3JB9k

Cryo-em structure of the yeast spliceosome at 3.6 angstrom resolution
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
89
structure length
89
Chain Sequence
TLYVNNLNDKINKNDLRTALYMLFSTYGTVVDIVALKTPKMRGQAHVVFFDPSAAAIAMKALKNFIFFGKEMKIQYAHSKSKIIERIVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a yeast spliceosome at 3.6-angstrom resolution
pubmed doi rcsb
molecule tags Rna binding protein/rna
molecule keywords Pre-mRNA-splicing factor spp42
total genus 22
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2015-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
k PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3jb9k00
3THPA 2X1AA 2GHPA 2CPFA 1F9FA 4PR6A 2DITA 4WFNQ 3S8SA 4TLQA 3MUTP 2G4BA 2DNRA 2HGMA 4Y0FA 1VBZA 2DNHA 5LSOA 3EGZA 2FC9A 1M5VC 2DNLA 4PRFA 1WEZA 2HVZA 2DGTA 5CA5A 3NNHA 1R8HA 1ZZNA 2JX2A 5LSLA 2DISA 2U1AA 1A7GE 2M8DB 1SJRA 2DNPA 2Q79A 3MDFA 2A3JA 2HGNA 2KVIA 2KXHA 2M9KA 1OO0B 2EK6A 2MY7A 1VQ8S 2K3KA 1BY9A 1WF1A 2DGOA 1WG5A 2MSSA 2WBRA 2KHCA 2MZSA 2MQNA 3SXLA 1VQLS 3S7RA 1K9MT 1S79A 1HL6A 1G2EA 2D9OA 2RS2A 2AYGA 2J0SD 3CMAS 1CVJA 2AYEA 3CCES 3TP2A 2MSTA 3D2WA 1HD1A 2B0GA 2QA4S 1VQMS 1YJWS 1UAWA 2MGZB 4OZ1A 1Q82T 1H6KX 2L08A 1HD0A 2J8AA 3VAJA 2ADCA 2CQGA 2M88A 4WFAQ 1VC5A 1FXLA 3CCRS 4C4WA 2O3DA 2F9JA 2XNRA 1U1MA 4QU6A 5D78A 2X1FA 3UCUP 2FPHX 4U67Q 1UFWA 4YUDA 2DO4A 4PKDB 5DM6Q 3NS6A 2M8HA 2CQ4A 3N9UC 1WHVA 2RU3A 1U1OA 2CPDA 1YHQS 2KG0A 1WHXA 3DXBA 1N52B 2DNNA 3U1MA 2QFJA 1FJ7A 2MQLA 2CQBA 2SXLA 2DGWA 3CMES 5DETA 1U2FA 5DDRC 1X4GA 3G6ES 5IM0A 1FT8A 3US5A 3IWNC 1QVFR 2L41A 4Y00A 3B4MA 1Q81T 4RU2A 3UCGA 3I55S 3BO4A 1WWHA 2ZJPQ 4W92B 5DDOC 2DO0A 4ED5A 3VAIA 3CC7S 1QM9A 5LXYA 1X0FA 1X4BA 1RKJA 2GO9A 4ZKAA 4IOAQ 3OW2R 1H2TZ 2LA4A 2PE8A 3VAFA 3JB9k 2AD9A 2HYIB 1SJFA 2KM8B 2DH8A 2L9WA 3R27A 2N3OA 2FHOB 1H2UX 2KFYA 3VAKA 2DNOA 3CCUS 2LA6A 1L3KA 2MZRA 3G71S 3R1LA 1M90T 2VOOA 2RT3A 2MXYA 2CQ1A 4Z2XA 1OWXA 3B4DA 3G9CA 2AYMA 2MKSA 2N7CA 1URNA 1VQ6S 1X5SA 1SJ4P 2N3LA 2DIVA 1AUDA 2MKCA 2MKHA 4P6QA 3SDEB 1X5PA 2OSQA 2MJNA 1X5OA 2MYFA 5DM7Q 2N82B 4IOCQ 4WCEQ 5IQQA 2M4MA 1FO1A 1RK8A 1P1TA 3ULHA 2LMIA 2DB1A 2MY8A 3CCVS 2ADBA 2LQ5A 2BOPA 3VF0B 2LECA 2KU7A 3NMRA 1O0PA 2XS7A 4F25A 3PIOQ 3P6YC 2RS8A 3CULA 1X5TA 1X4CA 1VC6A 1B7FA 2D3OR 1IQTA 2KN4A 3BEGB 1VBYA 2RUGA 3LPYA 1JJHA 3V4MA 3CCJS 2DNMA 1VQ4S 2DGVA 2JWNA 2MQPA 4J5OA 2M70A 1UW4A 1SXLA 1W2BR 4YOEA 2MKIA 4FXVA 1VQ5S 1R8PA 3K0JA 1VQ7S 2DHAA 2DNZA 1DRZA 2RRBA 2XB2D 3P5TL 4C7QA 5GAEU 3CF5Q 1KD1T 1KQSR 1U1KA 5GMKa 5LJ5Y 1OPIA 3UD4P 4TU9A 2DH9A 1K8AT 2VOPA 1PO6A 4QPTA 2E5JA 2UP1A 2U2FA 1SJQA 3I56S 3UCZP 2CQPA 3Q2SC 3MUVP 2CJKA 1WF2A 2VONA 2LCWA 4WKRA 2CPIA 2M0GB 5ITHA 4IO9Q 2E5IA 3CXCR 3UE2A 1U6FA 3G4SS 1WI8A 1QVGR 2MZJA 2DGSA 1FNXH 1K73T 2XS2A 2CQDA 2G1DA 2FC8A 1FHTA 1WF0A 4OZ0A 3NS5A 1WG1A 1WELA 1NJIT 5LXRA 2MQQA 1VQPS 1KOHA 3UD3P 2MQMA 4LIRA 1U6BA 1YJ9S 2MB0B 2MJUA 1NU4A 2DGUA 1XN9A 1YTYA 1U1NA 1X4FA 3P49B 5GAGU 3TO8A 2MZQA 1NO8A 1X4DA 2E5GA 2DGQA 5GVQA 1FJEB 3HHNB 4FXWA 2CPJA 1OIAA 3S01A 3J7ZT 3VAGA 2MQOA 1Q7YT 1WI6A 1X4HA 3H2VE 1DZ5A 2MPUA 4BS2A 4CH0S 5FJ4A 2CPXA 2LEAA 2OTLS 2MHNA 2F3JA 3G8TA 5JVHQ 2E5HA 2FY1A 2OTJS 2XNQA 3VAMA 2KYXA 2X1BA 2X1GA 3EGNA 3DLLQ 3EX7B 2MZ1A 2JVOA 2EVZA 2DK2A 3MOJB 4TU7A 4TU8A 3CCLS 2XS5A 2KG1A 1WG4A 2DHGA 1VC0A 3UWTA 1Q86T 2ZJQQ 1VBXA 1WTBA 3H2UB 2JRSA 2D9PA 1KOOA 2QEXS 2M52A 1D9AA 3NNCA 2KI2A 1M1KT 3BO3A 2HGLA 2KRBA 4QQBA 1JJ2R 1A9NB 4CQ1A 1S72S 1M5KC 1WHYA 5CYJA 5HL7Q 2LEBA 2BZ2A 1X4EA 1D8ZA 2MGZA 3FEXB 2DNYA 4IUFA 1VQOS 2DNKA 3LQVA 3P3DA 2YH0A 2MZTA 2E44A 4EGLA 5BJRA 3CCMS 1HA1A 2M7SA 1U1RA 5GADU 2KM8C 5H1SV 4C0OC 5DDPC 3RW7A 2V94A 2MKKA 2LKZA 3TYTA 2NZ4A 1P27B 3G96A 2CQHA 2RNEA 3SDEA 1VQNS 2AYBA 3SMZA 5EN1A 1DHMA 2DGXA 2RVJA 4V19X 4WF9Q 1ZZFA 2YTCA 2VODA 3NNAA 3CC4S 4M5DB 2I38A 2ERRA 5CXTA 1N88A 2DH7A 1YWXA 2CPHA 2DNQA 2RRAA 2YH1A 2DHSA 2LYVA 2KT5A 2F9DA 3CUNA 5HO4A 2PEHA 5MLCV 1YITS 3THTA 5IM0B 4CH1A 2KXFA 2ZJRQ 3MD3A 3BS9A 2OJ3A 4UY8T 3VAHA 2J76E 4F02A 1VQ9S 3CD6S 1N54B 4YB1P 2OSRA 2HZCA 4WIIA 2DNGA 4LJMA 2LXUA 3IRWP 1YI2S 2DIUA 1M5PC 2CPYA 2MKJA 2RQ4A 2OIHA 2I2YA 1H2VZ 2JVRA 2J0QD 3MI7X 3PIPQ 1JMTA 2NLWA 3Q2TC 1U1LA 1DBDA 3L3CA 1U1PA 5D77A 3VALA 3J7YU 5GAHU 4WFBQ 3CC2S 3CCQS 3CCSS 4W90B 2YKAA 3ZZZA 4QU7A 4A8XA 3S6EA 2RQCA 1UP1A 1JJ4A 1YIJS 1WHWA 4F26A 1FJCA 3U1LA 3HI9A 3BO2A 3R1HA 3ZZYA 3CPWR 4ERDA 2KXNB 1KC8T 2DHXA 2YWKA 3MD1A 2KH9A 1N8RT 5DDQC 1U1QA 1X4AA 2CQ2A 2CQCA 5JVGQ 3CTRA 3MXHP 1M5OC 2CPEA 2CPZA 4LMZA 1VQKS 2XSFA 3RW6A 3MURP 1YJNS 2KRRA 4UQTA 3MUMP 5IFMA 2G0CA 2LXIA 5LJ3Y 1WEYA 2M2BA 3G8SA 2K8GA 1WEXA 2CQIA 2MMYA 2CQ3A 2CQ0A 2EK1A 1ZH5A 1SJ3P 3FEYB 4CIOA 1PGZA
chains in the Genus database with same CATH superfamily
3M32A 5C25B 4GC6A 3MECA 4KYZA 1RP5A 3M8SA 2ACMA 2W1BA 1KVJA 5J1EB 3ILLA 4DEZA 4ZVQB 4PWWA 2W7PA 3BBCA 2IRXA 4Y0FA 2XY5A 4MIBA 1JXEA 3KHHA 3OL9A 2VZ9A 4R8UB 3SV4A 2DNHA 4R25A 4C3KA 5LSOA 1QD1A 1APSA 4OYZA 2EFNA 2DNLA 2WW8A 4DV0J 5F41A 1N5YA 4PRFA 3DLJA 2R7SA 3ETMA 5B09A 3PZPA 4ED4A 1PBUA 3A8KA 2IRYA 3RB6A 1ZAWA 1XC9A 2HFSA 3SSRA 4B17A 4JP8A 5CA5A 3VGTA 3T19A 2VV5A 2QZ8A 1WKLA 1ZTTA 2AX0A 1LQ9A 2JX2A 4H4OB 3T1AA 1C0UA 3Q83A 5EWEA 2OPRA 4DL0C 2ALYB 1FKOB 2U1AA 3MM8A 1ROFA 2AP6A 3KUEA 3I0RA 3KG0A 2O67A 1SJRA 2DNPA 2Q3PA 4DHVA 3I5BA 3MDFA 4E8UA 3JAMU 3HM9A 2A3JA 2G13A 2Y0BB 3BGFA 4B3SF 4BDPA 5EWFA 2M9KA 3I31A 1LOUA 2EK6A 3MHYA 3OJSA 3D3CJ 3FNNA 3Q22A 4PABA 3FC9A 4FF3A 3GJTB 4PPZA 1WF1A 2PA3A 4GKJJ 5CZVA 4O3RA 2WBRA 1NKBA 2B56A 4ZA1A 4D3GA 2UUBF 1IN0A 2KHCA 3A3NB 4FYDA 2YPYA 2HHHF 1B0PA 4CLTA 5JXSA 2Z2YB 3QT7A 3TUPA 1SH0A 3D4JA 3DLEB 4KGXB 4FF2A 3CB4A 1G2EA 2RS2A 4P7VA 4TYBA 4LREA 4NMLA 2UUAJ 5HVHA 5KFDA 2AYGA 2XM3A 4ID5A 2AYEA 2ZNZA 2JEIA 1I51B 1S9FA 3IM8A 4MFBB 2AT1B 6FDRA 1GXUA 4RNMA 2X3DA 4HH1A 2DVIA 2J8SA 2B0GA 1IKWA 1LEOA 3CJ3A 1VQMS 4KIAA 9ATCB 1W25A 2I0XA 5D4PA 3CCTA 4OZ1A 4CWBA 1FCAA 2NUUG 1Q53A 1HD0A 1ZTWA 2QLFB 2CJYB 3CT9A 3JSMB 3NAIA 2J8AA 4C8KA 3EDRB 2CQGA 1Q78A 3I0SA 4V1Ak 5K20B 1N33F 1CULA 1GFWB 4FPIA 2R4FA 4PQUA 1FXLA 5IT9Y 5HVFA 1B99A 2BEFA 1QAXA 1T94A 3NG8A 4G6VB 3K8VA 4G1IA 5LM7E 3GIJA 4WJBA 4GO5X 5KOXA 4DQQA 1B0TA 4U67Q 3NBPA 4OX8A 2R2TA 4ECVA 2C2EA 3J81j 1FJGF 4PKDB 3KK3A 3NS6A 3MR7A 4OLOA 5ETRA 4ECSA 2R7XA 5B0DA 2VASA 1YKWA 2HLUA 1N5QA 3C16A 3IBCB 3MMCB 2RU3A 4ELUA 1YHQS 2WSCC 3AD8C 1WHXA 3DXBA 1GK8A 3NGKA 4BC7A 5KFEA 4LRDA 3OVSA 2PMHA 1S76D 1N52B 3P8BB 5H9FK 2QTWA 3MAHA 4LRAA 4F4AA 2QV6A 3E3XA 3FMWA 2HMIA 4JI5J 1MU2A 1RLDA 3G6YA 2CQBA 2R7RA 3RW6A 2V5HG 2ZH2A 5LMNF 3DDKA 4K4SA 3OTEA 2EBEA 2XCPA 2GVDA 3CMES 4F8RA 2GVZB 4OI4A 1SC3B 1TUVA 2V6AA 3VGUA 1FWPA 2W9BA 5DDRC 3DM2A 1PSDA 2WW4A 3EM1A 1U45A 3CD5A 1FT8A 2HIQA 5HJYA 4O0IA 4UTGA 4GO7X 2E5LJ 1QVFR 3IN5A 1RT7B 2H5JB 5KT4A 2G2ZA 3UCGA 3GJSB 4B9SA 3I55S 2OO4A 2VHGA 3MM5A 2UXDF 1P8GA 3TJ8A 2DO0A 4IG3A 1CJVB 2V9KA 4Q43A 3VAIA 4ED5A 1JLAB 3DRRB 1QM9A 5IXUA 1X0FA 1R89A 3P5BP 1T0TV 2DKOB 3IFEA 5LMNJ 1RKJA 4LF9J 1RWWB 5KFPA 4ZKAA 2QL7B 5J1NA 4IOAQ 1NDPA 1VQSA 2PN6A 3DC2A 4ZP7A 1TK8A 1BD6A 1NJWA 5J2NA 3JB9k 2IM2A 3K58A 1LW0B 1R8BA 1S4FA 3HHLB 3AXKA 1NHVA 3DOLB 4ZPWR 2L9WA 3JS9A 2KM8B 3R27A 1SQFA 3MFHA 1REVB 4YMEA 3H25A 3IRXA 1H2UX 1NAQA 4BWMA 2NXNA 4NLYA 5BR8F 4J9KA 1Y00A 3KFWX 3J7Z5 4E0DA 1WC4A 2YQ3A 1S6PA 4Y2KA 1Q5VA 2CJXB 1FRJA 2XMMA 4KE5A 5GAEI 2V63A 4LF9F 4F0MA 2CQ1A 3TX8A 4AXJA 2VQFF 3W66A 2RU9A 3RR8A 2LQ9A 3M6UA 1CJTB 1B0VA 1H7XA 1M1HA 2Q6BA 1TQLA 4NASA 3FFIA 4WWSA 5FLXU 1LWFA 3LGMA 2N7CA 3SV3A 2HLTA 3QIDA 1VQ6S 4CLLA 1N33J 2PI5A 3OVAA 4C9DA 2MKCA 4YR0A 1KSPA 2CJBA 3FRYA 1J5OB 4AQYF 2MQ8A 1TMJA 3MEEB 2Q6CA 1X5OA 1YBAA 3GIMA 1ZYQA 3ZC4A 5J2MA 2KT3A 2NYHA 4NX9A 3ZTOA 1U0HA 5DGBA 4EYHB 1BC6A 3BKTA 5EX0A 4B9TA 4WBFA 1FO1A 4Y6IA 2V68A 3ULHA 4DPXA 3TANA 4M95A 3GU0A 2AEJA 5KFIA 5GMDA 1B3TA 1D1UA 3PJXA 3CW2C 3UDVA 3OBIA 3CCVS 1XMQJ 4C8ZA 3HHLD 2KTQA 2JL9A 3WX4A 1NZAA 4USVA 4AFFA 4NE9C 5C5JA 2CUYA 1MMLA 5EGYA 3Q8QB 4CCHA 2LVWA 4E2FB 1N5VA 4DSEA 2KU7A 4RX6A 3KUGA 2ZUGA 4DPWA 4OZ2A 1TL3A 1KTQA 1SPBP 2R7QA 4XDDA 4CT8A 3PIOQ 1VMBA 2XI3A 3J80U 4I2QA 1X5TA 3BSNA 1O5JA 1UW9A 3QQCD 4XPCA 4LF5F 1UVNA 2LP4A 1Y5LB 1VBYA 1EIYB 2RUGA 5I42B 5ETOA 3K89A 2WOMB 1CJKB 2FHJA 5H9EJ 2IJFA 3C6TB 2DGVA 4LFCJ 3NAHA 1UL3A 4KR0B 5A2QU 3H8YA 5B0GA 5DQHA 2JWNA 1MW7A 4UZCA 4DU7A 1H3DA 4R0EA 3FCVA 3LANA 2GIRA 3N6NA 1JX4A 2MKIA 3CO0P 5B0EA 4YOEA 1E6YB 1M0SA 1R8PA 3VTIA 3ZTPA 1CS4A 1WC5A 3F0NA 1DRZA 2A1BA 2AKWB 4DR4F 3V4IB 4B3MF 2Z8QA 3BR9A 4DF4A 2JEJA 2BM0A 3LP0A 1RCOB 3QBCA 3KLEB 4NLQA 4G1QB 1SVDA 3VWSA 2QMUB 2WVDA 2R8JA 2V9WA 3BGLA 5DQIA 1KN6A 4ECZA 1X8DA 4CYUA 2A10A 1HMVA 3K17A 1Q0NA 3H5SA 3LPEA 2DEIA 2VOPA 5E3AA 1SC4B 2IC3A 2RF2A 2U2FA 4TVAB 2AJ0A 3D1HA 2Y9HA 4CLZA 3KOAA 2J9DA 5A8RA 4ZLLA 3R5JB 3HHLC 4PEOA 3QWUA 2MHEA 3DLGB 2A2CA 4F0KA 1RTHA 2XQCA 2LCWA 4X2BA 3G82B 2NXEA 2V34A 4LSLB 3FSYA 2ZH6A 3CXCR 4S0MA 4RNHA 5KFHA 4EO8A 2ROEA 5K8OA 4WE1B 1QTMA 1JKHB 2PA8D 3QGGA 3MAQA 2MZJA 3BB5A 2DXDA 3MCOA 1WJ9A 3V2UC 1QVGR 4C8OA 2XS2A 2UV8A 4DFKA 2FQQB 5CYQA 1T9WA 4C97A 1IJFB 4K5RA 3KK2B 4ZPTR 2B5JA 2HWTA 3OR2A 4IRKA 3QLHA 3OTDA 4KBIA 3BBFA 2DR9A 4EZ9A 1FHTA 4NA2A 2N7YA 1WF0A 2WSFC 3CIMA 4NMXA 3NS5A 2O01C 4FYVB 1Y11A 1UMJA 2V8HA 1NJIT 3W2WA 1GAOA 4NOHA 4CRJA 4HI1A 2MQQA 2ZOGA 1XNRF 1X7VA 2GS8A 3OL7A 2HHXA 4NLXA 4KH1B 1N5SA 1XN9A 1OSCA 2L9DA 3FDSA 4WU2A 4BWJA 5A8RB 1U1NA 2WVEA 2ERRA 4I56A 3OVBA 2RILA 2VG7B 3CD0A 4YB6A 1FRXA 2EW9A 2R42A 3LOUA 2MZQA 5ETNA 1SJ1A 3DNCA 1WD6A 2J7WA 1V3ZA 2VFTA 1FDAA 1X4DA 1NSQA 2YKMA 3OT9A 3C15A 5KFQA 4KY3A 2BOAA 3D28A 4DR1F 1HBOB 1FFWB 1FVSA 4QWBA 2VBXA 4NZ7A 3DLKA 4KGVB 4M5LA 4DCJB 2CPJA 5J2PA 4LRCA 2XY7A 3J7ZT 2E7VA 4TQSA 3VAGA 4QYRA 1S9GA 3R2CJ 2HBRB 1Q7YT 4OIXA 4OHZA 4DR7J 2C2ZB 3D67A 2VFRA 4NXMF 4IH5A 4RWXA 4JB8B 1U2RA 4G65A 2ZH9A 1GTHA 1EHWA 3UN3A 3MGJA 1YQHA 4ANDA 3MZIA 5M2UA 2LEAA 4OZJA 3PR4A 2E9RX 5JVHQ 4N41A 4L73A 3MEDA 3UNGC 1UJ5A 2N4DA 2W7AA 3HVTB 4CTAB 3RB3A 5L9NA 2XNQA 3DLLQ 5D15A 4KFBA 1F60B 1WDDA 1RT1B 4O3NA 4P2MA 5C2CA 3GILA 1CC8A 4DR5F 2JHEA 2F8HA 1IQZA 4DPUA 2P9EA 1NB2A 4HT5A 2X51A 2VKZG 4PG7A 3W64A 3ZTQA 3AA8A 1PKUA 5KG6A 4TU8A 3CCLS 4ZJLA 2KG1A 2E5LF 1ZBTA 3RR7A 4O4GA 4U8VA 2IDEA 1LKZA 2HRTA 3KJVB 5L1IA 4F4XA 1R0CB 4DG1B 2C22A 1WUUA 4LR9A 4DL2A 1TAUA 1Q86T 2W4DA 2ZJQQ 2O66A 1VBXA 2AJQA 2CA9A 4TXSA 2HVDA 1RWOB 1RT1A 1I1GA 3FCWA 1TAQA 1NNDA 3DU6A 3GE9A 4MH8A 4K0KF 1KOOA 1XNRJ 4L3NA 3IAM9 1MU2B 1H73A 1IBKF 4LFCF 2FTRA 5EX3A 1MWZA 1HLWA 1QLNA 2OFHX 1YJVA 3SCJE 3KG1A 5J1EA 4ELTA 4Q8EA 4YDXA 1JJ2R 2YKQA 4OI2A 1L5UA 1A9NB 1K0VA 1RHRB 2QA1A 3ZZ0A 1KHWA 1UFKA 1WHYA 1ZOTA 4M1KA 4OYIA 5F8IA 2VQEF 2I5JB 5DLGA 2KJVA 2V8VA 4MMOA 2WHOA 2GIQA 2ZITA 4RW7B 2EXUA 1F5AA 1S7HA 1NK8A 1UEKA 3M1VB 2XLKA 1H74A 4BBYA 1ITPA 4B9NA 1S5ZA 2BJ3A 2EFVA 4C11A 4YY3J 3HHDA 4X4SA 1U24A 4CO0A 2XGPA 3HP6A 3AOBA 4OI6A 4RW4B 3KHGA 1VQOS 3DOKB 3KLIB 4USJC 3CCMS 5KFGA 3DU5A 3GSIA 4FNIA 5D0EA 2BKPA 4I0WA 3LP1B 4DLGA 2ZVSA 3TZWA 4C0OC 3I6PA 2WRMA 4K2JA 4ZVSB 3LWLA 1TP7A 2I6WA 2YWHA 1TKTA 3SDEA 2RNEA 2V0NA 3PFOA 4F3QA 4BC9A 4OL8A 4GRSA 1D09B 2ZHAA 2D3O1 2BJ8A 1R0AB 3DCAA 2IBKA 1KR4A 2BYCA 2B5JB 4PG8A 1NK9A 1S7IA 1XBWA 1ZZFA 3DRXA 3HKZD 4KHPF 1HNVB 2I38A 2R2UA 1NM2A 1VOMA 1KQKA 1N88A 4X62J 5CXTA 2QSWA 4IG0A 4KT0C 4NCGA 2J9CA 2RRAA 3T9ZA 3RAQA 2DHSA 3C2PA 4RNNA 3CUNA 1V6HA 1YGYA 1GEHA 2WB1D 3H98A 5HO4A 3MTJA 2UUCF 2MLXA 2PEHA 2C2NA 5KG5A 3T1YF 4OI0A 1U8WA 2ZZMA 1S57A 4CH1A 1LK5A 4Q2LA 3SCIE 1S12A 2K1RA 4MK8A 2GQ2A 1L3VA 2HNZB 3JTOA 5D3GB 2AGOA 4UOHA 3VAHA 1S0NA 4QR2A 4IYQA 1RBAA 2NSCA 5I4MA 1T7PA 1NK7A 4NYOA 3Q8VA 1RT6B 4YB1P 1C1CA 3V6DA 1GT8A 2VPWB 2CZ9A 3ZTSA 4DG1A 1FVQA 4EI2A 2ZWOA 2HHUA 2CPYA 2RQ4A 4RUAA 3J7YI 4WTOB 2E1AA 1H2VZ 4M5JA 2J0QD 1YRXA 2CFXA 3U02A 2R3VA 3C6UB 3ZO7A 2AJ4A 2NLWA 2EG1A 1REGX 3R5CA 1DTTB 1FK9B 3K5MA 1T9VA 2HMIB 4C3MA 2MKYA 3BSAA 1BUXA 3DLKB 3R7BB 2B9XA 4PQAA 1HHQA 3TWZA 4OYWA 3ZZZA 3OFHA 4F04B 1FD8A 2VUGA 2V2QA 2RQCA 1HWKA 4PZVA 3R7NB 4B9MA 2RD5C 2D69A 2PFFB 1K1SA 3LAMA 2Z57B 1SKUB 1HQUB 1NPPA 3V6JA 3HI9A 4R5PB 1S99A 1V3RA 5KFNA 5KFVA 2BRLA 1SKSA 4JI5F 2VBYA 4NRUA 3UDEA 3CPWR 2KXNB 1Z1ZA 2IM0A 5KAKA 2GAHC 2VFUA 3MD1A 4ZPAA 4JV0A 3AQPA 4ICLB 2EFGA 3HFVA 2V8GA 3RUBL 5DDQC 4B08A 1ZA2B 1TKTB 2G0JA 3LP2A 2XTJP 4PXDA 1U1QA 5JVGQ 3KHRA 2FLNA 3NS7B 1CSJA 4NYPA 2HS3A 1ICEB 1HW8A 1W26A 2CKWA 3GYGA 2AZ3A 3Q8YA 4IFVB 5E3RA 3J80Y 1NK5A 1TR0A 2E1MC 3ONQA 3PHTA 2VA2A 2NUHA 1BXNA 3GMGA 1TKXA 5IZHA 1VQKS 4M5HA 3A3PB 3C46A 4HR2A 3A4TA 4J9LA 3H42A 3MURP 3BH6B 1BMQB 2KRRA 1T9YA 2RHQB 3BN7A 1DQAA 4J91A 2QC3A 4UQTA 1U09A 4FBTA 5IFMA 2V2ZA 1IBCB 3KUHA 5AT1B 4ETZA 4R5PA 3DLEA 1WEYA 4OJ3A 2Y8YA 1HQUA 3T41A 4ZK7M 1S59A 1LWCB 1S4EA 4XK8C 1CLFA 3G6VA 4F2SA 2CQIA 2MMYA 2O1PA 2IAJA 1FF2A 1FK9A 2WVBA 1RTHB 2CDQA 5CCMA 3T5LA 2CQ0A 1ZH5A 1DTQB 2DJWA 1KQGB 2DBBA 5IS2A 1LV5A 1IBMF 1OY8A 2QLJB 4DFMA 4KB7A 3SSQA 2WZ1A 3THPA 2GHPA 1IKVA 2P2CB 3CWJA 4CNYA 4QIWD 4N8NA 2EC2A 2OD4A 1UTAA 4TLQA 1GX5A 3MUTP 1UA0A 2DR7A 1RBOB 5D0RA 3OUYA 2ZH5A 2BR0A 3QGHA 1IUJA 1NMEB 1LNQA 5KG4A 4OJHA 4ZMMA 3C3LA 3EGZA 4HDHA 1LFWA 2MTLA 2NPFA 2W01A 4LF7J 3BDPA 2M8DB 3DGPA 3AAWB 1S1UA 1NPKA 2F8MA 4A4JA 4X64J 2F1FA 1IXKA 3K7RA 4RBUA 4WK3A 2GMJA 3Q24A 2D3ZA 1ZZNA 2GVDB 2O5DA 5LSLA 1NJXA 2DISA 2VODA 2HRYA 2B4PA 3GONA 1LWCA 3IR5B 5F8HA 4QIGA 1IR2A 2Q79A 1GH8A 2G0IA 4PXEA 3KNAA 2HQFA 1EZZB 2HGNA 5L38A 4EYIB 6AT1B 1NK4A 1HBOA 2ZC4A 1QUPA 3HSZA 3BH7B 2DR5A 2MY7A 5GMEA 1U25A 4P2XA 4Y28C 4YEAA 4DX8H 1QSYA 3EGVA 1IKVB 1BY9A 1S9GB 4X65J 2DGOA 4CLPA 3HVRA 4FS2A 3A8EA 1VIXA 2C3YA 1ZM4A 1JXLA 5IWAJ 2W9BB 3SXLA 1XK8A 3N6MA 1K9MT 5LSRA 4ZCLA 5KOWA 2HG4A 1YLXA 4UOFA 2E1CA 4LFBJ 1HNVA 1WSRA 3G2XA 2AGQA 2ZOMA 5B0AA 1WC1A 1JIHA 1VCTA 2C3MA 2Z4PA 3QFWA 4LBIA 2H4WB 3M4XA 3TJAA 3TQEA 4FF1A 2J0SD 3G8QA 5THWA 4LVOP 3OR2B 4DDFA 2MSTA 4FVMA 2Z2ZA 4OX7A 4RW8B 1JLQA 2VJVA 1EETB 2MGZB 3PV8A 5KFBA 3I82A 2KKHA 3HLUA 3IP0A 3THVA 4N56A 1CJUA 5C24A 4KHMA 4P52A 2Z0GA 1RT5B 1TV6B 1RWNB 4JI4J 1QDUB 1IR1A 1T3OA 4G1PA 4C6AA 3CCRS 1S9EB 2UXBJ 4HHHA 3D54A 3MAAB 4NLOA 4H4KC 1U1MA 2Y0SD 3MEEA 3QPIA 2R2RA 2UXCF 1GMWA 2HS0A 3JYTB 1NDKA 2HBYB 2IC3B 3C8YA 3E51A 4NYZA 3UCUP 1AB8A 2FHMA 1N36F 5HANA 4FPRA 3ZXWA 3SCLE 3AODA 2DO4A 4JBCA 3M8ZA 1GX6A 2M8HA 1IBLF 1LWFB 2CQ4A 2MLYA 3FFIB 1D3WA 4Q2MA 1NCLA 2KJWA 3D6MB 2CPDA 1CJTA 3UD5A 3OL6A 1S1WA 1QSLA 2KG0A 5H9FJ 2YNGA 2OEJA 4O23A 1LW0A 4XDCA 1KVIA 3AFGA 3CCZA 4X64F 4A46A 3NCRA 4LBPA 2SXLA 1KNZA 1RTIA 1S6UA 4KFBB 4PUOA 1CQNA 5DETA 5KT5A 3E2EA 4U95A 2VC1A 2DCLA 4NZ6A 3VZHA 3LGHA 2NZCA 4JI3J 5IM0A 4X65F 2F4VF 5L1JA 3FBFA 4LF1A 3HULA 2V69A 2FVPA 2ILYA 2K7JA 1YSJA 4RU2A 2W25A 4RUBA 2QO3A 2ZJPQ 4W92B 5DDOC 1IBMJ 2J7KA 3CC7S 3ISNC 2JH3A 2DPJA 1Q95G 4B3TJ 2RQKA 1HBNA 1Y0HA 2JEFA 2BRKA 2RE1A 3OTBA 3ZZPA 3C15B 3SFUA 1SV5A 3LAKA 2VIHA 1YJ7A 1RAOA 4ECRA 4I69A 1TL3B 5CCLA 3OW2R 3TW0A 2PE8A 3VAFA 2Y1JA 2IHR1 5J2PB 2E1PA 3BZQA 4B3RJ 3JSYA 1WACA 4I2QB 4EMDA 4XAKA 2FHOB 2R7WA 4DPOA 5HVGA 3HD2A 4OHWA 3R2DJ 3UN5A 2H51B 2VDHA 3D9BA 2W9CB 2LA6A 3W5ZA 3CCUS 3G71S 4ZVEA 3ZFVA 1M90T 2QT7A 1FFGB 2ZOFA 5EHHA 2MXYA 2YQ1A 4I6YA 5KG2A 4EZ6A 1L3SA 2LDYA 3NP5A 2R8HA 3CGIA 4IO1A 4ECUA 4CLWA 3W60A 1SL1A 2AYMA 3EE3A 3TARA 4KV8B 2MKSA 2ZH8A 2A2DA 4O3QA 1F2HA 5F8JA 2N3LA 5HBMB 1AUDA 4B9VA 3QRPA 3RU0A 2LDIA 2MKHA 1HPZA 2HHTA 1B4SA 3EJMA 1JLBB 1VHIA 1NBEB 2GC8A 5E3CA 4ECQA 1Z2ZA 2IYGA 1R31A 1BQNB 2DR6A 2GW8A 3MFIA 2N82B 2XYHB 1JNZB 2C1EB 1OJ4A 1RAIB 3DLBA 2OUGA 1F9EB 4JI2F 3F73A 2HHSA 2W8LA 1ZAVA 2DRAA 4TU7A 1H0HB 2A0FB 1HR0J 1HHSA 2JDJA 1OPZA 4DR5J 3ILJA 3KJQB 1IBLJ 4D3HA 4O4GB 3OQ2A 2I5JA 2QLWA 1JLEB 2R8GA 3VF0B 1RWUA 5J2NB 1KHVA 3LO3A 1KEKA 1O0PA 3GIKA 4F25A 2LECA 5KFKA 1K1QA 1L3UA 3CJTA 3GG0A 3KMQA 3ZZRA 3OFGA 2UXCJ 1DQ8A 3E8OA 4J90A 4R0JA 4DR3F 4IQMA 5HQLA 5E3QA 3SCKE 3BV8A 4WP9A 2XYPB 2UXBF 1TL4A 1VLOA 1SUQB 1FRIA 2F4FA 1HR0F 1MMDA 4PG5A 4P72A 2FLLA 2HNDA 4DBQA 4X4QA 3V4MA 2EFPA 2P9CA 3CCJS 1B7YB 4A8SA 3NNAA 1HNWF 4O3PA 1SC1B 3DRSB 4USUA 4DV7F 2XSJB 2Y3YA 2Z56B 2MQPA 3UW1A 4DMZA 2M70A 4JYAJ 3ADAC 3G86A 1X9MA 3CE8A 1LK7A 1PJ7A 2ASJA 1T8EA 1EAYC 2FY8A 2G1HA 2WBMA 1HWLA 5I3UA 2IA0A 2HSEB 3LF0A 9RUBA 4CLUA 1KKHA 3KDNA 4YN3B 4DV6J 3HVTA 4ZVHA 1VQ7S 2DNZA 2JFDA 2XB2D 2HPUA 3F41A 3CJ0A 2XMJA 1KD1T 5C25A 1HI8A 1LXJA 3PDNA 1Q8IA 4UT4A 4MIAA 4FYWB 1RWXB 1OPIA 5GMKa 4KJIA 4V19J 4DR3J 2FDNA 2DH9A 3MMBB 5BXIA 2RDJA 1WC3A 4OI1A 1GXLA 3CIZA 3MAAA 2B6AB 4QPTA 6FD1A 2NREA 3KTQA 2E5JA 3PTWA 3I56S 5DS7A 2OPQA 3L4BC 3PW4A 4ETXA 3D6TB 2OPPA 4H4MB 5RUBA 2B3TB 5FDLA 3PNIA 3ISZA 2HZAA 3C19A 4QJVA 1U26A 4J9MA 2PDAA 2CJKA 2IIHA 1WF2A 1SBRA 1UVMA 2VONA 1RABB 1PAEX 1DAXA 2CPIA 2YNFB 5CH7B 5KFXA 3VVTA 3PW5A 2E5IA 2GAGC 2OFGX 5HMYA 1D9FA 1U6FA 1YK9A 4KGZB 4IDKA 4ZPVR 4Q45A 3PW7A 2EFQA 1HQEB 5T7LB 4ECTA 3AD9C 1K73T 1KRPA 2UUCJ 5I3QA 1RADB 1RCXB 4ZPDA 2BX6A 3HDSA 3KLGA 4LR7A 4UF4A 3O8WA 4O0NA 1OQ6A 3X1LB 5H9EK 4LF8J 2KT2A 4OZ0A 2VH7A 3R6GB 4RO0A 3TNVA 3VGSA 4X4VA 3PACA 3JQKA 4JV5F 2F4VJ 1NHKL 4WE1A 5LXRA 1VQPS 1KOHA 2MQMA 1R8CA 5K8MA 1YJ9S 2MB0B 3CJQA 2MJUA 1NU4A 3PRBA 1RAFB 4TKTA 2BJEA 1S1TB 2DD8S 2YKPA 2ZVIA 3DRYA 3PM9A 2G2YA 1X4FA 2R2SA 1B70B 1X60A 1Y5IB 1Q8LA 4RWWA 3TO8A 5GAGU 3AH6A 4UUWA 1VLYA 1S6QB 4B3OB 1RT2B 3QIPB 2HFNA 5KFRA 4ES3A 1YBUA 1ACMB 2B51A 2C2MB 4OFZA 2L9NA 2Q1LA 2EWHA 1HYSA 3OJUA 4C0HA 3DRPA 3CDUA 5BYRA 2BE2A 5HLFB 3IWNC 2FLPA 2FZKB 1SIZA 3R7SB 4XPEA 1BQMB 2HFUA 1CEZA 3H2VE 2KZZA 4NLTA 3VQTA 1XR5A 1D0EA 1T03A 3CJ4A 3A1YG 5FJ4A 2CPXA 5DJBA 4J9RA 2MHNA 3G8TA 1RT4A 3DHXA 1IWGA 1WC0A 4NXMJ 3SSSA 1FKOA 2KYXA 2X1GA 1RT3B 3KMSA 2V8DA 3DYAA 4ES1A 2ZKTA 2DEJA 2EVZA 3DMJA 3OPKA 1SL0A 3BBBA 2ROPA 2CNKB 3DM2B 5GAGI 1EQMA 3MCMA 1BHNA 3DN9A 3FZBA 2D1CA 2FD2A 1HWUA 1WG4A 3CDWA 3FBEA 5T41A 5B0BA 2HAIA 2IAJB 5ETTA 4F3MA 1VC0A 1YBTA 3UWTA 2HNYA 3GR0A 1Z4UA 3J81U 1OS5A 3RBDA 1RT2A 3QIPA 4Z37A 4KRWA 3BR8A 3A3OB 4AXIA 3KJFB 4PUOB 4IH6A 2CJ9A 3BKFA 4DL3A 3IGVA 4YHHF 1D9AA 5E5NA 3PCOB 3BO3A 1S1TA 7AT1B 2ZH4A 3UO0A 4RNFA 3GZ7A 2J5AA 4LRBA 3JQMA 1MMNA 2DXEA 3OD2A 1LW2B 2OMOA 2YNHB 3D66A 4USMA 4U6PA 2PEBA 2ZHOA 4DL7A 3TAMA 2BZ2A 1F3FA 2MLZA 3HFZB 4RLEA 2E9TA 1ELOA 2HZVA 3M2RA 2DNYA 4KKOB 3LP1A 4DV1F 1TL7A 4ZS6A 1TVRA 4PWUA 4I7FA 5DLFA 4LF4J 2DNKA 2VF3A 4ZVOB 4UW2A 2MZTA 2E44A 3D6HB 4CO3A 4OYOA 5BJRA 4DFJA 3D5MA 4ID5B 1UPMB 2KM8C 3W9IA 3MWBA 2E29A 2VD3A 3D68A 1S10A 1WNEA 2RHSB 2BA9A 1XTZA 3H59A 1RHQB 4KGKA 4ZLJA 5DDPC 4DR6J 1IKWB 3QJPA 2C2KB 2UZAA 1RAHB 1EETA 1P27B 3I9V9 1AFIA 4LF7F 3KJNB 3SMZA 4F7VA 2DGXA 5EN1A 3M9NB 1HI0P 2E66A 2KYZA 2MEWA 2OHDA 3CJ2A 4OYPA 1LW2A 1RAEB 2XZTB 2BV3A 2IVMA 1HNZF 2BUNA 2B7BB 2G9OA 3GCWP 4M5DB 4OV1A 2I9SA 3TZXA 2H5EA 3M30B 2W4CA 2HQGA 4LVNP 2F5GA 2Z2LA 3UDCA 2DNQA 3V81A 3EMTA 2RB7A 2V2VA 3GTYX 3L09A 3IG1B 4ZHRB 3N6LA 2YXLA 1FERA 2F9DA 3IM9A 2YNFA 2BKOA 1VQYA 2IRUA 3RB4A 4JI7F 3HT0A 2Z58B 4HI2A 5MLCV 1KONA 3PKYA 1F0XA 2X7IA 3THTA 2VA3A 4OZNA 3PRVA 2JSXA 4J9QA 1OMSA 2GIFA 5K5MA 3Q8PB 3BS9A 3CCWA 4RBVA 4DL6A 2OJ3A 4Y2CA 4YB5A 4P74A 4B9UA 4UY8T 1L3TA 1WOSA 4J9VA 2W8KA 4CO1A 5CD4A 1TKZB 4ZP8A 4HEA9 5A8KB 3M8RA 4WIIA 4MKAA 2XC9A 2KFNA 2B4UA 4LJMA 3TZYA 3GV8B 1XWLA 3I32A 1GQEA 1RB0A 5L1KA 2VJUA 1YI2S 2FJVA 2W7OA 3ILIA 2MKJA 3B54A 2FJXA 2W2QP 4NWBA 2OPSB 3FUYA 2C28A 3NGDA 2RDDA 3KK3B 4JV2A 3BGOP 8AT1B 1YG0A 1ULRA 4IG0B 1VGYA 5D77A 5E2QA 3RG6A 4ZHRA 3RYLA 2BE7D 1S48A 4Y34A 3VALA 3U7JA 1DFDA 3M32B 4WFBQ 4KGMA 2IYIA 3CCQS 2J7UA 1XMQF 4YHHJ 1WOPA 1RQ0A 4QU7A 4FN5A 4P9SA 3IGNA 2CJAA 1R0AA 5E3PA 1UP1A 2V8PA 3W7BA 1C1BA 3PY8A 1LWEB 2CWKA 2LEPA 4ENOA 2AQ4A 2LU1A 4DUYF 3QAEA 2V4RA 1SKWA 3UFCX 3QZ8A 3PJWA 5D0GA 4XIUA 3PR5B 3AJ1A 3GV5B 3Q23A 3V81B 4UOCA 4YDDB 3K59A 3QZ7A 1JLCB 2C42A 2CNLB 1S6QA 2R8KA 3J7AN 4Q5VA 1AW0A 1BWEA 1ZAXA 1KC8T 2YWKA 3W62A 4DN0A 4K59A 3Q89A 4HTIA 1VFJA 5K14B 4WXWA 4X66F 4FDFA 4X4PA 2ASLA 4UUXA 1FXDA 2BJDA 2YWWA 3WC2A 2WONA 3DOMA 4LFAF 2QL9B 1NDCA 1VISA 3M8YA 1UETA 1U49A 3SQGA 1T9UA 3Q86A 3MXHP 1IKYB 4ES2A 1M5OC 4K50A 1N6QA 1CG2A 3CMQA 4DUZJ 4RW8A 2Y1LB 5HROA 3PVXA 4XTTA 4DI6A 2W24A 3LP2B 4LMZA 4EO6A 2H4YB 3MMAA 4OQJA 2BVZA 2ZDOA 5E33A 1K44A 1AXQA 2LXFA 3DDIA 4RUCA 3MUMP 4W4MA 1YJNS 3A8JA 5D6GA 4MKVA 3MR2A 2LXIA 2FHKA 3ISND 4JI2J 2OPQB 5F8NA 2M2BA 2QN6B 2V2KA 4M5NA 1WEXA 3FEZA 1FEHA 2NXJA 2QLBB 3MF5A 3FQLA 2YNHA 4NLWA 2GHWA 2CQ3A 2GHVC 3MM6A 2BJ7A 1SJ3P 1RTDA 4RUHA 3AY0A 1RSCA 3G6XA 4OYAA 4P75A 2J6SA 4NLDA 5KT7A 4DPTA 4PR6A 4DX6A 3JQJA 2DITA 1F3VA 3GG1A 2UVVA 2DNRA 4XO0A 1XMOF 2HGMA 2W9CA 2OMLA 4HLBA 5ETVA 4MK7A 1XQIA 5I3UB 1WKJA 2OPSA 3TUIC 3F44A 1M5VC 4B02A 2LQ8A 3MM5B 4RZRA 3MECB 3MM8B 3H7HB 7FD1A 4DV3F 2DCUB 2HVZA 4NLGA 3BYPA 3NCPA 4PG4A 3GFYA 2AJ2A 4YQWA 1PC5A 4BCAA 4F4ZA 1R8HA 3NNHA 3W3SA 4RL1A 1SCJB 2ZDPA 1SH2A 4LQ3A 2YWEA 2DTJA 3OUYB 2QE5A 1RT6A 3QGPA 3T6BA 3LUYA 3HJFA 1VRTB 4OX9J 5EUHA 5A76A 1FJGJ 2XSJA 3M30A 1PYSB 2KXHA 2YNGB 4DUZF 1NLKL 4UQGA 2FVSA 1UVLA 2ALZA 2OI2A 5D8HB 4IKAA 3N5BA 3N01A 4QPXA 1RISA 3KLHB 3MMAB 3HVAA 4DZDA 3RRKA 2OLWA 2V4QA 3KK1A 1IWAA 2BE2B 2FGCA 1WG5A 2MSSA 3H5UA 1MG7A 3NKYA 4C3LA 3MPYA 4NLSA 5B08A 1N32F 2DHHA 2J0WA 2MZSA 2MQNA 2IMWP 5BYQA 4Q0BA 1M5SA 3VGVA 1S79A 1GMWD 2AEFA 1HL6A 2DYAA 3ENVA 4O3OA 1DQ9A 2D9OA 4X62F 3SZ2A 2BQUA 1S77D 1BE4A 3OFFA 4LUBA 2UU9J 4RW9B 3CMAS 2GA7A 3CCES 1R43A 3M8PA 4WP3A 1B64A 3BJYA 1HD1A 3GIIA 3LGNA 5KFYA 4OYXA 1OY9A 2APOA 3O1LA 2QMXA 3BGRA 4ED1A 3G82A 1V9OA 1FDBA 3GLJA 3HSJA 3CJKB 2FGOA 1Q82T 3GWCA 2DPIA 1H6KX 1V5VA 2DRDA 2FVCA 2L08A 1WTBA 1UWBA 3DKDA 4AD6A 3JYTA 3VAJA 3M9MB 3OL8A 2ADCA 3UVJA 4YB7A 4CLYA 1VC5A 1XNQF 4MT1A 1PILA 5T7LA 3SFGA 4OV6A 2XNRA 4QU6A 1HMVB 3RRHA 3TOQA 4FBUA 1NJYA 3VQSA 3NGUA 3OHAA 2FPHX 5HQMA 2B6AA 2HK3A 2GGPA 4Y2AA 3P96A 2HHWA 1C0TB 1IJEB 2GJFA 1FX4A 4YUDA 2PGCA 1SC6A 3BREA 1V3SA 4OX9F 3KDOA 4WZQA 4JV1A 2GX8A 4KV8A 3N9UC 1WHVA 4WYWA 2VFVA 4OX6A 5KFMA 1RGVA 5KFOA 1QAIA 5U47A 1FNOA 4WXOA 1TZ0A 1UWAA 4DX5A 5A8WA 4K2XA 3PX6A 4B3RF 2VU5A 3D1OA 3U1MA 2XG8A 1T9XA 1YZ7A 2D7SA 4Z7CA 2QFJA 2MQLA 1FJ7A 1FTRA 2LLZA 5JJBA 3MMBA 5L9XA 5IV3A 4X4OA 1TL1A 2XULA 2C3OA 4CT9A 3O2IA 4CYUB 2DGWA 3CNQP 3BPSP 3I96A 1A0OB 1TU0B 3TX0A 4DXLA 3QFHA 1AZSB 4ANCA 2KL8A 2UXDJ 5HMWA 2V4JB 5F8MA 4DL4A 3G6ES 4H4OA 2K3IA 2UVWA 4WFZA 3TA2A 5CABA 1UVJA 2P8IA 4Y00A 4DL5A 1Q81T 2B7CB 1HBMA 3V4IA 2R7UA 3W63A 1SV5B 5HLFA 4K5SA 3BO4A 1CS4B 1WWHA 4JI8F 1JLGA 1N5YB 1TUGB 1NXIA 1QJHA 1RT4B 1N32J 5CYMA 4FKXA 4EEYA 4FKYA 5IV4A 5LMUF 3QRRA 5F0WA 1RZMA 4B3OA 2IJNA 3K5PA 4NCAA 4K4WA 1H2TZ 1Y3KA 2UUWA 7FDRA 2AD9A 1AA1B 3T1HF 3W1YC 1R0BG 1S6OA 2DH8A 2QYCA 3B82A 1VIOA 4KAIA 4WU3A 2A18A 2FUG9 2ZC3A 3VAKA 4ZCKA 3RBZA 2XMKA 1MN9A 2GGPB 2DNOA 5HSPA 3OXLA 3B6BA 3WDOA 4DQRA 1L3KA 2MZRA 2R8IA 3R1LA 3IA0A 4HVZA 2VOOA 3T5KA 5IT4A 4C8NA 1T05B 3I9ZA 3MOZA 1RUSA 2AF6A 3W8GA 3B4DA 3G9CA 4IOBA 2CWXA 2BW2A 2WVFA 3W61A 1EJ7L 2YWFA 4ZVGA 5E0OA 3WHIA 1URNA 3I4PA 4IFVA 3UDLA 1XMOJ 4TNOA 4F0HA 3EXCX 4GVBB 3RZAA 4JI8J 1SJ4P 2KZMA 1JLFA 4U96A 1RAJA 4KSEB 3HSGA 1X5PA 3BGUA 2OSQA 3W2WB 4C98A 3ENQA 3GYXB 5IOLA 2AEMA 4NEZA 5HAOA 2P5VA 4OZ3A 3WQPA 2B8QA 4JOUA 3PO4A 5L39A 3LWMA 1YVFA 3KKFA 4RW4A 3WC0A 3TQ1A 2ZUAA 4USKA 4C11B 2OEMA 3PHEA 3FBCA 1JB0C 1BWVA 1GMVA 4IDKB 4J7CA 2OELA 5LOQA 3V6HA 2E9ZA 1TK5A 1YJTA 3LA0A 4JI1F 4ZOSA 2ADBA 3T5HA 2UUAF 4J9UE 1KQFB 1SQEA 1FRMA 4Q0BB 4N7TA 5FDLB 1RA7A 4DJBA 1ZPVA 4N47A 1HNXJ 2CVEA 4P2FA 3TAMB 3DLGA 4CNZA 3O6QA 1HBUB 3PKMA 2PT0A 2BOPA 4ZIVA 3MM9B 5B0CA 1Y5NB 3VCDA 1S1XB 4JI0J 4M5KA 3GPAA 1NDLA 2ACYA 1RLCL 4I4BA 2CIMA 3L95X 1UCNA 3MR5A 3CULA 4DSKA 4GMKA 1VC6A 1HW9A 2BANA 3BEGB 5CQGA 4Y2IA 1IQTA 2RUSA 3LPYA 4OZLA 1AFJA 2BACA 1URRA 1RU1A 2Z30B 2DNMA 3HD1A 1VQ4S 4DZ6A 2GVZA 3HF5A 2I1RA 3QJJA 4DV5F 2C2OB 4MKBA 1RWKB 1WORA 3FCHA 1R6VA 1Y3JA 2YBVA 4DV2J 4R8UA 1UW4A 1SXLA 3L7OA 1H7WA 3TVKA 4FXDA 4DUTA 2K1RB 1W2BR 2JNJA 4EBEA 4FXVA 2JLEA 1VQ5S 2HNDB 5KFCA 2H9ZA 3UN2A 2DHAA 4N77A 3NOCA 4K4YA 2RRBA 2BQRA 1NRKA 2QLXA 4QR0A 5KFUA 4FF4A 1JLEA 2AGPA 2ATLA 3TA1A 2FJDB 1RAGB 2RAQA 4ECXA 3UD4P 3NEKA 3LALA 2DY9A 4GKJF 1R7IA 1K8AT 2VBWA 3R5AA 1ZM3A 2CZ4A 3NGRA 4ILLA 5KFAA 3OXGA 3TR5A 3NOGA 3HJVA 2IA6A 3W2VA 4MK9A 2HNZA 3TJ9A 4A8KA 2VDIA 4YP3A 2XGQA 5AJ3F 1VDHA 1XERA 4QCLA 3LW5C 3ITHB 2CQPA 3IS9A 3Q2SC 4DV4F 1F9HA 1IR0A 4WFXA 5IC6B 3C16B 4OZ5A 3C14B 4WKRA 1N34F 3RAXA 1AUSL 2M0GB 1CJUB 1Y4ZB 5ITHA 3TEHB 1IKYA 4IO9Q 3UE2A 2RQMA 3RJMB 4TN2A 4MTPA 4Q7AA 4ZVPB 5HP1A 3OSPA 2DRBA 3G4SS 1PJ6A 5J2QA 4OI3A 3FMBA 1D8YA 2FVRA 1O8BA 3HVWA 4H4MA 4QWAA 2GO8A 4RW9A 1RI7A 2FC8A 2XWXA 1P9QC 4CO2A 4DN9A 4CP5A 5BYSA 3M1VA 4C48A 4F36A 4OMFG 5D4NA 2HURA 3BN4A 5GAHI 4ED3A 5HBMA 4ICLA 3U27A 5KG7A 1WG1A 3ELHA 4IR9A 1J5OA 5CD4H 4JUZA 1SH3A 2H54B 4DX7A 4JI3F 2BXJA 3PEJA 1U6BA 4HH0A 1QAYA 2EKNA 3EWGA 4ZJOA 1F5BA 3CJRA 5T14A 2BKNA 2DGUA 1NPRA 1PCAA 4K0KJ 3ZTRA 5FLXY 1D9DA 1E6VB 1FKPA 1R27B 3BPDA 2LFVA 1RWPB 3B78A 5CZXA 3QMQA 3IMQJ 4WIQA 3G87A 2FJAB 3HSDA 4X4NA 4QR1A 1NO8A 5KFWA 2LQBA 2DGQA 3SYZA 5GVQA 3CEDA 3HHNB 5BR8J 2ZHBA 3H5YA 2RKIA 3NCQA 4FXWA 3OHBA 3Q0AA 3M9OB 1N4LA 2ZBRA 3KLEA 2QRRA 3HPOA 4NI2B 4TLRA 1UZDA 2YKNB 2MQOA 1WI6A 1X4HA 2EKYA 1RU2A 2H1YA 5C42A 4P2SA 1NKEA 1DZ5A 4BS2A 4KC5A 4CH0S 4NXNF 3O3LA 1C4CA 4HT7A 4AT1B 5E7OB 1MN7A 2QMWA 5DGAA 2V50A 4I64A 4CLSA 1RTZA 2F3JA 3CVKA 1O6XA 4A8QA 3D6FB 1RDRA 4DR2J 4M5GA 4DR7F 2FY1A 5CHCB 2VQEJ 2IVYA 2X1BA 3EGNA 3QGIA 1RHJB 1IVZA 1RTIB 5DZ7A 1MWYA 2HRUA 1QY7A 2EG2A 4EU0A 2DK2A 3MOJB 5FIIA 1OYEA 3TEGA 3GJQB 2YX7A 1RT7A 5D3GA 4C0BA 3AA9A 3DRSA 1S1WB 2XZDB 1RJJA 2DHGA 2FHJD 2NXCA 5KFZA 3T1YJ 3C66A 2I8EA 1XR6A 1ZM2A 1RWVB 4USTA 2E7WA 1QTNB 3EICA 1DTQA 4AE5A 1Z2LA 1T3NA 3VZIA 2HVEA 2F7VA 1RHUB 3W5YA 3L7PA 4ITSA 4EK2A 4DPYA 2JRSA 4J9OA 2HWIA 4DV5J 1HYSB 4IFYA 4Y3CA 2D9PA 2OAUA 1IKXB 1R8AA 2GJ2A 1FE0A 2YPZA 2ZD1B 4USWA 2QEXS 3RRGA 3CC4S 2HVIA 3T6JA 4K4TA 1M1KT 5ETLA 1NH8A 3SBMA 3WIUA 2XMUA 1HNZJ 2KRBA 1VHFA 3K8WA 2YX4A 1SQGA 2H3EB 2JOQA 1TTHB 2F63A 2POKA 3HZGA 1DARA 4CQ1A 3FK4A 3PXGa 1S72S 3JSBA 1M5KC 2RDIA 2BE9B 5CYJA 5HL7Q 1HWJA 3A13A 2HQIA 2J9DE 1D8ZA 2HQCA 3F56A 3W9JA 2MGZA 2H5IB 3FEXB 3ILOA 3CDEA 4CO4A 2VPZB 1VI7A 2RRNA 4CDIA 3ETOA 1RT5A 4NA1A 2YKOA 1NSKL 1TKXB 2W2MP 1EP4A 3IWXA 1N5TA 3QWPA 4EGLA 3KWMA 1PAUB 5A6PA 4DOZA 5GADU 1U1RA 3K2YA 4PQUB 2BBEA 2J6UA 2D41A 2OD6A 2ZBIA 5A6WA 2Y1IA 3K5OA 3CDBA 3RW7A 1JLQB 1UA1A 3TUZC 1NK6A 2AWZA 4TYAA 4DQPA 1V5IB 3TYTA 3MMJA 2NZ4A 3KG4A 3PYFA 3G96A 2QA4G 1U4BA 5HMZA 1C1BB 1XIQA 4ZP9A 2B43A 2UUTA 3OLAA 2VL1A 1FEEA 2XZWA 4LSNA 4V19X 2RF2B 2XY6A 1Q8KA 2ROGA 4DSLA 1T05A 1MWQA 2OPPB 2ZWPA 4M8LA 3R5DA 4ELVA 4DLEA 1RWMB 1UJ6A 1VRUA 3HMJG 3EXYA 1YWXA 4EUVA 2CPHA 2WVCA 4WTYA 3O5TB 1S97A 2LYVA 4AUKA 3CD7A 4A8WA 3LP0B 4EBDA 1QE1B 2MDAA 2QFIA 2UUBJ 4IRDA 4ZITA 3HHLA 5SUHA 3BM7A 3HHKA 1YITS 3KK1B 2BABA 2YNIA 5F3TA 5IM0B 4X4TA 1UKUA 4I2PB 3H0PA 2ZJRQ 2GQCA 5M2PA 3MD3A 3IR6B 5I3PA 1JLAA 3DRRA 1KDNA 2J76E 3GCXP 5CYMB 3EVMA 3NY0A 4ZVFA 4P10A 3WZ0A 1N54B 3I0RB 2GV1A 3MCNA 5F9NA 2OSRA 4HYKA 2HS4A 4LF4F 1J2VA 2DNGA 2LXUA 1H98A 3V5RA 2DIUA 4YY3F 3IRWP 5I42A 1N48A 3FGVA 3MEDB 1Q7LB 1FI4A 4QOTA 2OIHA 2G2OA 2I2YA 2ASYA 2JVRA 4KH0B 1JWWA 5J1PA 1RAAB 1RXOB 1AZSA 1C1CB 1NSAA 3P4UB 3V6DB 4B3TF 4NL5A 4K4UA 2JC0A 3FJ2A 3FQKA 4KPCA 5F8LA 4WP8A 1X31C 1QE1A 4M5IA 4X66J 3L3CA 3QAUA 1HNXF 4F4KA 5B7WA 3NLCA 3J7YU 1EARA 5GAHU 1P9YA 3CC2S 1OSDA 1MSWD 4RPFA 2KDOA 2WCXA 4W90B 5AXLA 2YKAA 4CZCA 4F4WA 4LF6J 1IM6A 2NXUA 3ZZOA 3S6EA 5F3ZA 1YRTA 1WSVA 2IM3A 3NGTA 3QT5A 2YKNA 1YZ6A 2PD1A 2VFSA 4F26A 1YIJS 1FJCA 1MROB 3J7A1 1C0TA 2GMLA 5G0RA 3QJLA 2HBQB 3AXMA 3RAMA 2FVQA 2N4CA 2PMZD 3ZNJ1 4ZPCA 4JI6J 4RBTA 1S0VA 1VRQC 4LR8A 2KVQE 4U7UK 3HX9A 2B9WA 5KTQA 2DHXA 1G7CB 3OLBA 2KH9A 2ZZTA 8RUCA 5B0FA 2GNKA 2IPOB 4ZN1A 4ZLNA 4YR3A 5AE1A 1N8RT 3EZOA 3JSMA 3ENWA 1S9EA 1X4AA 4YR2A 4DR2F 1F1BB 2CQCA 1N0UA 2K06A 3DDNA 2EBGA 4JI0F 3QSYB 2NR0A 1R6YA 1YRUA 3CTRA 4GVBA 1C4AA 4L3KA 4O4RA 4ATNA 4NXNJ 1JKHA 4ILMA 4OHXA 2UVRA 3EZUA 4PXCA 1Q16B 4FVCA 2CPZA 5HP1B 4ZIWA 1QAJA 3SI8A 4ZLPA 2VG5B 4A8MP 3DOKA 4GKKJ 2HIYA 3KK2A 2DT9A 2XSFA 5CYQB 5HQ8A 2XO6A 1KTVA 2F65A 4QW9A 3M6XA 3BQ0A 2IFXA 1CBKA 2AHOB 2CRLA 4QYZK 3B8HA 2G0CA 1VYAA 5KFLA 4JI1J 2FIUA 5LJ3Y 2K2PA 3G8SA 4JI6F 4ECYA 1MROA 2K8GA 2QL5B 2KB2A 5L1LA 4FNHA 4RJVA 2QSFA 3UQSA 2UV8G 4L72B 2IY5B 1KBRA 4P73A 1DTTA 4J9PA 1KS2A 4FYXB 1G1XA 2EK1A 2Q43A 4PWDB 1NJZA 3I5CA 2XMVA 4WYLA 4Z2XA 3KLHA 4DCPB 1UJ4A 2X1AA 3FVYA 2CPFA 1F9FA 1FE4A 1CC7A 3D7SB 1PYOB 2ZD1A 3DYAB 4K8RA 4KO0B 4LBHA 3S8SA 4WFNQ 3CJSA 1JJCB 1GNKA 2G4BA 2ZM6J 4CLFA 2HW3A 3PYDA 1VBZA 4DWIA 4PG6A 5KG0A 1C0UB 2FC9A 2JLGA 1K47A 4A48A 1WEZA 2OEKA 1FDDA 3E01B 4DV7J 4NLVA 2DGTA 3BDEA 5EWGA 2GMHA 1CJKA 1SUQA 4DSJA 4FS1A 2IDLA 2OKQA 1C2PA 3D0IE 5A8KA 3N79A 1A7GE 1TKZA 4Q8FA 3JSRA 2FZCB 3UNYA 2HFOA 1SI9A 2RKIB 3PW0A 1HKAA 2KVIA 2XWYA 4WPAA 1JLGB 2NPIA 3MEKA 1PG5B 5A0YA 1OO0B 1FNMA 4RNOA 3M2VA 1KLNA 2EPIA 3AT1B 4BLGA 4U9RA 2A6OA 1VQ8S 2K3KA 2BW7A 4C8MA 5LMUJ 5M2RA 3W9HA 4BHQA 1XEZA 4NI2A 2Q66A 3D1QA 4UZBA 3I87A 4A47A 1BQMA 1PC4A 3W8PA 4GKKF 2YX1A 2ZM6F 3K5NA 3R6LB 5D4LA 3S7RA 3D0HE 3EPGA 2ZH1A 1VQLS 3Q8UA 3UR0A 4B3MJ 3HKWA 2QYGA 3FKBA 3GQCA 2HHQA 3WX8A 3PX0A 4ZCIA 1CVJA 1WDTA 3MM9A 1T95A 3TP2A 3QLHB 5AE2A 4WFYA 2Y8WA 1PBAA 3D2WA 1HIYA 1U0HB 2P9GA 1H38A 4Z7YA 1Q8BA 1RKIA 2VB6A 2QA4S 4HHJA 5AE3A 5J2MB 1YJWS 1UAWA 2VG5A 3ENAA 3NWGA 4AQYJ 2V67A 1U6ZA 3W5XA 2XEXA 2HAFA 1KP6A 1RACB 4PAAA 2GJIA 3M8PB 3D0GE 4LSLA 4LFBF 2NS1B 1FA0A 1VR6A 2AV5A 2M3DA 2GQQA 2CXEA 1OQ3A 2M88A 1EB0A 4M5MA 1ZS6A 3QSIA 1LFPA 1BQXA 3EDQB 4NPOA 4WFAQ 4C4WA 1U02A 2O3DA 2F9JA 3M8QB 4MIWA 2E7XA 3KLGB 5D78A 5J2QB 2X1FA 4ED8A 2W2OP 3HT3A 5DG7A 3TRGA 3CJ5A 2BQ3A 1UFWA 1UEUA 3TZZA 2AIRB 4I1TA 5DM6Q 4U7UD 4ED0A 3H40A 3ET6A 5L46A 4ER8A 2BMBA 3K5LA 5G0RB 1U1OA 2IM1A 3SEOA 2VG6B 4U7CA 1I6JA 2ZKUA 3HHEA 1S0OA 1BGXT 3BSCA 3TVZA 1KFDA 3CDAA 4LRFA 4DR1J 2DNNA 4IFYB 4X4UA 1F5CA 3M2VB 3SQOP 3IXQA 4TY8B 4J9SA 1Q5YA 3DHWC 3IO1A 5DO2A 2HWHA 2PO4A 4EFAC 3K57A 2NYIA 5KT2A 3KXDA 1UEVA 3GYNA 5EDWA 1RYRA 4E98A 1U2FA 1CJVA 5ETSA 1X4GA 2JFKA 3GR1A 2ZEJA 2FB0A 2YVSA 3BF4A 3EVOA 3FSXA 4WK1A 3US5A 1ZETA 4B9LA 2L41A 2HHPA 3FZ2A 3B4MA 3C6UA 1NKCA 2ZFHA 5C42B 5K8PA 3KLVA 1CQMA 2QX0A 4MKYA 1AT1B 5KG1A 4LF8F 1NSPA 2BANB 1FFSB 2B4VA 4DFPA 1CPZA 5KG3A 4ZJQA 2V4JA 3AQOA 3MM7B 1DJ0A 1G6BA 2XI2A 3EUNA 3QNWB 5LXYA 1X4BA 1VRUB 2DY1A 2WK4A 3LTOA 3R5BA 4J37A 2XMAA 2NQPA 2GO9A 3M8WA 1F2GA 4P71A 5HJXA 2F8EX 3R97A 1RTDB 1DURA 2LA4A 2VG6A 2HYIB 3U1NA 2L3MA 3L7UA 2C2DA 3GIRA 4O44B 4P7TA 4CH7A 1JNRB 4K4XA 1HHTP 5IT9U 2N3OA 4QW8A 3TI0A 2KFYA 2LQJA 2B8PA 4HDGA 4ED6A 1SB6A 1HQ2A 2P6TA 2B9EA 3OXFA 4JI7J 3J81Y 5F8GA 1R3NA 1HNIB 3IBFB 5KFJA 4DV1J 4ZN3A 2HQ3A 4H4KA 2RT3A 1E6VA 1FKPB 4DS5A 1SKRA 3NBPB 4ZCMA 1PJ5A 3KLIA 3POTB 3QATA 5LL6d 3VR1A 1HBUA 3GP9A 1OWXA 1ZPWX 2Y1RI 3R5GA 1MNEA 4LSZB 5L8RC 3TUJC 2L48A 4Q44A 4F50A 4ED7A 1N6QB 3RBEA 1X5SA 4RU9A 4PYDA 4HACB 1CULB 4KHRA 3SQGB 2DIVA 3I0SB 3DLHA 2W9AA 4JV5J 3DXSX 4P6QA 3SDEB 3OFEA 3DGVA 3RGIA 2MJNA 2ZBPA 1Y9OA 3C14A 3OTCA 3QT6A 4U8YA 5JMNA 5E41A 3PFEA 2WSEC 1X9WA 2MYFA 1T11A 2CNNB 4X4RA 2WTFA 1LWXA 5ETMA 3PJ9A 4EWTA 4IOCQ 5DM7Q 2JEGA 3IAS9 4WCEQ 1TVRB 4OJ1A 5IQQA 1TL7B 4DV2F 1EP4B 2M4MA 3NXZA 1WC6A 1RK8A 1IKXA 1P1TA 2M5YA 2LMIA 5DG8A 1HQEA 2DB1A 3OTOF 1JLBA 4KPYA 4LF6F 4C8YA 1I3OB 1ZM9A 2MY8A 4DR6F 1NUEA 1N0VC 5G4DA 5K8NA 1Q1KA 1Y10A 3IS9B 3ITHA 1I94F 3CO9A 4DV4J 1F6TA 1UVKA 1RE1B 2JC1A 2K7KA 2LQ5A 4L75A 2KFZA 2JZ5A 4NLPA 3H20A 4F4YA 3OV7A 5JUMA 3Q8SB 5A0YB 2XS7A 3NMRA 1RBLA 4PYAA 3S1TA 2BJ1A 4IRCA 3P6YC 2HVHA 2XCAA 1S0MA 2RS8A 5DRKA 4IR1A 3HZEA 2AX1A 4CTAA 3IRXB 4MJKA 5AXNA 1OY6A 2CADA 2NSBA 4QIEA 3MTKA 5GADI 3MR6A 4JYAF 1G3OA 1X4CA 3D3BJ 3T3FA 1B7FA 2D3OR 3PW2A 2KN4A 8ATCB 2KHDA 2JLFA 2ATCB 4DS4A 1JJHA 4NEYA 1EKRA 2XYGB 2AU0A 1DY3A 5DQGA 3KJVA 2IJRA 4MAKA 1JK9B 2OP5A 1W2IA 5FD1A 4K4ZA 4J5OA 3DFEA 4KQZA 3ZZTA 2XMWA 1UVIA 3HK2A 1JQGA 3ZZUA 1RA6A 2WOMA 2D74B 1HBMB 2EEYA 1TK0A 1HNWJ 1TMMA 2CG8A 4TY9A 2VPYB 2E1RA 4HHUA 5KFSA 3K0JA 3X3UA 2VG7A 3HFKA 4LT6A 5AXKA 2YQ0A 1FRHA 2A6MA 2W4PA 3UPFA 3OSNA 3IBWA 3P5TL 1RTJA 3M7VA 4YS2A 4URSA 4C7QA 5GAEU 3CF5Q 4QWDA 2C2RA 1U1KA 5ETKA 3RB0A 1KQSR 3DRPB 3MPDA 4ZPBA 1FRLA 4HTJA 3BQ2A 4LQ9A 5LJ5Y 3LH2S 4TU9A 4NRTA 1S1XA 4IQXA 1RYSA 3ICLA 3BYRA 3FBBA 4NLRA 2ASDA 2ABYA 5KFTA 3M8QA 4RKUC 1PO6A 1TELA 2FJWA 2WB4A 3NL0A 2UP1A 3JTPA 1SJQA 2ZZNA 3UCZP 5AXMA 3M2UA 1IM4A 2KO1A 3Q8RB 4CM0A 2CDRB 3JTNA 1MLAA 2CAJA 5SZTA 2BM1A 3MPUB 3MUVP 1HI1A 1GXTA 1AYEA 4AL6A 1XR7A 1H72C 3N28A 4NZ0A 2VBZA 2CG4A 1UWBB 2GZOA 2HFZA 3IG1A 4PPDA 1M5HA 4AYBD 1WI8A 5CAAA 3W65A 2DGSA 1FNXH 1YJUA 4DV0F 2PMWA 2CQDA 3AOCA 3NMAA 2G1DA 3PO5A 2FZGB 3AJDA 3OR1B 4MFBA 2HHVA 4FP9A 5IC4B 1WTFA 3NRBA 4WKYA 1JLFB 1G4CA 1HPZB 5K14A 4OHYA 1WELA 2CVIA 3VHQA 2JJ4D 3UI3A 2VC0A 2ZNYA 1PIEA 3UD3P 4LIRA 1U0SA 4A8FA 1FWKA 1NEEA 2QA2A 3MEGB 4PXBA 1YTYA 4K4VA 2XO7A 1RHKB 2VQFJ 4DCOB 3P49B 1S6PB 1E6YA 3AB4B 4O3SA 2H48B 2NCKL 3GFXA 3V6KA 1SIWB 2E5GA 2W2PP 1KFSA 1FJEB 1N34J 3H5XA 4LF5J 2QJ3A 3BQ1A 2QG9B 2UU9F 1EQ0A 2EFOA 1FD2A 4J9NA 4G3IA 5C7PA 1OIAA 3S01A 1RHMB 3AHPA 2LU2A 1FRKA 4I68A 3A12A 3C6TA 3MCSA 3MPWA 5A2QY 2ZH3A 2PFDA 2J6TA 2VKRA 4I6WA 4USHA 1KLMB 1S1VA 1VJQA 4QYZJ 2MPUA 2J0XA 2RIJA 3DGPB 4ALZA 2XHCA 1N36J 4CO5A 2R7VA 4F2RA 3CSKA 3IR7B 1TL5A 1M1GA 1FXRA 5HN0A 4TQRA 2DR8A 2BDPA 2HK2A 2OTLS 2UVUA 1AROP 4IG3B 3QRQA 2E5HA 3AJ2A 3UR3C 2C3UA 3JXOA 3VV2B 1HBNB 4DF8A 2OTJS 5KFFA 3AOAA 3VAMA 4NCBA 1XNQJ 2XLIA 3H2LA 1TL1B 5HATA 3FSIA 3EX7B 4KO0A 4HKQA 2MZ1A 1QSSA 2JVOA 1T03B 2HNYB 1W7WA 3KNGA 5C2GA 2IBOA 2AZ1A 1S49A 2XS5A 4OHVA 5KT6A 4Y65A 5F0UA 5A8WB 5K9FA 4AL7A 5HI7A 2ZBCA 4LF2A 4K7QA 4DQIA 2R7TA 1FKAF 1S1UB 1K0TA 3E01A 1YDLA 3DMJB 4C8LA 3H2UB 3EVWA 4NA3A 5HK4A 3TAPA 5MAOA 3M05A 3P45B 3PYEA 2M52A 4TY8A 3GJRB 4QWEA 1VS3A 4ZDNA 4ID8A 3NNCA 2KI2A 1X0PA 2RMLA 3I4HX 1J5EJ 2RH3A 3HCXA 3MEGA 2HGLA 2XMTA 3QO9B 4ZVRB 1VJWA 1WOOA 1TUWA 4ZVUB 4QQBA 4UY85 5KT3A 1TFYA 5IWAF 4KHPJ 4MYTA 2CNOB 1P6TA 3JAMY 3T5JA 3ET6B 3H90A 3NWRA 2Z2MA 4PWDA 2LEBA 1TFWA 4DQSA 3CJKA 1X4EA 4CM2A 3WBZA 4QIFA 1U2CA 2YWGA 2R7OA 3TAQA 3GV7B 1NH7A 4IUFA 2HQDA 4CLKA 3UVJB 1J27A 1OYDA 2B4OA 3AD7C 3LQVA 3P3DA 2YH0A 4DSIA 2AJFE 1HA1A 2M7SA 2OGUA 4OLPA 2ILZA 4I6AA 4RR5A 4ANEA 5H1SV 5AJ3J 3MR3A 2VICA 4DSFA 2AW0A 4ILRA 1NB7A 2V94A 4I7FB 2MKKA 1WKKA 1BLUA 2LKZA 5D0HA 2PC6A 1Q79A 4C2MA 2CQHA 3RTVA 2FJBB 1VQNS 2WONB 3DOMB 2AYBA 2PI4A 4GC7A 3GFZA 1DHMA 2PIIA 2RVJA 4W98A 3H4DA 1LWEA 3POTA 3OR1A 3T9NA 4WF9Q 1Y7PA 2AJ1A 1Q4RA 5LT5A 2YTCA 4F67A 5D4OA 1JLCA 1U7LA 1SL2A 2DH7A 5HMXA 4DR4J 1XMBA 2YY3A 4A8OA 1IBKJ 2PSZA 1FX2A 1JXVA 4USIA 2OH2A 1VRTA 3OTOJ 3PRDA 1O51A 2YH1A 3N5FA 3PEHA 2HHHJ 4OYBA 2KT5A 3KLFA 4M63A 1RTJB 2EI5A 4O44A 2FLOA 4G1QA 4L6V3 3WIVA 1U47A 3N4WA 4ZP6A 1UPPA 1REVA 2QGFB 1QUVA 3QO9A 4I67A 3DOLA 2KXFA 1LXNA 1PYTA 3TA0A 5ADZA 5IT0A 2EC0A 4N5SA 2OPRB 4M94A 3MM7A 3EYZA 4F02A 1VQ9S 3CD6S 4ECWA 1I5OB 4OJGA 4Y2MA 1KVKA 2HZCA 4EBCA 3M6VA 2HFVA 2RJZA 3PG9A 4FZVA 4I2PA 1M5PC 3EZ5A 3GSDA 4QBUA 2YNIB 2CJQA 2HKEA 4KTQA 2F40A 2H65B 4NLUA 3EPIA 3N0VA 5ETQA 3MPVA 3MI7X 3VVUA 1FDNA 3PIPQ 1JMTA 4MYUA 3Q2TC 2GCFA 1HARA 3MM6B 4QIVA 4LFAJ 2IMOA 4UOGA 1U1LA 1U48A 4JI4F 1RT3A 1DBDA 4RW6A 3FRZA 4YFUA 3KLFB 2X3GA 1U1PA 2FYXA 1GTEA 3BSOA 1U8SA 3M6WA 2FJEB 3EGWB 1J5EF 4IH7A 2YKMB 2RSQA 2IVFB 4N76A 2CZVC 1EKSA 2R9LA 3CCSS 5ETPA 4DV6F 2CYYA 4A8XA 4LSNB 1X9SA 1VBKA 1ZA1B 1KLMA 1S1VB 4H54A 2C3PA 3SIPB 1FTCA 4ZVTB 4URGA 2VPXB 1WHWA 4DUYJ 4A8YA 1JJ4A 3U1LA 5DG9A 2B9YA 4CI0B 3HXMA 3KYLA 2W2NP 4URQU 1XJWB 3MMCA 2D3UA 3IWLA 3BO2A 4FYYB 2ZE2B 3ZNUA 3R1HA 3NGSA 3ZZYA 2AMCB 4M5DA 4DU8A 4L76A 4ERDA 2XHWA 4NCGB 1BQNA 2COLA 2ZBQA 3A8IA 1DLOB 3DI6B 4PCQA 3PX4A 1TV6A 1A6LA 3BKUA 3KHLA 5HROB 1KWMA 1FESA 3R8YA 5C24B 2BJ9A 1UZHA 2J9EA 1GMUA 1T02A 2CQ2A 1TKDA 4F3OA 4GVLA 4N8OA 1VK3A 3O44A 3R9LA 2ZE2A 4HACA 2XLJA 2QIFA 3M2RB 2GFFA 4KKOA 5F9LA 4ED2A 2CPEA 4X84A 4B3SJ 1NHUA 3BGRB 1DLOA 1HWIA 3DI6A 3I5AA 3QYYA 1NZ8A 4HL9A 1VK8A 1I94J 2WAQD 3R3TA 1HFEL 2HBZB 2DXFA 3IC1A 4AL5A 3T1HJ 3GB0A 1HNIA 3TVYA 3W2VB 4WZMA 3QT8A 4OYMA 1P1LA 3PYGA 2ZH7A 3M2UB 2XBPA 1FWLA 1EX8A 4QZVB 1T9TA 3H4BA 1N56A 1NK0A 5IQ6A 4DV3J 5DZ6A 1UFLA 4L74A 4RW6B 1YJRA 3RBXA 3HO1A 1YX2A 3L9ZA 4QWCA 2P6SA 4LIWA 3AB2B 1SJFA 4RW7A 2HEKA 3GFHA 3FEYB 3CJ8A 4CIOA 1PGZA
chains in the Genus database with same CATH topology
3M32A 5C25B 4GC6A 3MECA 3M8SA 1RP5A 1KVJA 5J1EB 4DEZA 2W7PA 2IRXA 4Y0FA 2XY5A 4MIBA 1JXEA 3KHHA 3OL9A 2VZ9A 4R8UB 3SV4A 2DNHA 4R25A 4C3KA 5LSOA 1APSA 2EFNA 2DNLA 2WW8A 1N5YA 5F41A 4PRFA 3DLJA 2R7SA 5B09A 3PZPA 3RB6A 2IRYA 1XC9A 1ZAWA 1UVLA 3SSRA 4B17A 5CA5A 3T19A 2VV5A 2QZ8A 1ZTTA 2AX0A 1LQ9A 2JX2A 4H4OB 3T1AA 1C0UA 5EWEA 2OPRA 4DL0C 1FKOB 2U1AA 3MM8A 1ROFA 2AP6A 4DHVA 3I0RA 3KG0A 2O67A 1SJRA 2DNPA 2Q3PA 4E8UA 3I5BA 3MDFA 3HM9A 2M8DB 2A3JA 2G13A 3BGFA 4B3SF 4BDPA 5EWFA 2M9KA 3I31A 1LOUA 2EK6A 3MHYA 3OJSA 3FNNA 3Q22A 4FF3A 4PPZA 1WF1A 2PA3A 5CZVA 4O3RA 2WBRA 1NKBA 2B56A 4ZA1A 4D3GA 2UUBF 1IN0A 2KHCA 4FYDA 2HHHF 1B0PA 5JXSA 1SH0A 3DLEB 4FF2A 3CB4A 1G2EA 2RS2A 4P7VA 4TYBA 4NMLA 5KFDA 2AYGA 4ID5A 2AYEA 2ZNZA 2JEIA 1S9FA 4MFBB 6FDRA 1GXUA 4RNMA 4HH1A 2DVIA 2B0GA 1IKWA 3CJ3A 1VQMS 4KIAA 1W25A 2I0XA 5D4PA 3CCTA 4OZ1A 1FCAA 2NUUG 1Q53A 1HD0A 1ZTWA 3CT9A 3JSMB 3NAIA 2J8AA 4C8KA 2CQGA 1Q78A 3I0SA 1N33F 1FXLA 4PQUA 5IT9Y 2R4FA 1QAXA 1T94A 3NG8A 4G6VB 3K8VA 4G1IA 3GIJA 4WJBA 4GO5X 5KOXA 4DQQA 1B0TA 4U67Q 3NBPA 4OX8A 2R2TA 4ECVA 2C2EA 1FJGF 4PKDB 3KK3A 3NS6A 4OLOA 4ECSA 2R7XA 5B0DA 2VASA 3MMCB 2HLUA 1N5QA 2RU3A 4ELUA 1YHQS 2WSCC 1WHXA 3DXBA 3NGKA 4BC7A 5KFEA 3OVSA 1S76D 2PMHA 1N52B 3MAHA 2QV6A 3E3XA 3FMWA 2HMIA 1MU2A 3G6YA 2CQBA 2R7RA 2V5HG 2ZH2A 5LMNF 3DDKA 4K4SA 3OTEA 2EBEA 2XCPA 3CMES 4F8RA 4OI4A 1TUVA 2W9BA 5DDRC 3DM2A 1PSDA 1U45A 3CD5A 1FT8A 2HIQA 4O0IA 4GO7X 1QVFR 3IN5A 1RT7B 5KT4A 3UCGA 4B9SA 3I55S 2OO4A 3MM5A 2UXDF 1P8GA 2DO0A 4IG3A 2V9KA 4ED5A 4Q43A 3VAIA 1JLAB 3DRRB 1QM9A 5IXUA 1X0FA 1R89A 1RKJA 3IFEA 5KFPA 4ZKAA 5J1NA 4IOAQ 1VQSA 2PN6A 3DC2A 4ZP7A 1TK8A 1BD6A 1NJWA 5J2NA 3JB9k 2IM2A 3K58A 1LW0B 1R8BA 1S4FA 3HHLB 3DOLB 1NHVA 4ZPWR 2KM8B 2L9WA 3MFHA 3R27A 1REVB 4YMEA 3H25A 3IRXA 1H2UX 1NAQA 4BWMA 4NLYA 5BR8F 4J9KA 1Y00A 3KFWX 3J7Z5 4E0DA 2YQ3A 1S6PA 4Y2KA 1FRJA 2XMMA 4KE5A 5GAEI 4LF9F 2CQ1A 3TX8A 4AXJA 2VQFF 2RU9A 3RR8A 2LQ9A 3M6UA 4K0KF 1B0VA 1H7XA 2Q6BA 2R8HA 1TQLA 3PW0A 3FFIA 1LWFA 3LGMA 2N7CA 3SV3A 2HLTA 3QIDA 1VQ6S 2PI5A 3OVAA 4C9DA 2MKCA 4YR0A 1KSPA 2CJBA 3FRYA 1J5OB 4AQYF 3MEEB 2Q6CA 1X5OA 1YBAA 3GIMA 1ZYQA 3ZC4A 5J2MA 2KT3A 4NX9A 4EYHB 5DGBA 1BC6A 5EX0A 4B9TA 1FO1A 4Y6IA 3ULHA 3TANA 4M95A 1D1UA 5KFIA 4C8ZA 3PJXA 3CCVS 3OBIA 3HHLD 2KTQA 2JL9A 3WX4A 1NZAA 4AFFA 5C5JA 1MMLA 5EGYA 3Q8QB 4CCHA 2LVWA 1N5VA 4DSEA 2KU7A 4RX6A 2ZUGA 1TL3A 1KTQA 2R7QA 4XDDA 3PIOQ 4CT8A 1VMBA 2XI3A 4I2QA 1X5TA 3BSNA 1O5JA 4XPCA 4LF5F 1Y5LB 1VBYA 2RUGA 5I42B 2WOMB 5H9EJ 2FHJA 2IJFA 3C6TB 2DGVA 3NAHA 1UL3A 4KR0B 3H8YA 5B0GA 5DQHA 2JWNA 1MW7A 1H3DA 4R0EA 3LANA 2GIRA 3N6NA 1JX4A 2MKIA 4YOEA 5B0EA 1E6YB 1M0SA 1R8PA 3VTIA 4DR4F 1DRZA 2A1BA 3V4IB 4B3MF 2Z8QA 3BR9A 4DF4A 2JEJA 2BM0A 3LP0A 3KLEB 4NLQA 4G1QB 3VWSA 2R8JA 2V9WA 3BGLA 5DQIA 1KN6A 4ECZA 1X8DA 2A10A 1HMVA 2VOPA 3H5SA 5E3AA 2IC3A 2RF2A 2U2FA 2AJ0A 3D1HA 3KOAA 2J9DA 5A8RA 3HHLC 3QWUA 2MHEA 3DLGB 2A2CA 4X2BA 1RTHA 2LCWA 4LSLB 3FSYA 2ZH6A 3CXCR 4RNHA 5KFHA 4EO8A 2ROEA 5K8OA 4WE1B 1QTMA 1JKHB 2PA8D 3QGGA 3MAQA 2MZJA 3BB5A 1QVGR 3V2UC 2XS2A 4C8OA 2UV8A 5CYQA 4C97A 1IJFB 4K5RA 3KK2B 4ZPTR 2B5JA 2HWTA 3OR2A 3QLHA 3OTDA 4KBIA 2DR9A 4EZ9A 1FHTA 4NA2A 2N7YA 1WF0A 2WSFC 3CIMA 3NS5A 2O01C 2V8HA 1UMJA 1NJIT 3W2WA 1GAOA 4NOHA 4HI1A 2MQQA 2ZOGA 1XNRF 1X7VA 3OL7A 2HHXA 4NLXA 1N5SA 1XN9A 1OSCA 2L9DA 3FDSA 4WU2A 4BWJA 5A8RB 1U1NA 3OVBA 4I56A 2RILA 2VG7B 3CD0A 4YB6A 1FRXA 2EW9A 3LOUA 2MZQA 1SJ1A 3DNCA 1WD6A 2J7WA 1V3ZA 2VFTA 1FDAA 1X4DA 2YKMA 5KFQA 4DR1F 3D28A 1HBOB 1FVSA 4QWBA 2VBXA 4NZ7A 3DLKA 5J2PA 2CPJA 2XY7A 3J7ZT 4TQSA 3VAGA 4QYRA 1S9GA 1Q7YT 4OIXA 4OHZA 2VFRA 4NXMF 4IH5A 4RWXA 1U2RA 2ZH9A 1GTHA 5M2UA 3MGJA 1YQHA 3PR4A 3MZIA 2E9RX 2LEAA 4OZJA 5JVHQ 4N41A 3UNGC 3MEDA 1UJ5A 2N4DA 2W7AA 3HVTB 4CTAB 3RB3A 5L9NA 2XNQA 3DLLQ 4KFBA 1F60B 1RT1B 4O3NA 4DR5F 3GILA 1CC8A 2JHEA 2F8HA 1IQZA 2P9EA 4HT5A 4PG7A 2X51A 2VKZG 4TU7A 4TU8A 3CCLS 3AA8A 5KG6A 2E5LF 3RR7A 2KG1A 1ZBTA 4O4GA 1LKZA 3KJVB 5L1IA 4F4XA 4DG1B 2C22A 4DL2A 1TAUA 1Q86T 2W4DA 2ZJQQ 2O66A 1VBXA 2AJQA 4TXSA 3GE9A 1RT1A 1I1GA 4MH8A 1TAQA 1NNDA 3DU6A 1KOOA 4L3NA 3IAM9 1MU2B 1IBKF 4LFCF 2FTRA 5EX3A 1MWZA 1QLNA 2OFHX 1YJVA 3SCJE 3KG1A 5J1EA 4ELTA 4Q8EA 4YDXA 1JJ2R 2YKQA 4OI2A 1L5UA 1A9NB 2QA1A 3ZZ0A 1KHWA 4M1KA 1WHYA 1ZOTA 5F8IA 2VQEF 2I5JB 5DLGA 2KJVA 2V8VA 4MMOA 2WHOA 2GIQA 2ZITA 4RW7B 1F5AA 1S7HA 1NK8A 3M1VB 2XLKA 4BBYA 4B9NA 2EFVA 4C11A 4X4SA 3HHDA 1U24A 4CO0A 2XGPA 3HP6A 3KHGA 4OI6A 4RW4B 1VQOS 3DOKB 3KLIB 4USJC 3CCMS 5KFGA 3DU5A 4FNIA 4I0WA 3LP1B 4DLGA 2ZVSA 4C0OC 3I6PA 2WRMA 3LWLA 1TP7A 2YWHA 1TKTA 3SDEA 2RNEA 2V0NA 3PFOA 4F3QA 4BC9A 4OL8A 2ZHAA 1R0AB 3DCAA 2IBKA 1KR4A 2BYCA 2B5JB 4PG8A 1NK9A 1XBWA 1ZZFA 3DRXA 3HKZD 4KHPF