3JB9k

Cryo-em structure of the yeast spliceosome at 3.6 angstrom resolution
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
89
structure length
89
Chain Sequence
b'TLYVNNLNDKINKNDLRTALYMLFSTYGTVVDIVALKTPKMRGQAHVVFFDPSAAAIAMKALKNFIFFGKEMKIQYAHSKSKIIERIVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pre-mRNA-splicing factor spp42
publication title Structure of a yeast spliceosome at 3.6-angstrom resolution
pubmed doi rcsb
molecule tags Rna binding protein/rna
total genus 22
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2015-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
k PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3jb9k00
2MY8A 3OW2R 1UAWA 1FJ7A 1H6KX 1OWXA 1JJHA 3MOJB 1U1OA 2L9WA 3P6YC 2OIHA 3CCLS 4WFBQ 3CPWR 4V19X 5GAGU 2JRSA 1WI6A 2FC8A 4CQ1A 2M8HA 1S79A 2CPFA 3ZZZA 3U1LA 2DGUA 2NLWA 2EK1A 2LA6A 2MSSA 1H2VZ 2KXFA 2DNZA 2DH7A 2DGVA 3SDEB 5GAEU 2DITA 4IOCQ 2VOPA 5DDOC 3THPA 3EX7B 5ITHA 2AYGA 1A7GE 2Q79A 3CCUS 3Q2TC 1F9FA 2FHOB 1X4CA 2CJKA 4F25A 2X1FA 1R8PA 2OSRA 3JB9k 1WHYA 2CPIA 3J7YU 4TU7A 2MHNA 1U6BA 3TP2A 2QA4S 2B0GA 2M88A 1VC6A 2FPHX 3CCVS 1VQ8S 1WTBA 2KN4A 2DHAA 1VBZA 2KHCA 2KM8C 2OTJS 2RU3A 1M5OC 2YKAA 1WEXA 2RS2A 1VQMS 3RW7A 1NU4A 3G8TA 5LSLA 2D9PA 2HZCA 1X5OA 3P5TL 2OTLS 3MUMP 1VBYA 1SJQA 5H1SV 2CPHA 2RRBA 1WG4A 3UCZP 3MUTP 2MKSA 2KXNB 1WEYA 2MY7A 3CCES 1M90T 2U2FA 4QPTA 3MUVP 1M1KT 1QVFR 5CXTA 2DGOA 2LXUA 3CD6S 2DIVA 4BS2A 2DNNA 1X4HA 3UCGA 3G71S 3TYTA 3CF5Q 5GVQA 4F26A 3N9UC 2DNRA 2HGLA 4Z2XA 1IQTA 3CULA 2MZTA 1Q81T 2M52A 2RNEA 1RK8A 2F3JA 2MQLA 5IFMA 4TLQA 1KOHA 2SXLA 3G4SS 1VQ5S 3CXCR 2CQCA 2RS8A 2LEAA 1KQSR 4QU6A 3VAIA 2MZSA 2CQBA 2G1DA 1NJIT 2NZ4A 4CIOA 3CC2S 2DH8A 3BO2A 1WHWA 2QFJA 4UQTA 2DISA 3NNHA 3P49B 1SJFA 1P27B 1SXLA 1X5PA 2LMIA 5IQQA 3UWTA 2MKJA 4U67Q 2M8DB 2YH0A 3BEGB 3G9CA 2VOOA 1WHVA 2PEHA 1UW4A 2CPJA 3B4DA 2MQPA 2MKIA 2HGNA 2N3LA 2CQ3A 2LCWA 1URNA 2RT3A 5LXYA 1VQLS 5CA5A 3S8SA 1JJ4A 1VQ7S 1YJWS 1WI8A 1VQ9S 2KH9A 3I55S 2ZJRQ 3EGNA 2CPZA 5DDRC 2HYIB 2ZJQQ 3CC7S 2MJNA 2CQGA 2N3OA 2ADBA 2EK6A 3RW6A 2KG0A 2WBRA 1U1MA 1SJRA 2CPYA 1QM9A 3NS5A 3EGZA 2M4MA 1AUDA 3MDFA 3MURP 2KFYA 2KU7A 4W90B 1NO8A 2RQ4A 3B4MA 4W92B 2N7CA 3SXLA 2YH1A 3R1HA 5DETA 3UCUP 4YUDA 1X4AA 5D77A 1VBXA 3U1MA 1RKJA 1VC0A 2K8GA 1N52B 2MGZA 2ERRA 4TU9A 2E5IA 2V94A 1K8AT 1A9NB 1YJ9S 2RUGA 2L08A 4WFAQ 1D8ZA 1G2EA 2QEXS 1N88A 2O3DA 1VQKS 2LA4A 4LMZA 4WCEQ 4UY8T 4LJMA 3G8SA 3NS6A 3VAMA 1U2FA 3NNAA 3MI7X 2YWKA 4FXVA 2LYVA 3R1LA 2HGMA 3TO8A 1WF1A 3SMZA 2DHXA 2D9OA 2DNKA 4QQBA 2J76E 2KG1A 4J5OA 4LIRA 3SDEA 4P6QA 5D78A 1U1RA 3BO4A 2KI2A 3BS9A 1UP1A 2JVOA 3THTA 2DK2A 2MZ1A 1YJNS 2CQPA 2RVJA 2X1AA 2ADCA 1O0PA 1XN9A 2BZ2A 1CVJA 5HO4A 4ZKAA 1OPIA 4TU8A 1HL6A 3V4MA 3UD3P 2X1BA 4M5DB 3L3CA 4OZ1A 1M5VC 2DNMA 3MD3A 5CYJA 1L3KA 5DDQC 4C4WA 1WG1A 3VAFA 2VODA 1X4GA 5IM0A 2KRRA 2MQNA 4WIIA 3BO3A 3VAKA 1WG5A 2F9DA 4YB1P 2FY1A 5GAHU 5DM6Q 1BY9A 2JVRA 2XS2A 4WFNQ 2MXYA 2RQCA 3FEYB 3ULHA 2U1AA 5LJ5Y 2DNPA 4WKRA 1WWHA 3R27A 1ZZFA 3IRWP 2CQIA 1VQ6S 2CQ1A 1WF2A 2DO0A 3P3DA 1DZ5A 2G4BA 2MQQA 1K9MT 2E5GA 1HD0A 2DGSA 4CH0S 3CTRA 5LJ3Y 1K73T 4Y00A 3MXHP 2CQ2A 4A8XA 2KRBA 1YTYA 2AD9A 5JVGQ 2DGWA 1N54B 2M7SA 1U1PA 1WHXA 3I56S 1OIAA 2UP1A 4PKDB 2X1GA 2MKHA 2J0SD 2XS7A 3ZZYA 2HVZA 2MGZB 1JJ2R 4C7QA 3CCMS 3S6EA 3VALA 2MSTA 2DNYA 3LQVA 1JMTA 3S7RA 2CQHA 1X0FA 1U1QA 1WF0A 3HI9A 2DGTA 1Q82T 3CC4S 2KVIA 2DGQA 2KYXA 2YTCA 2CPXA 2LECA 1X4DA 2LXIA 1M5KC 1SJ3P 2N82B 2CQ0A 3VF0B 1VQPS 2K3KA 3NNCA 4WF9Q 1FJEB 2EVZA 1X4FA 1SJ4P 1U1KA 1UFWA 3UE2A 2XS5A 3HHNB 2MZRA 2DNLA 3FEXB 2AYMA 3VAJA 3MD1A 1U6FA 4IO9Q 1FJCA 2DNGA 1M5PC 3CMES 2E5HA 2DIUA 1VQNS 1HD1A 1YHQS 1W2BR 1B7FA 4RU2A 2XB2D 5LXRA 3H2VE 2MYFA 3PIPQ 1X5SA 3CCSS 1PGZA 5GMKa 2OSQA 2XSFA 2JWNA 2LEBA 1KOOA 3CUNA 2M70A 2AYEA 1S72S 1VQ4S 1FO1A 5EN1A 2DNOA 2MKCA 3NMRA 2MKKA 3US5A 2L41A 4PRFA 2G0CA 4IOAQ 4YOEA 3CMAS 3D2WA 3PIOQ 1FHTA 2DGXA 5LSOA 3IWNC 2MJUA 4C0OC 2FC9A 1Q86T 1Q7YT 1U1NA 2F9JA 1KC8T 3G96A 2CPEA 4CH1A 1H2UX 5IM0B 2LKZA 3CCJS 2M0GB 1X4EA 1YI2S 1WELA 1QVGR 4ERDA 1ZH5A 2BOPA 1DBDA 3S01A 2MMYA 2DB1A 4FXWA 4F02A 2JX2A 1DHMA 1HA1A 2XNRA 5HL7Q 4QU7A 1VQOS 5BJRA 2DHSA 2MZJA 5JVHQ 2ZJPQ 3VAHA 1KD1T 2MZQA 2KM8B 3DLLQ 2DNQA 2M2BA 2AYBA 3K0JA 2A3JA 2OJ3A 3Q2SC 2CPDA 4ED5A 2DO4A 4Y0FA 1WEZA 1DRZA 2E5JA 1FXLA 4OZ0A 1OO0B 2KXHA 1YITS 3CCQS 1FNXH 2KT5A 4PR6A 1VC5A 5GADU 1N8RT 2CQDA 2PE8A 3CCRS 2DH9A 2I38A 2J8AA 2MQMA 3LPYA 1X5TA 2CQ4A 3H2UB 3UD4P 1YIJS 1YWXA 1P1TA 1FT8A 1PO6A 2LQ5A 1D9AA 4IUFA 1X4BA 2MB0B 2I2YA 2DHGA 1H2TZ 1U1LA 1R8HA 2MPUA 2D3OR 2DNHA 5DDPC 1ZZNA 2RRAA 2E44A 2GO9A 2VONA 2MQOA 2J0QD 3J7ZT 3VAGA 2GHPA 5DM7Q 4EGLA 3DXBA 2XNQA 5FJ4A 2M9KA 3G6ES 5MLCV
chains in the Genus database with same CATH superfamily
2AJFE 3P8BB 1KHWA 1W25A 3T1YJ 5E3CA 3KK2B 3HK2A 4A8MP 5T41A 3CPWR 2JFDA 3PJXA 4ZJQA 3LH2S 2RH3A 2MSSA 1R8AA 1JNRB 5KFBA 5KFJA 5CD4A 3M8PB 3IR7B 4NLVA 3J7Z5 1NLKL 3C14A 4DR4J 4BWJA 3V4IB 1GXLA 3VGUA 2GO8A 3MM9B 2B4UA 2ZH2A 5B0EA 2ZNZA 1NRKA 2AZ1A 4DQQA 5RUBA 2VBXA 1DARA 3VQSA 2R8HA 1Z2LA 4GC6A 3G8TA 2XYGB 1U49A 2XGPA 1S1WB 2E1AA 2J9DA 4DV4J 1KNZA 4KHRA 3NGTA 1WEYA 3MUVP 4QPTA 3GJRB 4K8RA 2OAUA 1NK5A 4Q8FA 3MMBA 1RAOA 3W5ZA 2HMIB 4X4VA 1S97A 1WKKA 2HQ3A 1PKUA 4N47A 1N0UA 2LEAA 1UTAA 5G0RA 4FNIA 3TVZA 5LMNJ 2J8SA 1X5PA 2IJNA 4DL7A 2YH0A 1NJXA 1WHVA 2FHKA 3QSYB 5B0BA 3CGIA 4OYMA 1JJ4A 2NXUA 3C19A 5HBMB 1ZA2B 3B54A 4MH8A 2N3OA 3QT5A 3IG1A 2VUGA 1SJRA 3EXYA 3KLHB 2NUHA 3TZWA 2DTJA 2WAQD 3M05A 5D77A 4KHPJ 3U1MA 2C22A 2HG4A 2I1RA 4DL3A 1DY3A 2V63A 3GQCA 2BEFA 1OSCA 4UY8T 1XMBA 1E6VA 2V2ZA 4M5KA 1YX2A 2DVIA 1FWKA 4UOCA 1T11A 1GTEA 4P2FA 1KSPA 2LYVA 3Q8RB 4J5OA 3U27A 1QDUB 3A4TA 2B7CB 1RT6B 3EZUA 1FRMA 2DK2A 1P8GA 1RT7B 2QX0A 1IBKF 1V3ZA 2BE2A 3H25A 2ZH8A 4TU8A 1UVJA 1HL6A 5M2UA 2FJBB 3T5KA 1TKXA 4JI1J 1VRQC 3TX0A 2EG2A 3PRDA 3MF5A 5GAHU 4Y6IA 1CULA 4KGMA 2HEKA 2R7VA 4KGZB 2IM0A 2BJ7A 3MM6A 1S12A 3M8WA 3BSAA 1VQ6S 2CQ1A 4OZ3A 5L38A 4NWBA 5KT7A 2DR8A 2ZC4A 3IR6B 3E3XA 3TAMB 3N28A 2P9EA 3R6GB 2M7SA 3DOMA 5A0YB 4HH0A 3I0SA 1W7WA 3MCMA 1DAXA 3A8IA 4MYTA 1RT1B 3D0GE 1X7VA 3CWJA 3CC4S 2FHMA 2O5DA 2HS0A 2BBEA 1VQPS 3DDNA 4EZ6A 4XPEA 2OELA 4AFFA 5AJ3F 1U6FA 1Y00A 1B64A 2DNGA 3QGGA 3QYYA 4H4KA 1RQ0A 2KFZA 3OSNA 3H8YA 2B9YA 1LKZA 1HW8A 3PFEA 1FWLA 4CLKA 2DNOA 5I3PA 2BJDA 4H4OA 1S49A 3CMAS 1NK0A 3PDNA 3CJKB 2F9JA 2OUGA 3C15A 4ZP7A 4QYZJ 4X4TA 2YKMA 5AT1B 3NGSA 1CS4B 2RJZA 5F0UA 3MPVA 5IOLA 4KE5A 3DU6A 5D4LA 2QV6A 1VQOS 5JVHQ 3VAHA 3CW2C 4DQIA 1Q4RA 2UV8G 3EPIA 2ZM6F 2I5JA 3EPGA 2VG7B 4TQRA 2AJ0A 2R7QA 2PE8A 5B0AA 4NEZA 1X5TA 2UVUA 3R5DA 4B3MJ 2BKNA 4OI3A 4OL8A 5DGBA 7AT1B 2DNHA 4E98A 7FD1A 2EKYA 1VCTA 4DR7F 4HACB 3DXBA 5D4NA 4FPIA 3OW2R 1FJ7A 5B08A 4ZHRB 3C6TA 2YNIA 3UFCX 1HBMB 4C8OA 1UFLA 3U1LA 5EWGA 2KXFA 3D0HE 2EW9A 4LF9F 5A8RA 2VOPA 3RTVA 2QMWA 2NPIA 1YRXA 1IBKJ 2V68A 3ZTOA 3TP2A 2QMXA 2Z30B 3EVMA 4I6WA 5KG4A 3MAAA 1G1XA 3W60A 4R8UA 3MM7B 2IJRA 1KHVA 1NPPA 4DR1F 4OX9F 1MMLA 1U47A 1Z2ZA 5KFEA 2C2NA 3LTOA 2HQCA 4NRTA 4YDDB 2XC9A 4FPRA 3CCES 1M90T 1M1KT 3PYGA 2QA1A 5KG1A 4EBCA 4FBTA 4LSLB 2MLZA 2WB4A 5K20B 3KKFA 5KOXA 1AA1B 5F8JA 2AGOA 2J9DE 1IQTA 5LMUF 3TVYA 1S9EA 5E7OB 5M2PA 3QFWA 2QN6B 4FNHA 2XLIA 3IN5A 1KQSR 3Q8VA 3VAIA 1HFEL 2BJ8A 5HJXA 3CC2S 3A3NB 1P6TA 1CQNA 3W5YA 3ZZTA 3NNHA 1LWFB 3W9IA 1O6XA 3G9CA 1TKTB 1UVKA 4GKJF 1FNMA 2IBOA 4HDGA 5AJ3J 1ZTTA 4RZRA 2F1FA 4DV0F 3FVYA 3AOAA 4ED3A 2XSJA 1AZSA 4CO5A 4XAKA 4DDFA 2FJVA 2R2TA 3JQJA 4G1QB 1RDRA 1N52B 4Q43A 1A9NB 2ZH5A 2Z2LA 2BANB 1LW2A 3CCZA 1N88A 3ZZOA 4CYUA 3HHEA 2GFFA 3WQPA 4LJMA 3G8SA 3NS6A 1BD6A 1TL5A 2EXUA 3GZ7A 2IDLA 5LOQA 3AB2B 3FDSA 4IG0B 1MU2B 5J2PA 2ZM6J 1TL7A 4P6QA 1IBLF 3THTA 2V4RA 4PZVA 2QLBB 3RBDA 5CHCB 4M5DB 4PPDA 3TEGA 3SYZA 2R8JA 4OQJA 5GAHI 5DDQC 3IAM9 5IT9Y 2DCUB 3UN3A 2IC3A 1AYEA 3P45B 4RUHA 3NBPA 4DR7J 1N0VC 4MFBB 1SBRA 2RB7A 3E01B 4O3OA 4NCGB 2VQEF 1SL1A 4B3SF 3GFZA 3FQLA 1UWBA 1HD0A 3T5LA 4A8XA 4LVNP 4K4XA 2AD9A 3CJRA 2XYPB 4OZ5A 2NYHA 2E29A 4FYXB 4KYZA 1JJ2R 1JMTA 2HHXA 1BQMB 3FBFA 4ECXA 4P10A 2B5JB 2K7KA 3TZYA 3KLVA 5HROA 5K8NA 1KLMB 4QYZK 5HQLA 3T41A 4UZCA 3BJYA 3SZ2A 1UW9A 1W2IA 2QYGA 2C42A 5KFLA 4B17A 4X2BA 3D1QA 2K06A 4ZLJA 2E5HA 3AA9A 5IC6B 1YHQS 1KR4A 1UFKA 4ZCKA 5ETTA 5HMYA 2KZZA 3RG6A 1VISA 2JDJA 3M6WA 1IKYB 4QZVB 4USUA 2DGXA 3FRYA 1Q86T 4Y3CA 3VZHA 4DUYF 5LMUJ 5L9NA 2FIUA 5C24A 3T19A 3TZXA 3O5TB 4OX8A 4OYAA 2LKZA 4DEZA 1M5SA 5J2QA 3S01A 2MMYA 2FDNA 4O3NA 2JX2A 1OMSA 2ILYA 4ZVTB 2W9BA 1XTZA 1KD1T 3S1TA 2MKYA 2GMHA 1R31A 1X31C 3KJVA 4A8KA 2ZZMA 3RR8A 2FY8A 1VC5A 2KL8A 5DLFA 1WD6A 3I9V9 3O2IA 3ZNUA 1HNWF 1OY6A 3IP0A 2J6TA 1UL3A 1RHJB 4DV0J 2DPIA 2ABYA 2J5AA 1OY8A 1U1LA 4WYWA 2J0WA 5E3PA 3M9MB 3PX6A 2LXFA 3TARA 1ZZNA 4C9DA 3MFIA 1JLAB 2B9XA 3GP9A 5HMXA 4JUZA 2XNQA 2Y1LB 1UJ5A 2PD1A 3SQGA 2MY8A 4RU9A 1XERA 2BQ3A 1NSAA 1JJHA 3KLEA 3UVJB 4V19X 2FYXA 2GNKA 1REVA 3UD5A 5A2QY 5JJBA 4KC5A 3AAWB 4DPOA 2HFUA 3M2VB 1Y10A 4N77A 1IBLJ 1I51B 1RT3A 2BE2B 1U6BA 4JOUA 2EWHA 4HHJA 1VQ8S 4ID5A 3UDVA 1TKXB 2BE9B 4TVAB 3CDUA 4DMZA 1NU4A 4DV2F 1R0CB 2D9PA 3UQSA 1SJQA 4DN9A 2CPHA 4J37A 3PYEA 2RRBA 2HBRB 3MFHA 2KB2A 2X3DA 2ZOGA 3H59A 2W4DA 1PYSB 4B3SJ 4HDHA 1GK8A 3DLKA 3N9UC 2P6TA 1DLOA 4QWDA 5D0HA 3ZXWA 4WK1A 2V5HG 3DOMB 2C2ZB 4TLQA 2UVRA 2SXLA 3POTA 2XLJA 3QGIA 2GVZB 1UEKA 2EFPA 2MZSA 5B7WA 1N6QB 3BBCA 3MMJA 1H73A 3UNYA 1SC4B 4KJIA 3B4DA 1UW4A 4PWWA 1N32F 2HGNA 1VQLS 3C6UA 1IM4A 2ZJQQ 1NAQA 4WE1A 3FSYA 3MR7A 2CZ4A 1QM9A 4GRSA 4AUKA 2H5IB 3D28A 4OI4A 3K8WA 3AT1B 3M30A 1N34F 4KV8B 3EXCX 2FGOA 1CJVA 4DUYJ 1Q16B 1HNZF 4KH0B 3IS9A 4ECWA 3LALA 4U8VA 4K4VA 5KFZA 4A47A 1ZOTA 1D9DA 3OTDA 2QLFB 2BKPA 3VAMA 2IIHA 1ZTWA 3PW0A 1ZA1B 2W25A 4WU2A 2P2CB 3KG0A 2DNKA 4QQBA 2KG1A 2HK3A 2AGPA 2HRYA 2V2VA 4EO6A 1YJNS 2CQPA 2A10A 2ADCA 5D0EA 2BZ2A 1HNWJ 1S7IA 2EEYA 1JLQA 1UMJA 1TL3B 1N5SA 3TJ9A 4EU0A 3G6YA 1S10A 4NYOA 3L3CA 2ZZTA 3CIMA 3W8GA 2YBVA 1ICEB 3FSIA 3VAFA 3BV8A 4O0IA 2VD3A 2JC0A 2YWFA 1TK5A 2KDOA 3DI6A 1GXUA 2RQCA 2BACA 4WKRA 1XMOF 2ZD1A 3PX0A 1ZZFA 1T9VA 2VG6A 2EFNA 1MW7A 1JKHB 4CO3A 3MXHP 4DR5F 4I2QA 2PFFB 4FKXA 4B3RF 1DQAA 2ZNYA 5BYSA 2UP1A 1T9TA 1IR0A 4QWEA 2W7PA 2V34A 3QJJA 5D4PA 1HW9A 3ZZRA 1M5KC 1SJ3P 1FESA 1UVMA 2VPXB 4DV2J 4XK8C 1U1KA 3UE2A 3MD1A 3TZZA 1HD1A 2Z0GA 2UXDF 2H3EB 1WKLA 2OSQA 3GSDA 3KK1B 2AJ1A 3D2WA 3VGTA 3PW7A 2GJIA 3W5XA 2WVEA 2Z57B 4L3NA 1WELA 2GA7A 3MZIA 2OLWA 2V50A 2HLTA 2D7SA 2QYCA 3ET6A 1SVDA 2HFNA 2MZJA 3GCWP 4RNFA 2OI2A 4OZJA 4DX8H 1YJ7A 3F0NA 2AYBA 1IXKA 3N5FA 1WEZA 3ITHB 3T3FA 4ELTA 1N32J 3PJWA 1HBUA 1FNXH 1F2GA 3CEDA 1N8RT 2HBQB 3L7PA 2DH9A 4O3PA 1U0SA 2OGUA 1REGX 1TMMA 2BJ3A 5DDPC 1N34J 2XSJB 1Q0NA 4QWCA 2V6AA 1C1BA 1LWCA 1NHUA 4EGLA 1FRHA 2F63A 1HNZJ 4NLYA 1D9FA 1ZETA 1VGYA 4F4XA 1UAWA 4ICLB 2EC2A 3VR1A 2DT9A 3R2DJ 2F40A 4OYXA 1YGYA 5CYQB 3HZEA 1EJ7L 3R9LA 2DH7A 1TL7B 5EDWA 5I42A 3W2WA 5ITHA 5FLXU 1VFJA 2CJKA 3NMAA 1RACB 2ZBPA 3PXGa 2D74B 2XZTB 3I5AA 1R27B 5KFUA 2Y1RI 3PEJA 1HARA 2L9DA 1G4CA 1WEXA 1F9HA 2JLEA 2V4QA 4WIQA 4J9NA 4Y65A 2NYIA 4A8SA 5H1SV 3NBPB 1N56A 3UCZP 4I7FA 3A1YG 4X4OA 3HM9A 1XMOJ 5I3QA 4LBHA 4DV1F 1YZ7A 5A8KB 4F26A 4DR5J 3SQOP 4B3RJ 3C3LA 3M2RA 4NASA 3M8YA 4Y2IA 3LANA 2UVVA 3DC2A 3KLGA 1HNXF 4R25A 1Y5LB 4LF2A 5KFHA 2PSZA 4DCPB 1VS3A 1RT5B 1Y7PA 1VK3A 4OHYA 4Z7YA 1PILA 3EGVA 2YXLA 4NCAA 2FGCA 2VQFF 2YQ3A 2ADBA 2UXDJ 1AB8A 4TY8B 2I9SA 2IYIA 5J2MA 2GS8A 2RU9A 3R1HA 2F4FA 1GEHA 3LGNA 3VCDA 1FI4A 2CUYA 4GKKF 2MGZA 4MKVA 4NZ6A 4JYAF 7FDRA 3NWGA 5J2QB 1VQKS 1VDHA 4YR2A 4OZLA 2MHEA 1WF1A 5D3GB 9RUBA 1G6BA 1U1RA 3LAMA 3KJVB 4JI2J 4ETXA 2YNFA 2HBZB 3CMQA 3D1HA 4F0KA 3A8KA 5IT4A 4R5PB 3RR7A 3JSYA 4TN2A 4ED0A 4M63A 1T3NA 1HIYA 1WG1A 3EVOA 3W3SA 3SCKE 2KRRA 3VAKA 1WG5A 1HQEA 3BGUA 3IBCB 3DOLB 4GMKA 4P2SA 5GADI 3NLCA 3R27A 5H9FK 3CO9A 4DHVA 1ZPVA 1A6LA 3UI3A 3ENWA 3KLEB 5AXKA 4Y00A 3N6LA 4DX5A 3OVSA 2DGWA 3KHRA 1UJ6A 3SV4A 4B9VA 1KQKA 1M5HA 1MN9A 2UUAF 2VBWA 5L1JA 1RYSA 4ZA1A 3VHQA 4CLYA 1X0FA 1U1QA 2ZITA 4DV3F 1IKXA 4TY9A 3NKYA 2OHDA 4J9SA 3GJSB 2N82B 2CQ0A 3LA0A 2B8QA 5D0RA 3HP6A 2LP4A 5E3AA 1H7XA 1FJCA 2B51A 1BE4A 1RAIB 3CO0P 3CMES 2KT2A 1S6OA 1H38A 1FDBA 3FEZA 2CZ9A 1Y9OA 5HVHA 4ZOSA 3BGRA 1U09A 3CCSS 1HHTP 1PGZA 5GMKa 4RPFA 1RU1A 1C1CA 2WONB 3N4WA 2OO4A 3I82A 5A6WA 2G0CA 4DV1J 1RTDB 3DLKB 2BOAA 2XZDB 1MMDA 5KG5A 1NPRA 3OXLA 3FC9A 2HHTA 1RT4B 3POTB 4RW6B 4IFYA 1HNXJ 1YJTA 3MEGA 3E2EA 1EARA 5K8MA 3FMWA 5F8NA 3AA8A 1FKPA 3TUIC 4S0MA 5E33A 2M5YA 1Q5YA 1APSA 2VQFJ 4WE1B 1PO6A 2AHOB 1CLFA 3MR6A 1H2TZ 1MWQA 2HRUA 4XTTA 3OR1B 4K4SA 5F9NA 2WTFA 2A6OA 1AT1B 1DQ9A 3R2CJ 4GKKJ 1LK5A 2AIRB 3NOGA 2FUG9 1JXVA 4JYAJ 1YBTA 4ZVHA 2HQDA 4DCOB 3QWUA 3RBEA 4CNYA 3BH6B 2HIYA 3BQ0A 4CQ1A 1OYDA 2DY1A 1L3TA 4A8OA 1D09B 3IGVA 2DGUA 4WXOA 1S1XB 4NA2A 1PJ6A 1AW0A 5GAEU 1JLCA 2B3TB 2DITA 5J1PA 3OJSA 3OLAA 1JLQB 1J5OA 3GCXP 2KN4A 1UEVA 1VQMS 4P72A 3RW7A 1CBKA 3JS9A 1I6JA 2OTLS 4C8ZA 2HNZB 3MUMP 2C3PA 1LQ9A 3L7OA 2E9RX 4C11B 2DIVA 1YQHA 2H65B 2JZ5A 2NXEA 2MZTA 1OJ4A 3AJDA 2YWEA 1QSSA 4ANEA 4BDPA 2HW3A 1GMWD 4C6AA 1VQ5S 4LFAF 2UUAJ 2GV1A 4QU6A 1BGXT 4DV3J 4UQTA 2ZOFA 1P27B 4U7CA 2N7YA 4NYPA 4DUTA 1FKOA 5LT5A 1HI0P 4FF1A 3TW0A 2VOOA 1JK9B 1FXDA 3G6VA 1HYSB 4C0HA 3KG4A 2VIHA 1FRKA 3K89A 1RAEB 3ZTSA 2IFXA 2QL9B 4QIEA 3I5BA 4KGVB 2ROGA 5CCMA 5U47A 2BJ9A 1WC0A 3EGZA 3M8SA 3B4MA 2N7CA 1R43A 4LF6F 3A3OB 2XHWA 3AD8C 3QZ8A 4KSEB 2J0XA 3ADAC 2AP6A 3J81Y 2QA2A 1N5YA 4FBUA 3NCPA 4WFAQ 1VHIA 1SH0A 5ETSA 3OL6A 3LWMA 2QMUB 3MPUB 3B78A 3AODA 2GAHC 3LO3A 2HGMA 3SMZA 5DJBA 3C8YA 5D78A 4CDIA 3HULA 2Q6BA 3BS9A 4NLDA 3QIPA 3ZTRA 1SH3A 1HNIB 2H4WB 1JB0C 4ECQA 3TQ1A 5HO4A 3KLIA 2DBBA 3EZOA 4H4MA 1K1SA 1A0OB 3FZBA 4UY85 3R5BA 2LQBA 3KHGA 2WK4A 3BDPA 2J9CA 2D1CA 3ILOA 1LWCB 2OMOA 1IUJA 3GV7B 1G3OA 2U1AA 3WX8A 2V0NA 4X65F 3BYRA 4RKUC 1EHWA 3TANA 2CQIA 4I0WA 2QO3A 1E6YA 3N6NA 2G4BA 4RNMA 4PYDA 2XBPA 4C98A 2YWGA 3QLHB 1RWOB 3TI0A 2AU0A 4IFVA 4B9UA 1N36F 3KTQA 3W2WB 1WSRA 4OHZA 1SIZA 2HSEB 3ZZYA 3GILA 2MSTA 3BSOA 2IA0A 1RAFB 3TVKA 2VC1A 3RYLA 3BF4A 4ECYA 5L46A 2WSCC 3BPDA 1EP4A 1IWGA 2LU1A 5DO2A 1FTCA 3BH7B 3PRVA 3E51A 2V8VA 3SCLE 2XO7A 4J91A 4W4MA 1HQUA 1D0EA 4BC7A 2BJ1A 3IFEA 4EFAC 4FF2A 3M2RB 1H2UX 4M1KA 1X4EA 1YI2S 1BC6A 1SV5A 4J9PA 3JAMU 1YVFA 2P6SA 4CH7A 2APOA 5J1NA 1P9YA 1T9XA 1DQ8A 2XWXA 2V8HA 4LFBJ 5HP1A 2M2BA 3PW5A 3K0JA 5KTQA 4P71A 2NCKL 1IKWA 4JBCA 1KP6A 1P1TA 4IUFA 3KNAA 3KUGA 1H0HB 1XEZA 3WBZA 4LF6J 3AY0A 1N5QA 3BGLA 3M8ZA 1S0NA 4WYLA 2GHPA 4LR7A 4JP8A 1ZAWA 2D3UA 4LRAA 3M6XA 2H5JB 4DL4A 3QT6A 1H6KX 2L9WA 2W2MP 3OUYB 5F3ZA 3HKWA 3PV8A 4K2JA 1T03A 5GAEI 4X62J 1RT2B 5JMNA 4LREA 2YKNA 2VBZA 2YNFB 2E66A 3FFIA 2UUBF 3DRXA 2HQGA 4FXDA 4ZITA 2OH2A 4Z7CA 5DRKA 1S7HA 3KJQB 1WTBA 2JJ4D 3IO1A 4J90A 1FFSB 1DTQA 5MAOA 3OXGA 3PRBA 1GH8A 3Q0AA 2J7UA 1IBCB 1EETB 1GX5A 3FZ2A 1RBOB 2MY7A 2K3IA 4HH1A 5ETOA 3UDCA 4X65J 4RW8A 2WB1D 2LXUA 2ROEA 2EFQA 2CWXA 2HHWA 1L3SA 4QW9A 3CF5Q 4EWTA 2HGLA 1T9WA 3DNCA 1XMQF 1TP7A 4ZVOB 1FD2A 1N36J 4I6YA 1SC3B 1XNRF 4DSFA 2G1DA 3VQTA 3MECA 1IKXB 1BQXA 5DG9A 2HNDA 2MKJA 4U67Q 2AGQA 3LF0A 1D1UA 1RKIA 4PQUA 4MKBA 4WFYA 1XR7A 2CQ3A 2VC0A 1URNA 2C28A 3LP2A 1VQ7S 3HO1A 1S6QB 1UKUA 3AOCA 1GX6A 4Y34A 2AW0A 1O5JA 5EGYA 4TYAA 2M4MA 5T14A 2KU7A 4O44A 1U0HA 1NKBA 2WRMA 4CRJA 3CIZA 3MM8A 5IC4B 4YUDA 3CJSA 2PO4A 1K8AT 1NJWA 4IOBA 1YRUA 1D8ZA 1PAEX 2GQCA 3OTCA 2HKEA 3P4UB 2ASLA 2UU9F 4LMZA 4WCEQ 1R89A 4QIWD 3MEGB 1MG7A 4Q45A 4F36A 1NJYA 1IM6A 1FKPB 2ZH9A 3BO4A 5BYRA 3MMAA 2UUTA 4DR6F 4I64A 4ALZA 1HQ2A 3MTKA 3UD3P 4D3HA 2GMJA 5IZHA 5CYJA 1RCOB 3SI8A 1RAHB 2V8PA 2MQNA 1S0OA 3ZZ0A 4WFNQ 3ULHA 2AZ3A 1X0PA 4J9KA 1T95A 2Q3PA 2CDQA 1HBOA 2E5GA 3MAHA 2LQ9A 3WDOA 3QNWB 2Z4PA 3NRBA 2CJYB 2VJVA 5ETMA 4FF4A 1PCAA 3KHHA 4HI1A 2DNYA 3I9ZA 2UUBJ 3M9NB 3HHLA 2V4JA 2BABA 2W7AA 4IH6A 1Q82T 2HFVA 2B56A 1SB6A 2GQ2A 2K3KA 3V81A 3AFGA 2HS3A 1K0TA 3ILJA 2VG5B 5D4OA 5CAAA 1XBWA 2DIUA 1TV6A 2XYHB 2V8DA 1DTTB 4E8UA 3ISNC 4MIAA 1GNKA 2EFGA 3MAQA 4NZ7A 2L41A 4YOEA 3G87A 4ZPVR 1RTHA 3JTNA 4PWDB 2CFXA 1Q7YT 2B9EA 1R8BA 1DJ0A 2Y8WA 4LUBA 1XMQJ 1NHKL 4CH1A 2M0GB 1C0UA 1RUSA 1MNEA 1ZH5A 3LP1A 2BOPA 2J7WA 1F9EB 4B3TF 5J1EB 4P73A 5K8PA 1XNRJ 2ZWOA 5F3TA 4Y2KA 2YNGA 1FKOB 2V9WA 4YP3A 1IBMF 3RB3A 4F50A 4U9RA 4OZ0A 4WKYA 4M94A 2ZHOA 4ZK7M 1NMEB 5IT0A 2UUCF 2A0FB 4OHXA 3Q8YA 5ETLA 1X4BA 3IWXA 2Z2YB 1R8HA 3MR3A 4NLQA 2D3OR 1W26A 2W2QP 3HVTA 2MQOA 4DPUA 4CNZA 5KFKA 5HI7A 1OQ3A 1RWMB 3FBEA 3DRPB 2W2PP 4LF8J 1UPPA 2UU9J 2G2YA 2JRSA 1R0AA 4KIAA 5KFMA 4NMLA 3G82A 3SEOA 4QR2A 3DYAA 1LW0A 1VRTA 3FSXA 1A7GE 2VB6A 2XLKA 2MEWA 1NCLA 4DR6J 3RGIA 3ISND 3KLIB 1Y4ZB 1S5ZA 2ROPA 1H74A 3T1YF 1RLDA 1M0SA 4R0JA 1LXNA 3UR3C 2KM8C 4W98A 1M5OC 2YKAA 2XMTA 5T7LA 2FB0A 1UCNA 1Y5NB 3NP5A 2LQJA 2HZCA 4UUXA 3WC0A 1VQSA 4I2PA 5LL6d 2AT1B 1VBYA 2VHGA 1Z1ZA 5L9XA 3P96A 2KXNB 3OL9A 2ATCB 1GFWB 2U2FA 5KFQA 1S0VA 1ZM2A 3CD6S 1E6YB 4OLOA 3KK3A 4I6AA 5IS2A 1F0XA 3CDWA 3NWRA 1RHQB 1PYTA 1FX2A 5DQGA 3R5AA 4KFBA 4DV4F 3BDEA 2RS8A 4DS5A 2CNOB 2CQBA 2H9ZA 2QFJA 4RR5A 1JLFB 5KAKA 4QIGA 1S9FA 1SXLA 3UWTA 2NSCA 9ATCB 1HNVA 1PYOB 2GX8A 1ACMB 3ENVA 1Q5VA 1KBRA 4GVBB 1Q8BA 4AYBD 1UVNA 2KG0A 4MIWA 1GQEA 1HQUB 1SUQB 1X4AA 4MMOA 3R5JB 4ILRA 2V94A 4K5RA 2FJXA 1V5IB 2QEXS 2IAJA 3EDQB 5DZ6A 1C2PA 1QAJA 5H9EK 3KFWX 2NUUG 5E2QA 2C2RA 1BHNA 4OHVA 1IBMJ 3SCJE 3LGMA 2R3VA 3MCNA 2VICA 1IKWB 2XMAA 1IKVA 2W24A 4C8NA 3HFZB 2UUCJ 2X1BA 1GT8A 4TYBA 3EMTA 3DDIA 2F4VJ 2WHOA 3EZ5A 2D3O1 1TTHB 5IM0A 4WK3A 1NJZA 4C3MA 2HFOA 4ZP8A 4A8QA 1T05A 3R7NB 1FXRA 2BQRA 2ATLA 4WFZA 3P3DA 2DGSA 4NLSA 5LJ3Y 3CTRA 1K73T 2CQ2A 1BXNA 1T03B 4DR3F 3GYXB 1RTIA 4KO0B 2POKA 5LSRA 4ZPAA 4Q0BA 4NCBA 2AMCB 4G65A 3PHEA 4IH7A 2W9CA 5A8WA 3BREA 4DLEA 4JV5F 3LQVA 4WU3A 4YR0A 4AL7A 4O3RA 4O4GA 3M1VB 1F6TA 4N8OA 2RKIB 1Q8IA 2XMKA 1X4FA 2LQ8A 5CQGA 3HHNB 1WOPA 2D3ZA 2QL7B 3MPYA 5HJYA 2BE7D 4AD6A 1VQNS 1C0TB 2N4DA 3ONQA 1YBAA 3D6TB 4I68A 1NDPA 2JWNA 3UNGC 2OEJA 1S72S 2KJVA 2O66A 1FHTA 1HWKA 1NUEA 1S1VA 1KC8T 2GW8A 3CCJS 3MEEB 4JI4F 2ZBCA 2R9LA 1RTJB 5L1IA 1X9MA 2AX0A 2XHCA 1NSQA 1HR0F 2PFDA 2J9EA 4E0DA 2HNDB 2MZQA 2KM8B 5DQIA 2DNQA 5B09A 2VFTA 4ILLA 4Y0FA 3IRXA 4PQUB 2E5JA 4F0HA 3JTOA 1HWLA 3LP2B 2DJWA 4IDKA 3K7RA 2J8AA 2ZBRA 1B70B 1S6PA 2ZE2B 3L09A 5L8RC 2XG8A 1V3SA 1RABB 1FJGF 4MYUA 2HQIA 4UZBA 4RUAA 1U0HB 4MJKA 1JXEA 6FD1A 4E2FB 4YMEA 4PWUA 2HNYB 2MQ8A 1T9UA 2JSXA 4C48A 1JLGB 5AXNA 3M6UA 2ZDOA 3G6ES 4LBIA 3V6DA 2XO6A 4CO0A 3H98A 3MPDA 2RUSA 3EJMA 1VJQA 4UT4A 4DG1B 1OQ6A 2GGPB 2OIHA 1LNQA 4B3MF 2CJ9A 5GAGU 2FC8A 2M8HA 4EMDA 3D68A 4QCLA 3NS7B 1XK8A 1KEKA 5KT3A 1WJ9A 3JQMA 1Y3JA 5E3RA 3QFHA 3MMAB 1F9FA 4N76A 1F5CA 1R8PA 1FEEA 3JTPA 4EBDA 2B4PA 2DHAA 2FVCA 4DL0C 2E7VA 1Y11A 4QBUA 3AQPA 2QSWA 4FN5A 2BXJA 4XPCA 3BN7A 4C2MA 3OL8A 3W9HA 2MKSA 2ZVIA 1WORA 1T9YA 1TK8A 4Q5VA 2FVQA 2ZKUA 2BRLA 2I6WA 1SQEA 2IM3A 3UCGA 2JH3A 2HHQA 3OBIA 4IO1A 3VGVA 4DR3J 5HQMA 3NCQA 2MQLA 3HHDA 1WOSA 4KT0C 2DXEA 1NM2A 4WTOB 2FJDB 4J9QA 1RP5A 4JV5J 5KFCA 4DU7A 2DYAA 2NZ4A 2V4JB 3GFYA 3TA1A 4ECUA 3HVAA 2BVZA 3D5MA 3BBFA 4DFJA 4K2XA 4HLBA 4DPYA 4A8FA 2IRXA 3V81B 5SUHA 4ZPWR 5BR8F 2VA2A 4MTPA 4K7QA 3KHLA 4NX9A 1S4EA 2CQGA 1J2VA 2FLPA 2UV8A 3MMCB 1AUDA 2IA6A 1TR0A 2W7OA 1TVRB 4ZPTR 2FLOA 3ETOA 2RQMA 2K1RA 3M8QA 4QIVA 3K5OA 2XY7A 1IR1A 1VBXA 3DM2A 3BPSP 4WJBA 4WZQA 2F65A 5CYMA 4O3SA 5EX3A 3KMSA 3DLHA 1C0UB 4JI4J 5KFWA 3I4PA 1JX4A 3ZZUA 1AUSL 1HR0J 2PGCA 3Q83A 4HTJA 2KVQE 1VJWA 2YX1A 4Q2LA 3K58A 3K5PA 3W63A 4J9VA 1NK8A 2G13A 2RVJA 3T1HF 2B7BB 4QWAA 2EKNA 2Q6CA 2N4CA 1FJGJ 3UDEA 4ZJOA 3JSBA 3MD3A 1DFDA 4C4WA 1X4GA 4LRFA 3N01A 2Y1IA 4WIIA 2GVDB 2B6AA 1L5UA 2FY1A 4ZN3A 3HPOA 2JVRA 1XJWB 5C42B 2EC0A 1Q53A 5HQ8A 1UEUA 2A2DA 3TUPA 4I1TA 4CO4A 2MQQA 2ZHAA 2VU5A 4MKAA 4PUOB 3QT7A 4NLOA 1SKWA 4ZIVA 3ZZPA 3MWBA 5KFNA 3I56S 2X1GA 2FZGB 1F5BA 4KRWA 4RW9B 1AROP 4ZIWA 3HI9A 4ZCIA 1X4DA 2DHHA 2AEFA 1FRIA 4NI2A 4RO0A 5A6PA 3L4BC 2DD8S 1TKZA 3VAJA 4BCAA 4I2PB 3NGUA 3BQ2A 2B4OA 1RHMB 1W2BR 3E8OA 3KK2A 2NQPA 2YPZA 2BM0A 1S1TB 3O8WA 1IN0A 1FO1A 4PRFA 1RA7A 3GTYX 1QJHA 3PHTA 5LSOA 3GU0A 1R6VA 1LFPA 4RL1A 4ECRA 3OQ2A 3V4IA 3VVTA 4RBUA 3MM9A 4DV6F 4GC7A 4KFBB 4ERDA 4OYZA 1TMJA 4F2SA 4F3OA 4DBQA 1ELOA 4Q8EA 2XGQA 2NS1B 3FBCA 4UUWA 4ED5A 3R5GA 2KXHA 1RBAA 2HWHA 5BR8J 4PR6A 1VRUB 1VLOA 4UOFA 2CQ4A 3G6XA 4EUVA 2CKWA 2JNJA 4X66F 1GXTA 1BWVA 2PC6A 4UF4A 1JLBA 4ANDA 2HMIA 3D0IE 2GO9A 3GIJA 4C8MA 4USVA 2YKQA 1EQMA 4DX7A 4KH1B 5E3QA 5L1LA 1X9WA 5ADZA 3SSSA 5GAGI 4RBVA 2QE5A 1OWXA 1S9GB 2IAJB 4WFBQ 4EEYA 2J6UA 4TNOA 2IVFB 2D41A 2CJQA 2NLWA 5HBMA 2WBMA 4B3OB 3RAMA 4M5MA 4I69A 3LUYA 3CCUS 4P52A 3B82A 3Q2TC 3T1HJ 3KLHA 2OSRA 2ZVSA 2OPSB 4F8RA 1TL1B 2QA4S 1VC6A 2XWYA 2OD4A 3CDAA 4ILMA 3M32B 2CNNB 5IQ6A 4JI3F 1NK4A 5LSLA 4FYVB 4DWIA 2FVRA 4XIUA 1LWXA 4YY3F 3KDOA 3R6LB 1URRA 3NEKA 4R0EA 1B99A 1RZMA 3NAIA 3Q23A 4UQGA 3TA2A 3RRGA 1T3OA 3J7A1 4BS2A 1KQGB 3TYTA 2OPPB 1RT6A 1O8BA 1RGVA 1EKSA 2W8LA 2F3JA 5CZXA 2OEKA 4CO1A 5FDLB 4ZP9A 5A8WB 4URGA 4H4KC 4CIOA 4ZVGA 3G8QA 1ZAVA 2E7WA 2ZH3A 3P49B 3D6MB 2LMIA 3TRGA 4M5JA 3CD0A 3HKZD 1ZYQA 5CA5A 3O3LA 1VQ9S 2YPYA 3CD7A 2ZJRQ 4EI2A 2R7TA 1VR6A 2MJNA 5HMWA 2ZZNA 3C14B 1RWPB 2F8HA 3W2VA 1MWYA 2CXEA 1YLXA 1CG2A 3TAMA 1MMNA 1VLYA 2GMLA 4FYWB 5A0YA 1FRJA 3W8PA 3DCAA 1KVIA 1RSCA 4DQRA 4DL2A 2K8GA 3LW5C 1B4SA 4DV6J 1G2EA 2YQ0A 1WKJA 3J80Y 1FE0A 4A4JA 2ALYB 1N5VA 1KFDA 3TJAA 1VK8A 3HSZA 4FXVA 3SIPB 1U8WA 1TUVA 2PI4A 3IRXB 2EFVA 3FNNA 3MMBB 3Q89A 4YR3A 1FVSA 4L72B 3PYFA 1TAQA 2UXBJ 2XQCA 3VV2B 8RUCA 1ZM9A 2VDIA 5GMDA 4X66J 3V4MA 2X7IA 4A8WA 3CJKA 4OZ1A 4F4WA 3C46A 4M5IA 4DL5A 3OFFA 5G0RB 1CS4A 4ZLLA 4YB1P 5DM6Q 4OHWA 2KYZA 2YKOA 2M3DA 3M8RA 1WWHA 1SH2A 4J9MA 3D3BJ 3A8JA 5CD4H 1K9MT 4RW4A 1FCAA 3IG1B 1NDCA 3BSCA 2KRBA 1RAGB 1HWIA 1CSJA 1QD1A 2Y3YA 1U1PA 4JI8F 4PKDB 3PKMA 1KQFB 4C7QA 2HHUA 3ZFVA 2JFKA 1TUGB 1YG0A 2GJ2A 3W1YC 3MEKA 3DDKA 2LECA 4LFCF 4JI3J 4ER8A 5F9LA 1IQZA 1E6VB 2ILZA 4DPXA 4JI7F 2MZRA 5K8OA 4YY3J 3GIMA 3A13A 3CJ3A 1RB0A 1XR5A 4ZHRA 3H20A 1HBMA 4M5LA 4IQXA 5AE3A 5IT9U 3D66A 2P5VA 2QIFA 3US5A 4ED1A 2FVSA 3PIOQ 1RE1B 1U6ZA 4C0OC 1UETA 4HI2A 3C2PA 2ZH6A 3G96A 4V1Ak 2JC1A 2E7XA 2PEBA 4LQ3A 1CULB 3CJTA 4FXWA 3OR2A 5HL7Q 3MM6B 3MM7A 5HK4A 1WNEA 4B08A 1S4FA 5FIIA 4F2RA 4PG5A 3KG1A 2BKOA 4HVZA 3CB4A 2L48A 2P9GA 5I3UA 5C2CA 4IH5A 4LSLA 2VDHA 4QPXA 5GMEA 3I0SB 2Y9HA 1NB7A 1T7PA 4OYWA 4HHUA 2I2YA 1FF2A 3FMBA 4IG3A 2K1RB 1CC7A 4F4ZA 3J80U 1T94A 5DM7Q 3T1AA 2FQQB 2FTRA 2KTQA 2M9KA 2K7JA 1UWAA 1LWFA 3X1LB 1YDLA 2GHWA 1RCXB 4NLPA 2CNLB 5DG8A 4H4OB 3W61A 5EX0A 2DGVA 2IMWP 1OYEA 2LVWA 2WW4A 1EIYB 3LPEA 3OFEA 3C15B 1QE1A 1J27A 2YKMB 1YSJA 1NZ8A 4WPAA 2MHNA 1JIHA 2Q43A 4G1QA 2NR0A 3HXMA 3DLGA 3BSNA 2C3MA 3P5TL 1WC4A 4DX6A 2B6AB 3I96A 4HR2A 2CZVC 2I5JB 4CLLA 2F5GA 4ZPDA 2L9NA 1NSPA 4WP8A 4FDFA 3IA0A 4IG0A 4ECTA 1MU2A 5ETQA 1WOOA 3MGJA 2OP5A 5HVFA 3BZQA 4J9UE 2CAJA 4F4YA 4N5SA 5F8IA 1DURA 4JI8J 4OI6A 4M5DA 3L7UA 1FWPA 5A2QU 1C4AA 1XC9A 4YS2A 2DKOB 2DPJA 3W66A 3I87A 4ZJLA 4NLGA 1X60A 4LFCJ 3I32A 1D3WA 4NI2B 1Q7LB 3BEGB 2YKPA 3C6TB 4Y2AA 2YNIB 3D6HB 2VF3A 4MFBA 4JI7J 4WTYA 2KH9A 5ETNA 5E0OA 4NCGA 5DDRC 2BX6A 1V9OA 3CC7S 3WC2A 5A8RB 3RW6A 5I4MA 3K5LA 1HBNA 1VIOA 3MURP 3FCVA 1SC6A 3O6QA 4U7UD 4F04B 3QGHA 3NXZA 4NLUA 3MAAB 2E5IA 1RWWB 3GPAA 3V6KA 1U4BA 1BQMA 1FX4A 4R8UB 2B5JA 2L08A 3D7SB 2HFSA 2PMZD 2VKZG 4U95A 2V67A 1KLMA 4PG7A 2XEXA 4OX6A 3NNAA 3H42A 2EBGA 2QLWA 4NA3A 1HWUA 4ELUA 4LIRA 2W01A 1NNDA 3IBWA 1TKZB 2MZ1A 5KG3A 4NPOA 3BGFA 5KOWA 2X1AA 4MAKA 1S9EB 4CZCA 1O0PA 1IKYA 4RBTA 3ILIA 1N48A 1SKSA 1LWEA 1CJUA 3NY0A 4X4PA 1UA0A 4C97A 1JLBB 2IY5B 1M5VC 2DR9A 2H1YA 3IWLA 5HLFA 2R7OA 2CVIA 1EZZB 1JNZB 4EK2A 4J9OA 4LF7J 3AJ1A 5AE2A 3FEYB 4JI2F 3TA0A 5HANA 2AQ4A 4GO5X 3IRWP 4ZPCA 4L73A 1Y3KA 3KOAA 3PCOB 4NYZA 3GMGA 4PQAA 3C16A 2H54B 1I3OB 2E5LF 1H98A 2FJAB 1CC8A 1AZSB 1N54B 2HVEA 1BQNA 1Z4UA 1OIAA 3HJVA 3H4BA 2CQHA 2UXCF 1ZAXA 4DJBA 1LW2B 2YTCA 1M1HA 4CYUB 1JLAA 1UZHA 2E9ZA 2VL1A 3GV8B 1Q95G 2PA3A 3AXMA 4LR9A 4L74A 1M5PC 4Y2MA 5B0FA 5HATA 4K4ZA 5J2PB 4F0MA 2R7SA 4FYYB 4URSA 3UVJA 3H2VE 4LSNA 2V2KA 3H5YA 3OSPA 1HPZA 3DKDA 1XQIA 3M2VA 2QL5B 2OPRA 2ZH4A 1WACA 2VKRA 3EGWB 4G1PA 2CPEA 3VTIA 4IRKA 3FCWA 3AB4B 4L3KA 2IC3B 1PIEA 3QGPA 4IKAA 1XR6A 2HHHF 4FKYA 2GQQA 1PG5B 5IWAF 5F0WA 1UWBB 2A3JA 3BQ1A 2OJ3A 3Q2SC 3PVXA 4P7VA 3B8HA 1KDNA 1RHKB 3C66A 1EKRA 3FUYA 4ZLNA 3I31A 2R2SA 3GFXA 4LF5F 2YX7A 3ENAA 4MK9A 2B43A 3RBZA 2X3GA 2R42A 2RF2A 2BRKA 5EUHA 3W2VB 4N7TA 2MPUA 3EWGA 4DSJA 3DRRA 2VONA 2J0QD 5HROB 2GVZA 1UZDA 2W1BA 4P2MA 1N6QA 1JQGA 2W9AA 4UOHA 4X4RA 2HAFA 2H51B 2CJXB 3BB5A 1YKWA 4OIXA 3HD1A 1RWXB 3EX7B 5CH7B 4O4RA 2AYGA 2Q79A 2AEJA 3Q8QB 2X1FA 5C24B 2C2KB 2CPIA 3OJUA 4KV8A 3CCVS 1T8EA 5KFYA 2HWTA 4C3KA 4L6V3 4ATNA 1KLNA 2W9BB 2QZ8A 3GV5B 1GMUA 2AEMA 1XWLA 1FTRA 1SL0A 2DR7A 3CJ4A 5KFOA 1C4CA 2G2ZA 4ZDNA 2CVEA 3J81j 2CADA 2DEIA 3DHXA 2OEMA 3EICA 3LGHA 4Q44A 4RW4B 3CULA 2VJUA 4CM2A 2WW8A 2G9OA 3U7JA 4WP9A 2E5LJ 5IFMA 1TL3A 3L9ZA 2LDIA 4A48A 2MDAA 3QRRA 1RTZA 1V6HA 2BUNA 1NJIT 2UXCJ 3BR9A 4DV7F 2GC8A 3SQGB 3HSGA 4NMXA 1PC5A 1QSYA 2JEFA 3QPIA 4USHA 2M8DB 1REVB 2CPJA 2MQPA 2N3LA 3BN4A 4O23A 1FVQA 5LXYA 4DUZF 2NSBA 1WI8A 2XI2A 3I5CA 4LRCA 1B0PA 3IC1A 2ZH7A 4XDCA 4ZLPA 1JKHA 2WBRA 1BUXA 5F8HA 3HSJA 1RT3B 1NO8A 2RQ4A 1QAIA 1QTMA 5E41A 2QRRA 2R2RA 4J9RA 4ID5B 2VFVA 4LBPA 3MOZA 2ERRA 3ETMA 1SQFA 1FRXA 2MTLA 1YJ9S 5IV4A 1ZM3A 1WDTA 2HHHJ 2E9TA 2LA4A 3OR2B 2HHPA 3SBMA 2Z2ZA 3GLJA 3R1LA 5IWAJ 3QSIA 3H40A 1KS2A 2HLUA 1WDDA 2WVDA 1HMVA 1I1GA 1DLOB 2CRLA 4ES1A 4LF5J 4DLGA 5I3UB 2WSEC 3KK1A 4X64F 1XN9A 3RU0A 2OD6A 4MKYA 4LQ9A 1NHVA 2XULA 4DFMA 4B9NA 4IG3B 3OFGA 1TUWA 4RLEA 4OZNA 2EFOA 3MEDA 1S6UA 4NZ0A 1R7IA 4YEAA 4K4TA 3OV7A 3EUNA 4YDXA 3HX9A 4L75A 3C6UB 2IM2A 3R5CA 3R7BB 4A46A 4CH0S 3ITHA 4ETZA 3QAEA 2NXCA 3HFKA 3M30B 1EX8A 1P9QC 3QZ7A 1YRTA 2BA9A 1S59A 4AL6A 3PJ9A 1CJVB 6FDRA 2R8IA 3RRHA 1QE1B 3IS9B 1G7CB 3S7RA 2HBYB 2KVIA 2KYXA 2FJEB 1N4LA 3ILLA 2LXIA 2ASJA 3PO4A 2H48B 1S1UA 3DLGB 4LRDA 4PABA 2XS5A 3DOKA 3MR2A 2RE1A 4ICLA 4OV6A 4NEYA 1RAAB 4HKQA 4RU2A 1QTNB 3MHYA 1JWWA 2XSFA 2LEBA 5KG6A 3CUNA 3CE8A 3QIDA 5CYQA 4JI0F 3RB4A 2MLXA 1B0TA 1ULRA 3NMRA 1HKAA 4IOAQ 3EE3A 2HZVA 4G1IA 3JSMA 3SV3A 1XIQA 3THVA 4DS4A 4LT6A 2HS4A 1KKHA 4OLPA 5AE1A 3DI6B 2FHJA 2EG1A 2R7XA 4LSZB 2HWIA 1DHMA 4DV7J 2ZD1B 4HTIA 3OL7A 4N41A 2VG6B 1VYAA 2E1PA 2C3OA 2GIRA 4PPZA 3KYLA 4I56A 4I2QB 1FDDA 3CCQS 4DUZJ 2AJ2A 2QG9B 3DN9A 4B9LA 5KG2A 3QO9A 3CCRS 1NDLA 3UD4P 1YIJS 5A8KA 3NG8A 4KKOA 1FT8A 3HT0A 3DLEA 2LQ5A 1HBNB 2HVHA 2V2QA 3HLUA 2I8EA 3K17A 1TZ0A 4LF9J 4LFBF 3F41A 1TAUA 3VAGA 3TEHB 3I0RA 5CZVA 4RX6A 1TQLA 4CM0A 1P1LA 1L3UA 3WIVA 3UW1A 1U1OA 1RT5A 5KFIA 3WHIA 4K0KF 2B9WA 4IRCA 1WTFA 2DEJA 2CPFA 3ZZZA 2EK1A 4DR1J 3CD5A 4OX9J 3HD2A 1AXQA 4TY8A 5KG0A 4X64J 4MK7A 2B0GA 2M88A 3FQKA 1LWEB 3PX4A 1CJUB 3R7SB 1NH7A 2OTJS 3TUJC 2RU3A 4ZVRB 3ET6B 3UDLA 1M1GA 5HLFB 1PSDA 2WOMA 4L76A 4X62F 3HSDA 2ZDPA 3QRPA 2HVDA 1WG4A 2FZCB 1JLEA 2RAQA 3FCHA 2AJ4A 1HBUB 3GSIA 1I5OB 1U26A 5D3GA 2DNNA 1X4HA 2DRAA 5C7PA 2DNRA 4GKJJ 3OTEA 4DZDA 5L1KA 3PFOA 3C16B 4M95A 4ZVQB 2RNEA 2VFSA 1BQNB 1C1BB 2G0IA 3KLFA 1RBLA 3G4SS 4F4AA 5KT2A 4R5PA 1F60B 2F7VA 2DISA 4ED6A 1SJFA 4KR0B 3NAHA 3DOLA 3D6FB 2KZMA 1RA6A 1UA1A 2D69A 3K5NA 1NDKA 2QLJB 3TR5A 2CPZA 2HYIB 4ID8A 3RZAA 5I42B 5JXSA 4LSNB 3IM9A 3NS5A 3AD9C 1JJCB 3MDFA 1HPZB 3R3TA 4JI0J 2KFYA 2YH1A 2OPRB 5F8GA 5DETA 3QMQA 2PIIA 2C3UA 2ZBQA 1LV5A 5A76A 4DN0A 4F4KA 4PEOA 4TU9A 3HMJG 2E1RA 1NBEB 3UN2A 2QTWA 4JB8B 2YWHA 3QJLA 3GG0A 2F8EX 4I7FB 2OPQA 3TO8A 3SSQA 3SCIE 4CI0B 4DCJB 3FBBA 1RI7A 2CJBA 5BXIA 3JYTA 2WONA 3RJMB 3FKBA 3F56A 2G2OA 2VQEJ 4DV5F 1RHRB 5DGAA 1RTDA 1RLCL 1OSDA 5K5MA 4DPWA 2RF2B 1WUUA 2VZ9A 3KLGB 1QUVA 2DNMA 1L3KA 3DRRB 2Y1JA 1RT4A 4ENOA 3TQEA 3IGNA 1VBKA 4LF4F 4RW6A 2XS2A 4KAIA 4CLFA 4EZ9A 4FVMA 1YJRA 2W4CA 1WF2A 4TQSA 1LOUA 4ES3A 4K0KJ 3V6JA 3J81U 3IR5B 5J2MB 2NZCA 4ED7A 5B0DA 2UVWA 1WC6A 2OMLA 4QYRA 4ZPBA 2ASDA 2MGZB 2QLXA 3AHPA 3OR1A 2RRNA 2DGTA 1HI1A 1B0VA 3AD7C 2XCPA 5KFPA 4USWA 3N79A 5BYQA 1SJ4P 2VH7A 3CJ8A 2DNLA 2JL9A 3HT3A 2WSFC 1RISA 3Q8PB 1V3RA 3VZIA 5LXRA 4YB5A 4J7CA 1KOOA 2R7WA 2F8MA 4K5SA 1S1XA 2PDAA 2C2EA 2RSQA 3ZO7A 3W9JA 4K4YA 3FRZA 4WZMA 3OTBA 1SC1B 5KFVA 1KWMA 3DGPA 3TAQA 1HQEB 1NKEA 1RWNB 3ISZA 2EPIA 5FLXY 4G3IA 4QU7A 4HT7A 3JQKA 2HNZA 3B6BA 4WWSA 2XY5A 1FFGB 1DRZA 4RWWA 5D6GA 1FK9A 5F41A 4OJ1A 5GADU 2CQDA 3HF5A 4C11A 4C0BA 4X4UA 2QT7A 3CSKA 4CLTA 1KVKA 3MCOA 3KUHA 3GR0A 3DXSX 3CVKA 3M7VA 3V5RA 3LWLA 3D9BA 4U7UK 2KT3A 3J7ZT 2AJQA 2IYGA 3EYZA 4M8LA 1BLUA 3O1LA 5H9FJ 2XMJA 3CCLS 3BGRB 1OPZA 2WVFA 2FHJD 1C1CB 1HYSA 2ASYA 1EB0A 2LA6A 1YJVA 2OFGX 5C5JA 1N33F 1YK9A 1FA0A 5DDOC 3THPA 2ZC3A 3A3PB 2ZH1A 1HMVB 2VFUA 3ENQA 4F25A 2V69A 3J7YU 4DV5J 3RBXA 4LF8F 2Q66A 5KFGA 2GCFA 3D3CJ 2QC3A 4IFYB 2I0XA 2BW7A 1X5OA 2CA9A 5CABA 2FLNA 3MEDB 1FEHA 2QSFA 1NKCA 3CCTA 3K57A 2VPWB 4EO8A 2Z2MA 4LF4J 1SJ1A 2C2OB 3GYGA 4ZS6A 4USTA 3GIKA 4YFUA 2X51A 4K4UA 1VI7A 5GVQA 3MPWA 1SCJB 4RUCA 1Q81T 1HNIA 4DFKA 5DLGA 4M5GA 3VGSA 4JI6F 4KHMA 5M2RA 2R8KA 1KOHA 3CXCR 2CQCA 4BHQA 4U8YA 5B0CA 5F8MA 4PXEA 4M5NA 2JHEA 2DH8A 3NGKA 1WHWA 3CNQP 1J5EF 2HVIA 1S1UB 2UZAA 3HHKA 3GJTB 1Y5IB 4URQU 2VASA 2LCWA 3TNVA 3OHAA 1F3VA 1S76D 3DOKB 4RNHA 1NZAA 1JLCB 4ZP6A 5CCLA 2ACYA 4PAAA 4DOZA 3QLHA 2CJAA 4W90B 2CYYA 1NK7A 4W92B 1J5OB 4K4WA 3JSMB 3RB6A 4KBIA 1GMWA 3QQCD 5G4DA 1VC0A 3IM8A 3FK4A 4OYBA 3R8YA 2KKHA 4NL5A 3TWZA 4JV2A 2KHDA 1IWAA 3DHWC 3T9NA 2O3DA 2Z56B 2PMWA 1OS5A 3MI7X 2BM1A 1AFIA 1H72C 1L3VA 2XMMA 4AXIA 2J76E 8ATCB 4DSIA 3NGDA 3TOQA 3F73A 4KY3A 5KFXA 1SL2A 2E1CA 1PBAA 4KPCA 1PC4A 3QO9B 3KXDA 1OPIA 1KFSA 4KKOB 3MCSA 3DLEB 2DY9A 2H5EA 4OI0A 3GG1A 4PXDA 5J2NA 4ED8A 4J9LA 1BY9A 3CJ2A 3I0RB 2MXYA 4DF4A 5LJ5Y 3CDBA 1QAYA 1YBUA 4WBFA 4N8NA 3BR8A 1NEEA 4LR8A 1KTVA 2VPZB 2XMVA 2F4VF 3PKYA 2VFRA 4ANCA 2VBYA 4FP9A 4AXJA 5JVGQ 4QOTA 4FZVA 1N33J 3LAKA 2ZKTA 2HURA 2NREA 3G86A 3H5XA 4C8LA 1N5YB 3VALA 2IVMA 5EHHA 3H0PA 4UOGA 1Q78A 1XNQF 1WF0A 4I4BA 1N5TA 3K59A 2CPXA 1UJ4A 4ZVFA 2GHVC 3HZGA 3VF0B 1FJEB 3LOUA 1UFWA 4OI1A 2WOMB 2COLA 3KNGA 1B7FA 2VA3A 1JLEB 3OUYA 3PIPQ 1TFYA 2YWWA 3QIPB 3KJNB 3IAS9 1VQ4S 2HRTA 5EN1A 3VWSA 1RT2A 3D54A 2MKKA 4BLGA 4H4MB 3JSRA 4FVCA 2GAGC 2MJUA 2AKWB 2E1MC 3N5BA 3MTJA 3KLFB 4JI6J 3RUBL 1DBDA 1GMVA 3GR1A 4RUBA 3WZ0A 2XNRA 1K1QA 1TK0A 5BJRA 2DHSA 4M5HA 4IR9A 1J5EJ 4TKTA 4DSEA 2CPDA 1EETA 2PA8D 1EQ0A 2C1EB 4IFVB 4YB7A 1F1BB 5SZTA 3PW4A 3ZNJ1 3LPYA 4WXWA 3H2UB 4USJC 3FJ2A 1UVIA 4FS1A 2WVBA 3ZTPA 1TKDA 3BBBA 1SKUB 1Q8KA 4AT1B 1PJ7A 4X4QA 2BMBA 5KT4A 2QJ3A 4DSKA 1KRPA 4ITSA 4PG4A 2QFIA 4OJHA 5FJ4A 1EP4B 2Y0SD 4N56A 4AQYF 3HVWA 5EWFA 4O3QA 3MOJB 1IR2A 2KJWA 2OPQB 2RD5C 3U1NA 2WZ1A 2HHSA 4Y2CA 4ED4A 4CLWA 1S6QA 3DMJA 3J7YI 1K47A 3JYTB 2FHOB 3Q8SB 3RAXA 1RWKB 1H3DA 2G0JA 3H7HB 2GJFA 4CLZA 5KG7A 2K2PA 4KTQA 1SV5B 1HI8A 5K9FA 2YQ1A 3J7AN 4IR1A 2XI3A 3QBCA 5HP1B 3QT8A 1ZM4A 1RAJA 4IYQA 3GWCA 4CLSA 3Q22A 4QIFA 3HHLC 3G71S 2KFNA 2O67A 2M52A 4DL6A 3A12A 3KMQA 2A18A 2LU2A 1ZBTA 3DU5A 3UO0A 1U45A 2PT0A 4X84A 3OD2A 1KVJA 5HMZA 1U7LA 2WCXA 1XNQJ 4AE5A 2JEIA 4LF1A 5IQQA 4LIWA 3BKFA 2MKIA 4PG8A 5AXMA 3CT9A 4LRBA 3CDEA 4NLTA 1NH8A 2YKNB 4DPTA 4YQWA 1SIWB 3FFIB 4ED2A 2BV3A 2C3YA 2RMLA 2B8PA 4H54A 3CJ5A 2ALZA 1DTQB 1HWJA 3DGPB 1UVLA 5KFFA 4RNOA 3U02A 3UN5A 2NXNA 2GZOA 4HL9A 2NXJA 1U2FA 3AJ2A 4RW8B 2VG5A 2D9OA 2ZEJA 3SDEA 3DLBA 3PR5B 1DTTA 3CJQA 2AV5A 4ZCLA 2JVOA 3NCRA 1FK9B 3I6PA 4DI6A 2PI5A 4QR0A 3HFVA 4XDDA 4PWDA 1S0MA 4NA1A 5AXLA 5HVGA 2L3MA 2HHVA 4ZVEA 4I67A 3HHLD 3MECB 1S99A 4NLWA 1CJKA 1ZPWX 2HZAA 5J1EA 3GFHA 4AQYJ 3N0VA 3TAPA 3QATA 2DXFA 4UW2A 3JAMY 3GIRA 2HIQA 4RW7A 3CCWA 4O44B 3NGRA 2ZUGA 3T5HA 3MM8B 2R2UA 4FYDA 4BBYA 2MKHA 2HVZA 4CT8A 3S6EA 3MM5A 5IV3A 3JXOA 3M9OB 2R7RA 3DLJA 2DGQA 3AH6A 3P5BP 5D0GA 4ZVPB 4Y28C 2W2OP 2A1BA 3NOCA 3R97A 2IMOA 3DRPA 5F8LA 2KO1A 3QAUA 2FVPA 5KFTA 1HHSA 3A8EA 1SQGA 2BR0A 2XB2D 2FZKB 2OKQA 2IBKA 1WC3A 2M70A 2AYEA 4ELVA 2MKCA 1TL4A 3N6MA 1FE4A 5ETPA 3LP0A 4ZCMA 2FC9A 1U25A 1U1NA 1S57A 3TX8A 4U6PA 1QVGR 3Q24A 3PM9A 4DQSA 3T5JA 4F02A 4DSLA 5KT5A 4CLPA 4B02A 2ZJPQ 1TU0B 1LXJA 3DLLQ 2XMUA 2JEJA 4PYAA 4ECZA 1HBOB 3PW2A 4CTAA 5C25A 2DO4A 1NSKL 3RRKA 1RJJA 2RHSB 2KT5A 2YNHA 1Y0HA 3IBFB 2I38A 1Q79A 1CJTA 2OFHX 3GE9A 5FD1A 4OJ3A 2ZOMA 2W8KA 4U96A 2WVCA 3HHLB 2RRAA 1SKRA 4USKA 4UTGA 4P74A 1RU2A 4TXSA 1S77D 2W4PA 1KTQA 5LM7E 1JLFA 1CPZA 1Q8LA 3DRSA 1TV6B 3EVWA 3FGVA 3W64A 3RAQA 2Y8YA 3HVRA 1HHQA 4CWBA 1RTHB 4GVBA 5DG7A 1TFWA 3AQOA 1X8DA 4NLRA 4TLRA 5KFRA 3X3UA 2QA4G 3JB9k 1WHYA 4TU7A 5K14A 3W62A 2FPHX 3LP1B 3PACA 4OFZA 1AFJA 1SUQA 3AXKA 3MR5A 3D67A 1VBZA 3OPKA 2KHCA 2JLFA 4ECSA 4D3GA 3KWMA 4QW8A 2XM3A 5J2NB 4JI5F 2YNGB 2W2NP 2R8GA 4EBEA 3OVBA 1QY7A 4LFAJ 5KT6A 3MUTP 4NXNF 2CG8A 4OI2A 2BW2A 4NE9C 2P9CA 1F5AA 3GB0A 2DGOA 5KFAA 4ZMMA 3KDNA 4Z2XA 3IMQJ 4ZVUB 4DQPA 2CIMA 4CP5A 3HVTB 4P75A 4EYHB 4DFPA 4USIA 3SFUA 3KJFB 4NXMF 4OYPA 5C2GA 4JV0A 3BO2A 2IRYA 4F3QA 1PBUA 2ZWPA 1R0AB 4Q7AA 2V8GA 2RT3A 4B9TA 1PJ5A 1YJWS 4F7VA 5E5NA 3HCXA 2QGFB 3HDSA 3G82B 2EK6A 3DYAB 1LW0B 1VRTB 1U1MA 2CPYA 2RDIA 1RWUA 3KUEA 3M2UA 4KO0A 1MROA 3OVAA 3UCUP 1R0BG 3EDRB 2LFVA 2RDDA 4AL5A 5T7LB 2HK2A 1RWVB 1U48A 4OJGA 2RUGA 1R8CA 3M1VA 4OYIA 1YZ6A 2RKIA 1U2RA 5EWEA 1ITPA 1NXIA 4YN3B 6AT1B 2DHXA 3KK3B 1C0TA 3M8PA 5DZ7A 4F67A 1U8SA 2JEGA 2XMWA 2KI2A 2MLYA 1UP1A 3SSRA 1RHUB 4XO0A 3D4JA 4FF3A 3OT9A 1CVJA 1MSWD 4ZKAA 1K0VA 4KGKA 4JV1A 3H5UA 1VMBA 2C2MB 4MT1A 4PXBA 2VODA 4PXCA 3MEEA 2O1PA 1S1WA 3H4DA 2DRDA 3H2LA 1RTJA 2VV5A 1HNVB 2ACMA 4PG6A 4OX7A 2DNPA 2PMHA 3UR0A 4LVOP 3W65A 4KGXB 1QUPA 2DO0A 4PCQA 2IJFA 2UXBF 1Q1KA 4GVLA 1DZ5A 1UPMB 3DGVA 1F2HA 1CQMA 4OYOA 1JXLA 5KFDA 3DMJB 3T9ZA 1NPKA 2ZE2A 5KFSA 2J0SD 2XS7A 2CDRB 4B9SA 4HEA9 1OY9A 4K59A 1VIXA 2XCAA 4C8YA 3L95X 3OTOF 2HNYA 2A6MA 2Z8QA 1T02A 3NNCA 1JLGA 4WF9Q 1SI9A 3Q8UA 2EVZA 4RNNA 4JI5J 4IO9Q 4DXLA 4HHHA 4DG1A 2GGPA 4NXNJ 2MYFA 1X5SA 3BYPA 1U24A 2BQUA 1B3TA 4CCHA 2V9KA 5HN0A 2XTJP 4X4SA 1IVZA 1IKVB 2DCLA 4ECVA 3OLBA 1V5VA 4YHHF 1FKAF 1K44A 3BKUA 1ROFA 4MIBA 4QJVA 4IQMA 5IM0B 2B4VA 1FFWB 4RWXA 2IDEA 3M4XA 3EM1A 4ES2A 2J6SA 1VOMA 4NXMJ 1HA1A 1T05B 5H9EJ 3F44A 4WP3A 1F3FA 1I94F 3TUZC 5ETVA 4IRDA 2YVSA 3PY8A 1YITS 1GAOA 1RTIB 1RT7A 3PR4A 4Q0BB 2YX4A 2ZFHA 2MQMA 2IHR1 1YWXA 2W9CB 1D9AA 3T6BA 1YJUA 2GIFA 3K5MA 4O4GB 1KN6A 2DR6A 4A8YA 1T0TV 3GONA 4NOHA 3W7BA 3K2YA 5L39A 2RQKA 5JUMA 4KQZA 1KONA 4BWMA 4CO2A 3T6JA 2ZBIA 1PAUB 1X9SA 3P6YC 4CLUA 1LK7A 5IXUA 1WI6A 1S48A 1S79A 3IXQA 2HPUA 1U2CA 1H2VZ 2DNZA 3SDEB 1GTHA 4IOCQ 1ZS6A 2CWKA 5DQHA 2XY6A 2RHQB 4P7TA 3SFGA 2GIQA 1X4CA 3MMCA 1S1VB 4WFXA 1RT1A 1TVRA 1TELA 3BM7A 3QWPA 3M6VA 2ZHBA 3VVUA 2RS2A 4C8KA 3RB0A 2H4YB 4X4NA 4O0NA 4CT9A 1NB2A 2LDYA 2DRBA 1CJKB 3PEHA 3V6HA 4OZ2A 2BJEA 1QVFR 2JLGA 4IDKB 5CXTA 4OV1A 1RXOB 5DS7A 1S6PB 4QWBA 3BKTA 4RW7B 3D1OA 3Q86A 3GJQB 1RK8A 3OHBA 4YB6A 2LLZA 3UPFA 4NRUA 5HAOA 4KB7A 3MM5B 3V6DB 3OTOJ 3GYNA 2GVDA 4K50A 3ELHA 2PEHA 5ETKA 1IJEB 5C42A 2AWZA 3GIIA 1R3NA 2VG7A 3S8SA 4DR2F 3I55S 3EGNA 2A2CA 4NLXA 4PUOA 2HFZA 5D8HB 3G2XA 1LFWA 2IRUA 3SXLA 1MLAA 4HT5A 5ETRA 3LP0B 2JOQA 1QAXA 4YHHJ 2VPYB 2CNKB 2EBEA 2IPOB 4OMFG 1RKJA 2PN6A 4G6VB 4HACA 1WC5A 3OFHA 4RW9A 3I4HX 3PTWA 1RYRA 1FERA 5D15A 2R4FA 4F3MA 2C2DA 4KPYA 1NK6A 2LEPA 5HSPA 2YWKA 1MN7A 2O01C 2DR5A 1B7YB 4ZN1A 1MWZA 4CTAB 5C25B 1I94J 4DR4F 2DXDA 1WC1A 1S1TA 2YNHB 2BYCA 3HJFA 1O51A 1NK9A 2EI5A 1FDAA 1CJTB 2Y0BB 3O44A 1WSVA 3TJ8A 4QR1A 2FJWA 3NL0A 2ZUAA 2RDJA 3BO3A 1H7WA 2F9DA 4DU8A 4ZVSB 3PZPA 1FNOA 1VHFA 4Q2MA 1FRLA 2RILA 4USMA 4EYIB 2IVYA 3PG9A 2P8IA 3DRSB 3WIUA 4DF8A 1EAYC 4P9SA 1IJFB 1YTYA 2CG4A 2RIJA 1VRUA 3M8QB 2FLLA 1WHXA 4HYKA 2J7KA 3DM2B 5CYMB 4LF7F 3PYDA 3CCMS 8AT1B 1VQYA 4FS2A 5K14B 5LMNF 3QJPA 4P2XA 3PNIA 1R6YA 1TKTA 2AX1A 1RADB 4B9MA 5THWA 3FEXB 2AYMA 3CJ0A 1S9GA 1LEOA 4B3TJ 3ICLA 2YY3A 1FD8A 3ZC4A 4Z37A 4B3OA 2BDPA 3IWNC 3DFEA 2R7UA 1QLNA 4MK8A 4KHPF 4V19J 3ZTQA 3PO5A 3BGOP 2G1HA 2OPSA 1TL1A 4RJVA 2BANA 4DZ6A 1U02A 5B0GA 3M32A 2DB1A 4GO7X 2Q1LA 1FDNA 2XZWA 2Z58B 2NPFA 1QSLA 4BC9A 1SPBP 2HAIA 1HLWA 1FXLA 1OO0B 2HQFA 2IM1A 4DR2J 3H90A 1BMQB 3WX4A 2OPPA 3AOBA 3DRYA 2MB0B 2DHGA 3M2UB 4JI1F 2FD2A 3K8VA 2E44A 1D8YA 1MROB 4C3LA 1BWEA 5FDLA 3OXFA 1CEZA 3V2UC 3QRQA 2AF6A 2UUWA 5MLCV 3H5SA 3E01A
chains in the Genus database with same CATH topology
4CNYA 4RBVA 5H9FJ 2AJFE 2QE5A 2XMJA 1KHWA 1OWXA 1W25A 1S9GB 2IAJB 5E3CA 3CCLS 3KK2B 4WFBQ 4A8MP 5T41A 3HK2A 3CPWR 3BGRB 1OPZA 2JFDA 2FHJD 3BQ0A 4CQ1A 4EEYA 2J6UA 3PJXA 1L3TA 1C1CB 4TNOA 2IVFB 4A8OA 1HYSA 3LH2S 3IGVA 2D41A 2RH3A 2DGUA 2ASYA 2CJQA 2LA6A 2NLWA 2MSSA 4WXOA 1S1XB 1R8AA 4NA2A 5HBMA 1YJVA 1JNRB 2OFGX 2WBMA 5KFBA 5KFJA 4B3OB 1AW0A 3RAMA 5C5JA 4I69A 5GAEU 1JLCA 2B3TB 1N33F 3M8PB 2DITA 3IR7B 1FA0A 3LUYA 5DDOC 3THPA 5J1PA 3OJSA 4NLVA 3J7Z5 2ZC3A 2ZH1A 1HMVB 2VFUA 3ENQA 4BWJA 3CCUS 3V4IB 3B82A 3Q2TC 4F25A 3KLHA 1GXLA 2OSRA 2GO8A 2ZVSA 3MM9B 3J7YU 2B4UA 3OLAA 2OPSB 4F8RA 1TL1B 2QA4S 2ZH2A 1JLQB 1J5OA 1VC6A 4LF8F 5B0EA 2ZNZA 1NRKA 4DQQA 2KN4A 2XWYA 2Q66A 5KFGA 2OD4A 2GCFA 3CDAA 3M32B 4ILMA 2VBXA 1DARA 5IQ6A 4JI3F 1UEVA 4IFYB 3VQSA 3RBEA 1VQMS 2R8HA 3RW7A 2I0XA 1Z2LA 1NK4A 4GC6A 3G8TA 5LSLA 4DWIA 2FVRA 1I6JA 1X5OA 4XIUA 1U49A 2XGPA 2OTLS 1S1WB 2FLNA 2HNZB 4YY3F 3MUMP 4C8ZA 2E1AA 3MEDB 2J9DA 2C3PA 1FEHA 2QSFA 1NKCA 1KNZA 1LQ9A 3CCTA 2VPWB 4EO8A 2Z2MA 3K57A 1URRA 1SJ1A 4KHRA 3L7OA 4R0EA 3NAIA 1WEYA 3Q23A 4ZS6A 4UQGA 3TA2A 3RRGA 3GIKA 3MUVP 1T3OA 4QPTA 4YFUA 2X51A 4C11B 2E9RX 2OAUA 2DIVA 4K4UA 1YQHA 3J7A1 4BS2A 1KQGB 1VI7A 2JZ5A 3TYTA 5GVQA 2OPPB 1NK5A 1RT6A 3MPWA 1O8BA 4Q8FA 3MMBA 2MZTA 1RGVA 4RUCA 2W8LA 1Q81T 2HMIB 4X4VA 1S97A 1HNIA 4DFKA 2F3JA 5CZXA 5DLGA 2YWEA 1QSSA 2HQ3A 4BDPA 4CO1A 2HW3A 4JI6F 4KHMA 5M2RA 4N47A 5FDLB 2R8KA 1KOHA 4ZP9A 5A8WB 3CXCR 1VQ5S 4LFAF 4URGA 2CQCA 2GV1A 1N0UA 2LEAA 4H4KC 4BHQA 4QU6A 5B0CA 5F8MA 4PXEA 4CIOA 4ZVGA 1BGXT 3G8QA 2JHEA 5G0RA 1ZAVA 2DH8A 3NGKA 2E7WA 1WHWA 4FNIA 3TVZA 4UQTA 2ZH3A 3P49B 2ZOFA 1P27B 4U7CA 1X5PA 2LMIA 2IJNA 2N7YA 4DL7A 1J5EF 4NYPA 5LT5A 1FKOA 1HI0P 3TRGA 4FF1A 2HVIA 2YH0A 1NJXA 1S1UB 3TW0A 3CD0A 2VOOA 2UZAA 1JK9B 1WHVA 2FHKA 3HHKA 5B0BA 1Y5IB 1FXDA 4URQU 3G6VA 2VASA 3HKZD 2LCWA 1ZYQA 3CGIA 1HYSB 4C0HA 5CA5A 3O3LA 2NXUA 1JJ4A 3TNVA 3OHAA 1VQ9S 3KG4A 1S76D 3CD7A 5HBMB 3DOKB 1FRKA 4RNHA 2ZJRQ 2R7TA 1NZAA 4MH8A 1JLCB 2IFXA 2MJNA 4ZP6A 5CCLA 2N3OA 5HMWA 2ZZNA 4QIEA 3I5BA 2ACYA 2ROGA 3IG1A 4DOZA 2VUGA 5CCMA 1SJRA 2F8HA 5U47A 3EGZA 3QLHA 3W2VA 3EXYA 1MWYA 3M8SA 2CJAA 3KLHB 1CG2A 2NUHA 4W90B 3TAMA 3B4MA 2CYYA 1NK7A 4W92B 2N7CA 1R43A 2DTJA 1MMNA 4LF6F 1VLYA 2GMLA 2WAQD 1J5OB 5A0YA 4K4WA 1FRJA 3DCAA 2XHWA 3JSMB 1KVIA 3RB6A 3QZ8A 4KSEB 2J0XA 4KBIA 3M05A 4DQRA 5D77A 4DL2A 2AP6A 3U1MA 2C22A 5G4DA 1VC0A 2K8GA 2HG4A 2I1RA 3J81Y 3LW5C 4DL3A 2QA2A 1N5YA 4FBUA 2KKHA 3NCPA 4NL5A 3GQCA 4JV2A 4WFAQ 2KHDA 1G2EA 3DHWC 3T9NA 3J80Y 2O3DA 1SH0A 1FE0A 4A4JA 1OSCA 4UY8T 1XMBA 1OS5A 1N5VA 1E6VA 1KFDA 2DVIA 3OL6A 3MI7X 3LWMA 4UOCA 2BM1A 1AFIA 1GTEA 1KSPA 3B78A 1VK8A 4FXVA 1L3VA 2LYVA 3LO3A 2XMMA 2HGMA 3SMZA 4AXIA 3Q8RB 2J76E 4DSIA 4J5OA 5DJBA 3U27A 1TUVA 3C8YA 2PI4A 5D78A 3NGDA 3TOQA 2B7CB 3IRXB 1RT6B 2EFVA 2Q6BA 3F73A 3EZUA 3BS9A 3FNNA 3MMBB 1VBZA 1FRMA 5KFXA 2DK2A 1SL2A 2E1CA 4NLDA 3QIPA 4YR3A 1SH3A 1P8GA 1FVSA 4L72B 1RT7B 1HNIB 1PC4A 3QO9B 1JB0C 4ECQA 1IBKF 3TQ1A 1TAQA 1V3ZA 2BE2A 5HO4A 3H25A 2ZH8A 3KLIA 1OPIA 2DBBA 4H4MA 4TU8A 1UVJA 1HL6A 1ZM9A 4KKOB 5M2UA 1KFSA 3V4MA 3MCSA 1K1SA 2FJBB 4A8WA 3DLEB 3T5KA 1TKXA 3CJKA 3FZBA 4OZ1A 2H5EA 4F4WA 3C46A 4UY85 4OI0A 3R5BA 2LQBA 4DL5A 3GG1A 3OFFA 3KHGA 5G0RB 4PXDA 2WK4A 5J2NA 2EG2A 4J9LA 4ED8A 2J9CA 3BDPA 2D1CA 3PRDA 4YB1P 3MF5A 5GAHU 4Y6IA 1LWCB 5DM6Q 2OMOA 1BY9A 1IUJA 3CJ2A 4KGMA 3GV7B 4OHWA 1G3OA 3I0RB 2KYZA 2YKOA 2MXYA 2M3DA 3M8RA 4DF4A 2U1AA 2R7VA 5LJ5Y 3CDBA 1WWHA 2V0NA 2IM0A 1SH2A 3MM6A 4J9MA 4X65F 1QAYA 4RKUC 3TANA 2CQIA 3BSAA 4I0WA 2QO3A 1E6YA 1VQ6S 2CQ1A 3N6NA 5CD4H 2G4BA 4N8NA 1K9MT 4RW4A 5L38A 1FCAA 4RNMA 3IG1B 3BR8A 4NWBA 3BSCA 1NEEA 2XBPA 4C98A 5KT7A 2YWGA 2DR8A 2KRBA 3QLHB 1KTVA 2ZC4A 2VPZB 2XMVA 3E3XA 3IR6B 3TI0A 3PKYA 4IFVA 2VFRA 3N28A 3TAMB 2AU0A 4B9UA 2VBYA 2P9EA 4FP9A 4AXJA 5JVGQ 1HWIA 4QOTA 2M7SA 1CSJA 4FZVA 3DOMA 5A0YB 1N36F 3KTQA 1U1PA 4HH0A 3W2WB 3I0SA 3LAKA 4JI8F 4PKDB 2ZKTA 4OHZA 1SIZA 3PKMA 1DAXA 3ZZYA 3GILA 2NREA 4MYTA 1KQFB 3G86A 3H5XA 4C7QA 4C8LA 1N5YB 2HHUA 1RT1B 2MSTA 2IVMA 3VALA 3BSOA 3ZFVA 2JFKA 2IA0A 5EHHA 3D0GE 3TVKA 1X7VA 1YG0A 1Q78A 1XNQF 3CWJA 1WF0A 4I4BA 2GJ2A 1N5TA 3K59A 3CC4S 3MEKA 2CPXA 2FHMA 3DDKA 2LECA 4LFCF 2VC1A 3RYLA 2O5DA 2HS0A 2BBEA 1UJ4A 5F9LA 4ZVFA 3BF4A 2GHVC 4ECYA 3HZGA 3VF0B 1IQZA 2WSCC 3DDNA 1VQPS 1E6VB 4EZ6A 4XPEA 1FJEB 2ILZA 3LOUA 1UFWA 4AFFA 1EP4A 2MZRA 5K8OA 5AJ3F 4OI1A 2WOMB 4JI7F 1U6FA 1Y00A 2COLA 3KNGA 1B64A 2DNGA 3QGGA 3GIMA 3QYYA 3CJ3A 4H4KA 1XR5A 2LU1A 5DO2A 1FTCA 1B7FA 1RQ0A 3H20A 4ZHRA 2VA3A 1JLEB 2KFZA 3OSNA 3H8YA 2B9YA 1LKZA 1HW8A 3PFEA 3PIPQ 3OUYA 1TFYA 1HBMA 3QIPB 3E51A 4IQXA 2V8VA 3IAS9 5AE3A 1VQ4S 5EN1A 3VWSA 1RT2A 2DNOA 5I3PA 2P5VA 2BJDA 3D54A 4H4OA