2A 4Y91A 1U1SA 3FB9A 4M7DG 1WNLA 4XU3A 3QUIA 4C8QG 3JCMg 4M75G 5GMKh 1WQ7A 5GAN2 3RKXA 5LJ5j 2E64A 2Y90A 4M78C 2QTXA 4C8QA 3SWNB 1LNXA 4M75A 1KQ2A 5GANe 3FJPA 3GIBA 1B34B 3JB9H 5GANf 4HT9A 1D3BB 4M7DC 4C92E 5LJ3e 2YHTA 4PNOA 4JRKA 1I4K1 5GAOm 3JCMP 2DKGA 5GAMf 5LJ5d 5GANh 5GAN3 5GAN5 3HFOA 2I2LA 3L1AA 3JCMJ 2DZ9A 3JB9G 4PJOB 5GMKm 4EMKA 4M78D 2EWNA 4M78F 3V8LA 3EFRA 3JB9J 3RIRA 3V7SA 5GAMh 2RD1A 5GANg 4M7AE 5GMKe 3HFNA 5LJ3g 3SB2A 2DJZA 2E10A 4M7AB 4F7UF 4MMLA 3JCMb 3JCMd 2K57A 4NOYA 5GAOr 4M78A 1KQ1A 2RB6A 1HK9A 2YLCA 4M77C 3M4GA 4XTZA 4A54A 5GAOl 1JRIA 1U1TA 4HT8A 3JCMW 4F7UG 4M7DA 3RUXA 3V8JA 5GAN7 3JB9I 5GMKl 4PJOF 3JB9D 3JB9F 2EAYA 4XU0A 5GAOn 4F7UA 4V2SA 5GAOq 4XTVA 3FIFA 3INZA 5LJ3j 1WPYA 1H641 4N0AC 3JCMc 4JUVA 4A53A 3RERA 4JLIA 5GAMe 5I21A 4PJOG 4C92B 2DTIA 3RKYA 2VXFA 3QHSA 4M77D 4M77F 4M78E 2DXUA 4J5YA 5CAIA 2VXEA 1N9SA 2DTHA 4XQ3A 4RCCA 2CGHA 3RESA 5GAN4 5LJ3d 2DEQA 4XTUA 4M77G 4M7DE 5DY9A 1Y96A 4C8QE 4M75E 4EMGA 2E41A 5GMKj 4PJOA 4WF2A 4QVDA 3BW1A 4M7DB 4M77A 3JCMV 4XTYA 4C8QB 5LJ5f 4M75B 5GMKi 5GAMg 5GAN8 1LJOA 2JN0A 4XU2A 4EMHA 1I81A 2DZCA 4J6XA 3V7CA 4PJOC 4J6WA 5LJ5h 4NL3A 4PJOD 2FB7A 4N0AA 5GANj
chains in the Genus database with same CATH superfamily
1M8VA 4Z89A 2EJFA 2K79A 2ZGWA 1BIAA 2CZ1B 4Y92A 3C0CA 1M1FA 2E5KA 5GAMd 2JS2A 4KUDK 4F7UE 3CCVQ 1W2BP 2QASA 1VQ4T 3CC7T 2ZCFB 4C8QC 1ABQA 4LNPA 1I5LA 5D7UA 4OMNA 5KCOA 2VB6A 1IHWA 1SPKA 1AD5A 3L2QA 1IZ6A 2BZ8A 1E6HA 2CP6A 2HZYA 4M7DG 4PJMA 4AFQC 3BDLA 5LJ5j 2H8HA 1YP5A 2V8JA 1M2OA 2QXFA 1QP2A 2L8DA 2WSFE 2X4XA 2QQBA 4E7LA 4EMKA 3PFSA 1M1KC 3JB9J 3NTHA 1X6GA 1M30A 3HFNA 2PNIA 1WHGA 3CPFA 3G6ET 1KQ1A 2PUKB 2RI3A 2NLUA 3G7ZA 2JM9A 1YWPA 3OS1A 1W70A 5GMKl 1LPLA 2LRQA 3CMET 2EYQA 2DYBA 1VQMQ 1G3YA 1UGSB 2DPPB 3THKA 3OY9A 1SRLA 4JRQA 3CBOA 1N9SA 5FU6C 2FL7A 3PT9A 2W0ZA 4II1A 3BW1A 4M77A 4OMMA 4M75B 1PC0A 2MI6A 4J9IA 3I9QA 1NG2A 1B34A 4PFPA 3M0QA 1MGQA 2MWOA 3TU4K 3SDZA 1QCFA 2XDBA 3CD6Q 2X4JA 5J39A 3CCUA 2KAFA 1CSKA 1N9RA 5KYYB 1BCOA 2K2VA 1QCNA 1VIFA 4X1VA 3H8ZA 2M1HA 1K76A 3GP8A 4LDVA 3OYLA 2RJFA 2E12A 3UDCA 3CCRA 2HL5C 3OMCA 1PSFA 3CCJA 5CR2A 3EAEA 2X3WD 2FPEA 4M78G 4NL2A 2HAXA 4Y91A 3GPLA 3CCLA 1R8OB 7AT1B 1RL2A 4OF1A 4HVUA 2CSIA 4C92E 1X75C 5KYNA 1I4K1 4Y28E 3LWHA 2RI5A 2JTMA 5IXBA 5LJ5d 5L8RE 3JB9G 4CC4B 4M78D 4KGVB 4OGCA 5DLQE 4ZN1A 3EFOA 2E6NA 2M0YA 3M53A 1S72Q 2OJ2A 1MMGA 4F7UF 3L42A 3EG1A 1R0BG 3Q1JA 3E2UA 3MP6A 3JB9D 2EQKA 1QQJA 4E7HA 3RERA 4JUVA 3DKMA 3A1PA 4PKCC 4C92B 3CCQA 2VXFA 2JMAA 1HYOA 3CEYA 4FIBA 2OTLQ 4BDYA 4GLMA 1KC8R 3NGPA 1T3SA 2DRMA 3QDRB 3VS3A 4JRPA 2HKNA 3EGDB 4RTUA 4QVDA 1QWFA 2DL8A 1GBQA 1GBRA 2RJCA 3S3OA 1EZZB 4NL3A 2HBWA 5KYUB 3HSBA 5D6WA 3CC2A 5LJ5g 2ROTA 1YHQQ 1VQ9Q 2Z0WA 4OB1B 3ASKA 3O8VA 2EJ9A 4K11A 3M0SA 1BU1A 3V8KA 3JCMQ 3L2RA 2AKKA 2MWPA 4M75C 2QDYB 4XTXA 2A28A 2DAQA 4PJOE 2G3RA 4QVCA 4J9FA 2L3SA 3JCMe 2QDLA 5LJ3h 3VS4A 1HSQA 2FZKB 1Y96B 4C8QD 4BUGA 1E6GA 1G3WA 1NLPC 2C0IA 4BDZA 5GMKh 1KC8U 4FW2A 4DOVA 3NHNA 1P92A 5A0LA 2M51A 4CC2A 3L2VA 5GANh 1VQLT 3CCUT 2I2LA 4PJOB 2EVRA 2EWNA 1M90U 2NUTA 2MOXA 2BIVA 2P0QA 1RADB 1VQ7A 1RABB 1PRMC 4J9EA 2K57A 3M0TA 2DFUA 3CCRT 3M4GA 3CCJT 4DBRA 1U1TA 3JB9I 3VUBA 1UHCA 3VKIA 4XU0A 1VQOA 3VJPA 3QWXX 1H641 2EIFA 5GAMe 4OB0B 1UGRB 3CCLT 2LQWA 1M3BA 1KHCA 1WLPB 1X27A 5GAN4 1Z9QA 4E7JA 4PFZA 5IHIA 1MV0B 4D8DA 2PZ1A 2M02A 4MZTA 4BD3A 4A4FA 2EKHA 4O5VA 4JZ4A 1FWZA 2FPDA 2R58A 4M7AD 4RTXA 2E1HA 3FC3A 4C92C 3JSCA 2RK1A 1UE9A 4PFOA 2GCXA 1U3OA 2CP3A 3TCJA 1S1NA 3A8LB 4X9DA 4IUVA 3OYFA 1KJWA 1VQ4Q 1WDXA 3CC7Q 3CCQT 2DX1A 5GAN6 4QQDA 2HCKA 1Q86R 2J6OA 1IB8A 2GQIA 4OGEA 1UDLA 1OPLA 3MKDA 1WQWA 3RDVA 2ZPFB 3MP1A 1WGSA 3ZBDA 3BDUA 4BE0A 2AZSA 1K0SA 3MHXA 2LJ0A 1X2QA 3DB4A 1O75A 2MIOA 3CC2T 3RMSA 1LNXA 2RHUA 4BY6B 5IHKA 2HMAA 5GAOm 3JCMP 2EQJA 2ED0A 3E9GA 3HRSA 3C12A 3CXCP 3QJYA 3G4SA 2DE0X 4GBQA 3X26B 5I2MA 2CP5A 3SB2A 1YI2A 2E10A 3G6EQ 5FROA 3URGA 2CZ6B 4DBQA 2MCNA 2YRVA 4F7UG 5KYXB 3CMEQ 2WACA 3KFVA 1M8MA 5I21A 2YRDA 3HHTB 3OA6A 1YCSB 6AT1B 3A98A 2LP5A 3PIPA 4PJOC 4C8QE 4WF2A 2A7YA 2JW4A 4OMOA 4A4EA 2QEXQ 3EG9A 3ZEHA 1PNJA 3H0IA 3CMAA 4J6XA 3V7CA 2VASA 2ZPEB 3J7AF 2KVQG 1VQ7T 4F14A 3X20B 1RLQC 1QVFP 5A0DA 1M90C 2O9SA 4XTWA 1B3QA 1R0CB 1YJ9T 2ZAEA 2DMOA 1VQOT 4FYWB 3OYGA 1NEBA 5LJ5e 4RTYA 2JOYA 2YUNA 3VS6A 3CPWA 2CUDA 4IUPA 3GF5A 4KT0E 1T0HA 1D1CA 2VWFA 1JJ2A 2QA4A 3OYMA 4J9DA 2LCCA 3OS2A 4MDXA 3A8HB 2OI3A 1G3SA 4J6YA 3OSVA 4BE1A 2A37A 4OB3B 4A4KA 2CYZB 3QO3A 3LYIA 4M75D 1GCQC 2RHIA 4LN2A 3FB9A 3QUIA 1YITA 2NUPA 4RG8A 4PL6A 3LGLA 2WSEE 2DA9A 1K9AA 4QT7A 1Q82R 5I11A 4HT9A 1RI0A 4JZ3A 3RR6A 2KRSA 4JRKA 2FVUA 3MEUA 5IAYA 2CREA 4M78F 2A36A 3I55A 1SKUB 2RHXA 2K9GA 4M7AE 1HD3A 1MUZA 1EX4A 3EG2A 2M0OA 2O4XA 2LQ8A 2RO0A 3TSWA 4ELZC 1Q7YR 1WIEA 2RB6A 4A54A 2DEUA 3LX7A 1BI1A 1JRIA 5I2SA 4DBHA 2RF0A 1OI1A 1YBYA 2MAMA 4BI4A 1OOTA 3HP9A 3JB9F 1M27C 3PTAA 1FYNA 4BY6C 4D8KA 1SSFA 3SD4A 2DIQA 2LZ6B 8ATCB 3MEWA 2HD0A 2BUDA 2EYZA 1W6XA 3PIOA 1SG5A 2FO0A 3JCMV 5A2QE 2MMPA 1OV3A 2VGNA 1NEGA 5CK9A 1OULA 2F2VA 3G4ST 3NPFA 1VYTA 4L6V5 2O88A 4HKEA 3GLXA 4EDUA 2L2PA 4C92G 1YI2T 1Q82U 1EFNA 2GNCA 2X4YA 5EG2A 2JTFA 2M9UA 3JCMX 3HRTA 3BFMA 2FEIA 2LVMA 5CKHA 3M58A 1QP3A 4LD9K 2EFIA 2J06A 4C92D 3RKWA 2IG0A 3JV3A 4DEXA 4WTOB 4ZGDB 1Q7YU 2EGEA 1D1AA 1Y7XA 1YJWA 3CCEA 2C06A 3VS0A 4HXJA 3QBYA 3CMAT 1I5OB 4C8QF 4HVVA 2DNUA 3M9QA 2L3RA 2X35A 4IURA 3JCMg 1VYUA 1TG0A 4QKUA 2EBPA 2CP7A 3TREA 5GAN2 1WA7A 2HBPA 1KG1A 2FZCB 3CPWS 1N27A 3CCUQ 1OU8A 1YIJA 3JCMJ 1JJ2S 4P5NA 2XICA 3RIRA 1WFWA 2RD1A 4PLLA 2HQHA 4KGXB 2QA4T 2CKKA 1AVZC 3CCRQ 3EHQA 4XTZA 2YLCA 3CCJQ 1VQNA 4JPBW 4ANJA 2M16A 3G1JA 4ME7A 2L0AA 3OYNA 2AZVA 3DLLA 4F7UA 3NTKA 2PVOB 3OB9A 5LL6S 3QYGB 4PJOG 4AFSC 3CCLQ 1ZUYA 1YITT 1WXTA 3F70A 1PKSA 2CGHA 2BZYA 2CT4A 5D6XA 1JXOA 1H3HA 4UC4A 4M75E 2DBMA 4TVRA 1X2KA 5GAMg 2YUQA 1KK7A 3OW2A 4J6WA 2RNAA 3I55T 3X28B 4DBFA 4PJOD 5FU7C 2HNIA 4PJNA 4HCZA 1D3BA 4EMKB 3QDFA 3OYDA 3SWNC 4FSSA 3WVDB 5AT1B 2XDDA 3EGUA 1BKBA 2RHZA 4M7AF 3GBQA 2RQRA 1K1ZA 4XU1A 3J81E 1HJDA 4CI0C 4J83A 3ZFJA 4RG2A 4A63B 2XG8D 3V7RA 4LDUA 4FCYA 3FLGA 1VQ8A 3CCQQ 4M7AC 1V29B 1AWOA 1N6AA 2K5LA 1SHGA 3OYEA 1ZA2B 1WHKA 3R6OA 2K5FA 4RCBA 1U5SA 4F16A 3SEMA 1FX7A 4CRIA 2QQSA 4M77B 4CC7A 4F04B 1VQLA 3GNFB 3CC2Q 3PE0A 2XDPA 4C5HA 2KYMA 2DD5A 5GANe 1B34B 4LDXA 2JNGA 1Q81C 3G71A 4RMOA 1YFNA 1MNDA 2PQWA 4ATOA 2H3JA 4QQGA 2X51A 3P8HA 3V8LA 1K8AR 1NJIR 2DF6A 1SEMA 1NYFA 4LD6A 1SSHA 1JU5C 1KD1R 4FYXB 5IHNA 2RQTA 2LNVA 2XKOC 1YJWT 2YDLA 3CCET 4HT8A 4L5GA 2DXBA 2IIMA 3PMTA 1WHMA 4V2SA 5GAOq 3QXEB 2CS7A 1KIKA 2Y4YA 3MCAB 2ED1A 2VVKA 3OS5A 4LUEA 4EMGA 1AT1B 1VQ6A 1UG1A 2DL5A 5FRMA 4E2FB 1YIJT 3EH2A 3DLMA 1UJYA 2CH4A 4C5IA 2ESWA 2EYYA 4N0AA 1VQ7Q 4OP0A 4ORZA 5HK3A 4JLGA 4FYVB 1TUCA 3EFOB 1XNIA 1NLOC 3M55A 1NPRA 1B7TA 1VQNT 3JAME 2KYBA 3ER0A 4A4GA 1TWBA 1VQOQ 2EJGA 1NJIU 2KT8A 1ZQ1A 2JT4A 2LT1A 1BI2A 3VU3C 3C95A 3O5ZA 1M2VA 5LJ3f 4JJCA 2DD4A 4YTLA 4MZMA 3OW2S 4C0DB 4BE2A 3VV0A 2GTJA 4EMKC 2XHCA 2DVEA 2B8AA 4M75F 2JMCA 4M4ZA 2QQRA 3UA6A 4PJJA 4C8QG 2Y90A 4A4HA 4C5GA 4GLKA 5GANf 1K9MR 3VS1A 2IPOB 4PNOA 4OB2B 2DKGA 1OX8A 5GAN3 2RJEA 2KE9A 5IT9E 4FM4B 5DM7R 4IKFA 2RK2A 1VQ8T 2E4HA 1QWEA 4FU6A 2KRMA 3MO8A 2DXCA 5CQYA 1PM3A 3RMQA 2K3BA 4Z02A 3TSZA 4JS5A 2V1QA 4M77C 3EGXA 4M7DA 1KQSA 2EGCA 2XU8A 3FRNA 1AOJA 2LNHB 4C0FA 5LJ3j 4A53A 3GNGA 4IUQA 3LWIA 1V76A 4RCCA 3QPHA 2LDMA 4XK8E 1JXMA 2KMTA 5DY9A 2CH4W 5GMKj 1BK2A 1WX6A 5C6SA 3G71T 4M7DB 2BE9B 3NFCA 1VQKA 1PSEA 2AHJB 2JN0A 2KNBB 2P0PA 4KH0B 3OYIA 1I81A 1RAFB 1YJ9A 3G4SQ 1Z9ZA 2YWWA 2AK5A 1H3ZA 2Y4XA 5GANj 2CT3A 1YI2Q 1RAAB 2NUTB 4ZNXA 3QZ9B 1K9MU 3AHUA 4ZGJB 2E3IA 1YWOA 5J26A 2CDTA 1M5Q1 1NE8A 4OMLA 2F5KA 1IHVA 1TS9A 4M7AG 2RJDA 2KGTA 1N5ZA 3WXMB 1VIEA 4C92F 1G5VA 1RAGB 1ZSGA 4PJLA 4JJBA 2CUBA 1VQ6T 1IGUA 3KBGA 4MMKA 5AYFA 3CMAQ 4KRTA 5A0GA 1UECA 3J80E 5M9OA 1U1SA 1WNLA 1ZSZA 2DYIA 1VOMA 2EQIA 4LUDA 4HCCA 1UFFA 1VUBA 4E7ZA 5HKCA 1PD0A 3JB9H 3TQ7P 3M0UA 1YNZA 3HFOA 2BTTA 4J9CA 2NWMA 4C0DC 2LCSA 2RQUA 2QA4Q 1BI3A 2DJZA 1D0YA 4NOYA 4BI8B 4M78A 1HK9A 1V1CA 2J05A 3HPWA 2A0FB 2DK3A 1NBEB 1R77A 2KY9A 1H92A 4HCKA 3PVLA 4X34A 1YITQ 2QAZA 1YJNA 5CAIA 2DXUA 3X24B 3RESA 5LJ3d 2KK4A 1UGQB 2JXBA 3D7SB 2F69A 4OMFB 2GF7A 3REBB 1QVPA 3AT1B 2SEMA 4BB7A 3I55Q 4C0GA 3UF4A 1M9SA 1OZ3A 4PJOF 1AEYA 4F17A 1OQKA 4LDWA 4Q5WA 3L2ZA 3R6NA 4RKUE 3OSSC 1KQSS 4DQ2A 1Q86U 3VRZA 4FYYB 3JCMh 5GANd 2MF2A 2LT4A 4FT2A 3TEEA 4PK4A 3I5SA 3CCMA 2J7IA 2DBKA 3P8DA 1MMDA 1KC8C 1RI9A 2HEQA 2DVJA 2DTOA 1K73R 2R57A 1M1KR 3OYHA 5KYWA 4E47A 1X43A 2GBQA 2FHDA 1VQKT 4LDYA 2HKQB 1VQ5A 3I5RA 1ZBJA 2YSQA 3KUFA 2F5TX 1QMCA 3EG9B 1I07A 2RI2A 4M75G 1WQ7A 2JJ9A 2LX9A 5CKFA 4C8QA 2JS0A 2VKNA 4FSXA 5GJWB 3OYBA 2DL4A 2DL3A 3U23A 3L2UA 2RQWA 3X25B 1FXXA 1PHTA 2O31A 5GMKm 3MP8A 1O9SA 3VYHB 5CIUA 1EIFA 1WJQA 5GAMh 5GANg 2V26A 1XTDA 4PLIA 1IRXA 2SRCA 5L23A 1YJWQ 3CCEQ 3EHRA 3QZ5B 3C4SA 4CC3A 1Y0MA 2FG0A 4KULA 1OPKA 4XTVA 5FWCA 2DTIA 4M77D 1VQPA 2P4RA 1VQ9T 2V1RA 1K73U 1M1KU 1GFDA 2R5MA 2MK5A 2NUPB 2BE7D 4BACA 4NS5A 3OBYA 4DEYA 1YIJQ 3NTIA 4EMHA 1C6VX 2GTOA 3FIFA 4GY5A 3SWNA 3EH1A 4DA4A 1QW1A 2L3PA 3EG3A 2JUFA 1RAEB 5CO7A 1QVGA 1VQNQ 2RM4A 3N5BB 2O4XB 1ZUUA 1T0JA 5CQXA 2AKLA 5CCAA 1W4SA 1WXBA 1VA7A 2GQVA 4B9WA 1H8KA 2E65A 1AZEA 5HCKA 2GGRA 4M7AA 4XAXB 1WHHA 2PVDB 2RN8A 1YJNT 2QI2A 3VYGA 2E6ZA 1YCYA 3S6WA 2ATCB 1G3TA 1TOVA 3M59A 2A08A 3OYAA 1XOVA 3UPUA 3OS0A 3QIIA 3I56A 8AT1B 1Y57A 1ZUKA 2QK0A 3CC4A 1W2BA 1M3AA 2OTJA 2YHTA 4O6JA 1UJ0A 2COYA 4IUUA 2XK0A 3CCMT 2LC4A 3L1AA 1RAIB 2VGMA 2DZ9A 1Q86C 2QQAA 2F2XA 1VQ8Q 3C94A 2CSQA 3H6ZA 1ABOA 1WXUA 2FRWA 3HRUA 2DJQA 3QWYA 4ZGEB 4RTTA 1QCOA 5GAOl 3LH0A 1WHJA 2JVVA 3MEVA 1AZGB 1VQ5T 1DJ7B 4JLIA 1VQLQ 1NZ9A 3FEOA 2J6FA 1M3CA 1ZLMA 2XIDA 1E7OA 1I0CA 2DLPA 2D1XA 4J5YA 2VXEA 2X4WA 5CKBA 2DEQA 4R0KA 3G71Q 1ZA1B 5ECAA 4RUGA 2K3YA 2HDAA 4J9BA 2K6DA 3A8MB 3TVTA 2EQMA 3P8BB 4ZN3A 5KE3A 3I35A 5LJ5h 3EG0A 1XJWB 1I1JA 4BI3A 2FPFA 1IREB 1I8FA 2B86A 3ME9A 3CCSA 5FLXE 1JBMA 2RA2A 3NMZC 1HXDA 4RTZA 3PGGA 3OYYA 2OX7A 1F1BB 4J9HA 1VQPT 4F7UB 1FMVA 2QQ9A 3LLRA 1IXDA 1BIBA 4QVZA 2FYKA 1VQ6Q 1FMWA 2KXDA 2KT1A 3VS5A 2F1LA 1K73C 4M77E 1ARKA 4M7DD 2HQXA 1J3TA 2DO3A 3OBWA 1D09B 2ZPBB 3QYHB 1QVGS 1WYXA 5D6YA 4XU3A 1UHFA 2QG9B 1TXQA 4M75A 4EPCA 2XI9A 2LJ3A 1D3BB 5LJ3e 5HY6A 5KH6A 2K7AA 4R55A 2JTEA 1SHFA 1PKTA 1WZOA 4AG1C 2RH2A 2YT6A 5GMKe 3A8OB 2LJ1A 3BE3A 4OMPA 2QEXT 3H0FA 3M4YA 2D0NA 3FJ5A 3OW2P 5KYYA 1UGPB 5CKEA 2D8JA 2KBTA 5GAN7 3M0PA 1OU9A 2EYXA 1W2BS 3I56T 4N4IA 1WPYA 3JCMc 3CCVA 1Q82C 4KGZB 5IH2A 1BCMA 2YUPA 1OX9A 1UTIA 2IVWA 2D9TA 3UATA 4B9XA 3CC4T 3MJXA 1K0XA 2OTJT 5EC7A 1AHJB 4XU2A 2DZCA 2EGAA 3QKJA 4OVAA 4J7IA 1Q7YC 2OAWA 3KXTA 2AT1B 3RBBB 3S3NA 2ABLA 5FW9A 3EFSA 1N8RR 2KQWA 2O9VA 2C0OA 5GAOp 1PCXA 2P4TA 2A3LA 2KXCA 3SFMA 1JQQA 5FRNA 4KBMB 2EPDA 4ZTFA 1NPPA 2LMJA 4R56A 4IUTA 4IIOA 1VQKQ 1BB9A 2CP2A 2MPXC 4C92A 3A5ZB 1YJ9Q 2DXTA 4ESRA 4FT4A 2BKDN 1VQMA 1WJSA 2ZPIB 1K8AU 1GCPA 3ULRB 1D1BA 3EGDA 1CKBA 2E64A 2QTXA 1U06A 3OQ5A 1KQ2A 3GIBA 3M0RA 3CCST 1KD1U 4JJNK 2AIRB 5KYUA 2CZ0B 3EFRA 2PVGB 4C0ZA 1N8RU 1KFZA 5IXFA 1TSFA 3REAB 1FMKA 1UB4A 4MMLA 4E6RA 2V8KA 2K2MA 2VYTA 2KDSA 1M2VB 1UEBA 3QG1A 1GFCA 1JEGA 3HL8A 2I0NA 1M90R 3CD6A 1CKAA 1MMNA 1JB0E 1UGVA 1TUDA 3RKYA 5CVIA 4M77F 1M1GA 1RLPC 4Z8AA 1X69A 2KR3A 4C5EA 1RUWA 4M7DE 1Y96A 2E41A 2QTVA 2L89A 2HSPA 1G2BA 4RTVA 4Z88A 2L3QA 3QJ6A 3OYKA 2ZPHB 2XD0A 2OAUA 2FB7A 2YXYA 2P84A 2W10A 4LE9A 1Q95G 4PJOA 2V8IA 1X01A 4MDWA 1JO8A 3H41A 3EGXB 2ZPGB 4B6MA 3CCVT 1QKXA 4AFZC 1YJNQ 2JZ2A 3MPUB 1S72A 1WI7A 4JJDA 2GFAA 1B07A 4AT1B 3UWNA 4N4GA 1Y71A 2RPNA 2LX7A 2O2OA 4KH1B 3M56A 3T9NA 5KCHA 4AMCA 5HK0A 3JRZA 3IQLA 2OTLA 1KQSP 1SF9A 2HL3A 2DILA 3CCMQ 1AWXA 1VYVA 5GAN5 2ECZA 1Y07A 1AWWA 4FW1A 2YRCA 1NYGA 1GCQA 3V7SA 2FZGB 1BBZA 1XQHA 4J9GA 1TTHB 3JCMb 4AFUC 2C0TA 2D6FA 1YHQA 5GJVB 4E7KA 1VQ9A 3LH5A 1LVKA 2COZA 2KRNA 1VQ5Q 2EAYA 1MHNA 3INZA 4N0AC 2QYZA 1KHIA 1VQMT 1A0NB 4LXCA 1D0XA 3CXCA 5I22A 4M78E 5J3BA 2DTHA 4HCBA 2NUZA 3OYCA 4XTUA 1ZSZB 2D0QB 1K8AC 3H9NA 1NJIC 3CBMA 4QW2A 4J8OA 1T3LA 4FL6A 9ATCB 5GMKi 1MMAA 1QKWA 1GRIA 1QLYA 1WHLA 1KD1C 2X9HA 2E3HA 3QSUA 4E7IA 2HQEA 2EQUA 1BI0A 3JCMf 4N4HA 1MNEA 1ZHIA 3M5AA 1YN8A 3LW5E 1N8RC 2KI7A 2WSCE 1TH7A 1G83A 2YLBA 4HVWA 4M78B 3CD6T 4OMQA 2CZ7B 1W1FA 1VQPQ 2QGGA 3LGFA 2ZZDA 2VUBA 5KYXA 4VUBA 3VRYA 1X6BA 1QVFA 2BZXA 2LQKA 3S3MA 4M7DF 1D0ZA 1KSWA 5DLOA 3E19A 1PRLC 3FDRA 3RKXA 2CP0A 2GFUA 1PD1A 2EW3A 4M7DC 1RAHB 3VS2A 2L5QA 2RQVA 1OZ2A 4WCIA 5GAMf 3CQTA 2NYSA 4ELYC 2LCLA 2E5QA 2KEAA 1TU0B 2RMOA 2XMFA 2F2WA 5LJ3g 1S72T 1OEBA 5GAOr 2LQNA 1G8XA 3JCMW 3MEAA 1ACMB 3RUXA 3HTRA 2DETA 5KYWB 1U8RA 2K5IA 3VUZA 5GAOn 1AWJA 3I56Q 4QQ6A 3E9FA 3RNJA 1K9MC 3PVQA 3QHSA 1VQ4A 1LCKA 3CC7A 3CC4Q 2OTLT 2RHYA 1IGQA 3META 4M77G 2OTJQ 5IN1A 4C8QB 5GAN8 1NM7A 1LJOA 4JDSA 2QGFB 3UA7A 3HKSA 2PU9B 1GL5A 2KSSA 3SHWA 2LTOA 3CBPA 5GAMj 2PUOB 1YHQT 1PG5B 1GXIE 2R5AA 5FWBA 2DM1A 1RACB 4RTWA 2O01E 3CXCS 3UT1A 2VC8A 3PMIA 2J6KA 3BY7A 4JRIA 1Q81R 2X3XD 3CPWP 3GOXA 1ZSZC 4X9CA 1JJ2P 2HSEB 3M57A 3L2WA 5KE2A 3G6EA 2E70A 1BYMA 4MZPA 2JM8A 4ZTJA 3ZL7C 2H3EB 1WJRA 1ZX6A 1C1AA 2ENMA 3CMEA 4HA8A 1LOJA 1SRMA 4D6WA 1TUGB 5FU7B 1MV3A 4M78C 3SWNB 3M54A 1UUEA 3FJPA 3CCSQ 2DIGA 3DB3A 4KUIA 2ROLA 4JS4A 2G6FX 2K3XA 4E7SA 1X6OA 2DRKA 2MYSA 2QEXA 5FU6B 1PWTA 3H0HA 2KROA 3VS7A 4AG2C 1QVFS 2EKOA 4M7AB 3JCMd 3OYJA 1C0MA 2YUOA 5C0MA 4EIKA 3V8JA 4J7FA 2COWA 2PTKA 1Q81U 3WVEB 4DOWA 2DL7A 1OYXA 3E1SA 1K4US 4IIMA 1IO6A 3A8GB 1QVGP 2VV5A 2EYWA 4L59A 4XQ3A 2P0KA 1ZBXA 2K4YA 1M4ZA 2DERA 4XTYA 5LJ5f 3PNWC 5CKDA 2FRYA 2D8HA 3OMGA
chains in the Genus database with same CATH topology
1Q7YC 1VQ7T 1M8VA 3X20B 3KXTA 3S3NA 3EFSA 2EJFA 3QZ9B 2ZGWA 5A0DA 1M90C 1K9MU 1BIAA 3AHUA 2CZ1B 4ZGJB 2KQWA 4XTWA 5J26A 5GAOp 1YJ9T 1M5Q1 1NE8A 2F5KA 1M1FA 2P4TA 2A3LA 4M7AG 5GAMd 2RJDA 1VQOT 3OYGA 4KUDK 5LJ5e 4F7UE 2JOYA 3SFMA 5FRNA 3CPWA 4IUPA 1VQ4T 3GF5A 4KT0E 3CC7T 2ZCFB 4KBMB 3WXMB 4C8QC 1VIEA 4C92F 1JJ2A 1G5VA 4ZTFA 2QA4A 1NPPA 4R56A 3OYMA 4IUTA 1I5LA 2LCCA 5KCOA 3OS2A 3A8HB 4MDXA 1G3SA 1VQ6T 4J6YA 3OSVA 4BE1A 3KBGA 4MMKA 1IZ6A 4OB3B 3L2QA 5AYFA 2CYZB 4A4KA 4C92A 5A0GA 3QO3A 3LYIA 3A5ZB 4M75D 2DXTA 4FT4A 2BKDN 2RHIA 1VQMA 3J80E 1WJSA 2ZPIB 1U1SA 3FB9A 5M9OA 4M7DG 1WNLA 1K8AU 3QUIA 1YITA 4HCCA 3BDLA 1VUBA 4RG8A 4PL6A 2E64A 5HKCA 2V8JA 2QTXA 3LGLA 5LJ5j 2WSEE 3OQ5A 1KQ2A 3JB9H 3GIBA 2QXFA 4HT9A 3CCST 1KD1U 1QP2A 2L8DA 4JJNK 1RI0A 4JRKA 2FVUA 2WSFE 3MEUA 2X4XA 3HFOA 2CZ0B 2QQBA 4E7LA 5IAYA 4EMKA 4M78F 4A54A 3PFSA 3I55A 3EFRA 3JB9J 1M1KC 2PVGB 4C0ZA 3NTHA 2RHXA 4M7AE 4C0DC 1N8RU 3HFNA 1BI3A 2DJZA 2M0OA 1UB4A 2O4XA 2LQ8A 2RO0A 4MMLA 4NOYA 4BI8B 3CPFA 3G6ET 4M78A 4ELZC 1KQ1A 2PUKB 2V8KA 2RB6A 1HK9A 2RI3A 2KDSA 2VYTA 3LX7A 1BI1A 1UEBA 1JRIA 3HPWA 3QG1A 5I2SA 2NLUA 3G7ZA 1OI1A 1YBYA 2MAMA 3HL8A 3OS1A 4BI4A 3CD6A 3HP9A 5GMKl 3JB9F 2DK3A 2LRQA 3CMET 1JB0E 2EYQA 2KY9A 1G3YA 1UGSB 2DPPB 3PTAA 3OY9A 4X34A 3RKYA 5CVIA 4M77F 4BY6C 1M1GA 1SSFA 3SD4A 4JRQA 5CAIA 2DXUA 2DIQA 3CBOA 3X24B 1YJNA 1N9SA 3RESA 5FU6C 2FL7A 3MEWA 5LJ3d 4C5EA 4M7DE 2HD0A 1Y96A 3PT9A 2BUDA 2E41A 2KK4A 1UGQB 4II1A 2L89A 2F69A 3BW1A 4OMFB 4M77A 3JCMV 5A2QE 3PIOA 2MMPA 4M75B 2GF7A 1QVPA 2VGNA 3QJ6A 2MI6A 2ZPHB 3OYKA 2XD0A 4BB7A 5CK9A 4C0GA 2OAUA 3G4ST 1M9SA 1OZ3A 2FB7A 4L6V5 4HKEA 4PJOF 3GLXA 4EDUA 1B34A 4LDWA 4Q5WA 3L2ZA 4C92G 4RKUE 3OSSC 1YI2T 4DQ2A 1Q82U 1KQSS 2X4YA 5EG2A 1MGQA 2MWOA 3TU4K 2JTFA 1Q86U 3SDZA 2XDBA 2M9UA 3JCMX 3JCMh 2V8IA 5GANd 3HRTA 4PJOA 2MF2A 1X01A 2LT4A 3BFMA 4FT2A 3TEEA 2X4JA 4MDWA 3CCMA 5J39A 3CCUA 3P8DA 2KAFA 2LVMA 1N9RA 3CC2A 2K2VA 5CKHA 1KC8C 2ZPGB 3CCVT 1VIFA 3M58A 1QP3A 4LD9K 2EFIA 3H8ZA 2M1HA 2JZ2A 4C92D 2DTOA 3GP8A 3RKWA 2IG0A 4LDVA 3OYLA 1S72A 2RJFA 2R57A 4ZGDB 1Q7YU 3OYHA 4E47A 1Y7XA 2E12A 1YJWA 3UDCA 2GFAA 3CCEA 3CCRA 3UWNA 3OMCA 1PSFA 4N4GA 3CCJA 2C06A 2FHDA 1Y71A 1VQKT 4LDYA 5CR2A 3EAEA 3QBYA 3CMAT 4C8QF 1VQ5A 4M78G 4NL2A 2HAXA 3M56A 4Y91A 3T9NA 3KUFA 5KCHA 2F5TX 3M9QA 3GPLA 2L3RA 2X35A 5HK0A 3CCLA 2RI2A 3JRZA 4IURA 3JCMg 4M75G 1WQ7A 5GAN2 2OTLA 1R8OB 3TREA 1RL2A 2LX9A 5CKFA 4C8QA 4OF1A 4FSXA 2HBPA 3OYBA 1KG1A 4C92E 3CPWS 1X75C 1N27A 3LWHA 1I4K1 4Y28E 3L2UA 2RI5A 2JTMA 3X25B 5LJ5d 5L8RE 5GAN5 3JCMJ 3JB9G 1FXXA 1YIJA 1Y07A 5GMKm 1JJ2S 4M78D 3MP8A 1O9SA 4OGCA 4P5NA 2XICA 5DLQE 3VYHB 5CIUA 4ZN1A 1EIFA 1WJQA 3RIRA 2RD1A 3V7SA 5GAMh 5GANg 1XTDA 4PLLA 4PLIA 1XQHA 2E6NA 3M53A 4F7UF 3JCMb 2QA4T 3L42A 2CKKA 2D6FA 3Q1JA 1YHQA 4E7KA 1VQ9A 3QZ5B 2YLCA 4XTZA 1VQNA 3C4SA 2M16A 4KULA 4ME7A 3MP6A 3JB9D 2EAYA 2EQKA 1MHNA 4F7UA 3OYNA 3DLLA 3NTKA 4XTVA 4E7HA 3INZA 2PVOB 3OB9A 4N0AC 4JUVA 1KHIA 3DKMA 1VQMT 5LL6S 3QYGB 4PJOG 4PKCC 4C92B 2DTIA 3CCQA 2VXFA 4M77D 1VQPA 1YITT 1VQ9T 3CXCA 3CEYA 4FIBA 4M78E 4BDYA 1K73U 5J3BA 3F70A 1M1KU 2DTHA 4HCBA 2CGHA 2R5MA 5D6XA 3OYCA 4XTUA 3QDRB 4UC4A 4M75E 4TVRA 2D0QB 4JRPA 1K8AC 4QVDA 4BACA 1NJIC 3CBMA 4NS5A 4QW2A 4J8OA 5GMKi 4FL6A 3OBYA 5GAMg 3NTIA 4EMHA 2RJCA 3S3OA 1KD1C 3OW2A 4J6WA 3I55T 3X28B 4NL3A 4PJOD 3FIFA 4GY5A 3SWNA 5FU7C 3QSUA 2HNIA 3HSBA 5D6WA 4HCZA 2HQEA 1D3BA 2EQUA 1BI0A 4EMKB 4E7IA 4DA4A 3JCMf 3SWNC 5LJ5g 1QW1A 4N4HA 3WVDB 3OYDA 2JUFA 2XDDA 5CO7A 1QVGA 1BKBA 1ZHIA 2RHZA 3M5AA 4M7AF 3LW5E 1N8RC 2RM4A 4XU1A 3J81E 2WSCE 3N5BB 2O4XB 4OB1B 1TH7A 2YLBA 3ASKA 2EJ9A 3O8VA 4J83A 4M78B 5CQXA 4RG2A 1W4SA 3ZFJA 5CCAA 4CI0C 3CD6T 2XG8D 2GQVA 4B9WA 3V7RA 2E65A 4LDUA 3FLGA 1VQ8A 2CZ7B 3V8KA 3JCMQ 4M7AA 4XAXB 2PVDB 3L2RA 3LGFA 2ZZDA 1YJNT 2QI2A 4M7AC 2MWPA 3VYGA 1V29B 4M75C 1N6AA 2E6ZA 1YCYA 2QDYB 2K5LA 4XTXA 2DAQA 2VUBA 3S6WA 4PJOE 2G3RA 4QVCA 1G3TA 4VUBA 3OYEA 3JCMe 3M59A 3R6OA 5LJ3h 3OYAA 2K5FA 4RCBA 2LQKA 3S3MA 1QVFA 1XOVA 3UPUA 3OS0A 1Y96B 3QIIA 4M7DF 4C8QD 1FX7A 4CRIA 4BUGA 1G3WA 3I56A 2QQSA 4M77B 5DLOA 1VQLA 3E19A 3FDRA 3GNFB 4BDZA 5GMKh 1KC8U 4DOVA 3RKXA 2GFUA 2XDPA 4C5HA 1W2BA 3CC4A 2DD5A 5GANe 1B34B 4LDXA 1P92A 2JNGA 1Q81C 4M7DC 5A0LA 2OTJA 2YHTA 2L5QA 4O6JA 3G71A 4RMOA 1OZ2A 4IUUA 2XK0A 5GAMf 5GANh 2LC4A 3L2VA 3CCMT 3L1AA 2I2LA 3CCUT 2VGMA 2DZ9A 2PQWA 2QQAA 1Q86C 4ATOA 4PJOB 2EWNA 2H3JA 4QQGA 3C94A 4ELYC 3P8HA 3V8LA 1M90U 2LCLA 2E5QA 2BIVA 2P0QA 3H6ZA 1VQ7A 5LJ3g 4LD6A 3HRUA 1S72T 2K57A 4ZGEB 5GAOr 2LNVA 2XKOC 1YJWT 3CCRT 3CCET 3M4GA 5GAOl 4L5GA 3CCJT 4HT8A 1U1TA 2DXBA 3JCMW 3LH0A 3MEAA 3RUXA 3JB9I 2JVVA 3VUBA 1U8RA 2K5IA 3MEVA 3PMTA 4XU0A 3VKIA 3VUZA 5GAOn 5GAOq 1VQ5T 1VQOA 3VJPA 4V2SA 1DJ7B 4QQ6A 1H641 2EIFA 3E9FA 3QXEB 4JLIA 5GAMe 4OB0B 1K9MC 1NZ9A 1UGRB 3FEOA 3QHSA 3CCLT 3CC7A 1VQ4A 2XIDA 2CS7A 4J5YA 2OTLT 2RHYA 2VXEA 1KHCA 5GAN4 2Y4YA 2X4WA 3MCAB 5CKBA 2DEQA 3META 4M77G 3OS5A 4EMGA 1VQ6A 5IN1A 4E7JA 4C8QB 5FRMA 5GAN8 1YIJT 2K3YA 1LJOA 3A8MB 4JDSA 2EQMA 3DLMA 3P8BB 4ZN3A 3HKSA 4C5IA 5KE3A 5LJ5h 2PU9B 4MZTA 4N0AA 4BI3A 4OP0A 4BD3A 2KSSA 2LTOA 4A4FA 5HK3A 1IREB 3CBPA 4JLGA 4O5VA 1I8FA 3ME9A 1FWZA 1XNIA 5GAMj 2PUOB 2R58A 1YHQT 3M55A 1NPRA 4M7AD 3CCSA 5FLXE 1VQNT 1GXIE 2E1HA 2R5AA 3JAME 1JBMA 3FC3A 2RA2A 3ER0A 4C92C 4A4GA 3JSCA 2RK1A 2O01E 3CXCS 3UT1A 2GCXA 1HXDA 2VC8A 2EJGA 3TCJA 1NJIU 3PMIA 3PGGA 3BY7A 3A8LB 4JRIA 1ZQ1A 3OYYA 4IUVA 4X9DA 3OYFA 3GOXA 2LT1A 3CCQT 1VQPT 5GAN6 4QQDA 1BI2A 2QQ9A 3LLRA 4X9CA 4F7UB 3VU3C 2Y4XA 3C95A 5LJ3f 1BIBA 3M57A 2DD4A 3L2WA 5KE2A 1VQLT 4QVZA 3G6EA 2FYKA 2E70A 4OGEA 4MZMA 4YTLA 1BYMA 3OW2S 1WQWA 4C0DB 4BE2A 4MZPA 3VV0A 2ZPFB 3MP1A 1K73C 4ZTJA 1WGSA 4M77E 1WJRA 3ZBDA 4EMKC 2XHCA 2DVEA 4M7DD 3BDUA 4BE0A 3CMEA 2B8AA 4M75F 2HQXA 4HA8A 1LOJA 2DO3A 3MHXA 3OBWA 2ZPBB 3QYHB 3DB4A 1QVGS 2QQRA 5D6YA 4XU3A 4C8QG 4D6WA 1O75A 5FU7B 3CC2T 3RMSA 2Y90A 4M78C 4A4HA 4C5GA 3SWNB 1LNXA 3M54A 4GLKA 4M75A 3FJPA 4EPCA 2DIGA 2XI9A 3DB3A 4KUIA 5GANf 1D3BB 4JS4A 2K3XA 2RHUA 4BY6B 5LJ3e 5HY6A 5KH6A 4PNOA 1X6OA 4OB2B 5GAOm 2QEXA 3JCMP 2DKGA 2EQJA 3HRSA 3E9GA 5FU6B 2RJEA 3C12A 5GAN3 4R55A 5IT9E 4FM4B 5DM7R 4IKFA 3QJYA 2RK2A 3G4SA 1VQ8T 4FU6A 2RH2A 3MO8A 2DXCA 5I2MA 3X26B 5GMKe 3A8OB 1QVFS 5CQYA 3SB2A 1YI2A 2EKOA 2E10A 4M7AB 3RMQA 5FROA 3URGA 3JCMd 2QEXT 3M4YA 3OYJA 4Z02A 4JS5A 2CZ6B 4M77C 5C0MA 1UGPB 5CKEA 2YRVA 4F7UG 4M7DA 1KQSA 5GAN7 3V8JA 2XU8A 3FRNA 4J7FA 1Q81U 3WVEB 4DOWA 2WACA 4C0FA 1W2BS 3I56T 4N4IA 5LJ3j 1OYXA 1WPYA 3E1SA 3JCMc 4A53A 3CCVA 5I21A 1Q82C 3GNGA 4IUQA 3A8GB 3HHTB 3OA6A 2VV5A 3LWIA 4L59A 3CC4T 2IVWA 2D9TA 4RCCA 4XQ3A 4B9XA 3QPHA 2LDMA 2P0KA 4XK8E 3PIPA 2KMTA 5DY9A 4C8QE 4PJOC 5GMKj 1ZBXA 4WF2A 5C6SA 2OTJT 2K4YA 1M4ZA 2A7YA 3G71T 4M7DB 4A4EA 3NFCA 1AHJB 4XTYA 5LJ5f 1VQKA 3RERA 3PNWC 1PSEA 2AHJB 3ZEHA 5CKDA 3CMAA 2JN0A 2P0PA 4XU2A 3OYIA 1I81A 1YJ9A 2DZCA 4J6XA 3V7CA 1H3ZA 3QKJA 4OVAA 3OMGA 2ZPEB 3J7AF 2KVQG 5GANj 4J7IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QSU A;  4OP0 A;  1B34 A;  2HNI A;  3HSB A;  1M8V A;  1D3B A;  4EMK B;  3L2Z A;  3SWN C;  3JCM f;  4C92 G;  3EFS A;  2EJF A;  4DQ2 A;  5LJ5 g;  1I8F A;  2ZGW A;  1MGQ A;  1BIA A;  5GAM j;  3AHU A;  4XTW A;  4M7A D;  4M7A F;  3JCM X;  5GAO p;  2E1H A;  3JCM h;  5GAN d;  2RM4 A;  1JBM A;  4XU1 A;  1X01 A;  1M5Q 1;  2RA2 A;  3BFM A;  4C92 C;  1TH7 A;  2YLB A;  2EJ9 A;  4M78 B;  1HXD A;  2VC8 A;  2EJG A;  4M7A G;  5GAM d;  3PGG A;  1N9R A;  3BY7 A;  4JRI A;  4X9D A;  3V7R A;  2E65 A;  4F7U E;  5LJ5 e;  3V8K A;  3JCM Q;  4M7A A;  5GAN 6;  4F7U B;  4X9C A;  3VU3 C;  4M7A C;  4C92 D;  2DTO A;  4C92 F;  4M75 C;  3RKW A;  4C8Q C;  5LJ3 f;  1YCY A;  4XTX A;  1BIB A;  4PJO E;  4QVC A;  3SWN A;  2FYK A;  1I5L A;  3JCM e;  1WQW A;  4J6Y A;  5LJ3 h;  4MMK A;  4RCB A;  4M77 E;  4C92 A;  1Y96 B;  4EMK C;  2DVE A;  3QO3 A;  3BDU A;  4C8Q D;  4M7D D;  4C8Q F;  4M75 D;  4M7D F;  4M75 F;  4HA8 A;  2DXT A;  1LOJ A;  4M78 G;  4M77 B;  4NL2 A;  4Y91 A;  1U1S A;  3FB9 A;  4M7D G;  1WNL A;  4XU3 A;  3QUI A;  4C8Q G;  3JCM g;  4M75 G;  5GMK h;  1WQ7 A;  5GAN 2;  3RKX A;  5LJ5 j;  2E64 A;  2Y90 A;  4M78 C;  2QTX A;  4C8Q A;  3SWN B;  1LNX A;  4M75 A;  1KQ2 A;  5GAN e;  3FJP A;  3GIB A;  1B34 B;  3JB9 H;  5GAN f;  4HT9 A;  1D3B B;  4M7D C;  4C92 E;  5LJ3 e;  2YHT A;  4PNO A;  4JRK A;  1I4K 1;  5GAO m;  3JCM P;  2DKG A;  5GAM f;  5LJ5 d;  5GAN h;  5GAN 3;  5GAN 5;  3HFO A;  2I2L A;  3L1A A;  3JCM J;  2DZ9 A;  3JB9 G;  4PJO B;  5GMK m;  4EMK A;  4M78 D;  2EWN A;  4M78 F;  3V8L A;  3EFR A;  3JB9 J;  3RIR A;  3V7S A;  5GAM h;  2RD1 A;  5GAN g;  4M7A E;  5GMK e;  3HFN A;  5LJ3 g;  3SB2 A;  2DJZ A;  2E10 A;  4M7A B;  4F7U F;  4MML A;  3JCM b;  3JCM d;  2K57 A;  4NOY A;  5GAO r;  4M78 A;  1KQ1 A;  2RB6 A;  1HK9 A;  2YLC A;  4M77 C;  3M4G A;  4XTZ A;  4A54 A;  5GAO l;  1JRI A;  1U1T A;  4HT8 A;  3JCM W;  4F7U G;  4M7D A;  3RUX A;  3V8J A;  5GAN 7;  3JB9 I;  5GMK l;  4PJO F;  3JB9 D;  3JB9 F;  2EAY A;  4XU0 A;  5GAO n;  4F7U A;  4V2S A;  5GAO q;  4XTV A;  3FIF A;  3INZ A;  5LJ3 j;  1WPY A;  1H64 1;  4N0A C;  3JCM c;  4JUV A;  4A53 A;  3RER A;  4JLI A;  5GAM e;  5I21 A;  4PJO G;  4C92 B;  2DTI A;  3RKY A;  2VXF A;  3QHS A;  4M77 D;  4M77 F;  4M78 E;  2DXU A;  4J5Y A;  5CAI A;  2VXE A;  1N9S A;  2DTH A;  4XQ3 A;  4RCC A;  2CGH A;  3RES A;  5GAN 4;  5LJ3 d;  2DEQ A;  4XTU A;  4M77 G;  4M7D E;  5DY9 A;  1Y96 A;  4C8Q E;  4M75 E;  4EMG A;  2E41 A;  5GMK j;  4PJO A;  4WF2 A;  4QVD A;  3BW1 A;  4M7D B;  4M77 A;  3JCM V;  4XTY A;  4C8Q B;  5LJ5 f;  4M75 B;  5GMK i;  5GAM g;  5GAN 8;  1LJO A;  2JN0 A;  4XU2 A;  4EMH A;  1I81 A;  2DZC A;  4J6X A;  3V7C A;  4PJO C;  4J6W A;  5LJ5 h;  4NL3 A;  4PJO D;  2FB7 A;  4N0A A;  5GAN j; 
#chains in the Genus database with same CATH topology
 1M8V A;  4Z89 A;  2EJF A;  2K79 A;  2ZGW A;  1BIA A;  2CZ1 B;  4Y92 A;  3C0C A;  1M1F A;  2E5K A;  5GAM d;  2JS2 A;  4KUD K;  4F7U E;  3CCV Q;  1W2B P;  2QAS A;  1VQ4 T;  3CC7 T;  2ZCF B;  4C8Q C;  1ABQ A;  4LNP A;  1I5L A;  5D7U A;  4OMN A;  5KCO A;  2VB6 A;  1IHW A;  1SPK A;  1AD5 A;  3L2Q A;  1IZ6 A;  2BZ8 A;  1E6H A;  2CP6 A;  2HZY A;  4M7D G;  4PJM A;  4AFQ C;  3BDL A;  5LJ5 j;  2H8H A;  1YP5 A;  2V8J A;  1M2O A;  2QXF A;  1QP2 A;  2L8D A;  2WSF E;  2X4X A;  2QQB A;  4E7L A;  4EMK A;  3PFS A;  1M1K C;  3JB9 J;  3NTH A;  1X6G A;  1M30 A;  3HFN A;  2PNI A;  1WHG A;  3CPF A;  3G6E T;  1KQ1 A;  2PUK B;  2RI3 A;  2NLU A;  3G7Z A;  2JM9 A;  1YWP A;  3OS1 A;  1W70 A;  5GMK l;  1LPL A;  2LRQ A;  3CME T;  2EYQ A;  2DYB A;  1VQM Q;  1G3Y A;  1UGS B;  2DPP B;  3THK A;  3OY9 A;  1SRL A;  4JRQ A;  3CBO A;  1N9S A;  5FU6 C;  2FL7 A;  3PT9 A;  2W0Z A;  4II1 A;  3BW1 A;  4M77 A;  4OMM A;  4M75 B;  1PC0 A;  2MI6 A;  4J9I A;  3I9Q A;  1NG2 A;  1B34 A;  4PFP A;  3M0Q A;  1MGQ A;  2MWO A;  3TU4 K;  3SDZ A;  1QCF A;  2XDB A;  3CD6 Q;  2X4J A;  5J39 A;  3CCU A;  2KAF A;  1CSK A;  1N9R A;  5KYY B;  1BCO A;  2K2V A;  1QCN A;  1VIF A;  4X1V A;  3H8Z A;  2M1H A;  1K76 A;  3GP8 A;  4LDV A;  3OYL A;  2RJF A;  2E12 A;  3UDC A;  3CCR A;  2HL5 C;  3OMC A;  1PSF A;  3CCJ A;  5CR2 A;  3EAE A;  2X3W D;  2FPE A;  4M78 G;  4NL2 A;  2HAX A;  4Y91 A;  3GPL A;  3CCL A;  1R8O B;  7AT1 B;  1RL2 A;  4OF1 A;  4HVU A;  2CSI A;  4C92 E;  1X75 C;  5KYN A;  1I4K 1;  4Y28 E;  3LWH A;  2RI5 A;  2JTM A;  5IXB A;  5LJ5 d;  5L8R E;  3JB9 G;  4CC4 B;  4M78 D;  4KGV B;  4OGC A;  5DLQ E;  4ZN1 A;  3EFO A;  2E6N A;  2M0Y A;  3M53 A;  1S72 Q;  2OJ2 A;  1MMG A;  4F7U F;  3L42 A;  3EG1 A;  1R0B G;  3Q1J A;  3E2U A;  3MP6 A;  3JB9 D;  2EQK A;  1QQJ A;  4E7H A;  3RER A;  4JUV A;  3DKM A;  3A1P A;  4PKC C;  4C92 B;  3CCQ A;  2VXF A;  2JMA A;  1HYO A;  3CEY A;  4FIB A;  2OTL Q;  4BDY A;  4GLM A;  1KC8 R;  3NGP A;  1T3S A;  2DRM A;  3QDR B;  3VS3 A;  4JRP A;  2HKN A;  3EGD B;  4RTU A;  4QVD A;  1QWF A;  2DL8 A;  1GBQ A;  1GBR A;  2RJC A;  3S3O A;  1EZZ B;  4NL3 A;  2HBW A;  5KYU B;  3HSB A;  5D6W A;  3CC2 A;  5LJ5 g;  2ROT A;  1YHQ Q;  1VQ9 Q;  2Z0W A;  4OB1 B;  3ASK A;  3O8V A;  2EJ9 A;  4K11 A;  3M0S A;  1BU1 A;  3V8K A;  3JCM Q;  3L2R A;  2AKK A;  2MWP A;  4M75 C;  2QDY B;  4XTX A;  2A28 A;  2DAQ A;  4PJO E;  2G3R A;  4QVC A;  4J9F A;  2L3S A;  3JCM e;  2QDL A;  5LJ3 h;  3VS4 A;  1HSQ A;  2FZK B;  1Y96 B;  4C8Q D;  4BUG A;  1E6G A;  1G3W A;  1NLP C;  2C0I A;  4BDZ A;  5GMK h;  1KC8 U;  4FW2 A;  4DOV A;  3NHN A;  1P92 A;  5A0L A;  2M51 A;  4CC2 A;  3L2V A;  5GAN h;  1VQL T;  3CCU T;  2I2L A;  4PJO B;  2EVR A;  2EWN A;  1M90 U;  2NUT A;  2MOX A;  2BIV A;  2P0Q A;  1RAD B;  1VQ7 A;  1RAB B;  1PRM C;  4J9E A;  2K57 A;  3M0T A;  2DFU A;  3CCR T;  3M4G A;  3CCJ T;  4DBR A;  1U1T A;  3JB9 I;  3VUB A;  1UHC A;  3VKI A;  4XU0 A;  1VQO A;  3VJP A;  3QWX X;  1H64 1;  2EIF A;  5GAM e;  4OB0 B;  1UGR B;  3CCL T;  2LQW A;  1M3B A;  1KHC A;  1WLP B;  1X27 A;  5GAN 4;  1Z9Q A;  4E7J A;  4PFZ A;  5IHI A;  1MV0 B;  4D8D A;  2PZ1 A;  2M02 A;  4MZT A;  4BD3 A;  4A4F A;  2EKH A;  4O5V A;  4JZ4 A;  1FWZ A;  2FPD A;  2R58 A;  4M7A D;  4RTX A;  2E1H A;  3FC3 A;  4C92 C;  3JSC A;  2RK1 A;  1UE9 A;  4PFO A;  2GCX A;  1U3O A;  2CP3 A;  3TCJ A;  1S1N A;  3A8L B;  4X9D A;  4IUV A;  3OYF A;  1KJW A;  1VQ4 Q;  1WDX A;  3CC7 Q;  3CCQ T;  2DX1 A;  5GAN 6;  4QQD A;  2HCK A;  1Q86 R;  2J6O A;  1IB8 A;  2GQI A;  4OGE A;  1UDL A;  1OPL A;  3MKD A;  1WQW A;  3RDV A;  2ZPF B;  3MP1 A;  1WGS A;  3ZBD A;  3BDU A;  4BE0 A;  2AZS A;  1K0S A;  3MHX A;  2LJ0 A;  1X2Q A;  3DB4 A;  1O75 A;  2MIO A;  3CC2 T;  3RMS A;  1LNX A;  2RHU A;  4BY6 B;  5IHK A;  2HMA A;  5GAO m;  3JCM P;  2EQJ A;  2ED0 A;  3E9G A;  3HRS A;  3C12 A;  3CXC P;  3QJY A;  3G4S A;  2DE0 X;  4GBQ A;  3X26 B;  5I2M A;  2CP5 A;  3SB2 A;  1YI2 A;  2E10 A;  3G6E Q;  5FRO A;  3URG A;  2CZ6 B;  4DBQ A;  2MCN A;  2YRV A;  4F7U G;  5KYX B;  3CME Q;  2WAC A;  3KFV A;  1M8M A;  5I21 A;  2YRD A;  3HHT B;  3OA6 A;  1YCS B;  6AT1 B;  3A98 A;  2LP5 A;  3PIP A;  4PJO C;  4C8Q E;  4WF2 A;  2A7Y A;  2JW4 A;  4OMO A;  4A4E A;  2QEX Q;  3EG9 A;  3ZEH A;  1PNJ A;  3H0I A;  3CMA A;  4J6X A;  3V7C A;  2VAS A;  2ZPE B;  3J7A F;  2KVQ G;  1VQ7 T;  4F14 A;  3X20 B;  1RLQ C;  1QVF P;  5A0D A;  1M90 C;  2O9S A;  4XTW A;  1B3Q A;  1R0C B;  1YJ9 T;  2ZAE A;  2DMO A;  1VQO T;  4FYW B;  3OYG A;  1NEB A;  5LJ5 e;  4RTY A;  2JOY A;  2YUN A;  3VS6 A;  3CPW A;  2CUD A;  4IUP A;  3GF5 A;  4KT0 E;  1T0H A;  1D1C A;  2VWF A;  1JJ2 A;  2QA4 A;  3OYM A;  4J9D A;  2LCC A;  3OS2 A;  4MDX A;  3A8H B;  2OI3 A;  1G3S A;  4J6Y A;  3OSV A;  4BE1 A;  2A37 A;  4OB3 B;  4A4K A;  2CYZ B;  3QO3 A;  3LYI A;  4M75 D;  1GCQ C;  2RHI A;  4LN2 A;  3FB9 A;  3QUI A;  1YIT A;  2NUP A;  4RG8 A;  4PL6 A;  3LGL A;  2WSE E;  2DA9 A;  1K9A A;  4QT7 A;  1Q82 R;  5I11 A;  4HT9 A;  1RI0 A;  4JZ3 A;  3RR6 A;  2KRS A;  4JRK A;  2FVU A;  3MEU A;  5IAY A;  2CRE A;  4M78 F;  2A36 A;  3I55 A;  1SKU B;  2RHX A;  2K9G A;  4M7A E;  1HD3 A;  1MUZ A;  1EX4 A;  3EG2 A;  2M0O A;  2O4X A;  2LQ8 A;  2RO0 A;  3TSW A;  4ELZ C;  1Q7Y R;  1WIE A;  2RB6 A;  4A54 A;  2DEU A;  3LX7 A;  1BI1 A;  1JRI A;  5I2S A;  4DBH A;  2RF0 A;  1OI1 A;  1YBY A;  2MAM A;  4BI4 A;  1OOT A;  3HP9 A;  3JB9 F;  1M27 C;  3PTA A;  1FYN A;  4BY6 C;  4D8K A;  1SSF A;  3SD4 A;  2DIQ A;  2LZ6 B;  8ATC B;  3MEW A;  2HD0 A;  2BUD A;  2EYZ A;  1W6X A;  3PIO A;  1SG5 A;  2FO0 A;  3JCM V;  5A2Q E;  2MMP A;  1OV3 A;  2VGN A;  1NEG A;  5CK9 A;  1OUL A;  2F2V A;  3G4S T;  3NPF A;  1VYT A;  4L6V 5;  2O88 A;  4HKE A;  3GLX A;  4EDU A;  2L2P A;  4C92 G;  1YI2 T;  1Q82 U;  1EFN A;  2GNC A;  2X4Y A;  5EG2 A;  2JTF A;  2M9U A;  3JCM X;  3HRT A;  3BFM A;  2FEI A;  2LVM A;  5CKH A;  3M58 A;  1QP3 A;  4LD9 K;  2EFI A;  2J06 A;  4C92 D;  3RKW A;  2IG0 A;  3JV3 A;  4DEX A;  4WTO B;  4ZGD B;  1Q7Y U;  2EGE A;  1D1A A;  1Y7X A;  1YJW A;  3CCE A;  2C06 A;  3VS0 A;  4HXJ A;  3QBY A;  3CMA T;  1I5O B;  4C8Q F;  4HVV A;  2DNU A;  3M9Q A;  2L3R A;  2X35 A;  4IUR A;  3JCM g;  1VYU A;  1TG0 A;  4QKU A;  2EBP A;  2CP7 A;  3TRE A;  5GAN 2;  1WA7 A;  2HBP A;  1KG1 A;  2FZC B;  3CPW S;  1N27 A;  3CCU Q;  1OU8 A;  1YIJ A;  3JCM J;  1JJ2 S;  4P5N A;  2XIC A;  3RIR A;  1WFW A;  2RD1 A;  4PLL A;  2HQH A;  4KGX B;  2QA4 T;  2CKK A;  1AVZ C;  3CCR Q;  3EHQ A;  4XTZ A;  2YLC A;  3CCJ Q;  1VQN A;  4JPB W;  4ANJ A;  2M16 A;  3G1J A;  4ME7 A;  2L0A A;  3OYN A;  2AZV A;  3DLL A;  4F7U A;  3NTK A;  2PVO B;  3OB9 A;  5LL6 S;  3QYG B;  4PJO G;  4AFS C;  3CCL Q;  1ZUY A;  1YIT T;  1WXT A;  3F70 A;  1PKS A;  2CGH A;  2BZY A;  2CT4 A;  5D6X A;  1JXO A;  1H3H A;  4UC4 A;  4M75 E;  2DBM A;  4TVR A;  1X2K A;  5GAM g;  2YUQ A;  1KK7 A;  3OW2 A;  4J6W A;  2RNA A;  3I55 T;  3X28 B;  4DBF A;  4PJO D;  5FU7 C;  2HNI A;  4PJN A;  4HCZ A;  1D3B A;  4EMK B;  3QDF A;  3OYD A;  3SWN C;  4FSS A;  3WVD B;  5AT1 B;  2XDD A;  3EGU A;  1BKB A;  2RHZ A;  4M7A F;  3GBQ A;  2RQR A;  1K1Z A;  4XU1 A;  3J81 E;  1HJD A;  4CI0 C;  4J83 A;  3ZFJ A;  4RG2 A;  4A63 B;  2XG8 D;  3V7R A;  4LDU A;  4FCY A;  3FLG A;  1VQ8 A;  3CCQ Q;  4M7A C;  1V29 B;  1AWO A;  1N6A A;  2K5L A;  1SHG A;  3OYE A;  1ZA2 B;  1WHK A;  3R6O A;  2K5F A;  4RCB A;  1U5S A;  4F16 A;  3SEM A;  1FX7 A;  4CRI A;  2QQS A;  4M77 B;  4CC7 A;  4F04 B;  1VQL A;  3GNF B;  3CC2 Q;  3PE0 A;  2XDP A;  4C5H A;  2KYM A;  2DD5 A;  5GAN e;  1B34 B;  4LDX A;  2JNG A;  1Q81 C;  3G71 A;  4RMO A;  1YFN A;  1MND A;  2PQW A;  4ATO A;  2H3J A;  4QQG A;  2X51 A;  3P8H A;  3V8L A;  1K8A R;  1NJI R;  2DF6 A;  1SEM A;  1NYF A;  4LD6 A;  1SSH A;  1JU5 C;  1KD1 R;  4FYX B;  5IHN A;  2RQT A;  2LNV A;  2XKO C;  1YJW T;  2YDL A;  3CCE T;  4HT8 A;  4L5G A;  2DXB A;  2IIM A;  3PMT A;  1WHM A;  4V2S A;  5GAO q;  3QXE B;  2CS7 A;  1KIK A;  2Y4Y A;  3MCA B;  2ED1 A;  2VVK A;  3OS5 A;  4LUE A;  4EMG A;  1AT1 B;  1VQ6 A;  1UG1 A;  2DL5 A;  5FRM A;  4E2F B;  1YIJ T;  3EH2 A;  3DLM A;  1UJY A;  2CH4 A;  4C5I A;  2ESW A;  2EYY A;  4N0A A;  1VQ7 Q;  4OP0 A;  4ORZ A;  5HK3 A;  4JLG A;  4FYV B;  1TUC A;  3EFO B;  1XNI A;  1NLO C;  3M55 A;  1NPR A;  1B7T A;  1VQN T;  3JAM E;  2KYB A;  3ER0 A;  4A4G A;  1TWB A;  1VQO Q;  2EJG A;  1NJI U;  2KT8 A;  1ZQ1 A;  2JT4 A;  2LT1 A;  1BI2 A;  3VU3 C;  3C95 A;  3O5Z A;  1M2V A;  5LJ3 f;  4JJC A;  2DD4 A;  4YTL A;  4MZM A;  3OW2 S;  4C0D B;  4BE2 A;  3VV0 A;  2GTJ A;  4EMK C;  2XHC A;  2DVE A;  2B8A A;  4M75 F;  2JMC A;  4M4Z A;  2QQR A;  3UA6 A;  4PJJ A;  4C8Q G;  2Y90 A;  4A4H A;  4C5G A;  4GLK A;  5GAN f;  1K9M R;  3VS1 A;  2IPO B;  4PNO A;  4OB2 B;  2DKG A;  1OX8 A;  5GAN 3;  2RJE A;  2KE9 A;  5IT9 E;  4FM4 B;  5DM7 R;  4IKF A;  2RK2 A;  1VQ8 T;  2E4H A;  1QWE A;  4FU6 A;  2KRM A;  3MO8 A;  2DXC A;  5CQY A;  1PM3 A;  3RMQ A;  2K3B A;  4Z02 A;  3TSZ A;  4JS5 A;  2V1Q A;  4M77 C;  3EGX A;  4M7D A;  1KQS A;  2EGC A;  2XU8 A;  3FRN A;  1AOJ A;  2LNH B;  4C0F A;  5LJ3 j;  4A53 A;  3GNG A;  4IUQ A;  3LWI A;  1V76 A;  4RCC A;  3QPH A;  2LDM A;  4XK8 E;  1JXM A;  2KMT A;  5DY9 A;  2CH4 W;  5GMK j;  1BK2 A;  1WX6 A;  5C6S A;  3G71 T;  4M7D B;  2BE9 B;  3NFC A;  1VQK A;  1PSE A;  2AHJ B;  2JN0 A;  2KNB B;  2P0P A;  4KH0 B;  3OYI A;  1I81 A;  1RAF B;  1YJ9 A;  3G4S Q;  1Z9Z A;  2YWW A;  2AK5 A;  1H3Z A;  2Y4X A;  5GAN j;  2CT3 A;  1YI2 Q;  1RAA B;  2NUT B;  4ZNX A;  3QZ9 B;  1K9M U;  3AHU A;  4ZGJ B;  2E3I A;  1YWO A;  5J26 A;  2CDT A;  1M5Q 1;  1NE8 A;  4OML A;  2F5K A;  1IHV A;  1TS9 A;  4M7A G;  2RJD A;  2KGT A;  1N5Z A;  3WXM B;  1VIE A;  4C92 F;  1G5V A;  1RAG B;  1ZSG A;  4PJL A;  4JJB A;  2CUB A;  1VQ6 T;  1IGU A;  3KBG A;  4MMK A;  5AYF A;  3CMA Q;  4KRT A;  5A0G A;  1UEC A;  3J80 E;  5M9O A;  1U1S A;  1WNL A;  1ZSZ A;  2DYI A;  1VOM A;  2EQI A;  4LUD A;  4HCC A;  1UFF A;  1VUB A;  4E7Z A;  5HKC A;  1PD0 A;  3JB9 H;  3TQ7 P;  3M0U A;  1YNZ A;  3HFO A;  2BTT A;  4J9C A;  2NWM A;  4C0D C;  2LCS A;  2RQU A;  2QA4 Q;  1BI3 A;  2DJZ A;  1D0Y A;  4NOY A;  4BI8 B;  4M78 A;  1HK9 A;  1V1C A;  2J05 A;  3HPW A;  2A0F B;  2DK3 A;  1NBE B;  1R77 A;  2KY9 A;  1H92 A;  4HCK A;  3PVL A;  4X34 A;  1YIT Q;  2QAZ A;  1YJN A;  5CAI A;  2DXU A;  3X24 B;  3RES A;  5LJ3 d;  2KK4 A;  1UGQ B;  2JXB A;  3D7S B;  2F69 A;  4OMF B;  2GF7 A;  3REB B;  1QVP A;  3AT1 B;  2SEM A;  4BB7 A;  3I55 Q;  4C0G A;  3UF4 A;  1M9S A;  1OZ3 A;  4PJO F;  1AEY A;  4F17 A;  1OQK A;  4LDW A;  4Q5W A;  3L2Z A;  3R6N A;  4RKU E;  3OSS C;  1KQS S;  4DQ2 A;  1Q86 U;  3VRZ A;  4FYY B;  3JCM h;  5GAN d;  2MF2 A;  2LT4 A;  4FT2 A;  3TEE A;  4PK4 A;  3I5S A;  3CCM A;  2J7I A;  2DBK A;  3P8D A;  1MMD A;  1KC8 C;  1RI9 A;  2HEQ A;  2DVJ A;  2DTO A;  1K73 R;  2R57 A;  1M1K R;  3OYH A;  5KYW A;  4E47 A;  1X43 A;  2GBQ A;  2FHD A;  1VQK T;  4LDY A;  2HKQ B;  1VQ5 A;  3I5R A;  1ZBJ A;  2YSQ A;  3KUF A;  2F5T X;  1QMC A;  3EG9 B;  1I07 A;  2RI2 A;  4M75 G;  1WQ7 A;  2JJ9 A;  2LX9 A;  5CKF A;  4C8Q A;  2JS0 A;  2VKN A;  4FSX A;  5GJW B;  3OYB A;  2DL4 A;  2DL3 A;  3U23 A;  3L2U A;  2RQW A;  3X25 B;  1FXX A;  1PHT A;  2O31 A;  5GMK m;  3MP8 A;  1O9S A;  3VYH B;  5CIU A;  1EIF A;  1WJQ A;  5GAM h;  5GAN g;  2V26 A;  1XTD A;  4PLI A;  1IRX A;  2SRC A;  5L23 A;  1YJW Q;  3CCE Q;  3EHR A;  3QZ5 B;  3C4S A;  4CC3 A;  1Y0M A;  2FG0 A;  4KUL A;  1OPK A;  4XTV A;  5FWC A;  2DTI A;  4M77 D;  1VQP A;  2P4R A;  1VQ9 T;  2V1R A;  1K73 U;  1M1K U;  1GFD A;  2R5M A;  2MK5 A;  2NUP B;  2BE7 D;  4BAC A;  4NS5 A;  3OBY A;  4DEY A;  1YIJ Q;  3NTI A;  4EMH A;  1C6V X;  2GTO A;  3FIF A;  4GY5 A;  3SWN A;  3EH1 A;  4DA4 A;  1QW1 A;  2L3P A;  3EG3 A;  2JUF A;  1RAE B;  5CO7 A;  1QVG A;  1VQN Q;  2RM4 A;  3N5B B;  2O4X B;  1ZUU A;  1T0J A;  5CQX A;  2AKL A;  5CCA A;  1W4S A;  1WXB A;  1VA7 A;  2GQV A;  4B9W A;  1H8K A;  2E65 A;  1AZE A;  5HCK A;  2GGR A;  4M7A A;  4XAX B;  1WHH A;  2PVD B;  2RN8 A;  1YJN T;  2QI2 A;  3VYG A;  2E6Z A;  1YCY A;  3S6W A;  2ATC B;  1G3T A;  1TOV A;  3M59 A;  2A08 A;  3OYA A;  1XOV A;  3UPU A;  3OS0 A;  3QII A;  3I56 A;  8AT1 B;  1Y57 A;  1ZUK A;  2QK0 A;  3CC4 A;  1W2B A;  1M3A A;  2OTJ A;  2YHT A;  4O6J A;  1UJ0 A;  2COY A;  4IUU A;  2XK0 A;  3CCM T;  2LC4 A;  3L1A A;  1RAI B;  2VGM A;  2DZ9 A;  1Q86 C;  2QQA A;  2F2X A;  1VQ8 Q;  3C94 A;  2CSQ A;  3H6Z A;  1ABO A;  1WXU A;  2FRW A;  3HRU A;  2DJQ A;  3QWY A;  4ZGE B;  4RTT A;  1QCO A;  5GAO l;  3LH0 A;  1WHJ A;  2JVV A;  3MEV A;  1AZG B;  1VQ5 T;  1DJ7 B;  4JLI A;  1VQL Q;  1NZ9 A;  3FEO A;  2J6F A;  1M3C A;  1ZLM A;  2XID A;  1E7O A;  1I0C A;  2DLP A;  2D1X A;  4J5Y A;  2VXE A;  2X4W A;  5CKB A;  2DEQ A;  4R0K A;  3G71 Q;  1ZA1 B;  5ECA A;  4RUG A;  2K3Y A;  2HDA A;  4J9B A;  2K6D A;  3A8M B;  3TVT A;  2EQM A;  3P8B B;  4ZN3 A;  5KE3 A;  3I35 A;  5LJ5 h;  3EG0 A;  1XJW B;  1I1J A;  4BI3 A;  2FPF A;  1IRE B;  1I8F A;  2B86 A;  3ME9 A;  3CCS A;  5FLX E;  1JBM A;  2RA2 A;  3NMZ C;  1HXD A;  4RTZ A;  3PGG A;  3OYY A;  2OX7 A;  1F1B B;  4J9H A;  1VQP T;  4F7U B;  1FMV A;  2QQ9 A;  3LLR A;  1IXD A;  1BIB A;  4QVZ A;  2FYK A;  1VQ6 Q;  1FMW A;  2KXD A;  2KT1 A;  3VS5 A;  2F1L A;  1K73 C;  4M77 E;  1ARK A;  4M7D D;  2HQX A;  1J3T A;  2DO3 A;  3OBW A;  1D09 B;  2ZPB B;  3QYH B;  1QVG S;  1WYX A;  5D6Y A;  4XU3 A;  1UHF A;  2QG9 B;  1TXQ A;  4M75 A;  4EPC A;  2XI9 A;  2LJ3 A;  1D3B B;  5LJ3 e;  5HY6 A;  5KH6 A;  2K7A A;  4R55 A;  2JTE A;  1SHF A;  1PKT A;  1WZO A;  4AG1 C;  2RH2 A;  2YT6 A;  5GMK e;  3A8O B;  2LJ1 A;  3BE3 A;  4OMP A;  2QEX T;  3H0F A;  3M4Y A;  2D0N A;  3FJ5 A;  3OW2 P;  5KYY A;  1UGP B;  5CKE A;  2D8J A;  2KBT A;  5GAN 7;  3M0P A;  1OU9 A;  2EYX A;  1W2B S;  3I56 T;  4N4I A;  1WPY A;  3JCM c;  3CCV A;  1Q82 C;  4KGZ B;  5IH2 A;  1BCM A;  2YUP A;  1OX9 A;  1UTI A;  2IVW A;  2D9T A;  3UAT A;  4B9X A;  3CC4 T;  3MJX A;  1K0X A;  2OTJ T;  5EC7 A;  1AHJ B;  4XU2 A;  2DZC A;  2EGA A;  3QKJ A;  4OVA A;  4J7I A;  1Q7Y C;  2OAW A;  3KXT A;  2AT1 B;  3RBB B;  3S3N A;  2ABL A;  5FW9 A;  3EFS A;  1N8R R;  2KQW A;  2O9V A;  2C0O A;  5GAO p;  1PCX A;  2P4T A;  2A3L A;  2KXC A;  3SFM A;  1JQQ A;  5FRN A;  4KBM B;  2EPD A;  4ZTF A;  1NPP A;  2LMJ A;  4R56 A;  4IUT A;  4IIO A;  1VQK Q;  1BB9 A;  2CP2 A;  2MPX C;  4C92 A;  3A5Z B;  1YJ9 Q;  2DXT A;  4ESR A;  4FT4 A;  2BKD N;  1VQM A;  1WJS A;  2ZPI B;  1K8A U;  1GCP A;  3ULR B;  1D1B A;  3EGD A;  1CKB A;  2E64 A;  2QTX A;  1U06 A;  3OQ5 A;  1KQ2 A;  3GIB A;  3M0R A;  3CCS T;  1KD1 U;  4JJN K;  2AIR B;  5KYU A;  2CZ0 B;  3EFR A;  2PVG B;  4C0Z A;  1N8R U;  1KFZ A;  5IXF A;  1TSF A;  3REA B;  1FMK A;  1UB4 A;  4MML A;  4E6R A;  2V8K A;  2K2M A;  2VYT A;  2KDS A;  1M2V B;  1UEB A;  3QG1 A;  1GFC A;  1JEG A;  3HL8 A;  2I0N A;  1M90 R;  3CD6 A;  1CKA A;  1MMN A;  1JB0 E;  1UGV A;  1TUD A;  3RKY A;  5CVI A;  4M77 F;  1M1G A;  1RLP C;  4Z8A A;  1X69 A;  2KR3 A;  4C5E A;  1RUW A;  4M7D E;  1Y96 A;  2E41 A;  2QTV A;  2L89 A;  2HSP A;  1G2B A;  4RTV A;  4Z88 A;  2L3Q A;  3QJ6 A;  3OYK A;  2ZPH B;  2XD0 A;  2OAU A;  2FB7 A;  2YXY A;  2P84 A;  2W10 A;  4LE9 A;  1Q95 G;  4PJO A;  2V8I A;  1X01 A;  4MDW A;  1JO8 A;  3H41 A;  3EGX B;  2ZPG B;  4B6M A;  3CCV T;  1QKX A;  4AFZ C;  1YJN Q;  2JZ2 A;  3MPU B;  1S72 A;  1WI7 A;  4JJD A;  2GFA A;  1B07 A;  4AT1 B;  3UWN A;  4N4G A;  1Y71 A;  2RPN A;  2LX7 A;  2O2O A;  4KH1 B;  3M56 A;  3T9N A;  5KCH A;  4AMC A;  5HK0 A;  3JRZ A;  3IQL A;  2OTL A;  1KQS P;  1SF9 A;  2HL3 A;  2DIL A;  3CCM Q;  1AWX A;  1VYV A;  5GAN 5;  2ECZ A;  1Y07 A;  1AWW A;  4FW1 A;  2YRC A;  1NYG A;  1GCQ A;  3V7S A;  2FZG B;  1BBZ A;  1XQH A;  4J9G A;  1TTH B;  3JCM b;  4AFU C;  2C0T A;  2D6F A;  1YHQ A;  5GJV B;  4E7K A;  1VQ9 A;  3LH5 A;  1LVK A;  2COZ A;  2KRN A;  1VQ5 Q;  2EAY A;  1MHN A;  3INZ A;  4N0A C;  2QYZ A;  1KHI A;  1VQM T;  1A0N B;  4LXC A;  1D0X A;  3CXC A;  5I22 A;  4M78 E;  5J3B A;  2DTH A;  4HCB A;  2NUZ A;  3OYC A;  4XTU A;  1ZSZ B;  2D0Q B;  1K8A C;  3H9N A;  1NJI C;  3CBM A;  4QW2 A;  4J8O A;  1T3L A;  4FL6 A;  9ATC B;  5GMK i;  1MMA A;  1QKW A;  1GRI A;  1QLY A;  1WHL A;  1KD1 C;  2X9H A;  2E3H A;  3QSU A;  4E7I A;  2HQE A;  2EQU A;  1BI0 A;  3JCM f;  4N4H A;  1MNE A;  1ZHI A;  3M5A A;  1YN8 A;  3LW5 E;  1N8R C;  2KI7 A;  2WSC E;  1TH7 A;  1G83 A;  2YLB A;  4HVW A;  4M78 B;  3CD6 T;  4OMQ A;  2CZ7 B;  1W1F A;  1VQP Q;  2QGG A;  3LGF A;  2ZZD A;  2VUB A;  5KYX A;  4VUB A;  3VRY A;  1X6B A;  1QVF A;  2BZX A;  2LQK A;  3S3M A;  4M7D F;  1D0Z A;  1KSW A;  5DLO A;  3E19 A;  1PRL C;  3FDR A;  3RKX A;  2CP0 A;  2GFU A;  1PD1 A;  2EW3 A;  4M7D C;  1RAH B;  3VS2 A;  2L5Q A;  2RQV A;  1OZ2 A;  4WCI A;  5GAM f;  3CQT A;  2NYS A;  4ELY C;  2LCL A;  2E5Q A;  2KEA A;  1TU0 B;  2RMO A;  2XMF A;  2F2W A;  5LJ3 g;  1S72 T;  1OEB A;  5GAO r;  2LQN A;  1G8X A;  3JCM W;  3MEA A;  1ACM B;  3RUX A;  3HTR A;  2DET A;  5KYW B;  1U8R A;  2K5I A;  3VUZ A;  5GAO n;  1AWJ A;  3I56 Q;  4QQ6 A;  3E9F A;  3RNJ A;  1K9M C;  3PVQ A;  3QHS A;  1VQ4 A;  1LCK A;  3CC7 A;  3CC4 Q;  2OTL T;  2RHY A;  1IGQ A;  3MET A;  4M77 G;  2OTJ Q;  5IN1 A;  4C8Q B;  5GAN 8;  1NM7 A;  1LJO A;  4JDS A;  2QGF B;  3UA7 A;  3HKS A;  2PU9 B;  1GL5 A;  2KSS A;  3SHW A;  2LTO A;  3CBP A;  5GAM j;  2PUO B;  1YHQ T;  1PG5 B;  1GXI E;  2R5A A;  5FWB A;  2DM1 A;  1RAC B;  4RTW A;  2O01 E;  3CXC S;  3UT1 A;  2VC8 A;  3PMI A;  2J6K A;  3BY7 A;  4JRI A;  1Q81 R;  2X3X D;  3CPW P;  3GOX A;  1ZSZ C;  4X9C A;  1JJ2 P;  2HSE B;  3M57 A;  3L2W A;  5KE2 A;  3G6E A;  2E70 A;  1BYM A;  4MZP A;  2JM8 A;  4ZTJ A;  3ZL7 C;  2H3E B;  1WJR A;  1ZX6 A;  1C1A A;  2ENM A;  3CME A;  4HA8 A;  1LOJ A;  1SRM A;  4D6W A;  1TUG B;  5FU7 B;  1MV3 A;  4M78 C;  3SWN B;  3M54 A;  1UUE A;  3FJP A;  3CCS Q;  2DIG A;  3DB3 A;  4KUI A;  2ROL A;  4JS4 A;  2G6F X;  2K3X A;  4E7S A;  1X6O A;  2DRK A;  2MYS A;  2QEX A;  5FU6 B;  1PWT A;  3H0H A;  2KRO A;  3VS7 A;  4AG2 C;  1QVF S;  2EKO A;  4M7A B;  3JCM d;  3OYJ A;  1C0M A;  2YUO A;  5C0M A;  4EIK A;  3V8J A;  4J7F A;  2COW A;  2PTK A;  1Q81 U;  3WVE B;  4DOW A;  2DL7 A;  1OYX A;  3E1S A;  1K4U S;  4IIM A;  1IO6 A;  3A8G B;  1QVG P;  2VV5 A;  2EYW A;  4L59 A;  4XQ3 A;  2P0K A;  1ZBX A;  2K4Y A;  1M4Z A;  2DER A;  4XTY A;  5LJ5 f;  3PNW C;  5CKD A;  2FRY A;  2D8H A;  3OMG A; 
#chains in the Genus database with same CATH homology
 1Q7Y C;  1VQ7 T;  1M8V A;  3X20 B;  3KXT A;  3S3N A;  3EFS A;  2EJF A;  3QZ9 B;  2ZGW A;  5A0D A;  1M90 C;  1K9M U;  1BIA A;  3AHU A;  2CZ1 B;  4ZGJ B;  2KQW A;  4XTW A;  5J26 A;  5GAO p;  1YJ9 T;  1M5Q 1;  1NE8 A;  2F5K A;  1M1F A;  2P4T A;  2A3L A;  4M7A G;  5GAM d;  2RJD A;  1VQO T;  3OYG A;  4KUD K;  5LJ5 e;  4F7U E;  2JOY A;  3SFM A;  5FRN A;  3CPW A;  4IUP A;  1VQ4 T;  3GF5 A;  4KT0 E;  3CC7 T;  2ZCF B;  4KBM B;  3WXM B;  4C8Q C;  1VIE A;  4C92 F;  1JJ2 A;  1G5V A;  4ZTF A;  2QA4 A;  1NPP A;  4R56 A;  3OYM A;  4IUT A;  1I5L A;  2LCC A;  5KCO A;  3OS2 A;  3A8H B;  4MDX A;  1G3S A;  1VQ6 T;  4J6Y A;  3OSV A;  4BE1 A;  3KBG A;  4MMK A;  1IZ6 A;  4OB3 B;  3L2Q A;  5AYF A;  2CYZ B;  4A4K A;  4C92 A;  5A0G A;  3QO3 A;  3LYI A;  3A5Z B;  4M75 D;  2DXT A;  4FT4 A;  2BKD N;  2RHI A;  1VQM A;  3J80 E;  1WJS A;  2ZPI B;  1U1S A;  3FB9 A;  5M9O A;  4M7D G;  1WNL A;  1K8A U;  3QUI A;  1YIT A;  4HCC A;  3BDL A;  1VUB A;  4RG8 A;  4PL6 A;  2E64 A;  5HKC A;  2V8J A;  2QTX A;  3LGL A;  5LJ5 j;  2WSE E;  3OQ5 A;  1KQ2 A;  3JB9 H;  3GIB A;  2QXF A;  4HT9 A;  3CCS T;  1KD1 U;  1QP2 A;  2L8D A;  4JJN K;  1RI0 A;  4JRK A;  2FVU A;  2WSF E;  3MEU A;  2X4X A;  3HFO A;  2CZ0 B;  2QQB A;  4E7L A;  5IAY A;  4EMK A;  4M78 F;  4A54 A;  3PFS A;  3I55 A;  3EFR A;  3JB9 J;  1M1K C;  2PVG B;  4C0Z A;  3NTH A;  2RHX A;  4M7A E;  4C0D C;  1N8R U;  3HFN A;  1BI3 A;  2DJZ A;  2M0O A;  1UB4 A;  2O4X A;  2LQ8 A;  2RO0 A;  4MML A;  4NOY A;  4BI8 B;  3CPF A;  3G6E T;  4M78 A;  4ELZ C;  1KQ1 A;  2PUK B;  2V8K A;  2RB6 A;  1HK9 A;  2RI3 A;  2KDS A;  2VYT A;  3LX7 A;  1BI1 A;  1UEB A;  1JRI A;  3HPW A;  3QG1 A;  5I2S A;  2NLU A;  3G7Z A;  1OI1 A;  1YBY A;  2MAM A;  3HL8 A;  3OS1 A;  4BI4 A;  3CD6 A;  3HP9 A;  5GMK l;  3JB9 F;  2DK3 A;  2LRQ A;  3CME T;  1JB0 E;  2EYQ A;  2KY9 A;  1G3Y A;  1UGS B;  2DPP B;  3PTA A;  3OY9 A;  4X34 A;  3RKY A;  5CVI A;  4M77 F;  4BY6 C;  1M1G A;  1SSF A;  3SD4 A;  4JRQ A;  5CAI A;  2DXU A;  2DIQ A;  3CBO A;  3X24 B;  1YJN A;  1N9S A;  3RES A;  5FU6 C;  2FL7 A;  3MEW A;  5LJ3 d;  4C5E A;  4M7D E;  2HD0 A;  1Y96 A;  3PT9 A;  2BUD A;  2E41 A;  2KK4 A;  1UGQ B;  4II1 A;  2L89 A;  2F69 A;  3BW1 A;  4OMF B;  4M77 A;  3JCM V;  5A2Q E;  3PIO A;  2MMP A;  4M75 B;  2GF7 A;  1QVP A;  2VGN A;  3QJ6 A;  2MI6 A;  2ZPH B;  3OYK A;  2XD0 A;  4BB7 A;  5CK9 A;  4C0G A;  2OAU A;  3G4S T;  1M9S A;  1OZ3 A;  2FB7 A;  4L6V 5;  4HKE A;  4PJO F;  3GLX A;  4EDU A;  1B34 A;  4LDW A;  4Q5W A;  3L2Z A;  4C92 G;  4RKU E;  3OSS C;  1YI2 T;  4DQ2 A;  1Q82 U;  1KQS S;  2X4Y A;  5EG2 A;  1MGQ A;  2MWO A;  3TU4 K;  2JTF A;  1Q86 U;  3SDZ A;  2XDB A;  2M9U A;  3JCM X;  3JCM h;  2V8I A;  5GAN d;  3HRT A;  4PJO A;  2MF2 A;  1X01 A;  2LT4 A;  3BFM A;  4FT2 A;  3TEE A;  2X4J A;  4MDW A;  3CCM A;  5J39 A;  3CCU A;  3P8D A;  2KAF A;  2LVM A;  1N9R A;  3CC2 A;  2K2V A;  5CKH A;  1KC8 C;  2ZPG B;  3CCV T;  1VIF A;  3M58 A;  1QP3 A;  4LD9 K;  2EFI A;  3H8Z A;  2M1H A;  2JZ2 A;  4C92 D;  2DTO A;  3GP8 A;  3RKW A;  2IG0 A;  4LDV A;  3OYL A;  1S72 A;  2RJF A;  2R57 A;  4ZGD B;  1Q7Y U;  3OYH A;  4E47 A;  1Y7X A;  2E12 A;  1YJW A;  3UDC A;  2GFA A;  3CCE A;  3CCR A;  3UWN A;  3OMC A;  1PSF A;  4N4G A;  3CCJ A;  2C06 A;  2FHD A;  1Y71 A;  1VQK T;  4LDY A;  5CR2 A;  3EAE A;  3QBY A;  3CMA T;  4C8Q F;  1VQ5 A;  4M78 G;  4NL2 A;  2HAX A;  3M56 A;  4Y91 A;  3T9N A;  3KUF A;  5KCH A;  2F5T X;  3M9Q A;  3GPL A;  2L3R A;  2X35 A;  5HK0 A;  3CCL A;  2RI2 A;  3JRZ A;  4IUR A;  3JCM g;  4M75 G;  1WQ7 A;  5GAN 2;  2OTL A;  1R8O B;  3TRE A;  1RL2 A;  2LX9 A;  5CKF A;  4C8Q A;  4OF1 A;  4FSX A;  2HBP A;  3OYB A;  1KG1 A;  4C92 E;  3CPW S;  1X75 C;  1N27 A;  3LWH A;  1I4K 1;  4Y28 E;  3L2U A;  2RI5 A;  2JTM A;  3X25 B;  5LJ5 d;  5L8R E;  5GAN 5;  3JCM J;  3JB9 G;  1FXX A;  1YIJ A;  1Y07 A;  5GMK m;  1JJ2 S;  4M78 D;  3MP8 A;  1O9S A;  4OGC A;  4P5N A;  2XIC A;  5DLQ E;  3VYH B;  5CIU A;  4ZN1 A;  1EIF A;  1WJQ A;  3RIR A;  2RD1 A;  3V7S A;  5GAM h;  5GAN g;  1XTD A;  4PLL A;  4PLI A;  1XQH A;  2E6N A;  3M53 A;  4F7U F;  3JCM b;  2QA4 T;  3L42 A;  2CKK A;  2D6F A;  3Q1J A;  1YHQ A;  4E7K A;  1VQ9 A;  3QZ5 B;  2YLC A;  4XTZ A;  1VQN A;  3C4S A;  2M16 A;  4KUL A;  4ME7 A;  3MP6 A;  3JB9 D;  2EAY A;  2EQK A;  1MHN A;  4F7U A;  3OYN A;  3DLL A;  3NTK A;  4XTV A;  4E7H A;  3INZ A;  2PVO B;  3OB9 A;  4N0A C;  4JUV A;  1KHI A;  3DKM A;  1VQM T;  5LL6 S;  3QYG B;  4PJO G;  4PKC C;  4C92 B;  2DTI A;  3CCQ A;  2VXF A;  4M77 D;  1VQP A;  1YIT T;  1VQ9 T;  3CXC A;  3CEY A;  4FIB A;  4M78 E;  4BDY A;  1K73 U;  5J3B A;  3F70 A;  1M1K U;  2DTH A;  4HCB A;  2CGH A;  2R5M A;  5D6X A;  3OYC A;  4XTU A;  3QDR B;  4UC4 A;  4M75 E;  4TVR A;  2D0Q B;  4JRP A;  1K8A C;  4QVD A;  4BAC A;  1NJI C;  3CBM A;  4NS5 A;  4QW2 A;  4J8O A;  5GMK i;  4FL6 A;  3OBY A;  5GAM g;  3NTI A;  4EMH A;  2RJC A;  3S3O A;  1KD1 C;  3OW2 A;  4J6W A;  3I55 T;  3X28 B;  4NL3 A;  4PJO D;  3FIF A;  4GY5 A;  3SWN A;  5FU7 C;  3QSU A;  2HNI A;  3HSB A;  5D6W A;  4HCZ A;  2HQE A;  1D3B A;  2EQU A;  1BI0 A;  4EMK B;  4E7I A;  4DA4 A;  3JCM f;  3SWN C;  5LJ5 g;  1QW1 A;  4N4H A;  3WVD B;  3OYD A;  2JUF A;  2XDD A;  5CO7 A;  1QVG A;  1BKB A;  1ZHI A;  2RHZ A;  3M5A A;  4M7A F;  3LW5 E;  1N8R C;  2RM4 A;  4XU1 A;  3J81 E;  2WSC E;  3N5B B;  2O4X B;  4OB1 B;  1TH7 A;  2YLB A;  3ASK A;  2EJ9 A;  3O8V A;  4J83 A;  4M78 B;  5CQX A;  4RG2 A;  1W4S A;  3ZFJ A;  5CCA A;  4CI0 C;  3CD6 T;  2XG8 D;  2GQV A;  4B9W A;  3V7R A;  2E65 A;  4LDU A;  3FLG A;  1VQ8 A;  2CZ7 B;  3V8K A;  3JCM Q;  4M7A A;  4XAX B;  2PVD B;  3L2R A;  3LGF A;  2ZZD A;  1YJN T;  2QI2 A;  4M7A C;  2MWP A;  3VYG A;  1V29 B;  4M75 C;  1N6A A;  2E6Z A;  1YCY A;  2QDY B;  2K5L A;  4XTX A;  2DAQ A;  2VUB A;  3S6W A;  4PJO E;  2G3R A;  4QVC A;  1G3T A;  4VUB A;  3OYE A;  3JCM e;  3M59 A;  3R6O A;  5LJ3 h;  3OYA A;  2K5F A;  4RCB A;  2LQK A;  3S3M A;  1QVF A;  1XOV A;  3UPU A;  3OS0 A;  1Y96 B;  3QII A;  4M7D F;  4C8Q D;  1FX7 A;  4CRI A;  4BUG A;  1G3W A;  3I56 A;  2QQS A;  4M77 B;  5DLO A;  1VQL A;  3E19 A;  3FDR A;  3GNF B;  4BDZ A;  5GMK h;  1KC8 U;  4DOV A;  3RKX A;  2GFU A;  2XDP A;  4C5H A;  1W2B A;  3CC4 A;  2DD5 A;  5GAN e;  1B34 B;  4LDX A;  1P92 A;  2JNG A;  1Q81 C;  4M7D C;  5A0L A;  2OTJ A;  2YHT A;  2L5Q A;  4O6J A;  3G71 A;  4RMO A;  1OZ2 A;  4IUU A;  2XK0 A;  5GAM f;  5GAN h;  2LC4 A;  3L2V A;  3CCM T;  3L1A A;  2I2L A;  3CCU T;  2VGM A;  2DZ9 A;  2PQW A;  2QQA A;  1Q86 C;  4ATO A;  4PJO B;  2EWN A;  2H3J A;  4QQG A;  3C94 A;  4ELY C;  3P8H A;  3V8L A;  1M90 U;  2LCL A;  2E5Q A;  2BIV A;  2P0Q A;  3H6Z A;  1VQ7 A;  5LJ3 g;  4LD6 A;  3HRU A;  1S72 T;  2K57 A;  4ZGE B;  5GAO r;  2LNV A;  2XKO C;  1YJW T;  3CCR T;  3CCE T;  3M4G A;  5GAO l;  4L5G A;  3CCJ T;  4HT8 A;  1U1T A;  2DXB A;  3JCM W;  3LH0 A;  3MEA A;  3RUX A;  3JB9 I;  2JVV A;  3VUB A;  1U8R A;  2K5I A;  3MEV A;  3PMT A;  4XU0 A;  3VKI A;  3VUZ A;  5GAO n;  5GAO q;  1VQ5 T;  1VQO A;  3VJP A;  4V2S A;  1DJ7 B;  4QQ6 A;  1H64 1;  2EIF A;  3E9F A;  3QXE B;  4JLI A;  5GAM e;  4OB0 B;  1K9M C;  1NZ9 A;  1UGR B;  3FEO A;  3QHS A;  3CCL T;  3CC7 A;  1VQ4 A;  2XID A;  2CS7 A;  4J5Y A;  2OTL T;  2RHY A;  2VXE A;  1KHC A;  5GAN 4;  2Y4Y A;  2X4W A;  3MCA B;  5CKB A;  2DEQ A;  3MET A;  4M77 G;  3OS5 A;  4EMG A;  1VQ6 A;  5IN1 A;  4E7J A;  4C8Q B;  5FRM A;  5GAN 8;  1YIJ T;  2K3Y A;  1LJO A;  3A8M B;  4JDS A;  2EQM A;  3DLM A;  3P8B B;  4ZN3 A;  3HKS A;  4C5I A;  5KE3 A;  5LJ5 h;  2PU9 B;  4MZT A;  4N0A A;  4BI3 A;  4OP0 A;  4BD3 A;  2KSS A;  2LTO A;  4A4F A;  5HK3 A;  1IRE B;  3CBP A;  4JLG A;  4O5V A;  1I8F A;  3ME9 A;  1FWZ A;  1XNI A;  5GAM j;  2PUO B;  2R58 A;  1YHQ T;  3M55 A;  1NPR A;  4M7A D;  3CCS A;  5FLX E;  1VQN T;  1GXI E;  2E1H A;  2R5A A;  3JAM E;  1JBM A;  3FC3 A;  2RA2 A;  3ER0 A;  4C92 C;  4A4G A;  3JSC A;  2RK1 A;  2O01 E;  3CXC S;  3UT1 A;  2GCX A;  1HXD A;  2VC8 A;  2EJG A;  3TCJ A;  1NJI U;  3PMI A;  3PGG A;  3BY7 A;  3A8L B;  4JRI A;  1ZQ1 A;  3OYY A;  4IUV A;  4X9D A;  3OYF A;  3GOX A;  2LT1 A;  3CCQ T;  1VQP T;  5GAN 6;  4QQD A;  1BI2 A;  2QQ9 A;  3LLR A;  4X9C A;  4F7U B;  3VU3 C;  2Y4X A;  3C95 A;  5LJ3 f;  1BIB A;  3M57 A;  2DD4 A;  3L2W A;  5KE2 A;  1VQL T;  4QVZ A;  3G6E A;  2FYK A;  2E70 A;  4OGE A;  4MZM A;  4YTL A;  1BYM A;  3OW2 S;  1WQW A;  4C0D B;  4BE2 A;  4MZP A;  3VV0 A;  2ZPF B;  3MP1 A;  1K73 C;  4ZTJ A;  1WGS A;  4M77 E;  1WJR A;  3ZBD A;  4EMK C;  2XHC A;  2DVE A;  4M7D D;  3BDU A;  4BE0 A;  3CME A;  2B8A A;  4M75 F;  2HQX A;  4HA8 A;  1LOJ A;  2DO3 A;  3MHX A;  3OBW A;  2ZPB B;  3QYH B;  3DB4 A;  1QVG S;  2QQR A;  5D6Y A;  4XU3 A;  4C8Q G;  4D6W A;  1O75 A;  5FU7 B;  3CC2 T;  3RMS A;  2Y90 A;  4M78 C;  4A4H A;  4C5G A;  3SWN B;  1LNX A;  3M54 A;  4GLK A;  4M75 A;  3FJP A;  4EPC A;  2DIG A;  2XI9 A;  3DB3 A;  4KUI A;  5GAN f;  1D3B B;  4JS4 A;  2K3X A;  2RHU A;  4BY6 B;  5LJ3 e;  5HY6 A;  5KH6 A;  4PNO A;  1X6O A;  4OB2 B;  5GAO m;  2QEX A;  3JCM P;  2DKG A;  2EQJ A;  3HRS A;  3E9G A;  5FU6 B;  2RJE A;  3C12 A;  5GAN 3;  4R55 A;  5IT9 E;  4FM4 B;  5DM7 R;  4IKF A;  3QJY A;  2RK2 A;  3G4S A;  1VQ8 T;  4FU6 A;  2RH2 A;  3MO8 A;  2DXC A;  5I2M A;  3X26 B;  5GMK e;  3A8O B;  1QVF S;  5CQY A;  3SB2 A;  1YI2 A;  2EKO A;  2E10 A;  4M7A B;  3RMQ A;  5FRO A;  3URG A;  3JCM d;  2QEX T;  3M4Y A;  3OYJ A;  4Z02 A;  4JS5 A;  2CZ6 B;  4M77 C;  5C0M A;  1UGP B;  5CKE A;  2YRV A;  4F7U G;  4M7D A;  1KQS A;  5GAN 7;  3V8J A;  2XU8 A;  3FRN A;  4J7F A;  1Q81 U;  3WVE B;  4DOW A;  2WAC A;  4C0F A;  1W2B S;  3I56 T;  4N4I A;  5LJ3 j;  1OYX A;  1WPY A;  3E1S A;  3JCM c;  4A53 A;  3CCV A;  5I21 A;  1Q82 C;  3GNG A;  4IUQ A;  3A8G B;  3HHT B;  3OA6 A;  2VV5 A;  3LWI A;  4L59 A;  3CC4 T;  2IVW A;  2D9T A;  4RCC A;  4XQ3 A;  4B9X A;  3QPH A;  2LDM A;  2P0K A;  4XK8 E;  3PIP A;  2KMT A;  5DY9 A;  4C8Q E;  4PJO C;  5GMK j;  1ZBX A;  4WF2 A;  5C6S A;  2OTJ T;  2K4Y A;  1M4Z A;  2A7Y A;  3G71 T;  4M7D B;  4A4E A;  3NFC A;  1AHJ B;  4XTY A;  5LJ5 f;  1VQK A;  3RER A;  3PNW C;  1PSE A;  2AHJ B;  3ZEH A;  5CKD A;  3CMA A;  2JN0 A;  2P0P A;  4XU2 A;  3OYI A;  1I81 A;  1YJ9 A;  2DZC A;  4J6X A;  3V7C A;  1H3Z A;  3QKJ A;  4OVA A;  3OMG A;  2ZPE B;  3J7A F;  2KVQ G;  5GAN j;  4J7I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...