3JB9k

Cryo-em structure of the yeast spliceosome at 3.6 angstrom resolution
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
89
structure length
89
Chain Sequence
TLYVNNLNDKINKNDLRTALYMLFSTYGTVVDIVALKTPKMRGQAHVVFFDPSAAAIAMKALKNFIFFGKEMKIQYAHSKSKIIERIVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pre-mRNA-splicing factor spp42
publication title Structure of a yeast spliceosome at 3.6-angstrom resolution
pubmed doi rcsb
molecule tags Rna binding protein/rna
total genus 22
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2015-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
k PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3jb9k00
3ZZZA 2MZ1A 1WF2A 1DRZA 1P27B 2DNMA 1O0PA 3SMZA 1VQKS 2M8DB 2MZQA 3VAFA 1PO6A 3CF5Q 1VQNS 2FC8A 3UCGA 1QVFR 2DGVA 2MZTA 1SJ4P 2ZJQQ 2LCWA 3MD3A 1VQOS 2CPIA 2OIHA 3RW6A 1VC5A 4QU7A 3CD6S 2M4MA 2RQCA 3RW7A 3THPA 1QVGR 1N88A 2XS7A 1DHMA 2DHSA 5JVGQ 1X4EA 1VQMS 2RS8A 1FNXH 1N54B 2J0SD 2CQ0A 3EGZA 2CQ2A 5DM6Q 1UFWA 2MY7A 2YTCA 2DIUA 1HD1A 1S72S 1P1TA 2L9WA 3UCZP 2MKIA 3MURP 2KXFA 4M5DB 2CQIA 2WBRA 1U1LA 1OWXA 1UW4A 3PIPQ 3H2VE 1VC0A 3TO8A 5LXYA 2DH9A 1YITS 4IOCQ 1KOOA 2LYVA 2QEXS 2CPJA 3P49B 2AYBA 2EK6A 2MZSA 2PEHA 2Q79A 3MI7X 2F9JA 3CCRS 1FT8A 3FEYB 1ZZFA 5DDRC 2L08A 5HO4A 2LEBA 2QA4S 3R1HA 2CQPA 2KG0A 3CMAS 2F9DA 2M88A 2MQNA 3MUMP 1KQSR 3NNHA 1RK8A 2LMIA 3N9UC 2RNEA 1QM9A 1H6KX 2MB0B 3VAHA 2MQQA 1JJHA 2DK2A 3S6EA 3BO3A 1WG1A 1WF1A 1WHXA 2KH9A 4TU9A 1VQ5S 1F9FA 1OIAA 1X0FA 5D77A 2GO9A 3BS9A 2L41A 1X5TA 1WI6A 2MKJA 4LMZA 3CCMS 1WTBA 1K73T 2VONA 2KFYA 5DDPC 3EX7B 2CPZA 5DETA 2MKHA 5HL7Q 2OSRA 4W90B 2HZCA 4WKRA 1WELA 1U1OA 1BY9A 3BEGB 1FJEB 2MY8A 2UP1A 1WHVA 2XNQA 4IUFA 1X4FA 2N7CA 4WFAQ 2MKKA 2M8HA 2VOOA 1XN9A 2AYGA 1WEYA 1WEZA 1Q81T 2OTJS 2KVIA 2DNHA 3CCLS 1OPIA 1VQ6S 4QQBA 2LXIA 1SJFA 4A8XA 2KXNB 2DNQA 3NNAA 3CC4S 3ZZYA 2CPYA 2K3KA 5IQQA 1Q7YT 5IM0B 3BO2A 3CCSS 1YJNS 4ZKAA 1PGZA 2YH0A 2U1AA 1R8PA 2MKCA 5CXTA 2DHXA 3S01A 2ZJPQ 1FJ7A 2JX2A 4PR6A 4FXVA 4F26A 3BO4A 3Q2SC 1X5OA 4PRFA 2DGXA 3CCQS 3CC2S 2K8GA 3CXCR 3MXHP 2RRAA 1K9MT 2MQMA 3JB9k 2A3JA 2DGSA 1U1QA 1DBDA 2D3OR 3H2UB 4U67Q 5GVQA 2JVRA 1A9NB 1B7FA 2LEAA 2ADCA 3HHNB 1UAWA 3U1MA 2DNRA 3SDEA 5EN1A 4P6QA 1WHWA 4OZ1A 2DNZA 3J7YU 1X4GA 2SXLA 2D9OA 3VAGA 1WG4A 1M90T 3UD4P 3NMRA 4WIIA 1VQ9S 2CJKA 4Y00A 2FC9A 2ERRA 1U1RA 3MDFA 3ULHA 2ZJRQ 1FXLA 5GMKa 1D9AA 1WEXA 2PE8A 4F25A 2MSSA 1VC6A 2M70A 5IFMA 1NU4A 2HYIB 2J76E 4UY8T 2FHOB 2MQLA 1KOHA 1FHTA 5DDQC 2DHGA 5LJ5Y 4YOEA 1VQ7S 2RRBA 1W2BR 1JMTA 2CQDA 2E5HA 1KD1T 3EGNA 2MSTA 3US5A 3MUTP 2X1GA 2KHCA 2HGLA 3G96A 2DGWA 2AYMA 2MXYA 3G6ES 1U6FA 1X4AA 2YH1A 2X1FA 3UWTA 3DXBA 3UD3P 1U1MA 3G9CA 2XB2D 2DNKA 2KN4A 4UQTA 1VBZA 4J5OA 2HGNA 1D8ZA 5LSLA 3PIOQ 4ED5A 1U2FA 3VAJA 1HA1A 3CCVS 2MHNA 1M5KC 3I56S 1JJ2R 1CVJA 4C7QA 3R27A 2U2FA 4WFNQ 2ADBA 2DB1A 2XNRA 1HD0A 2M7SA 2FPHX 1YTYA 1NJIT 2CQ3A 3R1LA 2JRSA 3VAKA 1WG5A 3V4MA 2DO0A 2M9KA 3J7ZT 2KM8B 2YWKA 1ZH5A 2N82B 2VODA 2MPUA 2FY1A 2CPEA 5GAHU 2MGZA 3VAIA 1IQTA 4WFBQ 3I55S 2CPHA 2DITA 4YUDA 2G0CA 2LKZA 5GAEU 1X5SA 2VOPA 5GADU 3D2WA 1OO0B 1VQPS 2KU7A 4OZ0A 2M0GB 2D9PA 1N52B 2RQ4A 1YHQS 2NZ4A 4Z2XA 1NO8A 3Q2TC 3G8TA 3B4MA 4CH1A 1URNA 2LQ5A 2DNGA 3VALA 5JVHQ 2M2BA 2JWNA 3CCUS 3DLLQ 2N3LA 1H2UX 2I38A 3S7RA 2MZJA 3VAMA 2XS5A 3CCES 5BJRA 2DNLA 1S79A 2DO4A 2LA6A 2V94A 3MUVP 3HI9A 5D78A 2KM8C 5DDOC 2CQCA 4FXWA 5CYJA 2RT3A 1SJ3P 2OSQA 3UE2A 4IO9Q 2X1AA 5LSOA 2HGMA 4WF9Q 1R8HA 2KXHA 1H2VZ 4W92B 2KG1A 3SXLA 3P5TL 3NS5A 4YB1P 1FO1A 3U1LA 1UP1A 1WF0A 1YJ9S 2CQHA 2J8AA 5H1SV 2XS2A 2F3JA 5LJ3Y 4RU2A 2EK1A 3CC7S 5ITHA 1U6BA 4LIRA 2MQOA 5DM7Q 1YI2S 2CPFA 3B4DA 2QFJA 3IWNC 4Y0FA 2MJUA 1HL6A 2KRBA 2MJNA 1WHYA 2DNYA 2HVZA 1DZ5A 4CQ1A 2MGZB 1SXLA 1M5OC 2KI2A 3G71S 3MOJB 2O3DA 2DISA 1YIJS 4CH0S 2MYFA 1WWHA 1JJ4A 2RS2A 3P6YC 5LXRA 1A7GE 4BS2A 2KT5A 2XSFA 3L3CA 2YKAA 2RU3A 1SJRA 2CQ4A 2AD9A 4QU6A 2DH8A 3G8SA 1FJCA 3LQVA 5FJ4A 2DNNA 3THTA 4PKDB 2M52A 2CQ1A 1X4BA 5GAGU 1M5PC 4EGLA 4TLQA 1U1NA 3CUNA 2AYEA 3CULA 2DGOA 2KYXA 4QPTA 5IM0A 3NNCA 2NLWA 2OTLS 1M5VC 1X5PA 1N8RT 1K8AT 2X1BA 1G2EA 1VBXA 3LPYA 4F02A 1WI8A 2CQBA 4TU8A 2E5JA 1VQ8S 1M1KT 2MZRA 3CCJS 3VF0B 1Q82T 2GHPA 3MD1A 1X4CA 2BZ2A 3SDEB 1Q86T 4TU7A 3CTRA 1VQLS 4ERDA 2CPXA 3G4SS 1SJQA 5MLCV 3OW2R 1RKJA 1ZZNA 2G1DA 3NS6A 3CMES 2MQPA 2BOPA 2CPDA 2DHAA 4C0OC 2OJ3A 2DGQA 3TYTA 2J0QD 1U1KA 2LA4A 1L3KA 2DNOA 2E44A 2LXUA 4V19X 2LECA 2E5IA 2JVOA 1X4HA 4IOAQ 2RVJA 4C4WA 1U1PA 2KRRA 4LJMA 2N3OA 1YJWS 1VBYA 3K0JA 1H2TZ 4WCEQ 3IRWP 2MMYA 1VQ4S 3FEXB 2I2YA 1YWXA 2RUGA 3UCUP 2E5GA 2DNPA 2EVZA 2DGTA 2B0GA 3S8SA 1X4DA 2MKSA 4CIOA 2DIVA 1AUDA 2G4BA 3P3DA 5CA5A 3TP2A 3CPWR 2CQGA 2DGUA 1KC8T 2DH7A
chains in the Genus database with same CATH superfamily
2NXNA 4A8FA 5DQGA 4PG5A 3VAFA 4B17A 4FF2A 5E2QA 1VQNS 3BYRA 2J7UA 1SJ4P 3MD3A 3RW6A 1RT1A 4RW4A 2RU9A 4DR1J 4QU7A 5KG6A 2ABYA 2HNZB 3HM9A 2ZOMA 1KHVA 3KMQA 1VRTA 2KXFA 3LPEA 1HBMA 5B0CA 3BSCA 4ZS6A 2LQ9A 3I31A 1SV5B 1EKRA 2LYVA 4RBUA 1KP6A 2KJVA 3JTOA 2F9JA 4A47A 3ZNUA 4IH5A 4ELTA 2VBXA 3UVJA 4JUZA 3RJMB 4X64J 1TL7A 3T1HJ 3AA8A 3AODA 1WHXA 2GA7A 4KB7A 3HSJA 1TAUA 2PFDA 3FDSA 3MPVA 2XZWA 3QLHA 3W2WA 1FERA 4GC7A 3KK3B 3PKMA 1OPZA 1N36J 4URSA 3MTKA 4EYHB 2H48B 2AWZA 5KOXA 1NJYA 5HQMA 3IMQJ 3OHBA 2OEJA 5H9FJ 3CC4S 4WTYA 4RX6A 5DLFA 3OBIA 3OL7A 1RQ0A 2GAHC 4ZIVA 5KT4A 4JI0F 1FTRA 4JYAF 3M2UB 2YH0A 3KLGA 1WORA 2IDEA 2H5IB 1LWFA 3S01A 4RZRA 2GQCA 1SKRA 4PR6A 4CLFA 3MEKA 3CCQS 1U7LA 2HPUA 2YNGB 2D3OR 2AZ1A 3DDKA 2UVVA 2NZCA 2PEBA 5J1NA 1UTAA 5L39A 3NGRA 3HVTA 4KC5A 3SCJE 1IJFB 3ZZUA 3W62A 3MDFA 4DL4A 2DR6A 1KOHA 1QE1A 3KUEA 4PXCA 4I2PB 4USKA 1VHFA 3GFXA 3ITHB 1YRXA 2AV5A 5KFMA 1U1MA 2W2NP 4WU2A 2VDIA 4OZLA 1QTMA 4NLXA 3HO1A 5LSLA 1U2FA 3KJFB 1HA1A 3CCVS 1M5KC 2COLA 3I56S 3RB4A 3N6LA 3C2PA 1ZETA 4ETXA 1YBAA 3GWCA 4LSNB 3EZOA 1FD8A 2N82B 2ATLA 4B3MF 4HI1A 4DR2F 4UTGA 4U96A 2HK3A 3OFGA 3HSZA 5KG5A 1HHSA 4IO1A 1SVDA 3HHKA 2BKOA 2R4FA 3G8TA 5CYQA 1S1UB 3DLLQ 3OTDA 3OD2A 2AIRB 4C8ZA 2J9EA 5FLXY 1NJWA 1IR1A 1LKZA 2V4JA 4O0IA 1R8HA 3M9NB 3KNAA 3G8QA 3U1LA 5C5JA 3E3XA 3FUYA 5H1SV 1N5VA 1HHQA 2CNNB 3DOLA 4PPZA 4BLGA 5I3PA 1U6BA 1UVLA 4NLQA 1KR4A 2HZVA 5ETRA 1N5YB 5IS2A 4LF9J 2W9CB 3FCWA 3G71S 1T05B 2HWIA 5B7WA 3GIMA 4NWBA 1MMLA 1B0VA 4NLWA 5M2RA 3M8RA 2YY3A 2XSFA 1WTFA 2HURA 1WC3A 5ETOA 3IBFB 2R7UA 1XMQJ 2WVFA 2BR0A 4C2MA 2UUBJ 2W4CA 1KQGB 1N8RT 3A4TA 4DG1A 2QN6B 2ZM6J 3PYEA 1PKUA 2Z2LA 5HVGA 1FRIA 4KO0A 1XMOF 4LR8A 2FZCB 4ZK7M 2ZNZA 1REGX 1RKJA 2BVZA 1UVJA 2VQEF 1JLBA 1BQMA 1MWZA 4FVCA 4YR3A 3E2EA 1X4HA 2RVJA 3BGLA 1WC1A 2H4YB 3CO0P 4ZITA 1QAIA 3TANA 4UOGA 4IG3B 2OPSB 4Q45A 4DLGA 2PO4A 4OJHA 4KFBA 3UR0A 1CJUB 4M5JA 1WKLA 5HBMA 4DV0F 3NAIA 2VG7A 1HBOA 2R7QA 5E7OB 3Q83A 2PI5A 2NYIA 1T3OA 3FBEA 1M5SA 1S6PA 4QR1A 4NLGA 2DXFA 4JV5J 1MN9A 2W8KA 4Q44A 1NDCA 2NUHA 3RW7A 3KHGA 5KFJA 3JSMA 5DM6Q 1HD1A 3MMCA 3R7SB 4CYUA 2OEMA 4U6PA 3TO8A 4DMZA 4DSFA 4QIEA 1UVIA 3RUBL 3GJTB 3P49B 2EK6A 3EVWA 4F4YA 1B64A 5HJYA 5L1LA 2YX7A 3KJQB 3TW0A 1YBTA 2E9TA 2E1CA 2UXCF 4GKJF 1N33J 4YP3A 4EMDA 1UMJA 1TKTA 1WI6A 3PYDA 4M5HA 1GEHA 4IYQA 2GO8A 4ID8A 1O5JA 4OYXA 3EX7B 3AD8C 3RYLA 1CULA 4ICLA 2H65B 4C6AA 4F3OA 1CC7A 2CVIA 2VA3A 1EB0A 2YNIB 5A2QU 4DR5J 1EP4B 3HHLA 1VRQC 4HI2A 2C42A 2CFXA 1Q8LA 4ZN3A 1UEKA 5IQQA 3GIJA 4Y34A 5IC6B 1XEZA 4USIA 3OR2A 2U1AA 2DHXA 1I94F 1HNWF 3SSQA 1YJRA 1N6QA 2YPYA 2DKOB 4LQ3A 2OPPB 2C3PA 2MQMA 3KMSA 1IBLF 4ZPTR 1B0PA 2RUSA 3H2UB 1A9NB 3NBPB 3D6FB 2LFVA 1MMNA 1WHWA 4IG0A 3DXSX 3ISNC 4DR4F 3D1OA 2CJKA 4I2QB 2ERRA 2PFFB 1IKWA 1GXLA 3FZ2A 1AYEA 1SKWA 3KJVA 3KK1A 1S57A 3ILLA 3E51A 2H9ZA 3EGNA 2RJZA 2I5JA 1S49A 3HT0A 3I5AA 3GCWP 2DNKA 5ETQA 2ACMA 2QE5A 5LMUJ 4URGA 1IWAA 3CT9A 1RTIA 2J6UA 3EDRB 1ACMB 3PRVA 4TLRA 4QIGA 3Q86A 3M2VA 3R1LA 2P6SA 1CJVB 2Q6CA 1PC4A 2Z8QA 1AXQA 3FKBA 1DARA 3N28A 1SC6A 1V9OA 2R3VA 4EUVA 1V5VA 1RWWB 1FE0A 2VBWA 4JI2F 1OYDA 1JQGA 4LFCJ 4I6AA 4C3LA 2ZEJA 5GAHI 4ZVHA 2YKMA 2OSQA 5IT4A 2KXHA 2YKOA 4GVBA 5DGAA 2F8HA 4FKXA 5B0AA 4ZPCA 4M63A 1Q8IA 4NYZA 1MROA 2CYYA 2QFJA 3IS9A 2WTFA 3BV8A 5B08A 3AD9C 2DISA 4FP9A 4V19J 3NY0A 1RT5A 3UDLA 1T94A 2DH8A 3LH2S 4G1PA 3D0IE 3DDIA 1FX4A 1S1TA 1TTHB 4USWA 2QL5B 4A46A 5A8WA 1N56A 1RT3A 5J2NA 4LSZB 5HSPA 5DQHA 4MYTA 4HACB 3KLFA 2BZ2A 3ADAC 1LOUA 3CTRA 1VQLS 1KFSA 3A8IA 3NS6A 4N77A 3CMES 2CUYA 2CPDA 2C1EB 2J0QD 4DCOB 1A0OB 1L3KA 1BWEA 2W2PP 1J2VA 3I9V9 3KUHA 2LECA 2E5IA 4IOAQ 5C25B 4P2XA 1NPKA 2MMYA 2Y1RI 2CADA 2A10A 3GZ7A 4Q0BB 2RDJA 1H74A 1FKOA 1GFWB 2OPRA 2AX1A 5HLFA 2BM1A 3S8SA 1X4DA 3NAHA 2GX8A 4PXBA 1IVZA 5F0WA 1TMMA 1K0VA 3X1LB 4HL9A 2VU5A 2FZKB 1JK9B 4QR2A 3UCGA 3RRKA 4CP5A 1XR7A 4AL6A 2J9CA 1TELA 2OFHX 2NUUG 3ZTRA 4X66F 4DCPB 2BANB 2IC3A 2QMWA 2AMCB 2RS8A 4OI0A 4HEA9 5EX3A 4DUYJ 4YR2A 3LGMA 3MZIA 4EU0A 1GMWA 2ACYA 1P1TA 3UCZP 2CZ9A 2Y8YA 3I0RB 3B8HA 3CCZA 3SV3A 2VQFJ 2NQPA 3ETMA 2Q79A 1SL1A 3W7BA 4DZDA 2WOMB 4G1IA 3MUMP 3N9UC 5F0UA 3Q8YA 1TKZB 1D9FA 1Y7PA 3BO3A 1B70B 2ZKUA 1XNQF 3HHEA 1VQ5S 2AJFE 1MG7A 1VYAA 1NB2A 1RACB 1LXJA 5THWA 4OI2A 2WVCA 2GVDB 4CH7A 4NI2A 1Z2LA 1WELA 2VPYB 4RU9A 2BBEA 5CQGA 4RWWA 2XNQA 2N7CA 1FTCA 2V0NA 2XC9A 3KK2A 5JJBA 3QATA 4ZP9A 4G6VB 1LW2B 3FCHA 2HVDA 4DV1J 3EZUA 3BO2A 3WC0A 5A8KB 3GPAA 4P74A 2V8PA 3AOBA 4C11A 4M5GA 1RWNB 3TJ8A 4H54A 4X4OA 4USVA 1WNEA 5GVQA 4A8QA 5H9EJ 1T9UA 3BBFA 3IR7B 4ECSA 2V8VA 3D0HE 2KHDA 3NGDA 4R5PA 1U47A 3N6NA 3WBZA 4C8YA 1T03B 1JLGA 3IRXB 4WBFA 3R97A 1JMTA 5L1KA 2V69A 3PG9A 1HNIB 2RIJA 2B4UA 4KHPF 3IXQA 4DSJA 3G6XA 2VJVA 1L3VA 4KAIA 4DV5J 3CJRA 4ZPBA 4ED5A 3SQGA 6FD1A 2MHNA 4PUOB 1UPPA 3UD5A 5KFXA 4QZVB 4ECQA 4ER8A 1NJIT 4QCLA 3MM6A 1FRKA 3BKFA 4FBUA 2HRYA 3VAIA 1TP7A 3FSIA 1NMEB 2ZH5A 3IR5B 1I51B 3IFEA 1U26A 1XJWB 1GX6A 2VKZG 5JVHQ 3BGRA 4WZMA 3J7AN 1N0UA 2GQ2A 4C8LA 1HYSA 2LA6A 5CYJA 1SJ3P 4QR0A 4X4UA 5K8OA 4WF9Q 4F67A 1UP1A 2ALZA 1W2IA 2ZH4A 3QWPA 3IAM9 1IBMJ 1YI2S 4ZVOB 2DRDA 3DN9A 1WHYA 2DR9A 2DNYA 4Z7CA 4NLVA 1B7YB 4JI0J 1TL1B 3DU6A 3GIKA 4B9MA 4U8VA 2B9WA 4GMKA 4MK9A 3LP0A 2AD9A 4CLKA 4QU6A 4IR1A 2CJAA 2F4FA 1HMVA 3J81Y 1O51A 2GMJA 4BC7A 3R5DA 2VFRA 3I0SA 2HAIA 3Q89A 2BXJA 3CDBA 4WPAA 3EVMA 5F8MA 1MNEA 5DG7A 4ANEA 3JQMA 1RWKB 1NM2A 3GFHA 1NLKL 2XI2A 4RUBA 5HVHA 3SI8A 3DI6B 2W7PA 4ES3A 2HQIA 1QJHA 5KFEA 2W01A 4X84A 1JX4A 4PG8A 1S9FA 1U1PA 2O66A 2Y1LB 3UCUP 4W98A 5L9NA 2F63A 2JC1A 4DPYA 4YEAA 5C24B 1TUGB 1FEHA 4K2XA 4NA1A 3OPKA 1T9YA 3OXLA 2DEIA 4LIWA 1K47A 4E0DA 1VQKS 3HF5A 2MZQA 4B3MJ 4DR2J 3TJAA 2RB7A 2MZTA 3F56A 2UU9J 1VC5A 4CLTA 1FK9A 3KWMA 4IFYA 2WW8A 3THPA 3ET6A 4OJ3A 3CCTA 1DHMA 4IH6A 3DKDA 1N34F 4ID5B 3MEGB 2OMLA 5KT5A 2R7SA 3DLEB 1UZHA 3BF4A 1CPZA 3KLEB 1P6TA 1GX5A 1HPZA 4K4XA 2HBRB 1YITS 1YKWA 2CPJA 3TR5A 3FEYB 1HNXF 2L08A 2QA4S 3NNHA 2DR8A 4Z37A 3V4IA 3VVUA 3NXZA 5B0EA 3S6EA 3D6MB 4DF4A 4PYAA 2XMVA 3WQPA 1RAHB 4NOHA 4K4WA 1X5TA 2ZOFA 2MKJA 2PGCA 4J9KA 1RCOB 2CJXB 3GV7B 3QIPB 1KBRA 4MKBA 5ETTA 4ED3A 2Z56B 4NLYA 4ZPDA 2HQ3A 4DPOA 3C8YA 1Q81T 3L7OA 1T7PA 1B99A 3OLBA 1R3NA 3GYGA 3M1VB 4QIWD 4OZ2A 3GFZA 4LFAF 1RDRA 2P9EA 4RPFA 2B4VA 2IRUA 3OHAA 2DR7A 2E1AA 1JLQB 5GAEI 4N56A 2VQEJ 2ASJA 1HNVA 3R5JB 3MR3A 4DUZF 2KYZA 2OUGA 1M1GA 5BYRA 5HI7A 1R27B 2DNZA 5F8GA 2SXLA 2D9OA 3HKZD 2OMOA 3TVYA 5KFCA 1Q8BA 3EYZA 3B82A 1R8BA 4DV0J 2DPJA 5HK4A 4O4GA 1ICEB 1GXTA 1S4FA 2DGWA 4KGZB 3W8GA 2QRRA 3UPFA 3DXBA 3GMGA 2XB2D 5H9FK 5T7LA 2MLZA 3QT7A 1RA7A 4GO5X 5HP1A 3NEKA 1NZ8A 1HBUA 4OYMA 2DHHA 3AB4B 2B9XA 1HD0A 4NLDA 3J81j 1HFEL 3MCMA 2GJ2A 1R0CB 1Q79A 5DZ6A 2ZITA 5DLGA 3BN4A 1Q4RA 3MEEA 1UWBA 1SUQA 4WYWA 2VOPA 4GVLA 4ZVRB 2V5HG 2GIRA 2B4PA 3IG1B 4HT7A 6AT1B 3GFYA 3M32B 4ZA1A 3S7RA 3I5CA 4BCAA 3DNCA 2UXCJ 4W4MA 4GKJJ 3SSSA 2FHKA 2DNLA 4RW6B 2ILZA 1HWIA 1L5UA 3FFIB 7FDRA 2RT3A 3B6BA 3O8WA 1F2HA 3F0NA 2KG1A 3SXLA 4Y3CA 4NLUA 3DMJB 3C16A 2J8AA 1ZM4A 1HNZF 2EK1A 4WP8A 3EVOA 3CC7S 3H5UA 2R7XA 1ZPVA 2E7WA 3AOAA 5F8HA 1F3VA 1DZ5A 3W5ZA 1RT7B 2VPWB 2O3DA 5LT5A 2JH3A 5K5MA 1KKHA 1UKUA 6FDRA 2EPIA 1S4EA 1RXOB 4M95A 5D4OA 2Z30B 1UFKA 5HQ8A 3ILOA 1FWPA 3TX0A 1VHIA 4J9VA 1JLCB 4DDFA 5IM0A 1M5VC 1LW0A 4QWAA 5LSRA 2X1BA 2EKYA 4YR0A 1PBUA 4DR4J 3CCJS 2YX1A 2PT0A 2CPXA 2MLYA 3NWGA 4TY8A 3SQOP 3P4UB 2GVZA 3TARA 2YKNA 2LQ8A 2B9YA 2B8PA 3AAWB 4OYAA 4O44A 2HQDA 3PCOB 1H2TZ 4AL5A 4EZ6A 2Y0BB 2DNPA 3FCVA 2AT1B 2FYXA 2V68A 1PCAA 1CSJA 2H54B 2ZD1B 4UY85 4WYLA 2I8EA 4N41A 3ISZA 2M8DB 1S6QB 2LCWA 2Z58B 1K44A 3TVZA 1S9GA 4C8NA 1RLCL 1RTJA 3CD6S 2B9EA 1SQGA 5G4DA 4X4VA 2CQ2A 1NDLA 2MY7A 3AA9A 1FA0A 4QIVA 3MEDA 2NYHA 4LSLB 2YVSA 5D4PA 4EK2A 2VG6B 3N01A 3W2VB 2WONA 1ZAWA 4NA2A 3W61A 1DAXA 3WX4A 2G13A 3QRQA 2F4VF 2BJ8A 2GGPB 4M5LA 2F9DA 2ASLA 4NLOA 2IA6A 1RK8A 4ZVEA 4LRCA 3A1YG 5AXMA 1QM9A 1Z2ZA 4UZBA 1FDAA 1V6HA 1C0UA 2MTLA 3H59A 4A8YA 5D77A 2GO9A 4DX8H 2L41A 2FLPA 4XAKA 1YK9A 2ZH1A 3DYAA 3HFKA 4PG4A 2KFYA 2V8HA 1RLDA 1GMVA 1F9EB 2IHR1 4C0HA 2MY8A 3N79A 2NS1B 4DSEA 3Q8PB 4USJC 5K9FA 3MAAA 2B6AB 4X65F 2F40A 4DR1F 1EX8A 2BQ3A 2ZBRA 2AJ2A 5KFVA 2DNQA 3OTBA 2W9BB 5DZ7A 1T9WA 4J9LA 4DR6J 3T9ZA 3G2XA 4B3SF 1DTTA 2ZJPQ 4N7TA 1QUPA 4F26A 2YNHA 2BE7D 3MXHP 1YGYA 2RRAA 4HH0A 4ZJQA 3JB9k 1M1HA 1DBDA 1U45A 2Z2ZA 1B7FA 2XSJA 1S1WA 1YJTA 3SDEA 4JI6J 1J27A 4X64F 2HBQB 4DX6A 2VV5A 4XK8C 3NMRA 5EGYA 3BN7A 4I64A 4OZ5A 2YQ3A 4ILMA 3FZBA 1OY9A 4DXLA 4UY8T 3KHHA 4X4SA 5L8RC 3V6JA 1VQ7S 2VDHA 4DJBA 2DY1A 3M6VA 1N36F 1FXRA 4LR9A 5JXSA 1IR0A 3OFFA 3W8PA 1RHKB 1RHUB 4EBEA 3PYFA 4ECXA 1CVJA 1RT1B 4RW4B 4AD6A 2BM0A 3U27A 2J5AA 4HTJA 3Q8VA 2JEJA 2EFNA 1GH8A 3FRZA 3BH7B 1CC8A 2LEPA 2HNDA 3GLJA 4N47A 1BHNA 4PQUA 5GADU 1HBMB 2KU7A 4NZ6A 1JLEA 3N6MA 3B4MA 2Z57B 1RP5A 3VQTA 3PKYA 1IWGA 1TL4A 2XS5A 5A8RA 4ECZA 3RAMA 1I5OB 3GYNA 5DDOC 3UN3A 2AU0A 3UW1A 5KFSA 1RT4A 1VRUA 3NCPA 3CD5A 1TAQA 1FO1A 1N5SA 4DLEA 1MU2B 5HMZA 4ELUA 2JFDA 2QZ8A 2RRNA 3PVXA 4ZHRA 1CS4A 2EFOA 2A2DA 1MN7A 1F60B 4I1TA 2ZBPA 1EQ0A 4NRUA 1RHMB 1HW9A 2XYHB 3I87A 2CJQA 1R7IA 1Q78A 4F0MA 3T5KA 2OEKA 2ZC3A 1P1LA 2XMJA 5CD4H 1SQFA 2E1MC 4UF4A 4RNMA 2Q43A 5KT3A 3KLGB 5GAGU 1JKHB 4EGLA 4DL7A 2BUNA 2KYXA 2CVEA 3OXFA 2FVRA 3CE8A 5AE1A 5HMYA 1RBAA 2NSCA 1NK7A 3A8EA 4GO7X 2V2ZA 1UL3A 3GV8B 3W5YA 3HVTB 3SCKE 2XBPA 3OL9A 4C8OA 2CNLB 4HHHA 3LP2B 2QSWA 2KRRA 4CO0A 1QLNA 3JAMU 2BKPA 4RW9B 1VQ4S 3ZTQA 4C0BA 3NLCA 2NREA 3Q8UA 1SV5A 1IM4A 3EXCX 1Q5VA 2NPIA 4ZPAA 1LWEB 2YNFB 2DIVA 2DGUA 3TZXA 4WZQA 2HQCA 3LWMA 4K4TA 3MAQA 5B0BA 3EPIA 4B9NA 1FNOA 3TJ9A 4DN0A 2M4MA 3PW0A 5F3TA 3KK3A 4NLRA 1XNRJ 3ZZTA 5IT9U 1GMUA 3GIIA 4OX9F 4KKOA 3BQ2A 2ZM6F 2DIUA 5HROA 3H4DA 2V50A 2XGQA 4P9SA 4DCJB 1KOOA 3A8KA 3FNNA 4EFAC 3M2UA 5KFWA 3R5GA 3OVAA 4PXEA 1JLFA 1BLUA 3J7YI 4LT6A 4P72A 4USUA 4DFJA 4XDCA 3DOLB 1RBOB 1Y9OA 4WE1A 2E1PA 4J9MA 3MMJA 1ITPA 3D3BJ 2YNGA 4DV7F 4BWJA 5I4MA 5DDPC 2Q3PA 1HI8A 4KH1B 2KB2A 3UNGC 2HZCA 4WKRA 3LAKA 3QGPA 3PRBA 2MKKA 1UFLA 4X62F 3BB5A 4JV5F 4NYOA 4C3MA 1NCLA 1VQ6S 2IYGA 1YJ7A 4KPCA 1E6YB 3B78A 4ZPVR 4I2PA 3SCIE 1RHJB 2OPQB 1FJGJ 2YWGA 5GMDA 5J2MB 3OV7A 3FSXA 2GMLA 3BGOP 2VHGA 1VQSA 3C15B 2WCXA 2GHVC 1Y11A 3PR4A 1RSCA 3CXCR 1KTQA 3J80U 3M8QB 4IKAA 2Q66A 3T6BA 1JLBB 4LSNA 2C2DA 2CAJA 2HMIB 2QYGA 4KGXB 3TRGA 2QLFB 4KJIA 3H42A 5EUHA 1RB0A 1VC6A 4Y2IA 3R5BA 1NU4A 3PEJA 1S1UA 4EEYA 4KFBB 3HXMA 1ZAVA 2DXDA 3VGUA 3ENAA 5HBMB 5L38A 3CW2C 2RHSB 2HGLA 2VG7B 1HBOB 1SKSA 3KXDA 3LP1B 2H1YA 1L3TA 4XO0A 4FF4A 3PIOQ 4QWEA 2ASYA 1N34J 3HHLC 4C7QA 1BE4A 3FSYA 2BRLA 2U2FA 2V4RA 4RW8B 2B3TB 2DB1A 2ZZTA 3IM8A 3CD0A 3QGHA 1SJ1A 3KLIB 2RQMA 3TUIC 1WG5A 3M8WA 2KM8B 1N5YA 2YWKA 3GILA 2W9CA 3HLUA 4ZVSB 3L4BC 3GJSB 3MMCB 3D67A 1T05A 4QWBA 4LUBA 4OZ0A 1JNZB 1N52B 1YZ6A 1HNXJ 1NO8A 5H9EK 1URNA 3EGWB 2FHJA 3VALA 2N3LA 2K1RA 2MZJA 4FDFA 3EUNA 4NLTA 3QZ8A 3HI9A 2FVSA 3M2RB 2UZAA 5ADZA 2C2NA 2RDDA 4CLLA 3O6QA 1N5QA 3VR1A 4YY3F 5F8NA 2RE1A 2V9KA 2VKRA 4J9PA 1SH2A 2FVCA 2XY6A 3FGVA 4HLBA 3GG1A 4V1Ak 3Q24A 2QC3A 3IWNC 1CULB 2MJUA 2KRBA 2HWTA 2B5JA 1VJQA 2XYPB 1KFDA 2KJWA 1HW8A 3I82A 4LFAJ 3P6YC 3MFIA 2GJIA 3L3CA 2YKAA 1RWMB 4IG3A 2CQ4A 5IC4B 1XERA 1SKUB 3P45B 5KFRA 5I3QA 1XMBA 1FJCA 3TZYA 1EAYC 5CCMA 2VBZA 3THTA 1CJUA 3FK4A 2CNKB 1M5PC 2YWHA 3NL0A 4U9RA 3EICA 4TY9A 1BXNA 2UV8A 2FTRA 3U02A 5KG2A 4UOFA 1VBXA 2CXEA 2CQBA 2IY5B 2R8HA 4LFCF 1HQUA 3V6KA 3K5PA 3VF0B 4I6WA 1Q82T 2AEMA 3MD1A 2ZH7A 2BEFA 3AD7C 3G4SS 3UR3C 2UVWA 4AFFA 3OW2R 4IG0B 2XLKA 2J6TA 1NBEB 2OH2A 1EIYB 2IAJA 1NZAA 4JBCA 2W25A 5EX0A 4P73A 3OUYB 3KJVB 2N3OA 2H51B 1YJWS 3KK1B 3ILIA 1ZTWA 1GNKA 3FEXB 2I2YA 2HLUA 2V2KA 4RBVA 1ZA1B 2DGTA 4C8MA 4PEOA 4L3NA 1RJJA 1R8AA 1U09A 3TP2A 4DSLA 3OSNA 1PILA 1KC8T 1S9EB 3FVYA 1RTIB 4KH0B 5SUHA 2OD6A 5HMWA 2DGVA 3DRRB 3M2VB 2ZH9A 4CI0B 3RAXA 2BQRA 4PG7A 2QL7B 4LF1A 1FNXH 3MM7B 3C19A 2D7SA 5A6PA 1UFWA 2DT9A 2YNIA 3H8YA 1B0TA 2MKIA 1EP4A 4X2BA 3JTPA 1Z4UA 2OAUA 2GNKA 3TA1A 1JXVA 5AE2A 3O3LA 3DLKA 5D0EA 1RWUA 5L9XA 1HNZJ 2ZE2B 4L72B 1ZZFA 5MAOA 5HO4A 1KRPA 2O01C 4GVBB 2DEJA 1RTHB 2ZBQA 1MROB 2ILYA 2OPPA 3IS9B 3BS9A 3DHXA 3IGNA 5IXUA 4K0KJ 3CJKB 3NBPA 1TFYA 3LWLA 1QSYA 5K20B 4E2FB 3MCNA 1FKPB 1U02A 3ZTOA 3H20A 1RT5B 2NPFA 4C97A 4I2QA 2AGOA 1MMDA 3RTVA 4Q43A 4IUFA 4K2JA 2M8HA 2FY8A 4FPIA 5KFIA 2AYGA 1WEYA 4OI6A 4NXNF 3WHIA 1OPIA 1QY7A 4LF7F 1J5EJ 4KIAA 4EZ9A 1WOPA 1OQ3A 4KTQA 1D3WA 1D0EA 1S1TB 3OVSA 1DTQA 4DUYF 3B54A 1RT3B 4Q8EA 1WJ9A 2W4DA 1C1CA 2WVEA 1VOMA 2JX2A 2V2VA 1HWUA 3MM9A 1NK9A 1MW7A 4TXSA 2LU1A 3K59A 2MKYA 3BGFA 2VQFF 4C8KA 2ZWPA 3OTOJ 3MR6A 3QPIA 1X60A 2I9SA 2ADCA 1XQIA 4M5MA 2DRBA 3M8YA 3PZPA 4L73A 4DL2A 3AB2B 4ZLPA 3UD4P 2Y8WA 3M8SA 1KWMA 2VB6A 3RBZA 3JSBA 4F2SA 1D9AA 2PE8A 2ZHAA 2KT2A 1S12A 1FKOB 2OPRB 4AXIA 3TQ1A 2UV8G 2E5LJ 2DVIA 1Y5LB 3QAEA 3H5YA 4ZLJA 3DOMA 2EWHA 1X4AA 3H98A 4RUCA 4J7CA 2VA2A 4UQTA 2O67A 2HGNA 3IN5A 4CO5A 3GIRA 1JJ2R 2Z2YB 3CJ5A 1I1GA 2GC8A 2HRUA 2KFZA 1YTYA 5CH7B 5KFFA 1VCTA 1QAYA 2JLEA 1ZH5A 4LRAA 3OJSA 5KFPA 1PSDA 3EPGA 2CPHA 1C0TB 5A0YB 1R8CA 1NDPA 1VISA 3GSIA 2F4VJ 4AL7A 1IQZA 1TU0B 2ZH8A 2JWNA 3M05A 5J1PA 1CEZA 2DO4A 3MUVP 4KQZA 4OLOA 3I96A 2K06A 2DYAA 2IPOB 1N48A 4YB1P 2MQ8A 3AQPA 4DU7A 4C48A 3KG1A 4ITSA 2Y9HA 3HPOA 4DQSA 5DM7Q 2CPFA 2BE9B 2ROGA 4X65J 1VDHA 4P71A 4DV5F 1XWLA 2VICA 1YIJS 3KK2B 5C25A 4KR0B 3JSRA 4B3SJ 5D8HB 4I6YA 5LOQA 1FI4A 4Q0BA 1TUVA 5D0HA 3LQVA 2FDNA 3T9NA 4P2MA 5FLXU 2IBKA 1CG2A 2NXEA 4C11B 4OFZA 2XCAA 3EMTA 1G6BA 3D1QA 3JQJA 3TUPA 1K8AT 3IM9A 1H0HB 3BQ0A 1D9DA 1NK5A 1G2EA 4F3QA 1PIEA 5IZHA 4ZDNA 1FFGB 2FGOA 2O1PA 3D68A 4TU7A 3Q22A 1VIXA 2BANA 3R5CA 3QFWA 5K8MA 5A6WA 4OHZA 2K3IA 4DFKA 4FVMA 8RUCA 1NUEA 1VBYA 3I0RA 2FJWA 1IBMF 3OFEA 3PHTA 2D3O1 1QTNB 1X9MA 3MECB 4E8UA 2WOMA 2GHWA 3HMJG 3PNIA 2DJWA 2QX0A 2R8GA 1W25A 3SQGB 2HFVA 2XWYA 3SMZA 1I3OB 1KQKA 3LTOA 1SC1B 3I4PA 4I56A 4HHUA 3UI3A 2J6SA 4OYWA 2DCUB 1Y00A 1NK0A 3JS9A 2WBMA 3RGIA 1OY6A 3SCLE 1X4EA 2E1RA 3QMQA 3UQSA 3EGZA 2VUGA 5LL6d 1LEOA 3OTEA 5D6GA 2VFVA 2BYCA 4ZVGA 5B0FA 2ZUGA 2HHPA 1LW2A 4DQQA 4MTPA 3CEDA 1Y3KA 1FE4A 1IUJA 3D66A 2AW0A 4Q2MA 1JXEA 3NOGA 3SV4A 2BJDA 5I3UB 5AJ3F 1WF1A 2KT3A 4DHVA 4AQYF 1WDDA 3N0VA 3O1LA 1F9FA 2HVHA 2RF2B 2NXJA 2V9WA 3W3SA 1YSJA 2AHOB 1F5CA 1RYRA 3VGVA 4QPXA 1NHUA 2LU2A 2IJNA 2P8IA 3LP0B 2HWHA 4WK3A 4P7VA 2UU9F 1T03A 3AJ1A 3TAMB 3RB0A 2K3KA 3K5MA 1S59A 5SZTA 1FJ7A 4A8SA 3MR7A 2JHEA 4PRFA 4PUOA 1U2RA 2DD8S 1K9MT 3UN5A 3CJ8A 3HZEA 1PYSB 4K59A 4CRJA 2IBOA 2QLWA 2UUCF 3IWXA 4YHHJ 1Q7LB 3DGPA 2BV3A 1FDNA 2RD5C 4FKYA 4Q8FA 2B7CB 3BH6B 4DWIA 4U7CA 5BXIA 3CJ2A 1RU2A 2IFXA 2E5HA 1E6VB 4DX5A 3I6PA 1RTDB 3SFGA 1DQ9A 2F5GA 2AKWB 1HLWA 4LF6J 5E33A 4EO6A 2BQUA 1FK9B 4OX9J 1CLFA 1TL3B 1T95A 4JI7F 2BA9A 1TK0A 3V4MA 3PW2A 1SIWB 3V81B 1QD1A 4WFBQ 4IFVA 2QJ3A 1TL1A 3AQOA 2HHWA 2V34A 2LQ5A 3AJDA 2GIFA 2M2BA 4UT4A 3QBCA 3IBWA 1QSSA 5BJRA 2MEWA 1HI1A 4DZ6A 4DOZA 4DV7J 3QQCD 3W5XA 2FVPA 3QGGA 4K4SA 1I6JA 1QUVA 3HT3A 3AHPA 3M30A 5F3ZA 4RW7B 1XBWA 3TQEA 3FMBA 2EFPA 2C2OB 5L1IA 3KG0A 4UUWA 4FZVA 4X62J 3B4DA 1S7IA 2ZNYA 5J1EB 3DI6A 2GV1A 2HS3A 5FIIA 3KLHB 3R9LA 1NPRA 4XDDA 4OYOA 1YX2A 2KI2A 2D3ZA 2V4QA 5AXNA 5E3AA 2HLTA 1H38A 4MH8A 4BS2A 4PG6A 4ZCLA 1TK5A 1S0MA 1NSQA 5FJ4A 1R0AA 3M6WA 4ED7A 2M52A 4DV2F 3TNVA 2B56A 5C24A 3FRYA 4RBTA 3NNCA 1NK4A 2PMWA 3G82B 1EARA 1G4CA 2W7AA 4ANCA 1HNVB 4ED8A 5KG3A 4TU8A 1Q16B 4ILRA 3H40A 5ETSA 1HBNA 4WXWA 4F0KA 3PO4A 1PC5A 5ETLA 1FNMA 4CTAB 4PAAA 5I42B 4H4MB 1U1KA 3PDNA 4I67A 3RU0A 2DR5A 3DLEA 4V19X 4O4GB 1EJ7L 5KFZA 2R2RA 1B3TA 3PR5B 5KFGA 2C3MA 3HCXA 2MKSA 4BC9A 3H5SA 1M0SA 5RUBA 5HP1B 4CM0A 2JEGA 2VF3A 1HBUB 3AOCA 4NCBA 3E8OA 4J9NA 1RA6A 1SIZA 2ZJQQ 3K89A 1OS5A 3K58A 3UDVA 4H4OB 2PA3A 3MEEB 2CIMA 4HYKA 2AJ4A 3QIPA 2XQCA 1BUXA 1EZZB 2R7WA 3FBBA 3CMQA 3MURP 2CQIA 3H2VE 4DF8A 3PW7A 1CBKA 4YY3J 1YG0A 4N8NA 4LQ9A 3D7SB 2YQ1A 4MYUA 2HFNA 4M1KA 4F2RA 7AT1B 4XIUA 4LF2A 2RQKA 1KQSR 2HAFA 3C16B 1HHTP 1JLQA 2RILA 1RWOB 2J7KA 1LWXA 2BKNA 1X0FA 1JB0C 1IR2A 2GJFA 1PJ5A 4DL3A 1JLAB 3TI0A 1SC4B 1AFIA 3UNYA 2HS4A 2J7WA 5M2UA 4O3QA 3BM7A 1XN9A 2P6TA 1T0TV 3RBXA 1OSCA 2EFGA 1MWQA 4DBQA 1RCXB 1NSAA 4YB6A 5ETMA 2YXLA 5IM0B 1LW0B 2C3UA 1PAEX 3QJLA 3RB6A 4ZN1A 2DGXA 2XGPA 1FRXA 2NCKL 1HR0J 4PQAA 2HEKA 2M5YA 2KVQE 1W26A 2ALYB 5M2PA 4HKQA 4F36A 3SZ2A 1CJKA 1IN0A 3HHNB 3HHLD 2WVBA 3VAGA 1WG4A 1S99A 1BQNB 2EBGA 4PXDA 2FC9A 1RZMA 3R6LB 2FJXA 3IA0A 4ES1A 3MWBA 1AT1B 2POKA 3M32A 5KFQA 3M4XA 3T41A 4LVOP 4NA3A 2DHGA 5C7PA 1ZA2B 2AP6A 2R8JA 2RRBA 3VTIA 1KD1T 3L7PA 4DUTA 2JLGA 2KZMA 2MXYA 1ZBTA 3BKUA 3FFIA 1NJXA 1UJ5A 3UD3P 3K2YA 2HVEA 4GRSA 4J9RA 2O5DA 4ATNA 1U8WA 4OHXA 1HIYA 3TX8A 3DLHA 1S9GB 2FJBB 1RTJB 3KTQA 4B3TF 4DX7A 1VLOA 1IKXB 4DR6F 3O2IA 2I1RA 4ANDA 2ZH3A 1C4CA 4PABA 4KT0C 1RT7A 3E01B 4NPOA 5GAEU 1BGXT 5HANA 4R8UB 3MEDB 1S76D 3D2WA 1VQPS 2M0GB 3EGVA 2E9RX 2PMZD 1JJCB 5G0RB 4JV2A 2WONB 5K8PA 1IKVB 1NKCA 4NZ7A 3RRHA 4JI6F 3VAMA 2ZBIA 4P2FA 1S79A 1KTVA 2IDLA 2CDQA 1EETA 2F1FA 1LWCA 4FXWA 3LGHA 1JLCA 2X1AA 1IBKJ 1C0UB 2ROPA 5IT0A 2XG8A 4LVNP 1RAIB 3I9ZA 1VLYA 3DLGB 1WF0A 1YJ9S 1WOSA 2R7VA 3CDWA 1U48A 4DQRA 5ITHA 4YQWA 3BSAA 1VJWA 4NXNJ 4P7TA 2YX4A 2HS0A 1VBKA 2HVZA 4K4UA 4LF7J 2WSCC 3BBCA 5D0RA 2ZDOA 1P9QC 3PJWA 2AEJA 2KKHA 3FEZA 5KOWA 4B9LA 4HHJA 1A7GE 2BW2A 3NCRA 2GMHA 4G1QA 2CJYB 2DNNA 5EDWA 2GQQA 3CDAA 2HFSA 3BJYA 5CYMA 3MM8B 4NCAA 5CHCB 2AYEA 2ZD1A 1S48A 1RT6B 1J5OB 2KTQA 1U0HA 3G6YA 1SBRA 3CB4A 4IRKA 1S6QA 4LFBJ 3KYLA 2IRYA 1S1WB 4RR5A 3HJFA 3SDEB 3P5BP 2A6MA 1YJUA 5GAGI 5MLCV 5C42B 2QLXA 4NYPA 3PX4A 5IQ6A 5DQIA 4UOCA 3W64A 2DNOA 4MT1A 3GCXP 3W9JA 4PYDA 4LSLA 2ZWOA 1UJ4A 2FQQB 5KFTA 1OSDA 1TQLA 3QO9B 4OX8A 2UXBF 2K7JA 4CCHA 3A3OB 4L76A 2G4BA 2GGPA 2DH7A 2QYCA 3BBBA 1PYTA 2MZ1A 2N4DA 1H73A 2X51A 4FPRA 3CF5Q 2LXFA 4OX6A 3OR1A 1MLAA 3DM2A 2A18A 1FFSB 2JEIA 2OIHA 4QYZJ 2CKWA 4D3GA 3T5LA 2D41A 1N88A 2BJ7A 2AJQA 2JL9A 4QJVA 3CCWA 2J0SD 3LO3A 1V3SA 8AT1B 4M5DB 2B6AA 2UVRA 4F4AA 3S1TA 1O8BA 2PSZA 5J2QA 3J7Z5 2CWXA 2JNJA 3NP5A 2BMBA 2HHTA 5BR8J 1NRKA 5D3GA 1VQYA 3TOQA 2XO6A 1RT4B 4B3OA 2C2RA 3PTWA 2CQPA 2Q6BA 3MTJA 4OYIA 3UN2A 4IR9A 1H6KX 3GTYX 1JJHA 1CS4B 4LBIA 5DS7A 1PJ7A 1QDUB 1OIAA 1TV6B 4DV4F 1GMWD 2GCFA 1RT2A 4JI8J 1RWXB 3ILJA 5DETA 2UVUA 2EKNA 5KFAA 2WZ1A 3CO9A 4B9UA 4ZVQB 2HFZA 4WFAQ 4CO4A 1WEZA 2KO1A 4KGKA 3QRRA 1NJZA 4A8XA 3W63A 2QG9B 1XNRF 1BWVA 1REVA 3A3PB 4ALZA 1Q5YA 2BJ9A 4YB5A 2IYIA 4ZCIA 3V6DB 3M9OB 3LANA 2PN6A 2A0FB 1JXLA 1UWAA 5KFUA 3ZXWA 3V5RA 2K8GA 2JOQA 3LALA 2JVRA 5J2PB 4I7FA 2B43A 2J9DA 4DS5A 3BR9A 2GIQA 1T9VA 1K0TA 3MPDA 2VFSA 3OFHA 5D4LA 3QT8A 3H90A 4IQXA 5IFMA 2FHOB 3I4HX 5B09A 2HQGA 4MKAA 3AFGA 4MKYA 3L95X 2EBEA 3GJRB 4TYBA 5KG1A 2XHCA 1VBZA 4J5OA 1MU2A 3BREA 1P9YA 1RABB 1F1BB 3MMBB 4AYBD 4MK7A 1NAQA 4P2SA 5CCLA 2JRSA 1FJGF 1G7CB 1S77D 4FF3A 3CIZA 3J7ZT 4KE5A 2FY1A 4KKOB 5T14A 2VL1A 4YUDA 5HROB 3ZFVA 2OGUA 3U7JA 3NOCA 3OJUA 2RQ4A 2XEXA 2ATCB 2X3GA 1FX2A 1RAGB 4NRTA 3PYGA 3W60A 2DNGA 1UZDA 2IRXA 1H2UX 3JTNA 3MPWA 4RNOA 5AJ3J 1LQ9A 1JLFB 3CCES 4AQYJ 3OXGA 1NK6A 3CDEA 1JKHA 1YDLA 1S1VA 1R0BG 3ZC4A 3NGKA 4Z7YA 4WE1B 2ZZMA 4W92B 1O6XA 4DR7F 3CNQP 3ONQA 4NEZA 3UDEA 1D8YA 2AGQA 4DQPA 3PEHA 4FNHA 2B7BB 2LP4A 3POTB 3GONA 1D09B 3MFHA 3WDOA 4CNZA 4GKKF 4IDKB 3LP2A 4WKYA 3R2DJ 1TKDA 2NXCA 4FYDA 2RS2A 4RW9A 2FHMA 1S97A 3HX9A 4NZ0A 1LWEA 2IVYA 2YNFA 2PA8D 2VG5A 2UUCJ 3UFCX 4X4RA 4NCGA 1VI7A 1Q53A 3LPYA 2E29A 1FVQA 4PCQA 4HVZA 4TQRA 1LNQA 4RUAA 5HJXA 2HNYB 2I6WA 1X4CA 2WW4A 3W65A 4ED2A 2HIQA 3R7NB 4ZLNA 3A3NB 2BOPA 2XLJA 1RWVB 2VD3A 2GFFA 4ED6A 2RKIA 4ZVPB 2YWFA 4USHA 4CO2A 4Q2LA 1RAOA 3VWSA 3CJQA 3K0JA 3PRDA 4FF1A 4JI1F 3CDUA 4G65A 4PPDA 1RBLA 1RAFB 2RDIA 4HDGA 4CWBA 1TKXB 5KAKA 2XMUA 4Q7AA 4OLPA 4JI7J 3C6UB 2V2QA 4ZP6A 3BPDA 4MFBA 4OQJA 5K8NA 2FC8A 4OYZA 1WD6A 4WK1A 2WB1D 2IJFA 1VQOS 4X4PA 2VJUA 1UA1A 4LRDA 3KKFA 2F7VA 4RJVA 1N54B 2CQ0A 5BYSA 3C14B 2YTCA 3ZTPA 1OWXA 1N5TA 1UW4A 2K1RB 1U6ZA 4TN2A 2VC1A 1RGVA 2PIIA 3C6TA 4K7QA 4IOCQ 3UO0A 2C3YA 3PFEA 1E6YA 4X4NA 2XLIA 1QAXA 4WP9A 4ZVFA 1X7VA 2OPQA 5DDRC 1IKYB 1HQEA 5J2MA 2M88A 4LBHA 2LMIA 5E41A 3C15A 2MQQA 2XO7A 3FJ2A 3TZZA 2NR0A 1Y0HA 3LW5C 1K1SA 3M8QA 2X7IA 3O44A 2WSEC 4B9VA 2B5JB 4LMZA 2LDYA 2YKPA 1IJEB 2HMIA 5E5NA 3BEGB 4OYBA 2C22A 1FCAA 1AZSB 3VV2B 5HN0A 5LMNJ 1H7XA 3QT5A 3CJSA 3HD1A 4DV2J 3QJJA 1FKAF 2CWKA 4QYRA 1JIHA 4PWWA 1S10A 2I0XA 4DI6A 1Q7YT 4CLZA 1X9WA 3NWRA 3LP1A 4K4YA 3PO5A 3MMAB 4KHMA 3EZ5A 3T5JA 1MWYA 1WKKA 4Y2CA 1HQUB 4OL8A 4JV1A 2N4CA 3HFVA 3D54A 1WSRA 3CC2S 4DR3F 3BGUA 4RW8A 4QW8A 2A3JA 2F8EX 4DSIA 3OLAA 1U1QA 2LEAA 2MHEA 3KLIA 3RAQA 1ULRA 4ECRA 2DNRA 2IAJB 2C2MB 3EWGA 1UVNA 3J7YU 3W66A 3MAHA 2WK4A 3CJTA 1B4SA 4KY3A 4DPWA 4X4TA 2M70A 1DLOA 4ES2A 4K0KF 2QV6A 2HK2A 3MUTP 4DFPA 3M6UA 3G6ES 3M2RA 2X1FA 3UWTA 2KN4A 2A6OA 3A8JA 4WFZA 1KLMA 3MR2A 1U49A 1J5EF 4HT5A 3K5LA 8ATCB 3VCDA 2XNRA 4UW2A 3N5FA 2FPHX 3DRPA 2Y3YA 2DXEA 2ASDA 1GT8A 2UXDF 3RG6A 2N7YA 4YMEA 3M8PB 3JXOA 3WC2A 3HKWA 4USMA 3OTOF 1IXKA 2KDOA 3DLKB 2H5JB 4OZJA 1S1XA 3KHLA 2R2TA 2FLLA 3KUGA 2YWWA 4FYYB 1SH3A 2HGMA 2L9NA 2PMHA 3P5TL 2IA0A 4ZPWR 2CQHA 4LF5J 4USTA 2E5LF 3CVKA 2RSQA 2W2OP 1KDNA 4I68A 1CJTA 1FVSA 4LIRA 2CRLA 3PACA 1G1XA 2QT7A 3ZZRA 4Y0FA 4G3IA 4F4ZA 1NEEA 4LF8J 2ZH6A 3FC9A 4CQ1A 1SL0A 2W9AA 2MGZB 3OVBA 3QZ7A 4GC6A 1GXUA 3FQKA 2R7RA 4FBTA 2BDPA 3OUYA 4M5IA 4M94A 5LXRA 2HHHF 4A4JA 2EXUA 1DTQB 3JYTA 3DOKA 3QSIA 1HKAA 2YPZA 1C1CB 1N0VC 2ZHBA 4PWDB 3C3LA 3VZIA 2HHQA 3MM9B 4TLQA 5FDLB 2NLWA 5KTQA 1S9EA 4DL0C 1FWLA 2ZC4A 4B9TA 5E3PA 2BE2A 2E5JA 1WACA 2IVMA 3DRRA 3HULA 3AJ2A 3AT1B 5CZXA 2R7TA 4TQSA 4U7UK 1TVRB 2CZVC 1SJQA 1ZZNA 2CDRB 2DHAA 4C0OC 2OJ3A 3MM7A 4CLYA 3AXKA 2DCLA 2FJEB 4J37A 2EW9A 2HFUA 4NXMF 4Y65A 4CO3A 2XULA 3DRSA 3ICLA 2UUAF 2LLZA 1FRJA 2IIHA 2Q1LA 1UPMB 3DOMB 4KGMA 5HATA 2ZUAA 3ISND 3IR6B 2ZE2A 1U4BA 4B3TJ 4ZVTB 3P3DA 5EWEA 3CPWR 1HWKA 4F8RA 2AEFA 1F0XA 3ZZZA 1RTHA 1VR6A 1DRZA 4KBIA 5KFBA 2QTWA 3EM1A 4IOBA 2VPXB 2RMLA 5DG8A 4F4WA 2ZDPA 2VASA 2DBBA 2WHOA 3CJKA 4L6V3 4N5SA 2NXUA 3CJ0A 1DQAA 2B51A 4EBCA 1FKPA 5F8JA 4WFXA 3MCSA 4EWTA 2YBVA 2L9WA 3BPSP 3THVA 1U1LA 2UUTA 5A2QY 1KVJA 3U1NA 2DH9A 3HDSA 5K14A 2MZSA 1C1BA 1V3RA 3CCRS 3QYYA 2GZOA 2LEBA 1FDDA 1T9XA 2XMTA 2KG0A 2MQNA 2D3UA 2LDIA 3MM5A 2HHUA 2DK2A 1WKJA 2XWXA 1KLNA 4LBPA 3LF0A 4O3NA 2M3DA 2KFNA 2VC0A 1RYSA 4Y2AA 1BY9A 4U95A 1VK3A 5E0OA 2V8GA 2G1HA 4F7VA 2IM1A 1VRTB 2P2CB 3T1YJ 4DPUA 1T3NA 4P10A 2EFQA 1NKBA 2JLFA 1FEEA 1HQ2A 4KV8A 1TL5A 3CCSS 1YJNS 3TUJC 2G2OA 2C3OA 4K4VA 3UVJB 3JSYA 4ZMMA 1TL7B 3DU5A 2BJ1A 4H4KC 4JI3F 4NLSA 2XZTB 4EI2A 4JI5J 5B0DA 4A8MP 3I32A 4DV6F 1SCJB 2IM3A 1W7WA 4O4RA 2PD1A 3TWZA 3QLHB 3RZAA 2XMAA 4Y2KA 3W2WB 2Z0GA 3TA2A 1X4GA 2ROEA 2UXBJ 2LQBA 1C0TA 5A0YA 4M8LA 2Z4PA 4C98A 3ZZPA 4OHYA 2ZJRQ 2C28A 1TZ0A 2HYIB 2MQLA 3BDPA 5DDQC 3K7RA 1AROP 3HVWA 1W2BR 1HI0P 4ECUA 1U6FA 5AXLA 4IRDA 4O3SA 1LWFB 1EHWA 5KFNA 4DV3F 3VAJA 5KG4A 3L09A 2HBZB 3DDNA 4WFNQ 4O3RA 5DO2A 3MPUB 3OL6A 2CZ4A 4LF4F 4UQGA 3N5BA 2HNZA 4NE9C 3K17A 3PX6A 2EC2A 3IWLA 1R89A 1HWLA 3GP9A 4EYIB 2I38A 1PJ6A 3F41A 1PYOB 4YHHF 1LXNA 1QE1B 4O0NA 4ZIWA 3KJNB 1R6VA 1UVMA 3DHWC 4DV4J 2APOA 2Y1IA 3UE2A 2GAGC 2R42A 3GU0A 4QOTA 2ZVIA 9RUBA 1VK8A 1DJ0A 3R7BB 4EBDA 4QBUA 2QMXA 1LK7A 4ZOSA 4MKVA 1IBCB 1HL6A 4CT8A 4CLPA 4J9OA 2XHWA 4LF6F 4UZCA 4AT1B 1M5HA 3GJQB 5CYQB 2HFOA 4L75A 2FGCA 2VZ9A 3IBCB 3MECA 3SBMA 2CQ1A 3QGIA 2EFVA 2V4JB 2QIFA 2YKQA 3CUNA 4BBYA 1ZM3A 3D4JA 4IQMA 5DJBA 3OTCA 4DU8A 3QAUA 2AF6A 5KFYA 2JEFA 2OI2A 2JSXA 3K8WA 2HW3A 1S7HA 3DGPB 3LA0A 5AXKA 1ZAXA 2BRKA 3M7VA 3Q8SB 4URQU 2AJ1A 4DPTA 1GTHA 1NHKL 1YRTA 3BKTA 1OMSA 1VIOA 1BMQB 1S6UA 3IRWP 3ZO7A 3QNWB 1OYEA 2B0GA 3NGTA 5CZVA 2CQGA 2W2QP 3ITHA 1WF2A 1P8GA 5I3UA 2RAQA 4DG1B 2CG8A 1L3SA 1QVFR 2R2SA 2RF2A 2CPIA 4KO0B 5AE3A 4XPEA 2JDJA 4DPXA 3L9ZA 2H4WB 2OKQA 2XS7A 1VQMS 4IFVB 4B08A 1KQFB 1R31A 1BQMB 2DY9A 4JYAJ 3N4WA 3BSOA 1TUWA 4OI1A 3AY0A 4AE5A 2JJ4D 3IO1A 3HFZB 4I4BA 3SIPB 3PIPQ 2OFGX 5LXYA 2HZAA 4DR7J 3NCQA 3TAMA 2QEXS 2EG1A 5IWAF 2XMMA 4OMFG 4ELVA 2OLWA 2CG4A 4CLWA 4RNNA 3CMAS 2HVIA 1A6LA 3M30B 2MB0B 4ZVUB 3VAHA 1WUUA 3CJ3A 3EE3A 2HBYB 4GKKJ 1S6PB 1N4LA 2XMKA 1WTBA 5C2GA 1CQMA 3D1HA 4W90B 3JSMB 1U1OA 4XPCA 1BQXA 4JI4F 4QYZK 1RAAB 1WHVA 1RE1B 5ETNA 5KFHA 2WAQD 2VOOA 1UW9A 4CYUB 3KOAA 4K5SA 2RH3A 4QQBA 2LXIA 1SJFA 2FLNA 1PG5B 2KXNB 1R0AB 5LM7E 2CPYA 1E6VA 2V8DA 5C2CA 1RTDA 1RWPB 3EJMA 4OI3A 1FRMA 1VS3A 3HSGA 4CZCA 4K4ZA 1DY3A 4J91A 1HBNB 3M8ZA 1TL3A 2AZ3A 1TKTB 1FF2A 4F04B 2QMUB 4HDHA 4JI1J 5EN1A 3V81A 4B9SA 3LUYA 3C66A 5T41A 4ICLB 2KL8A 5EWFA 1M90T 3T19A 2MSSA 1RAJA 3HHLB 3WIUA 5CD4A 1SL2A 2J76E 1FHTA 1Y4ZB 2OPSA 4HH1A 3US5A 2X1GA 3HJVA 1KVIA 4YFUA 3OR2B 3G9CA 4TKTA 3F73A 3NMAA 1UA0A 1N6QB 2XCPA 3H4BA 4L74A 3A12A 1SB6A 4RW7A 3M6XA 4MIAA 5DRKA 3NG8A 5J1EA 3KLHA 3QRPA 3IP0A 2CPEA 2OP5A 1T02A 5IOLA 3EXYA 1UJ6A 1LV5A 2LKZA 3M9MB 4MK8A 1IKWB 1HR0F 1C4AA 3TEHB 2NZ4A 1NSKL 2CA9A 2W1BA 3BYPA 2C2EA 2LVWA 1WDTA 3CCUS 4A48A 2MLXA 4MJKA 1FD2A 1XMOJ 5L1JA 4IRCA 1S5ZA 1Y10A 4WIQA 2I5JB 4ED4A 3LAMA 3G82A 4DL6A 3QJPA 3PW5A 2F3JA 1NH7A 4RO0A 2R2UA 4NL5A 4ZP7A 4AUKA 1ROFA 1F5AA 5U47A 5EWGA 3Q0AA 1HWJA 1VFJA 3HD2A 4MIBA 1RADB 3DLBA 3TEGA 4R0EA 4CTAA 5I42A 2FJAB 2FHJD 4H4MA 1OJ4A 4DFMA 4NLPA 3MOJB 4MMOA 1JJ4A 3P96A 1NSPA 2C2KB 2J9DE 1ZTTA 4ZCMA 3G8SA 3PX0A 4DR3J 1ZYQA 2D1CA 1KNZA 1X4BA 4JOUA 1R6YA 2QL9B 2YKMB 5B0GA 4QPTA 2OTLS 1X5PA 5BYQA 4LREA 4CM2A 2R9LA 4OX7A 2OD4A 2WSFC 1CJKB 4M5NA 2JZ5A 3VGTA 4L3KA 2YQ0A 1BD6A 4H4OA 2VH7A 2GS8A 1IBKF 4OYPA 1N32F 4U8YA 3PJ9A 2FJVA 2LA4A 3QSYB 4ECVA 1PAUB 1YQHA 3MGJA 1V3ZA 2OHDA 2QGFB 4RNFA 3RR7A 2EVZA 4KSEB 4RNHA 1Q1KA 3QWUA 2FZGB 2F65A 1RKIA 5A8WB 2V67A 5J2NB 2UXDJ 1P27B 1YLXA 1DQ8A 1Y5NB 1SI9A 1JLAA 3KLFB 1URRA 3ENVA 4K8RA 2G0JA 5JVGQ 1CJVA 3LGNA 2ZBCA 1I94J 3MF5A 4A8OA 3DCAA 4LFBF 4DEZA 2WBRA 1HNWJ 2FB0A 1SQEA 1Y3JA 3SEOA 1EETB 2QLJB 1IBLJ 2PEHA 1LWCB 3MI7X 5HLFB 3VGSA 1FT8A 4TYAA 3R1HA 3PXGa 2CJ9A 1SC3B 2L48A 3CIMA 2AGPA 5F9LA 3R6GB 2HHHJ 4O23A 2V63A 2IC3B 2WVDA 2MKHA 2OSRA 3Q8QB 1XR6A 1VGYA 1NK8A 4WU3A 1BQNA 4E98A 2R8IA 2OTJS 4G1QB 1F3FA 1QAJA 3KDNA 4HR2A 2E7XA 5CYMB 3ZZYA 4DQIA 4B3RF 3DLJA 2L9DA 4ZKAA 1PGZA 1U0HB 1YBUA 4ZJOA 5ETKA 1U2CA 2YWEA 3BO4A 1U24A 1X5OA 5D15A 1S0NA 2J0XA 1ELOA 2H3EB 1Q8KA 1IKXA 2DGSA 4BWMA 4JI2J 4NXMJ 5BR8F 4HACA 2UUAJ 4OZ1A 1YRUA 4Y2MA 4NI2B 3E01A 2HG4A 4R8UA 3H25A 4Y00A 4CDIA 1VMBA 4F0HA 4DN9A 4I0WA 5G0RA 2ZH2A 1Q0NA 1IKVA 4JI8F 2ZKTA 4KPYA 3GR1A 4Y28C 4OZ3A 4J9SA 1V5IB 3KDOA 3D6HB 2KHCA 4F3MA 2PI4A 4OHVA 4WWSA 5F41A 4C9DA 1ZM9A 4HTIA 3VQSA 3VZHA 4UUXA 3DLGA 4FNIA 2DRAA 3OR1B 5KG7A 3DM2B 2XM3A 1EQMA 4OI4A 2H5EA 1NHVA 2DTJA 2CQ3A 3KHRA 1ZPWX 2M9KA 1AUSL 2MPUA 5GAHU 2DITA 1S6OA 3IAS9 1X5SA 4R5PB 1OO0B 2UUWA 2D9PA 4Z2XA 4OZNA 5J2QB 1G3OA 3P8BB 4QIFA 1JLGB 4WJBA 4ENOA 2BW7A 5D3GB 4B3OB 3LOUA 5D78A 3GG0A 2CQCA 3MM8A 1KEKA 4TVAB 4RLEA 2GW8A 1RISA 4IO9Q 2FIUA 1H2VZ 1RT6A 1KSPA 3NS5A 1J5OA 2XS2A 1TKZA 1RT2B 3VHQA 2QSFA 4F50A 3MPYA 2MQOA 1IM6A 1GK8A 3H7HB 2P9GA 3J7A1 3G86A 3T1HF 3MM6B 1FRHA 5C42A 2AX0A 1SXLA 4NMLA 2GVDA 4AXJA 1H7WA 4CH0S 2MYFA 1NH8A 4O3PA 2AJ0A 3DRXA 5HMXA 4H4KA 2KT5A 3QO9A 3BGRB 1SJRA 2LQJA 2IM0A 4JI3J 1YJVA 4U7UD 2A1BA 3R8YA 1HYSB 1JNRB 1REVB 3RR8A 3NS7B 4PKDB 4X66J 4DV6J 3BSNA 3MR5A 3NGUA 1U1NA 4LR7A 3CULA 3D3CJ 2DGOA 5D0GA 3K5NA 3PW4A 3T5HA 3GB0A 4LRBA 1FDBA 5A8KA 3ZZ0A 4F02A 1VQ8S 1M1KT 2QFIA 4ED0A 1UCNA 1Q86T 4O3OA 3ZTSA 4I7FB 4NX9A 3DRYA 2W8LA 4IH7A 1KONA 4LRFA 2MQPA 4K5RA 4RKUC 2DGQA 3TYTA 4I69A 4ECYA 3HK2A 1AA1B 2LXUA 2JVOA 1XC9A 4C4WA 1GAOA 3ENWA 1BC6A 2PC6A 4M5DA 3X3UA 2BX6A 3R2CJ 2WRMA 1XNQJ 4DV3J 5DGBA 4P52A 2K7KA 1HMVB 1NXIA 1X31C 3IRXA 4CIOA 2G9OA 1AUDA 1YVFA 3I0SB 4KGVB 1HNIA 4LF4J 1O0PA 4WFYA 5L46A 2HSEB 3WIVA 2ZHOA 2QO3A 4YDDB 1TV6A 1XTZA 1OQ6A 3K57A 3CD7A 4RWXA 4F4KA 2BJ3A 4Y6IA 2KZZA 3H0PA 1D1UA 3RRGA 2BABA 5KFKA 3ENQA 4CLSA 2C2ZB 4BDPA 3Q8RB 4ZP8A 2FVQA 1VC0A 4ECWA 3DGVA 4JB8B 3RBDA 4DSKA 1TMJA 5IV3A 3DFEA 1WC0A 1T11A 1S1VB 3QT6A 5CABA 4CT9A 3V6DA 2QA2A 3OSPA 2KH9A 3CWJA 4Q5VA 2EI5A 3HVRA 3BDEA 3TAQA 5D4NA 4KRWA 3W1YC 3QFHA 5J2PA 1K73T 2VONA 4IFYB 2CPZA 1KS2A 3ET6B 1F5BA 1R43A 1FJEB 3R5AA 3GE9A 3PY8A 2UP1A 2A2CA 3PFOA 1X4FA 1F9HA 4KHPJ 4NASA 2KVIA 4MIWA 2VFUA 5DG9A 1HPZB 3ZNJ1 4LF9F 3AXMA 1NDKA 2P9CA 3NNAA 4WTOB 5AT1B 3VVTA 2VG5B 4CNYA 3UDCA 3BR8A 2MKCA 5CXTA 3D9BA 4NCGB 4MAKA 2EEYA 1RAEB 1U0SA 3FBFA 4JV0A 4KHRA 3V4IB 4D3HA 3PM9A 1NPPA 1FRLA 1T9TA 5KFLA 2HHVA 1XMQF 3MMBA 2XY7A 9ATCB 2UUBF 4U67Q 4OV1A 3JQKA 3H2LA 1UAWA 3U1MA 1FWKA 3FMWA 2RKIB 2HRTA 3GSDA 4QW9A 4R0JA 3OT9A 3W9HA 5GMKa 4WP3A 2R7OA 3QIDA 3SFUA 5E3RA 1RTZA 5F9NA 2VBYA 1AB8A 3SSRA 2CQDA 3PJXA 3G96A 2AYMA 4MFBB 5LMNF 1H72C 3T6JA 2Z2MA 5E3QA 3NGSA 4ED1A 1Q95G 5E3CA 1TR0A 2IMOA 5HQLA 3MHYA 2E9ZA 3FBCA 4X4QA 2E7VA 2IMWP 4OJ1A 3KNGA 3POTA 1XR5A 2W4PA 2ZVSA 4YDXA 1WC4A 3R3TA 5CAAA 5IWAJ 4IDKA 3D0GE 1WC5A 4ID5A 5JUMA 3MEGA 1U25A 4ILLA 3C6TB 3Q2TC 4KYZA 2VFTA 4ZJLA 3KLEA 3PHEA 2VPZB 2XY5A 1L3UA 1HQEB 1X0PA 2KM8C 1NNDA 3CJ4A 2HKEA 2J0WA 5T7LB 4YB7A 4ZCKA 2JC0A 4JI4J 4RU2A 2G0IA 2HNYA 1WOOA 3V2UC 1DURA 1LK5A 4DS4A 1N33F 3H5XA 1M5OC 1UWBB 1SUQB 5A76A 1UEVA 4N8OA 4TNOA 3JAMY 1TK8A 2AQ4A 1TKXA 4OIXA 3BQ1A 2XZDB 3KLVA 4DR5F 3M1VA 5GMEA 3GV5B 3C6UA 4ZLLA 4PWUA 4OV6A 3OL8A 1WI8A 5KG0A 1GTEA 2FUG9 3TAPA 3RB3A 4ERDA 1F2GA 1C2PA 4NEYA 3RBEA 2ZZNA 2V6AA 3KFWX 3C14A 5IT9Y 2IJRA 2EC0A 1DLOB 4LJMA 4LF5F 4J9UE 2R8KA 2HIYA 2J8SA 2FD2A 4NMXA 1YWXA 4RUHA 2E5GA 3A13A 2DPIA 4LF8F 5ETPA 1Z1ZA 1IKYA 3T3FA 3GR0A 3L7UA 1KLMB 3K8VA 1XIQA 4N76A 4XTTA 3ETOA 1WSVA 2W7OA 2DNMA 1UVKA 1PO6A 3CGIA 4K50A 4A8KA 3DRPB 2BJEA 4S0MA 1RHQB 4TY8B 4EO8A 2RQCA 1QVGR 1CQNA 2GVZB 2DHSA 2YKNB 5LMUF 2BOAA 1OY8A 1AZSA 5FD1A 3ZZOA 5KFDA 4A8WA 2NSBA 4O44B 1S72S 1S0VA 3TVKA 4BHQA 3G87A 2XTJP 2W24A 1S1XB 2ZFHA 3IG1A 2AYBA 4QWCA 1ZS6A 1X8DA 4DUZJ 2OELA 5KT7A 4RL1A 3TUZC 1KN6A 2L3MA 4RW6A 3MMAA 4OHWA 2RNEA 3AH6A 1NKEA 1WG1A 1LFPA 3D5MA 1CJTB 4TU9A 7FD1A 3IGVA 3DMJA 3G6VA 3J80Y 2IM2A 2PDAA 3MCOA 4B02A 3CCMS 1WC6A 3K5OA 1FESA 2W2MP 5HL7Q 4FS2A 3I5BA 2XI3A 5EHHA 1AW0A 1U8SA 1K1QA 4ETZA 3JYTB 3DOKB 3W9IA 2DNHA 2X3DA 3GQCA 3CCLS 3D28A 3MOZA 2QA1A 4DL5A 1S0OA 3CSKA 1YZ7A 1EKSA 4FYXB 3HHDA 2D74B 1R8PA 1RUSA 2Y0SD 1RU1A 2BE2B 4FYVB 4JP8A 4FXVA 5GADI 3Q2SC 1N32J 3WZ0A 4FN5A 3HVAA 5F8IA 2FLOA 1MSWD 3TZWA 1TFWA 3DYAB 3DC2A 4P6QA 5HVFA 2E66A 2B4OA 3M8PA 2B8QA 1LFWA 2CJBA 1HARA 4WIIA 1VQ9S 2XYGB 1U1RA 1SH0A 3DRSB 3ULHA 1FXLA 1WEXA 4F25A 3SYZA 3MAAB 4ECTA 3ELHA 5LJ5Y 4YOEA 3C46A 4M5KA 2MSTA 4J90A 1Y5IB 4OJGA 4CO1A 4WXOA 2YH1A 4QWDA 1DTTB 3T1YF 1XK8A 3HZGA 1H3DA 1D8ZA 3GYXB 1DFDA 2YNHB 1F6TA 1T8EA 1QSLA 3R27A 2ADBA 3IC1A 2M7SA 3V6HA 2OO4A 1JWWA 2XSJB 2QLBB 2P5VA 3VAKA 4UOHA 2DO0A 3PV8A 2VODA 1RI7A 2HHXA 2MGZA 4CLUA 1IQTA 2MDAA 3I55S 2G0CA 4JI5F 2CNOB 4YS2A 4YN3B 5ETVA 2D69A 5KT2A 1YHQS 2F8MA 2HHSA 1ZOTA 4CH1A 5K14B 1C1BB 1PBAA 2G2ZA 2VG6A 2V94A 3W2VA 4PWDA 2K2PA 3J81U 4PZVA 3WX8A 1GQEA 3MM5B 5FDLA 3OQ2A 3TA0A 5HAOA 5LSOA 1KHWA 1H98A 2EG2A 2XMWA 2IVFB 3NRBA 5LJ3Y 1AFJA 4R25A 1TVRA 2Y1JA 2MJNA 3FQLA 1SPBP 1ZM2A 5KFOA 2HNDB 4FS1A 3HSDA 4PQUB 2ZOGA 3Q23A 4B3RJ 1WWHA 1JLEB 1KVKA 4FYWB 2RU3A 4FXDA 2FJDB 4KV8B 2VIHA 1RHRB 1UEUA 3HP6A 2WB4A 5A8RB 5IV4A 2W9BA 4C3KA 3O5TB 5KT6A 2JFKA 4P75A 2HQFA 1VRUB 2G2YA 2QA4G 3D6TB 4DV1F 3F44A 3NKYA 2MZRA 4ZHRB 2GHPA 5F8LA 1NB7A 1UETA 3EDQB 2G1DA 1FXDA 3KG4A 5JMNA 2BACA 1X9SA 2E44A 1FFWB 4J9QA 3T1AA 4WCEQ 2RUGA 3BZQA 1APSA 4F4XA 2RHQB 5CA5A
chains in the Genus database with same CATH topology
3ITHA 5HP1B 2ZD1B 1WF2A 2JEGA 4UY85 4WYLA 1P8GA 2I8EA 5I3UA 4N41A 4DG1B 1HBUB 3ISZA 4NCBA 2M8DB 5DQGA 1L3SA 4PG5A 3E8OA 3VAFA 4A8FA 4B17A 4J9NA 4FF2A 5E2QA 1VQNS 1QVFR 1S6QB 1RA6A 1SIZA 2J7UA 1SJ4P 2ZJQQ 2LCWA 3MD3A 2R2SA 2RF2A 2CPIA 4KO0B 1OS5A 3RW6A 1RT1A 4RW4A 1S9GA 2RU9A 3TVZA 5AE3A 4C8NA 3K58A 4QU7A 4H4OB 1RTJA 2JDJA 4XPEA 5KG6A 3CD6S 2ABYA 2PA3A 2OKQA 3MEEB 2CIMA 2XS7A 1VQMS 4HYKA 2AJ4A 2HNZB 4IFVB 4B08A 3HM9A 3QIPA 1R31A 1KQFB 1BQMB 2ZOMA 1KHVA 2R7WA 5G4DA 3N4WA 3KMQA 2CQ2A 3BSOA 4X4VA 4OI1A 3AY0A 4AE5A 2MY7A 2JJ4D 3AA9A 1VRTA 1FA0A 3MURP 2KXFA 2CQIA 3IO1A 4I4BA 4QIVA 3MEDA 1HBMA 5B0CA 4LSLB 3H2VE 3PIPQ 2OFGX 2YVSA 5D4PA 3BSCA 4ZS6A 2LQ9A 3I31A 5LXYA 4DF8A 3PW7A 3NCQA 3TAMA 1SV5B 2VG6B 2LYVA 2QEXS 3N01A 4RBUA 3W2VB 2WONA 1YG0A 2KJVA 3JTOA 2EG1A 4N8NA 1ZAWA 5IWAF 2XMMA 4NA2A 4LQ9A 4OMFG 2F9JA 1DAXA 4ELVA 4A47A 2OLWA 3WX4A 4MYUA 4IH5A 2G13A 2HFNA 2CG4A 4RNNA 2F4VF 4ELTA 4M1KA 2VBXA 4F2RA 2GGPB 4XIUA 3CMAS 2F9DA 4JUZA 2RQKA 2ASLA 4NLOA 1KQSR 2IA6A 1RK8A 1A6LA 4ZVEA 3A1YG 5AXMA 3M30B 1HHTP 1QM9A 1JLQA 2MB0B 1Z2ZA 3VAHA 3AA8A 2RILA 1FDAA 1V6HA 1WHXA 1C0UA 2GA7A 4KB7A 3CJ3A 1TAUA 2J7KA 3H59A 3FDSA 1X0FA 1S6PB 4A8YA 1JB0C 1N4LA 5D77A 2GO9A 4DX8H 2L41A 4DL3A 4XAKA 2FLPA 1JLAB 2ZH1A 2XMKA 3MPVA 3DYAA 3HFKA 4PG4A 1WTBA 2KFYA 2XZWA 3QLHA 3TI0A 1AFIA 3W2WA 2HS4A 2J7WA 1CQMA 2V8HA 1FERA 4GC7A 3KK3B 3PKMA 3D1HA 4W90B 3JSMB 2IHR1 1U1OA 5M2UA 4XPCA 1BQXA 4JI4F 4O3QA 1OPZA 4C0HA 3BM7A 2MY8A 3N79A 1WHVA 2NS1B 4URSA 3MTKA 5KFHA 2WAQD 4EYHB 3Q8PB 4USJC 4DSEA 2VOOA 2AWZA 5KOXA 5K9FA 1XN9A 1NJYA 2B6AB 2P6TA 3KOAA 4X65F 4K5SA 2F40A 1OSCA 2EFGA 4DR1F 2RH3A 3OHBA 2BQ3A 4QQBA 2LXIA 1SJFA 2FLNA 2KXNB 4DBQA 5KFVA 5H9FJ 2DNQA 1R0AB 3OTBA 4YB6A 2W9BB 3CC4S 4WTYA 4RX6A 5DLFA 3OBIA 3OL7A 2CPYA 4J9LA 1RQ0A 1E6VA 2V8DA 5KT4A 4JI0F 1FTRA 5IM0B 4JYAF 3M2UB 3T9ZA 1LW0B 1RTDA 2YH0A 3KLGA 4B3SF 1DTTA 1LWFA 3S01A 2ZJPQ 2C3UA 4RZRA 3QJLA 2GQCA 4OI3A 3RB6A 1FRMA 1SKRA 4PR6A 1QUPA 1VS3A 4F26A 3MEKA 4CZCA 2DGXA 2YNHA 2XGPA 4K4ZA 3CCQS 1FRXA 1U7LA 1HBNB 4PQAA 2HPUA 1TL3A 2M5YA 2YNGB 1YGYA 2RRAA 3MXHP 4HH0A 3JB9k 5M2PA 4HKQA 1TKTB 1DBDA 2D3OR 1U45A 3DDKA 1FF2A 3SZ2A 2UVVA 1B7FA 1IN0A 2XSJA 3HHNB 5J1NA 1S1WA 1YJTA 4HDHA 3SDEA 5EN1A 5L39A 3V81A 3HHLD 4B9SA 3LUYA 3C66A 4X64F 5T41A 4ICLB 3HVTA 3VAGA 1WG4A 2VV5A 4KC5A 3SCJE 3T19A 5EWFA 1M90T 4XK8C 3NMRA 1S99A 1BQNB 2EBGA 1IJFB 5EGYA 3BN7A 3ZZUA 4PXDA 2FC9A 4I64A 3MDFA 4OZ5A 2YQ3A 4ILMA 3FZBA 2MSSA 4DL4A 2FJXA 1RAJA 3HHLB 3IA0A 1SL2A 2J76E 4ES1A 3KHHA 4UY8T 3MWBA 2POKA 3M32A 5KFQA 1KOHA 5L8RC 4X4SA 1FHTA 3V6JA 3M4XA 4LVOP 1Y4ZB 4NA3A 2DHGA 2AP6A 2R8JA 1VQ7S 1QE1A 2RRBA 2OPSA 4PXCA 4DJBA 3VTIA 1KD1T 4HH1A 3L7PA 4I2PB 3US5A 2X1GA 1VHFA 1KVIA 2JLGA 3GFXA 2KZMA 4YFUA 3ITHB 2MXYA 1ZBTA 1YRXA 3OR2B 3FFIA 2AV5A 3M6VA 1N36F 1FXRA 5KFMA 1NJXA 1UJ5A 5JXSA 1U1MA 3UD3P 3K2YA 3G9CA 1IR0A 4TKTA 4WU2A 3F73A 3NMAA 3OFFA 4OZLA 1UA0A 4J9RA 2O5DA 4ATNA 1QTMA 4NLXA 4EBEA 3HO1A 4ECXA 1N6QB 5LSLA 1U2FA 4OHXA 2XCPA 1HA1A 3H4BA 3CCVS 1M5KC 2COLA 3I56S 1CVJA 3TX8A 1SB6A 4RW7A 1RT1B 3RB4A 3DLHA 4RW4B 1S9GB 3M6XA 3N6LA 2BM0A 3U27A 2FJBB 2J5AA 3C2PA 4HTJA 1RTJB 3KTQA 4MIAA 1ZETA 4B3TF 1IKXB 4DR6F 3O2IA 5DRKA 4ETXA 1YBAA 2I1RA 3GWCA 4LSNB 3NG8A 5J1EA 2JEJA 2EFNA 2ZH3A 3KLHA 1C4CA 1GH8A 3FRZA 1FD8A 2N82B 1CC8A 2CPEA 2OP5A 4KT0C 1T02A 1RT7A 2LEPA 2HNDA 2ATLA 3EXYA 4B3MF 4HI1A 3E01B 4NPOA 4DR2F 1UJ6A 4N47A 1LV5A 2LKZA 5GAEU 1BGXT 3M9MB 3OFGA 4R8UB 3MEDB 5GADU 1HBMB 3D2WA 1VQPS 2KU7A 4MK8A 4NZ6A 2M0GB 1S76D 5KG5A 1IKWB 1HHSA 4IO1A 1JLEA 1HR0F 1C4AA 2NZ4A 3N6MA 2E9RX 3HHKA 2PMZD 2R4FA 5G0RB 3B4MA 3G8TA 4JV2A 2WONB 5CYQA 1S1UB 1RP5A 2C2EA 2LVWA 3CCUS 5K8PA 3DLLQ 1IKVB 3VQTA 4A48A 3PKYA 1NKCA 3OTDA 4NZ7A 3RRHA 1TL4A 4MJKA 1FD2A 4JI6F 3VAMA 2XS5A 2ZBIA 1S79A 5A8RA 4C8ZA 5L1JA 1KTVA 4IRCA 2J9EA 5FLXY 1NJWA 1LKZA 2CDQA 1EETA 3RAMA 3GYNA 4ECZA 5DDOC 2V4JA 2I5JB 2F1FA 1LWCA 4FXWA 3LAMA 1JLCA 3UW1A 2X1AA 2AU0A 5KFSA 4O0IA 1RT4A 1VRUA 1C0UB 1R8HA 2ROPA 5IT0A 4DL6A 3M9NB 3NCPA 3QJPA 3KNAA 2XG8A 3G8QA 3CD5A 3I9ZA 1TAQA 4LVNP 1FO1A 1VLYA 3DLGB 3U1LA 1N5SA 4DLEA 1MU2B 1WF0A 5HMZA 5C5JA 1YJ9S 3E3XA 3PW5A 4ELUA 2JFDA 5H1SV 2F3JA 1NH7A 2R7VA 3CDWA 1U48A 1N5VA 2QZ8A 2RRNA 2R2UA 4NL5A 4ZP7A 4PPZA 3DOLA 4ZHRA 4DQRA 4AUKA 3PVXA 5I3PA 5ITHA 1ROFA 1U6BA 1F5AA 2EFOA 4YQWA 5U47A 1UVLA 4NLQA 5EWGA 3Q0AA 1HWJA 2A2DA 1KR4A 1VFJA 3BSAA 1F60B 1VJWA 4MIBA 3DLBA 4I1TA 2YX4A 4P7TA 2HS0A 4R0EA 2HVZA 1N5YB 4CTAA 4NRUA 5IS2A 4K4UA 5I42A 2FJAB 2WSCC 2W9CB 2FHJD 1HW9A 2ZDOA 4H4MA 1P9QC 3I87A 3PJWA 3G71S 4NLPA 4DFMA 3MOJB 2CJQA 1T05B 1R7IA 4MMOA 2HWIA 5B7WA 3GIMA 1Q78A 4NWBA 1MMLA 1B0VA 2KKHA 3P96A 1JJ4A 4NLWA 3FEZA 2ZC3A 5M2RA 1P1LA 5KOWA 3M8RA 3T5KA