3JB9J

Cryo-em structure of the yeast spliceosome at 3.6 angstrom resolution
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
73
structure length
73
Chain Sequence
KAGAPDLKKYLDRQVFVQLNGSRKVYGVLRGYDIFLNIVLEDSIEEKVDGEKVKIGSVAIRGNSVIMIETLDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pre-mRNA-splicing factor spp42
publication title Structure of a yeast spliceosome at 3.6-angstrom resolution
pubmed doi rcsb
molecule tags Rna binding protein/rna
total genus 9
structure length 73
sequence length 73
chains with identical sequence o
ec nomenclature
pdb deposition date 2015-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3jb9J00
2DXUA 4M77D 3RUXA 3SB2A 5GANh 2I2LA 3AHUA 1WQWA 4C92F 5GAN2 4M75B 2CGHA 4N0AA 4F7UB 4XTXA 5LJ5d 3JCMP 1B34A 5GANe 3BW1A 4M7DC 4EMKC 1BIAA 3JCMV 3RKYA 4A54A 5GMKl 2RM4A 4M78A 3SWNA 4C8QG 1X01A 4XU3A 5GANd 1WQ7A 4M75A 2DTIA 4C92E 4JRIA 3QUIA 4C8QB 1U1TA 1LOJA 2DJZA 1KQ1A 4C92D 5GMKj 4QVCA 1M8VA 1WNLA 2E65A 4JLIA 1KQ2A 2DXTA 4XQ3A 3V7CA 4M78F 2DKGA 4M77C 5GMKh 4PJOA 3EFSA 3BY7A 5DY9A 4M7AF 4XTVA 4M7DG 2DTOA 5GMKe 2EJ9A 5GAMf 4HA8A 2DZCA 4X9CA 5GAMh 2ZGWA 1N9SA 4M7DB 4M78E 4MMLA 4EMKB 4XTYA 5I21A 2DTHA 2FYKA 2Y90A 3JCMf 4XTWA 4X9DA 4M78D 4M7AE 3JB9H 3L1AA 2EJGA 4C92C 4M7DA 4M7AD 4EMKA 3JB9G 4PJOF 4F7UA 1JBMA 5LJ3f 4M77G 3HSBA 5GAN3 3GIBA 3QO3A 4XU2A 4NL2A 4XU0A 3HFOA 4NL3A 5GAMj 1HK9A 1N9RA 4M77B 5LJ5f 5GAOl 5GAMg 4C8QA 4M7DD 4PJOD 2E41A 2FB7A 4N0AC 3JCMg 3INZA 4M75F 4F7UF 3QSUA 3RKXA 2RA2A 4PNOA 1LJOA 3EFRA 4M78C 4C92G 3SWNC 3JCMJ 3RERA 1TH7A 4M75C 5LJ3j 5GAMe 3JCMh 4M7AC 4C92B 4M75E 4F7UE 4J6WA 4XU1A 4QVDA 3BFMA 4C8QF 5LJ3g 3JCMX 5GAOq 5GAMd 2DZ9A 4M75D 1LNXA 2E10A 3JCMe 1I5LA 5GMKm 3QHSA 5LJ5j 3JCMW 4V2SA 5LJ5g 1Y96B 4XTZA 4C92A 3V8KA 1MGQA 5GAN5 2QTXA 5LJ3h 2EWNA 5GAN7 1I81A 1D3BB 5GAOr 1U1SA 1YCYA 4C8QE 3JCMQ 1BIBA 2EAYA 3FJPA 4PJOC 5LJ3e 3L2ZA 4C8QD 2DVEA 1Y96A 5LJ5h 2DEQA 2EJFA 3PGGA 4M78G 4PJOE 3HFNA 1B34B 4MMKA 3M4GA 5LJ3d 1D3BA 4M75G 5GMKi 4HT8A 3VU3C 3JCMc 5GAOn 5LJ5e 2RD1A 4M7AG 3JB9I 4M7DF 4M78B 5GANf 3SWNB 3V7SA 2E1HA 2YLBA 4M77A 1H641 4A53A 3JB9J 4M7AB 1HXDA 4PJOB 4RCBA 2HNIA 4WF2A 3JCMb 5GAN4 4Y91A 2E64A 4M7DE 2VXEA 5CAIA 5GAN6 4J6XA 4RCCA 1WPYA 4M7AA 2VC8A 4JRKA 3RKWA 4PJOG 3JB9F 1M5Q1 1I4K1 4EMHA 3V8JA 4J5YA 4EMGA 4M77F 4C8QC 1I8FA 3BDUA 3JCMd 2YHTA 4NOYA 3RESA 5GAOp 4DQ2A 4HT9A 5GANj 2K57A 3V7RA 2JN0A 2YLCA 5GANg 4OP0A 1JRIA 3FB9A 4XTUA 2RB6A 3JB9D 5GAN8 4JUVA 4M77E 3RIRA 5GAOm 4F7UG 2VXFA 4J6YA 3V8LA 3FIFA
chains in the Genus database with same CATH superfamily
3RUXA 3SB2A 1NM7A 3OYIA 3M53A 1Q81R 5IN1A 4OMQA 2DILA 4DOVA 5KYYB 1QCFA 5KYXB 1W4SA 1VQMQ 1U1TA 4EDUA 2DA9A 4JLIA 2LMJA 3EG2A 4XQ3A 2ZCFB 3VRZA 4A4HA 5GMKh 1SF9A 1BCMA 4LUEA 2KGTA 4CRIA 3I5SA 4KH1B 1UFFA 3VYHB 1MMDA 1VQOA 4ZTJA 2DL5A 3LWIA 1NJIC 4OMFB 3M0TA 3QO3A 4DA4A 4JZ4A 2LCLA 2HCKA 1M90U 1SHGA 1AD5A 1IXDA 2BKDN 1VQ4A 4Z88A 3HKSA 4Y92A 4M78C 3MP8A 3EG9B 4M75C 2O9SA 4AMCA 1Q81C 2E6ZA 3JAME 1IZ6A 2KI7A 4LDXA 2CP5A 1PSFA 5GAMd 1G3TA 1VQ7T 1K76A 4OGCA 1PKSA 5FRMA 3Q1JA 1U1SA 1BIBA 3CMEQ 3S3NA 4C8QD 2IPOB 3OYYA 4E7LA 4MMKA 1ABQA 2JS0A 3DLMA 1CKBA 5KYUA 3V7SA 2X4JA 2FVUA 2P0PA 1K0XA 3OW2S 3JCMb 4A63B 2DXCA 3NMZC 1N8RU 2EPDA 2K2MA 2RHXA 3DLLA 3RKWA 2O4XB 3BE3A 2RQWA 1UDLA 2RI2A 3CCVT 1E6HA 4KGXB 4DQ2A 2C0IA 2DK3A 2A08A 2PVOB 4RTUA 3OYNA 1OZ3A 5GAN8 1M90R 3I9QA 5I2MA 2I2LA 4O5VA 4C0ZA 2NUPB 4WTOB 4HCZA 1ZUUA 2B8AA 1OZ2A 1KD1R 2DTIA 2V8JA 3E2UA 4IUQA 3VS0A 1ABOA 1B7TA 1ZHIA 2DXTA 3CC7T 2CZ1B 1OQKA 4ME7A 1OULA 3EFSA 4M7AF 4KH0B 1AVZC 1XNIA 2CZ7B 1T0JA 1AWWA 2PU9B 3M5AA 4HCKA 3TREA 5KH6A 4EMKB 2DTHA 2DJQA 2QXFA 1SRMA 4LXCA 2GFAA 2JTFA 1N8RR 3AT1B 2MCNA 2CUBA 1ZX6A 4ZGDB 4PJOF 2NWMA 2E5QA 1G2BA 1WGSA 4PFZA 3MP1A 3H0HA 2C0TA 1IHWA 5CQYA 2CP6A 1YHQA 4M75F 3CPWP 1QVFP 2OTLA 1M90C 1LJOA 3LW5E 4C5GA 2DBMA 3E1SA 2YUOA 4ESRA 3T9NA 4F7UE 4Z02A 4HCCA 1YITQ 1VQ6A 1ZSGA 1PRLC 1KD1C 5LJ5g 4PFPA 2RMOA 1D3BB 3CD6T 1WJQA 3META 4CC3A 2EIFA 3PGGA 5LJ5h 2M1HA 4F04B 5GMKi 1MMAA 1OX9A 3VU3C 4M7DF 2COYA 3SEMA 2E1HA 3CCSA 2QEXA 2JVVA 1H641 2AZVA 4RCBA 3A8MB 2E64A 1W70A 2ZZDA 3EGDA 2L2PA 3KXTA 4JZ3A 4JRKA 3CCMT 1N8RC 4QT7A 2LNHB 1X6GA 2KVQG 3E19A 1ACMB 1I07A 4KGZB 1N27A 2RF0A 8AT1B 1VA7A 2DXUA 1WQWA 2XICA 3TVTA 3QXEB 1GCQA 5I2SA 2JMAA 5KYWB 1P92A 4C8QB 4ZN3A 2EYQA 4AG2C 2E65A 3HHTB 2MOXA 1QMCA 1VQMA 2CZ6B 5D6XA 1U8RA 1OV3A 2V26A 1BCOA 5FU7C 1K0SA 4ATOA 2MWOA 3FJ5A 1EFNA 1NZ9A 5KCOA 2W0ZA 2H3EB 2V1QA 3L1AA 1VQ5Q 2JNGA 1TS9A 2L3QA 2EQKA 1YJ9Q 3UPUA 4M77G 1M1FA 3MEUA 3P8HA 1HK9A 5GAOl 1AWJA 2RK2A 3JCMg 4ZGJB 1EX4A 1X6BA 4C92G 3PMTA 2C0OA 1VQNQ 3RERA 5J26A 3JCMh 4JS4A 2JS2A 4QVDA 5LJ3g 3OMCA 1OI1A 2J6KA 2E3HA 2KRSA 3V8KA 5LJ3h 4KGVB 2QQRA 3X28B 4L59A 2DPPB 1IGUA 3QJ6A 2J6FA 1KQSP 1T3SA 4C0GA 1KC8U 1B34B 1QP3A 4LN2A 3OSVA 3CMEA 2D1XA 3EGXB 3RR6A 3CC4T 3M59A 5CK9A 4BI8B 4LD9K 3PT9A 4LDVA 3D7SB 1Y7XA 3MJXA 3G4SQ 1JQQA 4J9EA 2J7IA 5CIUA 3RESA 4B6MA 2CS7A 3CCEQ 3NHNA 4HVUA 2JN0A 2ATCB 3LLRA 1YN8A 5GAOm 2FRWA 1VYTA 3G7ZA 2JTMA 2KSSA 3PIPA 1RAEB 2RHYA 4N0AA 2D6FA 5GANe 2K79A 1CSKA 5AT1B 5HCKA 2YT6A 3M58A 3FC3A 1G3YA 2BZ8A 1NEGA 1QLYA 2QI2A 2DETA 1NG2A 1WHKA 2GGRA 1WHMA 3EG3A 3G71T 2CREA 2ZGWA 2L3SA 1Q7YR 4M78D 5CQXA 3CXCA 3CCUQ 4RMOA 2DD4A 4X1VA 2K4YA 1Q82R 1BB9A 4J9IA 4J7FA 1R77A 3WVDB 5HK0A 4PFOA 2RQRA 2EYYA 4MZPA 5GAMj 1FMWA 3TSZA 4F7UF 2HQXA 2M02A 4R0KA 1GCQC 5FRNA 3EFRA 2QDLA 4MZTA 2VWFA 1Z9ZA 3I55Q 3CXCS 1M1KU 1ARKA 4J6WA 4XU1A 1TWBA 1WX6A 2M9UA 2DZ9A 2ENMA 1TXQA 1VQKQ 4C92A 3L2VA 2QTXA 2XDBA 1F1BB 1MNEA 1BI0A 1YITA 5A0DA 4FT2A 3HFNA 5LJ3d 2DX1A 5GAOn 1K9MU 1M9SA 3JB9J 1RAAB 1HXDA 3CCLQ 2RN8A 5IT9E 4O6JA 3EHQA 1Q7YC 2OTLT 4TVRA 4RCCA 5CR2A 4FYXB 3OW2P 5CKFA 1MMNA 4J83A 1M5Q1 1Q82C 4NOYA 3UWNA 2E4HA 4E7SA 3JB9D 4M77E 1SSFA 1VUBA 4IIMA 3EH1A 5DLOA 4B9WA 2K5LA 2NLUA 3A98A 2CT3A 2EYXA 1RI9A 2QEXT 1QWEA 4C92E 3I56T 3CBMA 2DJZA 3DB4A 5GMKj 3LWHA 4OF1A 2EQMA 3VJPA 4Z89A 2CUDA 4PJOA 1R0CB 2HSEB 4OB0B 4FSXA 4CI0C 4M4ZA 2VGMA 3ZBDA 1K9MR 1ZA2B 3SDZA 1YIJQ 2LTOA 4E7IA 1S72Q 1YCSB 1YI2T 2DAQA 3OA6A 4II1A 2COWA 5GAN3 1QVGA 1VQ5A 3GPLA 2BE7D 2HD0A 3JV3A 3HTRA 1I1JA 1ZBXA 2FB7A 2JMCA 1YJ9A 4N0AC 2YRDA 2F2VA 2DBKA 3OYLA 2RA2A 3P8DA 4EIKA 3HL8A 1YJNQ 2DYBA 1VQMT 4E6RA 4JS5A 9ATCB 2VGNA 1RLPC 4ZN1A 3CMAQ 1UE9A 1U5SA 3KFVA 1LNXA 5IH2A 1VQNA 3CCRT 2R58A 1NJIU 1QW1A 1YWOA 4GLMA 1QVGS 3CBOA 3CCQQ 2LDMA 2CT4A 1HYOA 4PJOE 2EJFA 2CSQA 4QW2A 2VV5A 3VYGA 4M78B 2R5MA 1Q81U 1GCPA 3QPHA 4WF2A 4QKUA 1O75A 3OYMA 4E47A 2XDDA 3OYCA 2VC8A 3EGUA 3X26B 2KAFA 3OMGA 3G4SA 4JRQA 1V1CA 4ELZC 1Y71A 2D9TA 3CCEA 3FIFA 3PVLA 4PJNA 3AHUA 3H0FA 3OYBA 2MYSA 2X4YA 2YXYA 2KE9A 2QYZA 3SWNA 4Z8AA 1WQ7A 1WDXA 1WXBA 3RMQA 5I22A 1QCNA 1X43A 2EYZA 2KQWA 2LQWA 4L6V5 1ZQ1A 2ZPIB 1M27C 1PD1A 4NS5A 2LVMA 3QG1A 3G1JA 2BE9B 2DKGA 1WJSA 3MO8A 2EJ9A 5GAMf 4HA8A 3PNWC 2WSCE 1WYXA 2YUNA 4C0FA 2HEQA 2A3LA 2IG0A 1KK7A 2RPNA 4IUPA 1NPPA 3M9QA 2HQEA 3L2UA 3CCUA 4XU0A 4NL3A 3MP6A 3GOXA 3MPUB 4IKFA 1FXXA 3LGFA 3OS5A 3UDCA 1H92A 4PNOA 1VQPQ 1BI2A 2GQVA 3WVEB 2EKHA 2DNUA 4M7AC 2A36A 2V8IA 2E10A 5LJ5j 2DE0X 2X4XA 3I55A 5GAN7 2CP3A 4PJOC 3MEAA 4N4GA 2E6NA 1CKAA 2J05A 1VQKA 1UEBA 3JB9I 2DL3A 2AKKA 3M0UA 4J9DA 1UB4A 1GBQA 3X25B 1K73R 4A4KA 3S3OA 4DEXA 1M2VA 5FROA 2EVRA 4OB2B 3CCJQ 4XK8E 1KD1U 5A0LA 3I35A 2A0FB 2W10A 2XDPA 3CCLA 4M77F 1OPKA 3IQLA 3PE0A 1UGRB 1WIEA 2O4XA 2XI9A 5GANg 3CQTA 5IHKA 3GLXA 4A4GA 2K3BA 4E7KA 1SHFA 2D0QB 2QA4Q 5GANh 2CSIA 4C92F 1OOTA 2HBPA 2XD0A 4M7DC 2EKOA 5GJWB 2L8DA 3EFOB 2QQSA 4IUTA 5FU6C 4C8QG 2E5KA 3PIOA 2DRKA 3VRYA 2GTOA 1RL2A 2X35A 3KBGA 1WHGA 5A2QE 4YTLA 4DBHA 4XAXB 1JEGA 2F2XA 4XTVA 3OS0A 1E6GA 1K73C 1SSHA 3JB9H 3FEOA 3X24B 3R6NA 4EMKA 3J80E 4F7UA 2LX9A 1YIJA 1S72A 1A0NB 3HFOA 4C0DB 1D09B 2VUBA 5FU7B 2XU8A 1HD3A 2YUPA 3OYGA 3SWNC 1XQHA 1LVKA 5LJ3j 1IO6A 4IIOA 1YFNA 4MDXA 1YJNA 2XK0A 3JCMW 3CXCP 2PNIA 1KHIA 1X69A 3CMAA 1I81A 3JCMQ 3C0CA 2JM9A 2WSFE 1D1BA 3OYJA 1NBEB 2F5KA 2EYWA 3A8LB 4AFSC 1D3BA 4DBQA 1ZUKA 3O5ZA 3CCQA 3R6OA 4GY5A 3A8OB 1YJ9T 4A4EA 3S3MA 4QQGA 2MAMA 4J5YA 3V8JA 3UATA 3X20B 1VQ7Q 4OMPA 2RK1A 2XMFA 1UECA 3EH2A 1H8KA 4BI4A 2FL7A 2Y4YA 3FRNA 2A28A 2HQHA 4AT1B 4J9FA 3GBQA 2L0AA 5GANd 2XIDA 3CC2Q 4FYYB 4LNPA 2O88A 2JT4A 1ZUYA 5FW9A 2QAZA 3QJYA 2RNAA 2OTJQ 2O01E 4UC4A 1KQ2A 2DIGA 5HKCA 1RACB 3L2RA 3CCVQ 3G4ST 3H0IA 4RTTA 2COZA 2KR3A 3HP9A 2PTKA 1YNZA 3CCET 1EIFA 5FWCA 2M0OA 2MPXC 2P0QA 3MCAB 4J7IA 2GF7A 2QQ9A 1N9RA 3QIIA 5LJ5f 3DKMA 2DD5A 1FWZA 2ED0A 3QSUA 1OYXA 3RKXA 2Y4XA 1M30A 4OMOA 3JCMJ 4BE1A 3JCMX 1VQPA 2LP5A 3OYDA 1W1FA 4XTZA 2GBQA 1MGQA 1MNDA 2QG9B 1ZSZA 3J7AF 4C8QE 1PD0A 1BU1A 4JJDA 1QVGP 1PHTA 2M16A 3CCUT 2YRCA 1UGPB 3E9FA 2G3RA 1TOVA 4PL6A 1XTDA 2RJFA 1VQ9Q 5GAN4 4QVZA 2K5FA 3PFSA 1WPYA 2K3XA 3SD4A 3EGXA 4D8DA 4ZNXA 1MHNA 2PZ1A 3BDUA 1I5OB 2DM1A 4FSSA 3CCJA 3M56A 2MF2A 1VQOT 3I55T 3VS5A 1O9SA 1AWOA 3GNGA 2B86A 4E7JA 2MIOA 3CD6Q 4AFZC 1VQKT 2NUTA 5AYFA 5LJ5d 2PVGB 1G83A 1Q7YU 1NE8A 1X2QA 3VV0A 1IGQA 2QA4A 1VQ4T 1X01A 3KUFA 2F5TX 1Q82U 5L23A 3QUIA 1NEBA 1I0CA 4LE9A 2R57A 2CH4A 2J6OA 1UGVA 2JOYA 1JJ2P 1GRIA 3CCLT 1K1ZA 3BY7A 4CC4B 2AZSA 3C4SA 2DL7A 4X9CA 1VIFA 5C6SA 4XTYA 3JCMf 4BY6B 2F69A 1KHCA 1OEBA 4M7AD 1UUEA 2QASA 1Y57A 2LRQA 4PJLA 3LYIA 5LJ3f 4RTYA 1RLQC 2OAWA 4D6WA 4PJOD 5KE2A 1MUZA 3OS2A 2L5QA 3CEYA 4OMMA 1ZLMA 3G6EQ 4M75D 1AHJB 1V29B 5GJVB 4PJMA 3H41A 3TEEA 1W2BA 1NLPC 3RMSA 1R0BG 4M78G 1Q95G 4M75G 1KSWA 1SKUB 2EBPA 4EPCA 4FW2A 4M77A 2LQKA 2QK0A 1HJDA 2K7AA 1OPLA 4FU6A 2JM8A 4M7DD 4MZMA 7AT1B 1D1CA 2H8HA 1T0HA 1D0YA 1W2BS 3JCMd 3M57A 1M3BA 1AT1B 1YJNT 3FDRA 1W6XA 2PUKB 4XTUA 1JRIA 1NYFA 2EQUA 2DLPA 3EHRA 3MHXA 4HVVA 1VQ7A 1OU8A 2CGHA 2AKLA 4D8KA 4BACA 2MI6A 1YHQT 1BIAA 2ZPBB 4XU3A 2ABLA 1GL5A 4IUUA 1ZSZC 3WXMB 2ESWA 1ZA1B 2OI3A 1LOJA 2OX7A 3UA6A 3N5BB 3CC4Q 3ER0A 2JZ2A 2V8KA 3CC2A 4FW1A 1VQ6T 1K9AA 2OTJA 3NPFA 1TUDA 5DY9A 2DTOA 5CVIA 2DMOA 3H6ZA 4MMLA 2YWWA 2FEIA 3CCVA 2BTTA 2LJ1A 3OSSC 1KG1A 2RQTA 2KT1A 2PQWA 3CCST 3JB9G 1K4US 4XU2A 2JTEA 4LUDA 1KJWA 2ECZA 2D8HA 2PVDB 3OB9A 1M3CA 4WCIA 4RG2A 1C6VX 5KCHA 2OAUA 1K8AU 4HCBA 1RAHB 2E70A 3RNJA 4FCYA 4C8QF 2G6FX 3G71Q 1KIKA 3QHSA 3NGPA 1VQ8Q 4LDYA 3S6WA 4E2FB 5GAOr 2SEMA 1YCYA 1QKWA 2ZPEB 4J9BA 2DVEA 3RBBB 2DEQA 2EGAA 3JCMc 2RD1A 1JB0E 2FHDA 4M7AB 2HL3A 1VYUA 4GBQA 3F70A 1R8OB 1U06A 1QKXA 4J9GA 5GAN6 1X2KA 2HDAA 1VQ9A 1VQLQ 1YP5A 4FL6A 4DOWA 4EMHA 4BD3A 4PJOB 2P84A 1VQPT 2A7YA 2FZKB 4J8OA 5GANj 1RUWA 2K9GA 1YJWQ 2JW4A 2K3YA 3FB9A 1BBZA 3M0PA 2H3JA 3OYEA 4P5NA 3LGLA 4J6YA 2DEUA 2RHIA 2ZPFB 4M75B 1LCKA 1TUCA 3BW1A 1K8AR 4BE0A 1WXUA 1UHCA 3RKYA 3PTAA 4FYVB 3H8ZA 2I0NA 3CD6A 1AZGB 3HRSA 1KQSA 1FMKA 2VASA 1KQ1A 2DXBA 1M1GA 3ZFJA 3M55A 1WLPB 4M77C 3OYHA 2KBTA 5FWBA 1TG0A 5GAMh 2CP2A 3OBWA 4KUDK 1N9SA 4M7DB 4M78E 4LDWA 1WXTA 3ZEHA 5FU6B 2YSQA 2X3XD 2RJEA 1D0ZA 4C92C 4GLKA 3CMET 2XHCA 2FPEA 4FM4B 2BZYA 3VS4A 3RDVA 1QVPA 5KYYA 5KYXA 3I56Q 2GFUA 2LT4A 3INZA 4F16A 5A0GA 1PM3A 1K73U 2YDLA 1WHJA 2K6DA 2CKKA 1K8AC 4AG1C 2YRVA 4DEYA 3VKIA 4V2SA 1XJWB 1Y96B 5I11A 5DM7R 4BDYA 4MDWA 2K5IA 2FRYA 1YI2Q 3G6EA 5DLQE 1WI7A 1RAGB 1PRMC 4IURA 4AFUC 3SWNB 1QCOA 3REAB 1Y07A 5IXFA 2KXCA 1S1NA 4JLGA 2DVJA 4RTVA 4BE2A 1D1AA 4J6XA 2M0YA 3ULRB 1UJYA 2KRNA 2Z0WA 3EG9A 1I4K1 3MEWA 1MV3A 1AOJA 3CCRQ 3ME9A 3MEVA 3CPFA 2HKQB 5FLXE 5IXBA 3OYKA 2VXFA 5IHIA 2QQBA 5ECAA 1E7OA 5D7UA 3VS2A 1RAFB 3TSWA 3M0SA 1WA7A 4A54A 4C5IA 1C0MA 3EFOA 1G3WA 1OU9A 2HAXA 2GCXA 3CC4A 4F17A 4ELYC 1YITT 2CH4W 2F2WA 2WACA 2GTJA 4ORZA 4PKCC 2FYKA 3OW2A 1V76A 1HSQA 2FZGB 3TCJA 2E3IA 2NUPA 4OMLA 2V1RA 2P0KA 2QGFB 3BDLA 2JJ9A 4OB1B 3VUZA 4PLLA 3GNFB 2KROA 3CC2T 1M2VB 4PK4A 2OTJT 1TH7A 2X3WD 2RQVA 1UG1A 2M51A 1I5LA 1SG5A 2WSEE 3L42A 3OBYA 3G71A 2LJ0A 1QWFA 5KYUB 1VQ8A 1RI0A 2AK5A 3ASKA 5J39A 5GANf 2YLBA 4IUVA 4A53A 3H9NA 2L3RA 3NTKA 3A1PA 1FMVA 2BZXA 2VXEA 2HBWA 4KULA 4OVAA 3DB3A 4J9HA 1Y0MA 4HT9A 4J9CA 2YLCA 1W2BP 3VS6A 1VQLA 1DJ7B 1G8XA 1VQ5T 2X51A 2RJDA 1YJWA 4F7UB 4HKEA 3JCMP 3OQ5A 3JCMV 5CKHA 2MWPA 2RM4A 1WZOA 5KE3A 4FYWB 1M2OA 4F14A 2RHZA 2DO3A 3NTIA 3OS1A 1X75C 2CYZB 3QKJA 1B07A 4C5EA 3JRZA 4E7ZA 1VQ9T 1VQNT 4ZTFA 4M78F 4VUBA 2O2OA 3MKDA 1NPRA 2QTVA 2FPFA 2Y90A 1B3QA 2F1LA 4DBRA 2ZAEA 4HVWA 2D0NA 2PUOB 3E9GA 2JUFA 2FPDA 3VUBA 2DERA 3C95A 4OGEA 3UA7A 2AT1B 8ATCB 3HSBA 1UGSB 4QQ6A 2EQJA 3HRTA 5KYWA 4C8QA 1UHFA 1G3SA 4BB7A 2LCCA 3I56A 5EC7A 4R55A 1G5VA 5GAMe 1RAIB 3GF5A 1JXMA 3CBPA 2FG0A 1PG5B 1PC0A 2P4RA 1N6AA 3QZ5B 4RKUE 2RQUA 2EWNA 1Z9QA 2RJCA 1YI2A 3UF4A 3CC7Q 2OJ2A 3EGDB 1X27A 3HRUA 4E7HA 3QDRB 2DRMA 2VVKA 3VS1A 2LX7A 3JB9F 5EG2A 2KMTA 1UJ0A 2ED1A 4JDSA 3QZ9B 3M4YA 1GXIE 1Q86U 1WFWA 4OP0A 5HK3A 4C0DC 1UTIA 2RB6A 1SPKA 3PMIA 2EJGA 3G6ET 2KXDA 1BK2A 4M77D 1JU5C 4A4FA 2DF6A 3EG1A 2HZYA 3HPWA 3CCRA 1B34A 2DIQA 4EMKC 2E12A 3LH0A 4Q5WA 1MV0B 3QWXX 2LQNA 4C92D 2CP7A 1BYMA 4Y28E 5KYNA 1JXOA 1SRLA 1IB8A 1ZBJA 2KY9A 4DBFA 2QGGA 2EFIA 2ROLA 3REBB 5GMKe 2D8JA 4KBMB 5CCAA 1M3AA 1KFZA 4XTWA 1FYNA 4X9DA 1ZSZB 4JRPA 1VIEA 6AT1B 3VS3A 1JBMA 1YWPA 1TTHB 3L2WA 3SFMA 3P8BB 4BUGA 3TU4K 1Q86R 3CCMQ 2C06A 3C12A 2RO0A 2RHUA 4RTWA 4OMNA 2EW3A 4KUIA 5HY6A 4PJJA 4RTZA 4RG8A 4KRTA 2EAYA 3LH5A 3L2ZA 2GQIA 2NUTB 2KRMA 5LL6S 2J06A 4C5HA 5D6WA 3A8HB 4M7AG 5M9OA 4B9XA 1AZEA 2P4TA 2XG8D 2KT8A 1RADB 5IAYA 1WHLA 4PJOG 5C0MA 4C8QC 1LPLA 2YHTA 1GBRA 2NUZA 1KC8R 1YIJT 5CO7A 1Q86C 4JUVA 3RIRA 3THKA 1S72T 2FZCB 1VQ8T 4XTXA 1PWTA 3OY9A 2HSPA 2VKNA 5GMKl 2O9VA 1J3TA 3URGA 4JRIA 2RI5A 1QP2A 1TSFA 1M8VA 3JSCA 1BI3A 1OX8A 1EZZB 1NYGA 3VS7A 2AHJB 2KYBA 2QQAA 3CPWA 1QVFA 4HXJA 3V7CA 1M4ZA 3CMAT 4M7DG 3I5RA 2A37A 2KEAA 2XKOC 1AEYA 1VQLT 1VQOQ 3M0RA 5CKEA 5I21A 2LQ8A 2CP0A 3CCQT 1YJWT 3A5ZB 2RH2A 5D6YA 4R56A 2L89A 3GIBA 4NL2A 1VQ4Q 3CPWS 1QVFS 2IIMA 3TQ7P 1PKTA 4M77B 4L5GA 2LC4A 1KC8C 5J3BA 3OYAA 4KT0E 4ANJA 1UGQB 2MK5A 4CC7A 2X9HA 1QQJA 4BI3A 1PNJA 1H3ZA 4C92B 3QWYA 2VB6A 3A8GB 1RABB 5GMKm 5GAN5 5IHNA 1PSEA 3FJPA 1FX7A 2JXBA 2EGEA 1IHVA 5LJ5e 4QQDA 3M54A 4FT4A 1XOVA 4JJCA 3QYHB 1M1KR 4Y91A 4BY6C 1MMGA 4M7AA 4RTXA 3CC7A 2LNVA 2BIVA 1JO8A 3U23A 4FIBA 1GFCA 4EMGA 2CDTA 4ZGEB 3SHWA 2L3PA 2GNCA 3EG0A 2ZPHB 3V7RA 2VYTA 4JJBA 2LZ6B 2ROTA 1X6OA 2CZ0B 3FLGA 3PVQA 3GP8A 3V8LA 1C1AA 5GAN2 1T3LA 2EQIA 1M8MA 1WHHA 4M78A 4RUGA 2BUDA 4M75A 4AFQC 2EGCA 1TU0B 4QVCA 1WNLA 3O8VA 4CC2A 2NYSA 2DL4A 1IREB 2X4WA 2FO0A 2DZCA 2HL5C 2MMPA 3ZL7C 1VYVA 4M7AE 1M1KC 1D0XA 1AWXA 4M7DA 3J81E 2RI3A 1GFDA 3NTHA 2LJ3A 1YHQQ 1U3OA 1NLOC 2R5AA 2HMAA 3C94A 2OTLQ 2KDSA 1SEMA 5GAMg 1IRXA 2E41A 2KK4A 2DFUA 3CCJT 2DL8A 1VQ6Q 3QYGB 1WJRA 3CCMA 1K9MC 2LCSA 2HKNA 1BKBA 4M75E 3UT1A 3BFMA 5GAOq 3EAEA 4N4HA 1YBYA 5CKDA 2O31A 3JCMe 1KQSS 1JJ2A 2K2VA 4JJNK 4N4IA 1TUGB 2KNBB 1VOMA 3L2QA 2ZPGB 2QA4T 4OB3B 2SRCA 3LX7A 5LJ3e 3CCSQ 2QEXQ 1Y96A 4LD6A 4PLIA 3M4GA 4HT8A 4K11A 5L8RE 2IVWA 2QDYB 1N5ZA 3QBYA 4BDZA 2HNIA 2LT1A 2DYIA 4M7DE 2KYMA 5CAIA 5CKBA 2AIRB 1JJ2S 4X34A 1BI1A 1PCXA 1NJIR 1H3HA 1I8FA 4JPBW 5GAOp 3QDFA 3OYFA 3M0QA 3NFCA 4LDUA 2YUQA 4F7UG 2K57A
chains in the Genus database with same CATH topology
2RJDA 3RUXA 3SB2A 4B9WA 2K5LA 5DLOA 4E7JA 1YJWA 3OYIA 2NLUA 5AYFA 4HKEA 4F7UB 5LJ5d 3M53A 2PVGB 3JCMP 5IN1A 1Q7YU 1NE8A 3OQ5A 3VV0A 3JCMV 5CKHA 2MWPA 2RM4A 2QA4A 1VQ4T 1X01A 3KUFA 2F5TX 4DOVA 5KE3A 2QEXT 4C92E 3I56T 1W4SA 3CBMA 1Q82U 2RHZA 3QUIA 1U1TA 2DJZA 2DO3A 2R57A 3DB4A 3NTIA 4EDUA 5GMKj 3OS1A 1X75C 2CYZB 3QKJA 4JLIA 3LWHA 4OF1A 2EQMA 2JOYA 3JRZA 4C5EA 3VJPA 4XQ3A 1VQ9T 1VQNT 3CCLT 4ZTFA 2ZCFB 4M78F 4VUBA 4A4HA 5GMKh 4PJOA 3BY7A 3C4SA 4OB0B 4FSXA 4CI0C 4X9CA 1VIFA 1NPRA 2VGMA 5C6SA 3ZBDA 4XTYA 3SDZA 2LTOA 2Y90A 3JCMf 4CRIA 4BY6B 2F69A 1KHCA 4E7IA 2PUOB 3VYHB 3E9GA 1YI2T 4M7AD 2JUFA 1VQOA 2LRQA 3VUBA 2DAQA 4ZTJA 3LYIA 3C95A 4OGEA 3OA6A 4II1A 5LJ3f 3LWIA 1NJIC 4OMFB 5GAN3 3QO3A 1QVGA 1UGSB 4DA4A 1VQ5A 3HSBA 4QQ6A 3GPLA 2EQJA 3HRTA 2LCLA 2HD0A 4C8QA 4D6WA 1G3SA 1YJ9A 1ZBXA 2FB7A 5KE2A 1M90U 4N0AC 4PJOD 3OS2A 2BKDN 4BB7A 2L5QA 2RA2A 3CEYA 3P8DA 2LCCA 3OYLA 1VQ4A 3HL8A 3HKSA 3I56A 4M78C 1VQMT 3MP8A 4R55A 4JS5A 2VGNA 4M75C 4ZN1A 1G5VA 5GAMe 1Q81C 2E6ZA 3JAME 1IZ6A 3GF5A 4LDXA 1PSFA 5GAMd 3CBPA 4M75D 1G3TA 1LNXA 1VQ7T 1AHJB 1VQNA 3QZ5B 1N6AA 3CCRT 4OGCA 2R58A 4RKUE 1QW1A 1V29B 1NJIU 1QVGS 3TEEA 5FRMA 2EWNA 3CBOA 3Q1JA 1W2BA 1U1SA 2LDMA 1BIBA 3RMSA 3S3NA 4C8QD 4PJOE 2EJFA 4M78G 3OYYA 4E7LA 4MMKA 4QW2A 4M75G 2RJCA 3DLMA 2VV5A 3VYGA 4M78B 1YI2A 3V7SA 4EPCA 4M77A 2X4JA 2FVUA 2LQKA 2P0PA 2R5MA 3HRUA 1Q81U 3QPHA 3OW2S 3JCMb 4WF2A 2DXCA 1O75A 3OYMA 1N8RU 4FU6A 4E47A 4E7HA 3QDRB 2XDDA 2RHXA 4M7DD 4MZMA 3OYCA 3DLLA 2VC8A 3RKWA 3JB9F 5EG2A 2O4XB 2KMTA 3X26B 1W2BS 3JCMd 2RI2A 2KAFA 3M57A 3CCVT 4JDSA 3QZ9B 1YJNT 4DQ2A 2DK3A 3M4YA 2PVOB 3FDRA 3OMGA 1GXIE 1Q86U 2PUKB 3G4SA 4OP0A 1JRIA 4XTUA 5HK3A 4C0DC 4JRQA 2RB6A 4ELZC 3OYNA 1OZ3A 5GAN8 2EQUA 1Y71A 2D9TA 3PMIA 2EJGA 3G6ET 3CCEA 3FIFA 3MHXA 4M77D 5I2MA 4A4FA 2I2LA 1VQ7A 3AHUA 3OYBA 3HPWA 4O5VA 2CGHA 4C0ZA 3CCRA 1B34A 4BACA 2MI6A 2X4YA 2DIQA 4HCZA 1YHQT 4EMKC 1BIAA 2E12A 3LH0A 2B8AA 2ZPBB 1OZ2A 4Q5WA 4XU3A 3SWNA 1WQ7A 4IUUA 2DTIA 3RMQA 3WXMB 2V8JA 4IUQA 2KQWA 1LOJA 4C92D 1BYMA 4Y28E 4L6V5 1ZHIA 1ZQ1A 3N5BB 3ER0A 2ZPIB 2JZ2A 2KY9A 2V8KA 4NS5A 3CC2A 2DXTA 2LVMA 3CC7T 2CZ1B 1VQ6T 4ME7A 3QG1A 2DKGA 2OTJA 1WJSA 2EFIA 3EFSA 5DY9A 4M7AF 1XNIA 2DTOA 5CVIA 2CZ7B 3MO8A 5GMKe 2EJ9A 3H6ZA 4HA8A 2PU9B 3M5AA 4KBMB 3TREA 5GAMf 3PNWC 5CCAA 5KH6A 4MMLA 4EMKB 2WSCE 2DTHA 4XTWA 4X9DA 3CCVA 4C0FA 2QXFA 2A3LA 2IG0A 4JRPA 2GFAA 2JTFA 3OSSC 1KG1A 3CCST 1VIEA 2PQWA 4IUPA 4ZGDB 4PJOF 3JB9G 1NPPA 1JBMA 2E5QA 3M9QA 2HQEA 1WGSA 3L2WA 4XU2A 3L2UA 3CCUA 4XU0A 3MP1A 4NL3A 3SFMA 3P8BB 2PVDB 4BUGA 3TU4K 3MP6A 3GOXA 3OB9A 5CQYA 4IKFA 1FXXA 3LGFA 3OS5A 3UDCA 4RG2A 1YHQA 2C06A 4M75F 2OTLA 1M90C 3C12A 4PNOA 1LJOA 1BI2A 2RO0A 3LW5E 4C5GA 5KCHA 2GQVA 3WVEB 3E1SA 2OAUA 1K8AU 4HCBA 2E70A 2RHUA 3T9NA 4M7AC 4F7UE 4KUIA 5HY6A 4Z02A 4C8QF 4HCCA 2V8IA 4RG8A 2E10A 1VQ6A 3QHSA 5LJ5j 2X4XA 1KD1C 5LJ5g 4LDYA 3I55A 3S6WA 5GAN7 5GAOr 1D3BB 1YCYA 2EAYA 3CD6T 4PJOC 1WJQA 2ZPEB 3L2ZA 3MEAA 2DVEA 3META 4N4GA 2E6NA 5LJ5h 2DEQA 2EIFA 3PGGA 2M1HA 5LL6S 1VQKA 5GMKi 3VU3C 3JCMc 5D6WA 4C5HA 2RD1A 1UEBA 3A8HB 3JB9I 4M7AG 4M7DF 5M9OA 4B9XA 2E1HA 3CCSA 2QEXA 2JVVA 2P4TA 1H641 2XG8D 1UB4A 1JB0E 2FHDA 4M7AB 3X25B 4RCBA 3A8MB 4A4KA 5IAYA 3S3OA 3F70A 2E64A 1R8OB 5FROA 2ZZDA 4OB2B 5GAN6 4XK8E 3KXTA 4JRKA 3CCMT 1N8RC 4PJOG 1KD1U 5A0LA 1VQ9A 4FL6A 2XDPA 4DOWA 5C0MA 4EMHA 3CCLA 4BD3A 4M77F 4C8QC 4PJOB 1VQPT 2YHTA 2A7YA 1UGRB 4J8OA 5GANj 2O4XA 2XI9A 5GANg 2K3YA 2KVQG 3E19A 3FB9A 3GLXA 4A4GA 1YIJT 2H3JA 5CO7A 1N27A 4P5NA 3OYEA 4E7KA 4JUVA 1Q86C 3RIRA 3LGLA 2D0QB 1S72T 4J6YA 2DXUA 5GANh 2RHIA 1VQ8T 1WQWA 2XICA 2HBPA 2ZPFB 4C92F 4M75B 4XTXA 2XD0A 3BW1A 4BE0A 4M7DC 2EKOA 3OY9A 3QXEB 2L8DA 5GMKl 2QQSA 4IUTA 5FU6C 3RKYA 4C8QG 3PTAA 5I2SA 3H8ZA 3PIOA 3CD6A 2X35A 1RL2A 3HRSA 3URGA 4JRIA 2RI5A 1QP2A 1P92A 4C8QB 1KQSA 4ZN3A 1KQ1A 2DXBA 1M8VA 3JSCA 1BI3A 2EYQA 3KBGA 2E65A 2AHJB 2QQAA 3HHTB 1M1GA 3ZFJA 3CPWA 5A2QE 1QVFA 4YTLA 3V7CA 3M55A 1VQMA 2CZ6B 4XAXB 4M77C 1M4ZA 5D6XA 3OYHA 1U8RA 3CMAT 4M7DG 5FU7C 4XTVA 4ATOA 2MWOA 5GAMh 2XKOC 1NZ9A 3OBWA 3OS0A 4KUDK 1N9SA 1VQLT 4M7DB 4M78E 4LDWA 3ZEHA 5CKEA 5I21A 5FU6B 5KCOA 2LQ8A 2RJEA 3CCQT 1K73C 3JB9H 3L1AA 3FEOA 1YJWT 2JNGA 4C92C 4GLKA 3X24B 2XHCA 3CMET 4EMKA 1VQKT 2EQKA 3A5ZB 4F7UA 3J80E 2LX9A 2RH2A 1YIJA 5D6YA 4R56A 4FM4B 3UPUA 2L89A 4M77G 3GIBA 1S72A 1QVPA 4NL2A 3HFOA 3CPWS 1QVFS 1M1FA 3MEUA 3P8HA 4C0DB 1HK9A 5GAOl 4M77B 2RK2A 2VUBA 4L5GA 5FU7B 2GFUA 2LT4A 2LC4A 2XU8A 1KC8C 3JCMg 3INZA 5J3BA 3OYAA 4KT0E 4ZGJB 1UGQB 3OYGA 4C92G 5A0GA 3PMTA 3SWNC 1XQHA 3RERA 4BI3A 1K73U 5J26A 5LJ3j 3JCMh 4JS4A 1H3ZA 4C92B 4QVDA 5LJ3g 1K8AC 2CKKA 3OMCA 4MDXA 1OI1A 2YRVA 1YJNA 3A8GB 2XK0A 5GMKm 3VKIA 3JCMW 4V2SA 1Y96B 1KHIA 5DM7R 4BDYA 3V8KA 5GAN5 3CMAA 4MDWA 2K5IA 5LJ3h 1I81A 2QQRA 3JCMQ 3X28B 4L59A 2DPPB 1PSEA 3FJPA 5DLQE 2WSFE 3QJ6A 3G6EA 1FX7A 3OYJA 4C0GA 1KC8U 2F5KA 1B34B 3A8LB 1QP3A 1D3BA 4IURA 3CCQA 5LJ5e 3R6OA 4QQDA 4GY5A 3SWNB 3OSVA 3A8OB 3CMEA 1Y07A 3M54A 1YJ9T 4FT4A 1XOVA 3QYHB 4JLGA 4Y91A 4A4EA 3CC4T 3M59A 4BE2A 5CK9A 4BI8B 4BY6C 4LD9K 3PT9A 1VQ5T 4J6XA 4LDVA 4M7AA 1Y7XA 3CC7A 2LNVA 3S3MA 2BIVA 1I4K1 4QQGA 4FIBA 2MAMA 4J5YA 5CIUA 3V8JA 3MEWA 4EMGA 3RESA 4ZGEB 2CS7A 3V7RA 2JN0A 2ZPHB 3X20B 2VYTA 2RK1A 3ME9A 1X6OA 2CZ0B 3FLGA 3LLRA 3MEVA 3GP8A 3CPFA 5FLXE 5GAOm 3OYKA 2VXFA 3G7ZA 3V8LA 2JTMA 2KSSA 2FL7A 2QQBA 2Y4YA 3FRNA 4BI4A 3PIPA 5GAN2 2RHYA 4N0AA 2D6FA 5GANe 4A54A 4M78A 5GANd 2XIDA 2BUDA 4C5IA 4M75A 3QJYA 2O01E 4QVCA 4UC4A 3M58A 1G3WA 1WNLA 3O8VA 1KQ2A 3FC3A 2DIGA 1G3YA 5HKCA 2HAXA 3L2RA 2GCXA 2QI2A 3CC4A 1IREB 2X4WA 4ELYC 3G4ST 3G71T 1YITT 2DZCA 2WACA 2ZGWA 4PKCC 3HP9A 2FYKA 3OW2A 2MMPA 4M78D 3CCET 5CQXA 1EIFA 3CXCA 4M7AE 1M1KC 4RMOA 4M7DA 2M0OA 2DD4A 3TCJA 3J81E 2RI3A 2K4YA 3NTHA 4J7FA 2P0QA 3WVDB 3MCAB 5HK0A 2P0KA 2GF7A 2R5AA 2QQ9A 3C94A 2KDSA 4J7IA 3BDLA 4MZPA 5GAMj 1N9RA 3QIIA 5LJ5f 4OB1B 5GAMg 3VUZA 3DKMA 2DD5A 1FWZA 2E41A 4PLLA 3GNFB 3CC2T 3QSUA 1OYXA 2KK4A 4F7UF 3RKXA 2HQXA 2Y4XA 3CCJT 5FRNA 3EFRA 3JCMJ 4BE1A 2OTJT 3QYGB 1WJRA 1TH7A 4MZTA 3CCMA 1K9MC 3CXCS 1M1KU 1BKBA 4M75E 4J6WA 4XU1A 3UT1A 3BFMA 5GAOq 2M9UA 3JCMX 3EAEA 4N4HA 1YBYA 1VQPA 2DZ9A 5CKDA 3JCMe 1I5LA 2WSEE 3OYDA 1KQSS 1JJ2A 2K2VA 4XTZA 4C92A 3L2VA 4JJNK 1MGQA 4N4IA 2QTXA 2XDBA 3L42A 3L2QA 2ZPGB 3J7AF 3OBYA 4C8QE 2QA4T 4OB3B 1BI0A 3G71A 3LX7A 1YITA 5LJ3e 5A0DA 1Y96A 4FT2A 1VQ8A 1RI0A 4LD6A 4PLIA 3HFNA 5LJ3d 3M4GA 2M16A 4HT8A 5GAOn 3CCUT 3ASKA 1UGPB 5J39A 3E9FA 5GANf 2G3RA 5L8RE 2IVWA 2YLBA 4PL6A 2QDYB 1M9SA 4IUVA 4A53A 1K9MU 3JB9J 1XTDA 3QBYA 1HXDA 2L3RA 2RJFA 4BDZA 3NTKA 2HNIA 5GAN4 5IT9E 2LT1A 2K5FA 4O6JA 4QVZA 4M7DE 2VXEA 3PFSA 1Q7YC 4TVRA 5CAIA 5CKBA 2OTLT 4RCCA 1WPYA 5CR2A 2K3XA 3SD4A 4X34A 1JJ2S 1BI1A 5CKFA 4KULA 4J83A 1M5Q1 1MHNA 4OVAA 3DB3A 1Q82C 1I8FA 3BDUA 4NOYA 5GAOp 4HT9A 3OYFA 3CCJA 3M56A 2YLCA 2MF2A 3UWNA 1VQOT 3I55T 3NFCA 1VQLA 3JB9D 4LDUA 1DJ7B 4M77E 1O9SA 4F7UG 2K57A 3GNGA 1SSFA 1VUBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DXU A;  4M77 D;  3RUX A;  3SB2 A;  5GAN h;  2I2L A;  3AHU A;  1WQW A;  4C92 F;  5GAN 2;  4M75 B;  2CGH A;  4N0A A;  4F7U B;  4XTX A;  5LJ5 d;  3JCM P;  1B34 A;  5GAN e;  3BW1 A;  4M7D C;  4EMK C;  1BIA A;  3JCM V;  3RKY A;  4A54 A;  5GMK l;  2RM4 A;  4M78 A;  3SWN A;  4C8Q G;  1X01 A;  4XU3 A;  5GAN d;  1WQ7 A;  4M75 A;  2DTI A;  4C92 E;  4JRI A;  3QUI A;  4C8Q B;  1U1T A;  1LOJ A;  2DJZ A;  1KQ1 A;  4C92 D;  5GMK j;  4QVC A;  1M8V A;  1WNL A;  2E65 A;  4JLI A;  1KQ2 A;  2DXT A;  4XQ3 A;  3V7C A;  4M78 F;  2DKG A;  4M77 C;  5GMK h;  4PJO A;  3EFS A;  3BY7 A;  5DY9 A;  4M7A F;  4XTV A;  4M7D G;  2DTO A;  5GMK e;  2EJ9 A;  5GAM f;  4HA8 A;  2DZC A;  4X9C A;  5GAM h;  2ZGW A;  1N9S A;  4M7D B;  4M78 E;  4MML A;  4EMK B;  4XTY A;  5I21 A;  2DTH A;  2FYK A;  2Y90 A;  3JCM f;  4XTW A;  4X9D A;  4M78 D;  4M7A E;  3JB9 H;  3L1A A;  2EJG A;  4C92 C;  4M7D A;  4M7A D;  4EMK A;  3JB9 G;  4PJO F;  4F7U A;  1JBM A;  5LJ3 f;  4M77 G;  3HSB A;  5GAN 3;  3GIB A;  3QO3 A;  4XU2 A;  4NL2 A;  4XU0 A;  3HFO A;  4NL3 A;  5GAM j;  1HK9 A;  1N9R A;  4M77 B;  5LJ5 f;  5GAO l;  5GAM g;  4C8Q A;  4M7D D;  4PJO D;  2E41 A;  2FB7 A;  4N0A C;  3JCM g;  3INZ A;  4M75 F;  4F7U F;  3QSU A;  3RKX A;  2RA2 A;  4PNO A;  1LJO A;  3EFR A;  4M78 C;  4C92 G;  3SWN C;  3JCM J;  3RER A;  1TH7 A;  4M75 C;  5LJ3 j;  5GAM e;  3JCM h;  4M7A C;  4C92 B;  4M75 E;  4F7U E;  4J6W A;  4XU1 A;  4QVD A;  3BFM A;  4C8Q F;  5LJ3 g;  3JCM X;  5GAO q;  5GAM d;  2DZ9 A;  4M75 D;  1LNX A;  2E10 A;  3JCM e;  1I5L A;  5GMK m;  3QHS A;  5LJ5 j;  3JCM W;  4V2S A;  5LJ5 g;  1Y96 B;  4XTZ A;  4C92 A;  3V8K A;  1MGQ A;  5GAN 5;  2QTX A;  5LJ3 h;  2EWN A;  5GAN 7;  1I81 A;  1D3B B;  5GAO r;  1U1S A;  1YCY A;  4C8Q E;  3JCM Q;  1BIB A;  2EAY A;  3FJP A;  4PJO C;  5LJ3 e;  3L2Z A;  4C8Q D;  2DVE A;  1Y96 A;  5LJ5 h;  2DEQ A;  2EJF A;  3PGG A;  4M78 G;  4PJO E;  3HFN A;  1B34 B;  4MMK A;  3M4G A;  5LJ3 d;  1D3B A;  4M75 G;  5GMK i;  4HT8 A;  3VU3 C;  3JCM c;  5GAO n;  5LJ5 e;  2RD1 A;  4M7A G;  3JB9 I;  4M7D F;  4M78 B;  5GAN f;  3SWN B;  3V7S A;  2E1H A;  2YLB A;  4M77 A;  1H64 1;  4A53 A;  3JB9 J;  4M7A B;  1HXD A;  4PJO B;  4RCB A;  2HNI A;  4WF2 A;  3JCM b;  5GAN 4;  4Y91 A;  2E64 A;  4M7D E;  2VXE A;  5CAI A;  5GAN 6;  4J6X A;  4RCC A;  1WPY A;  4M7A A;  2VC8 A;  4JRK A;  3RKW A;  4PJO G;  3JB9 F;  1M5Q 1;  1I4K 1;  4EMH A;  3V8J A;  4J5Y A;  4EMG A;  4M77 F;  4C8Q C;  1I8F A;  3BDU A;  3JCM d;  2YHT A;  4NOY A;  3RES A;  5GAO p;  4DQ2 A;  4HT9 A;  5GAN j;  2K57 A;  3V7R A;  2JN0 A;  2YLC A;  5GAN g;  4OP0 A;  1JRI A;  3FB9 A;  4XTU A;  2RB6 A;  3JB9 D;  5GAN 8;  4JUV A;  4M77 E;  3RIR A;  5GAO m;  4F7U G;  2VXF A;  4J6Y A;  3V8L A;  3FIF A; 
#chains in the Genus database with same CATH topology
 3RUX A;  3SB2 A;  1NM7 A;  3OYI A;  3M53 A;  1Q81 R;  5IN1 A;  4OMQ A;  2DIL A;  4DOV A;  5KYY B;  1QCF A;  5KYX B;  1W4S A;  1VQM Q;  1U1T A;  4EDU A;  2DA9 A;  4JLI A;  2LMJ A;  3EG2 A;  4XQ3 A;  2ZCF B;  3VRZ A;  4A4H A;  5GMK h;  1SF9 A;  1BCM A;  4LUE A;  2KGT A;  4CRI A;  3I5S A;  4KH1 B;  1UFF A;  3VYH B;  1MMD A;  1VQO A;  4ZTJ A;  2DL5 A;  3LWI A;  1NJI C;  4OMF B;  3M0T A;  3QO3 A;  4DA4 A;  4JZ4 A;  2LCL A;  2HCK A;  1M90 U;  1SHG A;  1AD5 A;  1IXD A;  2BKD N;  1VQ4 A;  4Z88 A;  3HKS A;  4Y92 A;  4M78 C;  3MP8 A;  3EG9 B;  4M75 C;  2O9S A;  4AMC A;  1Q81 C;  2E6Z A;  3JAM E;  1IZ6 A;  2KI7 A;  4LDX A;  2CP5 A;  1PSF A;  5GAM d;  1G3T A;  1VQ7 T;  1K76 A;  4OGC A;  1PKS A;  5FRM A;  3Q1J A;  1U1S A;  1BIB A;  3CME Q;  3S3N A;  4C8Q D;  2IPO B;  3OYY A;  4E7L A;  4MMK A;  1ABQ A;  2JS0 A;  3DLM A;  1CKB A;  5KYU A;  3V7S A;  2X4J A;  2FVU A;  2P0P A;  1K0X A;  3OW2 S;  3JCM b;  4A63 B;  2DXC A;  3NMZ C;  1N8R U;  2EPD A;  2K2M A;  2RHX A;  3DLL A;  3RKW A;  2O4X B;  3BE3 A;  2RQW A;  1UDL A;  2RI2 A;  3CCV T;  1E6H A;  4KGX B;  4DQ2 A;  2C0I A;  2DK3 A;  2A08 A;  2PVO B;  4RTU A;  3OYN A;  1OZ3 A;  5GAN 8;  1M90 R;  3I9Q A;  5I2M A;  2I2L A;  4O5V A;  4C0Z A;  2NUP B;  4WTO B;  4HCZ A;  1ZUU A;  2B8A A;  1OZ2 A;  1KD1 R;  2DTI A;  2V8J A;  3E2U A;  4IUQ A;  3VS0 A;  1ABO A;  1B7T A;  1ZHI A;  2DXT A;  3CC7 T;  2CZ1 B;  1OQK A;  4ME7 A;  1OUL A;  3EFS A;  4M7A F;  4KH0 B;  1AVZ C;  1XNI A;  2CZ7 B;  1T0J A;  1AWW A;  2PU9 B;  3M5A A;  4HCK A;  3TRE A;  5KH6 A;  4EMK B;  2DTH A;  2DJQ A;  2QXF A;  1SRM A;  4LXC A;  2GFA A;  2JTF A;  1N8R R;  3AT1 B;  2MCN A;  2CUB A;  1ZX6 A;  4ZGD B;  4PJO F;  2NWM A;  2E5Q A;  1G2B A;  1WGS A;  4PFZ A;  3MP1 A;  3H0H A;  2C0T A;  1IHW A;  5CQY A;  2CP6 A;  1YHQ A;  4M75 F;  3CPW P;  1QVF P;  2OTL A;  1M90 C;  1LJO A;  3LW5 E;  4C5G A;  2DBM A;  3E1S A;  2YUO A;  4ESR A;  3T9N A;  4F7U E;  4Z02 A;  4HCC A;  1YIT Q;  1VQ6 A;  1ZSG A;  1PRL C;  1KD1 C;  5LJ5 g;  4PFP A;  2RMO A;  1D3B B;  3CD6 T;  1WJQ A;  3MET A;  4CC3 A;  2EIF A;  3PGG A;  5LJ5 h;  2M1H A;  4F04 B;  5GMK i;  1MMA A;  1OX9 A;  3VU3 C;  4M7D F;  2COY A;  3SEM A;  2E1H A;  3CCS A;  2QEX A;  2JVV A;  1H64 1;  2AZV A;  4RCB A;  3A8M B;  2E64 A;  1W70 A;  2ZZD A;  3EGD A;  2L2P A;  3KXT A;  4JZ3 A;  4JRK A;  3CCM T;  1N8R C;  4QT7 A;  2LNH B;  1X6G A;  2KVQ G;  3E19 A;  1ACM B;  1I07 A;  4KGZ B;  1N27 A;  2RF0 A;  8AT1 B;  1VA7 A;  2DXU A;  1WQW A;  2XIC A;  3TVT A;  3QXE B;  1GCQ A;  5I2S A;  2JMA A;  5KYW B;  1P92 A;  4C8Q B;  4ZN3 A;  2EYQ A;  4AG2 C;  2E65 A;  3HHT B;  2MOX A;  1QMC A;  1VQM A;  2CZ6 B;  5D6X A;  1U8R A;  1OV3 A;  2V26 A;  1BCO A;  5FU7 C;  1K0S A;  4ATO A;  2MWO A;  3FJ5 A;  1EFN A;  1NZ9 A;  5KCO A;  2W0Z A;  2H3E B;  2V1Q A;  3L1A A;  1VQ5 Q;  2JNG A;  1TS9 A;  2L3Q A;  2EQK A;  1YJ9 Q;  3UPU A;  4M77 G;  1M1F A;  3MEU A;  3P8H A;  1HK9 A;  5GAO l;  1AWJ A;  2RK2 A;  3JCM g;  4ZGJ B;  1EX4 A;  1X6B A;  4C92 G;  3PMT A;  2C0O A;  1VQN Q;  3RER A;  5J26 A;  3JCM h;  4JS4 A;  2JS2 A;  4QVD A;  5LJ3 g;  3OMC A;  1OI1 A;  2J6K A;  2E3H A;  2KRS A;  3V8K A;  5LJ3 h;  4KGV B;  2QQR A;  3X28 B;  4L59 A;  2DPP B;  1IGU A;  3QJ6 A;  2J6F A;  1KQS P;  1T3S A;  4C0G A;  1KC8 U;  1B34 B;  1QP3 A;  4LN2 A;  3OSV A;  3CME A;  2D1X A;  3EGX B;  3RR6 A;  3CC4 T;  3M59 A;  5CK9 A;  4BI8 B;  4LD9 K;  3PT9 A;  4LDV A;  3D7S B;  1Y7X A;  3MJX A;  3G4S Q;  1JQQ A;  4J9E A;  2J7I A;  5CIU A;  3RES A;  4B6M A;  2CS7 A;  3CCE Q;  3NHN A;  4HVU A;  2JN0 A;  2ATC B;  3LLR A;  1YN8 A;  5GAO m;  2FRW A;  1VYT A;  3G7Z A;  2JTM A;  2KSS A;  3PIP A;  1RAE B;  2RHY A;  4N0A A;  2D6F A;  5GAN e;  2K79 A;  1CSK A;  5AT1 B;  5HCK A;  2YT6 A;  3M58 A;  3FC3 A;  1G3Y A;  2BZ8 A;  1NEG A;  1QLY A;  2QI2 A;  2DET A;  1NG2 A;  1WHK A;  2GGR A;  1WHM A;  3EG3 A;  3G71 T;  2CRE A;  2ZGW A;  2L3S A;  1Q7Y R;  4M78 D;  5CQX A;  3CXC A;  3CCU Q;  4RMO A;  2DD4 A;  4X1V A;  2K4Y A;  1Q82 R;  1BB9 A;  4J9I A;  4J7F A;  1R77 A;  3WVD B;  5HK0 A;  4PFO A;  2RQR A;  2EYY A;  4MZP A;  5GAM j;  1FMW A;  3TSZ A;  4F7U F;  2HQX A;  2M02 A;  4R0K A;  1GCQ C;  5FRN A;  3EFR A;  2QDL A;  4MZT A;  2VWF A;  1Z9Z A;  3I55 Q;  3CXC S;  1M1K U;  1ARK A;  4J6W A;  4XU1 A;  1TWB A;  1WX6 A;  2M9U A;  2DZ9 A;  2ENM A;  1TXQ A;  1VQK Q;  4C92 A;  3L2V A;  2QTX A;  2XDB A;  1F1B B;  1MNE A;  1BI0 A;  1YIT A;  5A0D A;  4FT2 A;  3HFN A;  5LJ3 d;  2DX1 A;  5GAO n;  1K9M U;  1M9S A;  3JB9 J;  1RAA B;  1HXD A;  3CCL Q;  2RN8 A;  5IT9 E;  4O6J A;  3EHQ A;  1Q7Y C;  2OTL T;  4TVR A;  4RCC A;  5CR2 A;  4FYX B;  3OW2 P;  5CKF A;  1MMN A;  4J83 A;  1M5Q 1;  1Q82 C;  4NOY A;  3UWN A;  2E4H A;  4E7S A;  3JB9 D;  4M77 E;  1SSF A;  1VUB A;  4IIM A;  3EH1 A;  5DLO A;  4B9W A;  2K5L A;  2NLU A;  3A98 A;  2CT3 A;  2EYX A;  1RI9 A;  2QEX T;  1QWE A;  4C92 E;  3I56 T;  3CBM A;  2DJZ A;  3DB4 A;  5GMK j;  3LWH A;  4OF1 A;  2EQM A;  3VJP A;  4Z89 A;  2CUD A;  4PJO A;  1R0C B;  2HSE B;  4OB0 B;  4FSX A;  4CI0 C;  4M4Z A;  2VGM A;  3ZBD A;  1K9M R;  1ZA2 B;  3SDZ A;  1YIJ Q;  2LTO A;  4E7I A;  1S72 Q;  1YCS B;  1YI2 T;  2DAQ A;  3OA6 A;  4II1 A;  2COW A;  5GAN 3;  1QVG A;  1VQ5 A;  3GPL A;  2BE7 D;  2HD0 A;  3JV3 A;  3HTR A;  1I1J A;  1ZBX A;  2FB7 A;  2JMC A;  1YJ9 A;  4N0A C;  2YRD A;  2F2V A;  2DBK A;  3OYL A;  2RA2 A;  3P8D A;  4EIK A;  3HL8 A;  1YJN Q;  2DYB A;  1VQM T;  4E6R A;  4JS5 A;  9ATC B;  2VGN A;  1RLP C;  4ZN1 A;  3CMA Q;  1UE9 A;  1U5S A;  3KFV A;  1LNX A;  5IH2 A;  1VQN A;  3CCR T;  2R58 A;  1NJI U;  1QW1 A;  1YWO A;  4GLM A;  1QVG S;  3CBO A;  3CCQ Q;  2LDM A;  2CT4 A;  1HYO A;  4PJO E;  2EJF A;  2CSQ A;  4QW2 A;  2VV5 A;  3VYG A;  4M78 B;  2R5M A;  1Q81 U;  1GCP A;  3QPH A;  4WF2 A;  4QKU A;  1O75 A;  3OYM A;  4E47 A;  2XDD A;  3OYC A;  2VC8 A;  3EGU A;  3X26 B;  2KAF A;  3OMG A;  3G4S A;  4JRQ A;  1V1C A;  4ELZ C;  1Y71 A;  2D9T A;  3CCE A;  3FIF A;  3PVL A;  4PJN A;  3AHU A;  3H0F A;  3OYB A;  2MYS A;  2X4Y A;  2YXY A;  2KE9 A;  2QYZ A;  3SWN A;  4Z8A A;  1WQ7 A;  1WDX A;  1WXB A;  3RMQ A;  5I22 A;  1QCN A;  1X43 A;  2EYZ A;  2KQW A;  2LQW A;  4L6V 5;  1ZQ1 A;  2ZPI B;  1M27 C;  1PD1 A;  4NS5 A;  2LVM A;  3QG1 A;  3G1J A;  2BE9 B;  2DKG A;  1WJS A;  3MO8 A;  2EJ9 A;  5GAM f;  4HA8 A;  3PNW C;  2WSC E;  1WYX A;  2YUN A;  4C0F A;  2HEQ A;  2A3L A;  2IG0 A;  1KK7 A;  2RPN A;  4IUP A;  1NPP A;  3M9Q A;  2HQE A;  3L2U A;  3CCU A;  4XU0 A;  4NL3 A;  3MP6 A;  3GOX A;  3MPU B;  4IKF A;  1FXX A;  3LGF A;  3OS5 A;  3UDC A;  1H92 A;  4PNO A;  1VQP Q;  1BI2 A;  2GQV A;  3WVE B;  2EKH A;  2DNU A;  4M7A C;  2A36 A;  2V8I A;  2E10 A;  5LJ5 j;  2DE0 X;  2X4X A;  3I55 A;  5GAN 7;  2CP3 A;  4PJO C;  3MEA A;  4N4G A;  2E6N A;  1CKA A;  2J05 A;  1VQK A;  1UEB A;  3JB9 I;  2DL3 A;  2AKK A;  3M0U A;  4J9D A;  1UB4 A;  1GBQ A;  3X25 B;  1K73 R;  4A4K A;  3S3O A;  4DEX A;  1M2V A;  5FRO A;  2EVR A;  4OB2 B;  3CCJ Q;  4XK8 E;  1KD1 U;  5A0L A;  3I35 A;  2A0F B;  2W10 A;  2XDP A;  3CCL A;  4M77 F;  1OPK A;  3IQL A;  3PE0 A;  1UGR B;  1WIE A;  2O4X A;  2XI9 A;  5GAN g;  3CQT A;  5IHK A;  3GLX A;  4A4G A;  2K3B A;  4E7K A;  1SHF A;  2D0Q B;  2QA4 Q;  5GAN h;  2CSI A;  4C92 F;  1OOT A;  2HBP A;  2XD0 A;  4M7D C;  2EKO A;  5GJW B;  2L8D A;  3EFO B;  2QQS A;  4IUT A;  5FU6 C;  4C8Q G;  2E5K A;  3PIO A;  2DRK A;  3VRY A;  2GTO A;  1RL2 A;  2X35 A;  3KBG A;  1WHG A;  5A2Q E;  4YTL A;  4DBH A;  4XAX B;  1JEG A;  2F2X A;  4XTV A;  3OS0 A;  1E6G A;  1K73 C;  1SSH A;  3JB9 H;  3FEO A;  3X24 B;  3R6N A;  4EMK A;  3J80 E;  4F7U A;  2LX9 A;  1YIJ A;  1S72 A;  1A0N B;  3HFO A;  4C0D B;  1D09 B;  2VUB A;  5FU7 B;  2XU8 A;  1HD3 A;  2YUP A;  3OYG A;  3SWN C;  1XQH A;  1LVK A;  5LJ3 j;  1IO6 A;  4IIO A;  1YFN A;  4MDX A;  1YJN A;  2XK0 A;  3JCM W;  3CXC P;  2PNI A;  1KHI A;  1X69 A;  3CMA A;  1I81 A;  3JCM Q;  3C0C A;  2JM9 A;  2WSF E;  1D1B A;  3OYJ A;  1NBE B;  2F5K A;  2EYW A;  3A8L B;  4AFS C;  1D3B A;  4DBQ A;  1ZUK A;  3O5Z A;  3CCQ A;  3R6O A;  4GY5 A;  3A8O B;  1YJ9 T;  4A4E A;  3S3M A;  4QQG A;  2MAM A;  4J5Y A;  3V8J A;  3UAT A;  3X20 B;  1VQ7 Q;  4OMP A;  2RK1 A;  2XMF A;  1UEC A;  3EH2 A;  1H8K A;  4BI4 A;  2FL7 A;  2Y4Y A;  3FRN A;  2A28 A;  2HQH A;  4AT1 B;  4J9F A;  3GBQ A;  2L0A A;  5GAN d;  2XID A;  3CC2 Q;  4FYY B;  4LNP A;  2O88 A;  2JT4 A;  1ZUY A;  5FW9 A;  2QAZ A;  3QJY A;  2RNA A;  2OTJ Q;  2O01 E;  4UC4 A;  1KQ2 A;  2DIG A;  5HKC A;  1RAC B;  3L2R A;  3CCV Q;  3G4S T;  3H0I A;  4RTT A;  2COZ A;  2KR3 A;  3HP9 A;  2PTK A;  1YNZ A;  3CCE T;  1EIF A;  5FWC A;  2M0O A;  2MPX C;  2P0Q A;  3MCA B;  4J7I A;  2GF7 A;  2QQ9 A;  1N9R A;  3QII A;  5LJ5 f;  3DKM A;  2DD5 A;  1FWZ A;  2ED0 A;  3QSU A;  1OYX A;  3RKX A;  2Y4X A;  1M30 A;  4OMO A;  3JCM J;  4BE1 A;  3JCM X;  1VQP A;  2LP5 A;  3OYD A;  1W1F A;  4XTZ A;  2GBQ A;  1MGQ A;  1MND A;  2QG9 B;  1ZSZ A;  3J7A F;  4C8Q E;  1PD0 A;  1BU1 A;  4JJD A;  1QVG P;  1PHT A;  2M16 A;  3CCU T;  2YRC A;  1UGP B;  3E9F A;  2G3R A;  1TOV A;  4PL6 A;  1XTD A;  2RJF A;  1VQ9 Q;  5GAN 4;  4QVZ A;  2K5F A;  3PFS A;  1WPY A;  2K3X A;  3SD4 A;  3EGX A;  4D8D A;  4ZNX A;  1MHN A;  2PZ1 A;  3BDU A;  1I5O B;  2DM1 A;  4FSS A;  3CCJ A;  3M56 A;  2MF2 A;  1VQO T;  3I55 T;  3VS5 A;  1O9S A;  1AWO A;  3GNG A;  2B86 A;  4E7J A;  2MIO A;  3CD6 Q;  4AFZ C;  1VQK T;  2NUT A;  5AYF A;  5LJ5 d;  2PVG B;  1G83 A;  1Q7Y U;  1NE8 A;  1X2Q A;  3VV0 A;  1IGQ A;  2QA4 A;  1VQ4 T;  1X01 A;  3KUF A;  2F5T X;  1Q82 U;  5L23 A;  3QUI A;  1NEB A;  1I0C A;  4LE9 A;  2R57 A;  2CH4 A;  2J6O A;  1UGV A;  2JOY A;  1JJ2 P;  1GRI A;  3CCL T;  1K1Z A;  3BY7 A;  4CC4 B;  2AZS A;  3C4S A;  2DL7 A;  4X9C A;  1VIF A;  5C6S A;  4XTY A;  3JCM f;  4BY6 B;  2F69 A;  1KHC A;  1OEB A;  4M7A D;  1UUE A;  2QAS A;  1Y57 A;  2LRQ A;  4PJL A;  3LYI A;  5LJ3 f;  4RTY A;  1RLQ C;  2OAW A;  4D6W A;  4PJO D;  5KE2 A;  1MUZ A;  3OS2 A;  2L5Q A;  3CEY A;  4OMM A;  1ZLM A;  3G6E Q;  4M75 D;  1AHJ B;  1V29 B;  5GJV B;  4PJM A;  3H41 A;  3TEE A;  1W2B A;  1NLP C;  3RMS A;  1R0B G;  4M78 G;  1Q95 G;  4M75 G;  1KSW A;  1SKU B;  2EBP A;  4EPC A;  4FW2 A;  4M77 A;  2LQK A;  2QK0 A;  1HJD A;  2K7A A;  1OPL A;  4FU6 A;  2JM8 A;  4M7D D;  4MZM A;  7AT1 B;  1D1C A;  2H8H A;  1T0H A;  1D0Y A;  1W2B S;  3JCM d;  3M57 A;  1M3B A;  1AT1 B;  1YJN T;  3FDR A;  1W6X A;  2PUK B;  4XTU A;  1JRI A;  1NYF A;  2EQU A;  2DLP A;  3EHR A;  3MHX A;  4HVV A;  1VQ7 A;  1OU8 A;  2CGH A;  2AKL A;  4D8K A;  4BAC A;  2MI6 A;  1YHQ T;  1BIA A;  2ZPB B;  4XU3 A;  2ABL A;  1GL5 A;  4IUU A;  1ZSZ C;  3WXM B;  2ESW A;  1ZA1 B;  2OI3 A;  1LOJ A;  2OX7 A;  3UA6 A;  3N5B B;  3CC4 Q;  3ER0 A;  2JZ2 A;  2V8K A;  3CC2 A;  4FW1 A;  1VQ6 T;  1K9A A;  2OTJ A;  3NPF A;  1TUD A;  5DY9 A;  2DTO A;  5CVI A;  2DMO A;  3H6Z A;  4MML A;  2YWW A;  2FEI A;  3CCV A;  2BTT A;  2LJ1 A;  3OSS C;  1KG1 A;  2RQT A;  2KT1 A;  2PQW A;  3CCS T;  3JB9 G;  1K4U S;  4XU2 A;  2JTE A;  4LUD A;  1KJW A;  2ECZ A;  2D8H A;  2PVD B;  3OB9 A;  1M3C A;  4WCI A;  4RG2 A;  1C6V X;  5KCH A;  2OAU A;  1K8A U;  4HCB A;  1RAH B;  2E70 A;  3RNJ A;  4FCY A;  4C8Q F;  2G6F X;  3G71 Q;  1KIK A;  3QHS A;  3NGP A;  1VQ8 Q;  4LDY A;  3S6W A;  4E2F B;  5GAO r;  2SEM A;  1YCY A;  1QKW A;  2ZPE B;  4J9B A;  2DVE A;  3RBB B;  2DEQ A;  2EGA A;  3JCM c;  2RD1 A;  1JB0 E;  2FHD A;  4M7A B;  2HL3 A;  1VYU A;  4GBQ A;  3F70 A;  1R8O B;  1U06 A;  1QKX A;  4J9G A;  5GAN 6;  1X2K A;  2HDA A;  1VQ9 A;  1VQL Q;  1YP5 A;  4FL6 A;  4DOW A;  4EMH A;  4BD3 A;  4PJO B;  2P84 A;  1VQP T;  2A7Y A;  2FZK B;  4J8O A;  5GAN j;  1RUW A;  2K9G A;  1YJW Q;  2JW4 A;  2K3Y A;  3FB9 A;  1BBZ A;  3M0P A;  2H3J A;  3OYE A;  4P5N A;  3LGL A;  4J6Y A;  2DEU A;  2RHI A;  2ZPF B;  4M75 B;  1LCK A;  1TUC A;  3BW1 A;  1K8A R;  4BE0 A;  1WXU A;  1UHC A;  3RKY A;  3PTA A;  4FYV B;  3H8Z A;  2I0N A;  3CD6 A;  1AZG B;  3HRS A;  1KQS A;  1FMK A;  2VAS A;  1KQ1 A;  2DXB A;  1M1G A;  3ZFJ A;  3M55 A;  1WLP B;  4M77 C;  3OYH A;  2KBT A;  5FWB A;  1TG0 A;  5GAM h;  2CP2 A;  3OBW A;  4KUD K;  1N9S A;  4M7D B;  4M78 E;  4LDW A;  1WXT A;  3ZEH A;  5FU6 B;  2YSQ A;  2X3X D;  2RJE A;  1D0Z A;  4C92 C;  4GLK A;  3CME T;  2XHC A;  2FPE A;  4FM4 B;  2BZY A;  3VS4 A;  3RDV A;  1QVP A;  5KYY A;  5KYX A;  3I56 Q;  2GFU A;  2LT4 A;  3INZ A;  4F16 A;  5A0G A;  1PM3 A;  1K73 U;  2YDL A;  1WHJ A;  2K6D A;  2CKK A;  1K8A C;  4AG1 C;  2YRV A;  4DEY A;  3VKI A;  4V2S A;  1XJW B;  1Y96 B;  5I11 A;  5DM7 R;  4BDY A;  4MDW A;  2K5I A;  2FRY A;  1YI2 Q;  3G6E A;  5DLQ E;  1WI7 A;  1RAG B;  1PRM C;  4IUR A;  4AFU C;  3SWN B;  1QCO A;  3REA B;  1Y07 A;  5IXF A;  2KXC A;  1S1N A;  4JLG A;  2DVJ A;  4RTV A;  4BE2 A;  1D1A A;  4J6X A;  2M0Y A;  3ULR B;  1UJY A;  2KRN A;  2Z0W A;  3EG9 A;  1I4K 1;  3MEW A;  1MV3 A;  1AOJ A;  3CCR Q;  3ME9 A;  3MEV A;  3CPF A;  2HKQ B;  5FLX E;  5IXB A;  3OYK A;  2VXF A;  5IHI A;  2QQB A;  5ECA A;  1E7O A;  5D7U A;  3VS2 A;  1RAF B;  3TSW A;  3M0S A;  1WA7 A;  4A54 A;  4C5I A;  1C0M A;  3EFO A;  1G3W A;  1OU9 A;  2HAX A;  2GCX A;  3CC4 A;  4F17 A;  4ELY C;  1YIT T;  2CH4 W;  2F2W A;  2WAC A;  2GTJ A;  4ORZ A;  4PKC C;  2FYK A;  3OW2 A;  1V76 A;  1HSQ A;  2FZG B;  3TCJ A;  2E3I A;  2NUP A;  4OML A;  2V1R A;  2P0K A;  2QGF B;  3BDL A;  2JJ9 A;  4OB1 B;  3VUZ A;  4PLL A;  3GNF B;  2KRO A;  3CC2 T;  1M2V B;  4PK4 A;  2OTJ T;  1TH7 A;  2X3W D;  2RQV A;  1UG1 A;  2M51 A;  1I5L A;  1SG5 A;  2WSE E;  3L42 A;  3OBY A;  3G71 A;  2LJ0 A;  1QWF A;  5KYU B;  1VQ8 A;  1RI0 A;  2AK5 A;  3ASK A;  5J39 A;  5GAN f;  2YLB A;  4IUV A;  4A53 A;  3H9N A;  2L3R A;  3NTK A;  3A1P A;  1FMV A;  2BZX A;  2VXE A;  2HBW A;  4KUL A;  4OVA A;  3DB3 A;  4J9H A;  1Y0M A;  4HT9 A;  4J9C A;  2YLC A;  1W2B P;  3VS6 A;  1VQL A;  1DJ7 B;  1G8X A;  1VQ5 T;  2X51 A;  2RJD A;  1YJW A;  4F7U B;  4HKE A;  3JCM P;  3OQ5 A;  3JCM V;  5CKH A;  2MWP A;  2RM4 A;  1WZO A;  5KE3 A;  4FYW B;  1M2O A;  4F14 A;  2RHZ A;  2DO3 A;  3NTI A;  3OS1 A;  1X75 C;  2CYZ B;  3QKJ A;  1B07 A;  4C5E A;  3JRZ A;  4E7Z A;  1VQ9 T;  1VQN T;  4ZTF A;  4M78 F;  4VUB A;  2O2O A;  3MKD A;  1NPR A;  2QTV A;  2FPF A;  2Y90 A;  1B3Q A;  2F1L A;  4DBR A;  2ZAE A;  4HVW A;  2D0N A;  2PUO B;  3E9G A;  2JUF A;  2FPD A;  3VUB A;  2DER A;  3C95 A;  4OGE A;  3UA7 A;  2AT1 B;  8ATC B;  3HSB A;  1UGS B;  4QQ6 A;  2EQJ A;  3HRT A;  5KYW A;  4C8Q A;  1UHF A;  1G3S A;  4BB7 A;  2LCC A;  3I56 A;  5EC7 A;  4R55 A;  1G5V A;  5GAM e;  1RAI B;  3GF5 A;  1JXM A;  3CBP A;  2FG0 A;  1PG5 B;  1PC0 A;  2P4R A;  1N6A A;  3QZ5 B;  4RKU E;  2RQU A;  2EWN A;  1Z9Q A;  2RJC A;  1YI2 A;  3UF4 A;  3CC7 Q;  2OJ2 A;  3EGD B;  1X27 A;  3HRU A;  4E7H A;  3QDR B;  2DRM A;  2VVK A;  3VS1 A;  2LX7 A;  3JB9 F;  5EG2 A;  2KMT A;  1UJ0 A;  2ED1 A;  4JDS A;  3QZ9 B;  3M4Y A;  1GXI E;  1Q86 U;  1WFW A;  4OP0 A;  5HK3 A;  4C0D C;  1UTI A;  2RB6 A;  1SPK A;  3PMI A;  2EJG A;  3G6E T;  2KXD A;  1BK2 A;  4M77 D;  1JU5 C;  4A4F A;  2DF6 A;  3EG1 A;  2HZY A;  3HPW A;  3CCR A;  1B34 A;  2DIQ A;  4EMK C;  2E12 A;  3LH0 A;  4Q5W A;  1MV0 B;  3QWX X;  2LQN A;  4C92 D;  2CP7 A;  1BYM A;  4Y28 E;  5KYN A;  1JXO A;  1SRL A;  1IB8 A;  1ZBJ A;  2KY9 A;  4DBF A;  2QGG A;  2EFI A;  2ROL A;  3REB B;  5GMK e;  2D8J A;  4KBM B;  5CCA A;  1M3A A;  1KFZ A;  4XTW A;  1FYN A;  4X9D A;  1ZSZ B;  4JRP A;  1VIE A;  6AT1 B;  3VS3 A;  1JBM A;  1YWP A;  1TTH B;  3L2W A;  3SFM A;  3P8B B;  4BUG A;  3TU4 K;  1Q86 R;  3CCM Q;  2C06 A;  3C12 A;  2RO0 A;  2RHU A;  4RTW A;  4OMN A;  2EW3 A;  4KUI A;  5HY6 A;  4PJJ A;  4RTZ A;  4RG8 A;  4KRT A;  2EAY A;  3LH5 A;  3L2Z A;  2GQI A;  2NUT B;  2KRM A;  5LL6 S;  2J06 A;  4C5H A;  5D6W A;  3A8H B;  4M7A G;  5M9O A;  4B9X A;  1AZE A;  2P4T A;  2XG8 D;  2KT8 A;  1RAD B;  5IAY A;  1WHL A;  4PJO G;  5C0M A;  4C8Q C;  1LPL A;  2YHT A;  1GBR A;  2NUZ A;  1KC8 R;  1YIJ T;  5CO7 A;  1Q86 C;  4JUV A;  3RIR A;  3THK A;  1S72 T;  2FZC B;  1VQ8 T;  4XTX A;  1PWT A;  3OY9 A;  2HSP A;  2VKN A;  5GMK l;  2O9V A;  1J3T A;  3URG A;  4JRI A;  2RI5 A;  1QP2 A;  1TSF A;  1M8V A;  3JSC A;  1BI3 A;  1OX8 A;  1EZZ B;  1NYG A;  3VS7 A;  2AHJ B;  2KYB A;  2QQA A;  3CPW A;  1QVF A;  4HXJ A;  3V7C A;  1M4Z A;  3CMA T;  4M7D G;  3I5R A;  2A37 A;  2KEA A;  2XKO C;  1AEY A;  1VQL T;  1VQO Q;  3M0R A;  5CKE A;  5I21 A;  2LQ8 A;  2CP0 A;  3CCQ T;  1YJW T;  3A5Z B;  2RH2 A;  5D6Y A;  4R56 A;  2L89 A;  3GIB A;  4NL2 A;  1VQ4 Q;  3CPW S;  1QVF S;  2IIM A;  3TQ7 P;  1PKT A;  4M77 B;  4L5G A;  2LC4 A;  1KC8 C;  5J3B A;  3OYA A;  4KT0 E;  4ANJ A;  1UGQ B;  2MK5 A;  4CC7 A;  2X9H A;  1QQJ A;  4BI3 A;  1PNJ A;  1H3Z A;  4C92 B;  3QWY A;  2VB6 A;  3A8G B;  1RAB B;  5GMK m;  5GAN 5;  5IHN A;  1PSE A;  3FJP A;  1FX7 A;  2JXB A;  2EGE A;  1IHV A;  5LJ5 e;  4QQD A;  3M54 A;  4FT4 A;  1XOV A;  4JJC A;  3QYH B;  1M1K R;  4Y91 A;  4BY6 C;  1MMG A;  4M7A A;  4RTX A;  3CC7 A;  2LNV A;  2BIV A;  1JO8 A;  3U23 A;  4FIB A;  1GFC A;  4EMG A;  2CDT A;  4ZGE B;  3SHW A;  2L3P A;  2GNC A;  3EG0 A;  2ZPH B;  3V7R A;  2VYT A;  4JJB A;  2LZ6 B;  2ROT A;  1X6O A;  2CZ0 B;  3FLG A;  3PVQ A;  3GP8 A;  3V8L A;  1C1A A;  5GAN 2;  1T3L A;  2EQI A;  1M8M A;  1WHH A;  4M78 A;  4RUG A;  2BUD A;  4M75 A;  4AFQ C;  2EGC A;  1TU0 B;  4QVC A;  1WNL A;  3O8V A;  4CC2 A;  2NYS A;  2DL4 A;  1IRE B;  2X4W A;  2FO0 A;  2DZC A;  2HL5 C;  2MMP A;  3ZL7 C;  1VYV A;  4M7A E;  1M1K C;  1D0X A;  1AWX A;  4M7D A;  3J81 E;  2RI3 A;  1GFD A;  3NTH A;  2LJ3 A;  1YHQ Q;  1U3O A;  1NLO C;  2R5A A;  2HMA A;  3C94 A;  2OTL Q;  2KDS A;  1SEM A;  5GAM g;  1IRX A;  2E41 A;  2KK4 A;  2DFU A;  3CCJ T;  2DL8 A;  1VQ6 Q;  3QYG B;  1WJR A;  3CCM A;  1K9M C;  2LCS A;  2HKN A;  1BKB A;  4M75 E;  3UT1 A;  3BFM A;  5GAO q;  3EAE A;  4N4H A;  1YBY A;  5CKD A;  2O31 A;  3JCM e;  1KQS S;  1JJ2 A;  2K2V A;  4JJN K;  4N4I A;  1TUG B;  2KNB B;  1VOM A;  3L2Q A;  2ZPG B;  2QA4 T;  4OB3 B;  2SRC A;  3LX7 A;  5LJ3 e;  3CCS Q;  2QEX Q;  1Y96 A;  4LD6 A;  4PLI A;  3M4G A;  4HT8 A;  4K11 A;  5L8R E;  2IVW A;  2QDY B;  1N5Z A;  3QBY A;  4BDZ A;  2HNI A;  2LT1 A;  2DYI A;  4M7D E;  2KYM A;  5CAI A;  5CKB A;  2AIR B;  1JJ2 S;  4X34 A;  1BI1 A;  1PCX A;  1NJI R;  1H3H A;  1I8F A;  4JPB W;  5GAO p;  3QDF A;  3OYF A;  3M0Q A;  3NFC A;  4LDU A;  2YUQ A;  4F7U G;  2K57 A; 
#chains in the Genus database with same CATH homology
 2RJD A;  3RUX A;  3SB2 A;  4B9W A;  2K5L A;  5DLO A;  4E7J A;  1YJW A;  3OYI A;  2NLU A;  5AYF A;  4HKE A;  4F7U B;  5LJ5 d;  3M53 A;  2PVG B;  3JCM P;  5IN1 A;  1Q7Y U;  1NE8 A;  3OQ5 A;  3VV0 A;  3JCM V;  5CKH A;  2MWP A;  2RM4 A;  2QA4 A;  1VQ4 T;  1X01 A;  3KUF A;  2F5T X;  4DOV A;  5KE3 A;  2QEX T;  4C92 E;  3I56 T;  1W4S A;  3CBM A;  1Q82 U;  2RHZ A;  3QUI A;  1U1T A;  2DJZ A;  2DO3 A;  2R57 A;  3DB4 A;  3NTI A;  4EDU A;  5GMK j;  3OS1 A;  1X75 C;  2CYZ B;  3QKJ A;  4JLI A;  3LWH A;  4OF1 A;  2EQM A;  2JOY A;  3JRZ A;  4C5E A;  3VJP A;  4XQ3 A;  1VQ9 T;  1VQN T;  3CCL T;  4ZTF A;  2ZCF B;  4M78 F;  4VUB A;  4A4H A;  5GMK h;  4PJO A;  3BY7 A;  3C4S A;  4OB0 B;  4FSX A;  4CI0 C;  4X9C A;  1VIF A;  1NPR A;  2VGM A;  5C6S A;  3ZBD A;  4XTY A;  3SDZ A;  2LTO A;  2Y90 A;  3JCM f;  4CRI A;  4BY6 B;  2F69 A;  1KHC A;  4E7I A;  2PUO B;  3VYH B;  3E9G A;  1YI2 T;  4M7A D;  2JUF A;  1VQO A;  2LRQ A;  3VUB A;  2DAQ A;  4ZTJ A;  3LYI A;  3C95 A;  4OGE A;  3OA6 A;  4II1 A;  5LJ3 f;  3LWI A;  1NJI C;  4OMF B;  5GAN 3;  3QO3 A;  1QVG A;  1UGS B;  4DA4 A;  1VQ5 A;  3HSB A;  4QQ6 A;  3GPL A;  2EQJ A;  3HRT A;  2LCL A;  2HD0 A;  4C8Q A;  4D6W A;  1G3S A;  1YJ9 A;  1ZBX A;  2FB7 A;  5KE2 A;  1M90 U;  4N0A C;  4PJO D;  3OS2 A;  2BKD N;  4BB7 A;  2L5Q A;  2RA2 A;  3CEY A;  3P8D A;  2LCC A;  3OYL A;  1VQ4 A;  3HL8 A;  3HKS A;  3I56 A;  4M78 C;  1VQM T;  3MP8 A;  4R55 A;  4JS5 A;  2VGN A;  4M75 C;  4ZN1 A;  1G5V A;  5GAM e;  1Q81 C;  2E6Z A;  3JAM E;  1IZ6 A;  3GF5 A;  4LDX A;  1PSF A;  5GAM d;  3CBP A;  4M75 D;  1G3T A;  1LNX A;  1VQ7 T;  1AHJ B;  1VQN A;  3QZ5 B;  1N6A A;  3CCR T;  4OGC A;  2R58 A;  4RKU E;  1QW1 A;  1V29 B;  1NJI U;  1QVG S;  3TEE A;  5FRM A;  2EWN A;  3CBO A;  3Q1J A;  1W2B A;  1U1S A;  2LDM A;  1BIB A;  3RMS A;  3S3N A;  4C8Q D;  4PJO E;  2EJF A;  4M78 G;  3OYY A;  4E7L A;  4MMK A;  4QW2 A;  4M75 G;  2RJC A;  3DLM A;  2VV5 A;  3VYG A;  4M78 B;  1YI2 A;  3V7S A;  4EPC A;  4M77 A;  2X4J A;  2FVU A;  2LQK A;  2P0P A;  2R5M A;  3HRU A;  1Q81 U;  3QPH A;  3OW2 S;  3JCM b;  4WF2 A;  2DXC A;  1O75 A;  3OYM A;  1N8R U;  4FU6 A;  4E47 A;  4E7H A;  3QDR B;  2XDD A;  2RHX A;  4M7D D;  4MZM A;  3OYC A;  3DLL A;  2VC8 A;  3RKW A;  3JB9 F;  5EG2 A;  2O4X B;  2KMT A;  3X26 B;  1W2B S;  3JCM d;  2RI2 A;  2KAF A;  3M57 A;  3CCV T;  4JDS A;  3QZ9 B;  1YJN T;  4DQ2 A;  2DK3 A;  3M4Y A;  2PVO B;  3FDR A;  3OMG A;  1GXI E;  1Q86 U;  2PUK B;  3G4S A;  4OP0 A;  1JRI A;  4XTU A;  5HK3 A;  4C0D C;  4JRQ A;  2RB6 A;  4ELZ C;  3OYN A;  1OZ3 A;  5GAN 8;  2EQU A;  1Y71 A;  2D9T A;  3PMI A;  2EJG A;  3G6E T;  3CCE A;  3FIF A;  3MHX A;  4M77 D;  5I2M A;  4A4F A;  2I2L A;  1VQ7 A;  3AHU A;  3OYB A;  3HPW A;  4O5V A;  2CGH A;  4C0Z A;  3CCR A;  1B34 A;  4BAC A;  2MI6 A;  2X4Y A;  2DIQ A;  4HCZ A;  1YHQ T;  4EMK C;  1BIA A;  2E12 A;  3LH0 A;  2B8A A;  2ZPB B;  1OZ2 A;  4Q5W A;  4XU3 A;  3SWN A;  1WQ7 A;  4IUU A;  2DTI A;  3RMQ A;  3WXM B;  2V8J A;  4IUQ A;  2KQW A;  1LOJ A;  4C92 D;  1BYM A;  4Y28 E;  4L6V 5;  1ZHI A;  1ZQ1 A;  3N5B B;  3ER0 A;  2ZPI B;  2JZ2 A;  2KY9 A;  2V8K A;  4NS5 A;  3CC2 A;  2DXT A;  2LVM A;  3CC7 T;  2CZ1 B;  1VQ6 T;  4ME7 A;  3QG1 A;  2DKG A;  2OTJ A;  1WJS A;  2EFI A;  3EFS A;  5DY9 A;  4M7A F;  1XNI A;  2DTO A;  5CVI A;  2CZ7 B;  3MO8 A;  5GMK e;  2EJ9 A;  3H6Z A;  4HA8 A;  2PU9 B;  3M5A A;  4KBM B;  3TRE A;  5GAM f;  3PNW C;  5CCA A;  5KH6 A;  4MML A;  4EMK B;  2WSC E;  2DTH A;  4XTW A;  4X9D A;  3CCV A;  4C0F A;  2QXF A;  2A3L A;  2IG0 A;  4JRP A;  2GFA A;  2JTF A;  3OSS C;  1KG1 A;  3CCS T;  1VIE A;  2PQW A;  4IUP A;  4ZGD B;  4PJO F;  3JB9 G;  1NPP A;  1JBM A;  2E5Q A;  3M9Q A;  2HQE A;  1WGS A;  3L2W A;  4XU2 A;  3L2U A;  3CCU A;  4XU0 A;  3MP1 A;  4NL3 A;  3SFM A;  3P8B B;  2PVD B;  4BUG A;  3TU4 K;  3MP6 A;  3GOX A;  3OB9 A;  5CQY A;  4IKF A;  1FXX A;  3LGF A;  3OS5 A;  3UDC A;  4RG2 A;  1YHQ A;  2C06 A;  4M75 F;  2OTL A;  1M90 C;  3C12 A;  4PNO A;  1LJO A;  1BI2 A;  2RO0 A;  3LW5 E;  4C5G A;  5KCH A;  2GQV A;  3WVE B;  3E1S A;  2OAU A;  1K8A U;  4HCB A;  2E70 A;  2RHU A;  3T9N A;  4M7A C;  4F7U E;  4KUI A;  5HY6 A;  4Z02 A;  4C8Q F;  4HCC A;  2V8I A;  4RG8 A;  2E10 A;  1VQ6 A;  3QHS A;  5LJ5 j;  2X4X A;  1KD1 C;  5LJ5 g;  4LDY A;  3I55 A;  3S6W A;  5GAN 7;  5GAO r;  1D3B B;  1YCY A;  2EAY A;  3CD6 T;  4PJO C;  1WJQ A;  2ZPE B;  3L2Z A;  3MEA A;  2DVE A;  3MET A;  4N4G A;  2E6N A;  5LJ5 h;  2DEQ A;  2EIF A;  3PGG A;  2M1H A;  5LL6 S;  1VQK A;  5GMK i;  3VU3 C;  3JCM c;  5D6W A;  4C5H A;  2RD1 A;  1UEB A;  3A8H B;  3JB9 I;  4M7A G;  4M7D F;  5M9O A;  4B9X A;  2E1H A;  3CCS A;  2QEX A;  2JVV A;  2P4T A;  1H64 1;  2XG8 D;  1UB4 A;  1JB0 E;  2FHD A;  4M7A B;  3X25 B;  4RCB A;  3A8M B;  4A4K A;  5IAY A;  3S3O A;  3F70 A;  2E64 A;  1R8O B;  5FRO A;  2ZZD A;  4OB2 B;  5GAN 6;  4XK8 E;  3KXT A;  4JRK A;  3CCM T;  1N8R C;  4PJO G;  1KD1 U;  5A0L A;  1VQ9 A;  4FL6 A;  2XDP A;  4DOW A;  5C0M A;  4EMH A;  3CCL A;  4BD3 A;  4M77 F;  4C8Q C;  4PJO B;  1VQP T;  2YHT A;  2A7Y A;  1UGR B;  4J8O A;  5GAN j;  2O4X A;  2XI9 A;  5GAN g;  2K3Y A;  2KVQ G;  3E19 A;  3FB9 A;  3GLX A;  4A4G A;  1YIJ T;  2H3J A;  5CO7 A;  1N27 A;  4P5N A;  3OYE A;  4E7K A;  4JUV A;  1Q86 C;  3RIR A;  3LGL A;  2D0Q B;  1S72 T;  4J6Y A;  2DXU A;  5GAN h;  2RHI A;  1VQ8 T;  1WQW A;  2XIC A;  2HBP A;  2ZPF B;  4C92 F;  4M75 B;  4XTX A;  2XD0 A;  3BW1 A;  4BE0 A;  4M7D C;  2EKO A;  3OY9 A;  3QXE B;  2L8D A;  5GMK l;  2QQS A;  4IUT A;  5FU6 C;  3RKY A;  4C8Q G;  3PTA A;  5I2S A;  3H8Z A;  3PIO A;  3CD6 A;  2X35 A;  1RL2 A;  3HRS A;  3URG A;  4JRI A;  2RI5 A;  1QP2 A;  1P92 A;  4C8Q B;  1KQS A;  4ZN3 A;  1KQ1 A;  2DXB A;  1M8V A;  3JSC A;  1BI3 A;  2EYQ A;  3KBG A;  2E65 A;  2AHJ B;  2QQA A;  3HHT B;  1M1G A;  3ZFJ A;  3CPW A;  5A2Q E;  1QVF A;  4YTL A;  3V7C A;  3M55 A;  1VQM A;  2CZ6 B;  4XAX B;  4M77 C;  1M4Z A;  5D6X A;  3OYH A;  1U8R A;  3CMA T;  4M7D G;  5FU7 C;  4XTV A;  4ATO A;  2MWO A;  5GAM h;  2XKO C;  1NZ9 A;  3OBW A;  3OS0 A;  4KUD K;  1N9S A;  1VQL T;  4M7D B;  4M78 E;  4LDW A;  3ZEH A;  5CKE A;  5I21 A;  5FU6 B;  5KCO A;  2LQ8 A;  2RJE A;  3CCQ T;  1K73 C;  3JB9 H;  3L1A A;  3FEO A;  1YJW T;  2JNG A;  4C92 C;  4GLK A;  3X24 B;  2XHC A;  3CME T;  4EMK A;  1VQK T;  2EQK A;  3A5Z B;  4F7U A;  3J80 E;  2LX9 A;  2RH2 A;  1YIJ A;  5D6Y A;  4R56 A;  4FM4 B;  3UPU A;  2L89 A;  4M77 G;  3GIB A;  1S72 A;  1QVP A;  4NL2 A;  3HFO A;  3CPW S;  1QVF S;  1M1F A;  3MEU A;  3P8H A;  4C0D B;  1HK9 A;  5GAO l;  4M77 B;  2RK2 A;  2VUB A;  4L5G A;  5FU7 B;  2GFU A;  2LT4 A;  2LC4 A;  2XU8 A;  1KC8 C;  3JCM g;  3INZ A;  5J3B A;  3OYA A;  4KT0 E;  4ZGJ B;  1UGQ B;  3OYG A;  4C92 G;  5A0G A;  3PMT A;  3SWN C;  1XQH A;  3RER A;  4BI3 A;  1K73 U;  5J26 A;  5LJ3 j;  3JCM h;  4JS4 A;  1H3Z A;  4C92 B;  4QVD A;  5LJ3 g;  1K8A C;  2CKK A;  3OMC A;  4MDX A;  1OI1 A;  2YRV A;  1YJN A;  3A8G B;  2XK0 A;  5GMK m;  3VKI A;  3JCM W;  4V2S A;  1Y96 B;  1KHI A;  5DM7 R;  4BDY A;  3V8K A;  5GAN 5;  3CMA A;  4MDW A;  2K5I A;  5LJ3 h;  1I81 A;  2QQR A;  3JCM Q;  3X28 B;  4L59 A;  2DPP B;  1PSE A;  3FJP A;  5DLQ E;  2WSF E;  3QJ6 A;  3G6E A;  1FX7 A;  3OYJ A;  4C0G A;  1KC8 U;  2F5K A;  1B34 B;  3A8L B;  1QP3 A;  1D3B A;  4IUR A;  3CCQ A;  5LJ5 e;  3R6O A;  4QQD A;  4GY5 A;  3SWN B;  3OSV A;  3A8O B;  3CME A;  1Y07 A;  3M54 A;  1YJ9 T;  4FT4 A;  1XOV A;  3QYH B;  4JLG A;  4Y91 A;  4A4E A;  3CC4 T;  3M59 A;  4BE2 A;  5CK9 A;  4BI8 B;  4BY6 C;  4LD9 K;  3PT9 A;  1VQ5 T;  4J6X A;  4LDV A;  4M7A A;  1Y7X A;  3CC7 A;  2LNV A;  3S3M A;  2BIV A;  1I4K 1;  4QQG A;  4FIB A;  2MAM A;  4J5Y A;  5CIU A;  3V8J A;  3MEW A;  4EMG A;  3RES A;  4ZGE B;  2CS7 A;  3V7R A;  2JN0 A;  2ZPH B;  3X20 B;  2VYT A;  2RK1 A;  3ME9 A;  1X6O A;  2CZ0 B;  3FLG A;  3LLR A;  3MEV A;  3GP8 A;  3CPF A;  5FLX E;  5GAO m;  3OYK A;  2VXF A;  3G7Z A;  3V8L A;  2JTM A;  2KSS A;  2FL7 A;  2QQB A;  2Y4Y A;  3FRN A;  4BI4 A;  3PIP A;  5GAN 2;  2RHY A;  4N0A A;  2D6F A;  5GAN e;  4A54 A;  4M78 A;  5GAN d;  2XID A;  2BUD A;  4C5I A;  4M75 A;  3QJY A;  2O01 E;  4QVC A;  4UC4 A;  3M58 A;  1G3W A;  1WNL A;  3O8V A;  1KQ2 A;  3FC3 A;  2DIG A;  1G3Y A;  5HKC A;  2HAX A;  3L2R A;  2GCX A;  2QI2 A;  3CC4 A;  1IRE B;  2X4W A;  4ELY C;  3G4S T;  3G71 T;  1YIT T;  2DZC A;  2WAC A;  2ZGW A;  4PKC C;  3HP9 A;  2FYK A;  3OW2 A;  2MMP A;  4M78 D;  3CCE T;  5CQX A;  1EIF A;  3CXC A;  4M7A E;  1M1K C;  4RMO A;  4M7D A;  2M0O A;  2DD4 A;  3TCJ A;  3J81 E;  2RI3 A;  2K4Y A;  3NTH A;  4J7F A;  2P0Q A;  3WVD B;  3MCA B;  5HK0 A;  2P0K A;  2GF7 A;  2R5A A;  2QQ9 A;  3C94 A;  2KDS A;  4J7I A;  3BDL A;  4MZP A;  5GAM j;  1N9R A;  3QII A;  5LJ5 f;  4OB1 B;  5GAM g;  3VUZ A;  3DKM A;  2DD5 A;  1FWZ A;  2E41 A;  4PLL A;  3GNF B;  3CC2 T;  3QSU A;  1OYX A;  2KK4 A;  4F7U F;  3RKX A;  2HQX A;  2Y4X A;  3CCJ T;  5FRN A;  3EFR A;  3JCM J;  4BE1 A;  2OTJ T;  3QYG B;  1WJR A;  1TH7 A;  4MZT A;  3CCM A;  1K9M C;  3CXC S;  1M1K U;  1BKB A;  4M75 E;  4J6W A;  4XU1 A;  3UT1 A;  3BFM A;  5GAO q;  2M9U A;  3JCM X;  3EAE A;  4N4H A;  1YBY A;  1VQP A;  2DZ9 A;  5CKD A;  3JCM e;  1I5L A;  2WSE E;  3OYD A;  1KQS S;  1JJ2 A;  2K2V A;  4XTZ A;  4C92 A;  3L2V A;  4JJN K;  1MGQ A;  4N4I A;  2QTX A;  2XDB A;  3L42 A;  3L2Q A;  2ZPG B;  3J7A F;  3OBY A;  4C8Q E;  2QA4 T;  4OB3 B;  1BI0 A;  3G71 A;  3LX7 A;  1YIT A;  5LJ3 e;  5A0D A;  1Y96 A;  4FT2 A;  1VQ8 A;  1RI0 A;  4LD6 A;  4PLI A;  3HFN A;  5LJ3 d;  3M4G A;  2M16 A;  4HT8 A;  5GAO n;  3CCU T;  3ASK A;  1UGP B;  5J39 A;  3E9F A;  5GAN f;  2G3R A;  5L8R E;  2IVW A;  2YLB A;  4PL6 A;  2QDY B;  1M9S A;  4IUV A;  4A53 A;  1K9M U;  3JB9 J;  1XTD A;  3QBY A;  1HXD A;  2L3R A;  2RJF A;  4BDZ A;  3NTK A;  2HNI A;  5GAN 4;  5IT9 E;  2LT1 A;  2K5F A;  4O6J A;  4QVZ A;  4M7D E;  2VXE A;  3PFS A;  1Q7Y C;  4TVR A;  5CAI A;  5CKB A;  2OTL T;  4RCC A;  1WPY A;  5CR2 A;  2K3X A;  3SD4 A;  4X34 A;  1JJ2 S;  1BI1 A;  5CKF A;  4KUL A;  4J83 A;  1M5Q 1;  1MHN A;  4OVA A;  3DB3 A;  1Q82 C;  1I8F A;  3BDU A;  4NOY A;  5GAO p;  4HT9 A;  3OYF A;  3CCJ A;  3M56 A;  2YLC A;  2MF2 A;  3UWN A;  1VQO T;  3I55 T;  3NFC A;  1VQL A;  3JB9 D;  4LDU A;  1DJ7 B;  4M77 E;  1O9S A;  4F7U G;  2K57 A;  3GNG A;  1SSF A;  1VUB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...