3JC22

The structure of the mammalian sec61 channel opened by a signal sequence
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
62
structure length
62
Chain Sequence
b'FVEPSRQFVKDSIRLVKRCTKPDRKEFQKIAMATAIGFAIMGFIGFFVKLIHIPINNIIVGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein transport protein Sec61 subunit alpha isoform 1
publication title Structure of the Sec61 channel opened by a signal sequence.
pubmed doi rcsb
source organism Bos taurus
molecule tags Transport protein
total genus 11
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2015-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00584 SecE SecE/Sec61-gamma subunits of protein translocation complex
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.820 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Preprotein translocase SecE subunit 3jc2200
2YXQB 3MP7B 2YXRB 1RH5B 1RHZB 3JC22
chains in the Genus database with same CATH superfamily
3L75E 2WSCH 3SWYA 1SQQD 1RE3A 2ITAA 2H89C 2V7QH 2QG4A 3TGUE 2IX7C 3EFGA 3H1JE 1NTKE 3VMAA 5B66H 1LP1B 2R5DA 2H7HA 3GHGB 3GLMA 3L74J 1J1DB 3AE7C 1ZMEC 3AEDC 3EQ2A 3KXDA 1NOHA 4EDFA 1N7SA 5KLIB 1QLED 3JC22 1NTKK 1GU4A 3HE4B 2D2CD 2G8YA 5AW9B 3HD7A 1VF5B 1M90Q 1LNQA 1N2DC 1FOSF 1NTZE 4C46A 1SQBG 5AW3B 2C9LY 2IFMA 4H0LB 2XNXA 3JSVC 1X22A 3M0DA 5APXA 1KQFB 4H44B 1S5LH 2JWAA 1AVOA 3CCMP 3TNUA 5BU5A 3RK3D 4W7ZA 1NTZK 1VQ6P 1BCCG 4AQRD 4HH2A 5AVXB 1KZUB 1IFIA 3L72J 1LTTC 1H8AA 5KAIE 1YIJP 3CLQA 4GT1A 1KILB 1A02J 1W2EA 3USSA 4YTPC 4H13D 3H1KE 3W67A 2GA1A 2BEZF 1RF1B 1NAYA 2SPZA 3D70A 2P1JA 1NGMB 2N1TB 1KYOD 2AEJA 4TT3H 2E75D 2QJKC 3N7NA 5C39A 1RF0C 1SQBJ 3H1IG 1EXJA 1YITP 4U7JA 1T2KD 1QEXA 1S2EA 4XE5B 1Y9BA 1OIPA 2W8ZA 2IBZG 2OARA 2ZYGA 2AEFA 5KTBA 3AE2C 2YXRB 1BE3D 4WBAA 5CMZA 1CZQA 4PJ0H 2Y0EA 4C7RA 1Q90D 1LTAC 2Y9YA 4BRYB 2XDJA 1MV8A 1PP9J 2FFDC 3PH0A 2KB7P 1KB9E 2KP8A 2NZ2A 3LIEA 1G2CA 5KAFE 3WU2H 2YIUB 3B4SA 1K9MQ 5L8RJ 3CCEP 1L4AC 3MD0A 3OA7A 1SQVK 2O1KA 1NKZB 1ZR2A 2HPCA 1SQQE 3P8CD 1VF5D 3Q5RA 1KB9I 1JEKA 1WMKA 1FC2C 3H1IJ 4PV1C 2Q3IA 4N78D 3P7KA 3E1IA 3MGNA 4KT0J 1JUNA 2K9YA 1VQMP 3WMM0 4JBZA 4PD4H 1LTBC 2OYIA 2A06G 5GTHE 2YO2A 1N73A 4N6JA 1BSHA 3U1AA 1CSBA 3LW5H 3QWOC 3L70J 3MP7B 4C7NA 3H1HG 2WTYA 3HTKA 1M56D 3A0BE 1HUCA 1NVOA 2WSEH 1RE4A 5KLVG 3SWFA 1JMMA 3L35A 3N4XA 2BCCG 3CC7P 1JM0A 1PPJD 3U1CA 3JCUH 2Q6QA 4Y99C 2AXTH 1NWQA 2NPSC 2LXBA 2WPRA 2E5YA 3V2QA 4OGQC 5AW6B 1L2PA 2Y0CA 3GG2A 4GDOA 3OAKA 1NH4A 1RQVA 2ZVNB 1LWUC 4PV1B 1QL2A 1LP1A 2ZYAA 1KD1Q 2Q9IA 3B5NC 2N1TD 3GHGA 3L71D 3GF3A 3S4RA 1JY2N 1P84D 2BEQD 1JTHA 2PP6A 5CCHC 3PHLA 1X9VA 1FZCC 2MKVA 2A45I 5APWA 2YKQA 3HD7B 1KFNA 3ZDMA 4EOTA 1IK9A 1VPCA 3V4WA 3H1HJ 3WUTA 2CPSA 3H6PA 5EFWB 4LGDE 1LTJC 1YI2P 1OW7A 5M1BA 4LC1A 2YMKA 2HG5D 5KLVJ 4L74A 2QJPC 1KYOE 3AE4C 1R8EA 2BCCJ 3PJSK 3CD6P 1NU1E 2WSFH 2R3SA 1R5SA 3L37A 2WSCJ 1YQ3C 1LWUB 2GUSA 1SQXG 1SFCC 3F89A 2V7QJ 1GD2E 5B5EE 4DT0A 2R44A 3L74D 1G1IA 4K3AA 3CCSP 1BE3E 1XTCC 1J2JB 1NKNA 1NU1K 1KC8Q 1KYOI 1GK6A 1H89A 5KJ7C 4M3LA 3AE5C 3FWLA 3CX5D 5CJ4A 1GU5A 1RF1A 4WY4C 3O8ZA 4HJGH 2N1TA 1LT1A 4RESB 1KTMA 1CW5A 1YTZI 3P32A 2FXMA 2HFED 2J58A 1SVFA 3P8CE 4XA4A 4ASVA 4YXWH 5APTA 1AV1A 3L73D 3M9HA 3M9BA 1OXZA 1L4AD 1YJNP 2FXOA 2D2CB 1L0NG 2K88A 1RQUA 4N78E 2IDBA 2AXCA 1SQXJ 3MUDC 1NTMG 3M0AA 3K5BA 2JDIH 4BRYA 1K8AQ 2YXQB 3L72D 4L73A 1GL2C 1PZQA 3H1LG 4PV1D 4UB6E 1G2CB 1BGYD 1LTSC 3L75G 2BASA 1YQ4C 5AW5B 2NRGA 1L0LJ 1FDOA 2B87A 3TGUG 2XZRA 2QJYC 2ZYDA 3FWNA 3U59A 2KOGA 3H1JG 3G3ZA 2N9BA 3IFMA 2Q1KA 5AVRB 1M8OB 1WT6A 1PGJA 2Q5UA 1FZEA 1OX3A 2P67A 4H13B 2JWDA 3MTUE 2NPSD 3L71E 3RL0C 1SQVD 5CHXA 2PFXA 4HB1A 1P84E 2KXPB 5GTIH 3A0HE 1ZR4A 2WPSA 1NTMJ 4C7NB 4N3YB 2YMYA 1PP9D 3B5ND 1FS0E 3KDPB 1DD3A 3V2RA 1YBKA 4UB8E 1EXIA 3OJAB 5AVWB 3L75J 1LT9B 1P84I 5CCGD 2PRRA 2DW3A 1NJIQ 2V4HA 3NTNA 2B88A 1GMJA 3H1JJ 1VQPP 1TU3F 4GOEA 3KYQA 4U3FD 1KQGB 3H1ID 5AW4B 2YO3A 1N8RQ 3TDKA 1VQ9P 3S9OA 3D6ZA 3CWBD 1OVVA 1JTHB 4NPDA 5TJHA 3L74E 1ZW0A 1VQOP 1AVYA 1URQC 1SFCD 3H1KG 3RK2B 3L70D 2WT7A 4GKGA 3FX0A 2OYHB 3Q5SA 3CX5E 1JMBA 3AEFC 2IZ1A 5AVQB 1VQKP 3LW5J 2NPSA 5KJ7D 4IOIH 4YXDC 2WSEJ 3H32B 2IYPA 3L36A 5APSA 1LWUA 3C1LA 4XFJA 1Q81Q 3L73E 3B5NA 1SQPG 1S4XA 3CX5I 3NMDA 2O1JA 1EDLA 5BVZA 4IL6E 1M1JC 4A7PA 3L4FA 3HUSC 3KZIE 2R3CA 3CXHH 2HYNA 5CCGA 4HKZH 3AEBC 3L72E 3R4YA 1GZLA 2B9BA 2A06D 1GW4A 2QM8A 2O01H 1BGYE 2CPBA 3H1KJ 1JNMA 4IFFA 1SQQG 5E79E 1GK4A 2ZJSE 1J1EC 1GL2D 1SLQA 4MN4C 1NU1D 3SSUA 1MKMA 2H43A 5H2FH 2P7JA 2ZVOB 3AEEC 2HR3A 2BCCD 3E7KA 2HODB 1P84H 1QL1A 3BCCD 3QH9A 3I56P 1RHZB 3LIDA 3BRTB 3HRNA 1KORA 4IL6X 1EDIA 1JY3N 4I1LA 1IFJA 2Z5HA 1BCCJ 1X79B 2K3RA 2WSFJ 1SQPJ 1SQVE 5K5GB 3AE9C 1FBMA 1SQBK 4WB4A 3A7OA 5KJ7A 1OFCX 1EZVD 1PP9E 4RO0A 4L75A 1U7MA 3TK1A 2YKOA 3A2AA 4DZOA 1LTIC 4QMAA 2Q3EA 1FDIA 3VP8A 1RY3A 2E74C 1VQ7P 2WSSH 2B87B 1OMIA 3ABVC 3TF5A 4L76A 2QJKB 1MZ9A 3A5TA 1SQQJ 3RK2D 1A02F 1CI6A 1HTLC 2E43A 2Z5IA 1N7LA 1HJ0A 4GODA 1JCCA 1RE3C 2KYVA 1PV3A 2ZT9C 2L91A 2E76C 1M1KQ 1T3JA 3MUDA 4U3FE 3H1IE 3NXSA 4NPEA 1QGKB 3V2PA 3CWBE 1SQXD 3D6YA 1OW8A 3CX5H 2FFDB 3CCQP 2KI7B 1HH0A 1QVFO 1N7SC 2J5UA 1USDA 1H88A 3Q5PA 2CK3H 1L4AB 1ZLLA 3L70E 4EYYQ 1LGHB 1L0LD 1LT9A 1URQD 1OZHA 4D6TD 1AQTA 2R5BA 4IL6H 2I8DA 2FYUG 3M0DC 3V5BA 5KAIH 3IF4A 3SWKA 2GUVA 3AE3C 1BE3G 2RMZA 2RH0A 1IFDA 2JO1A 3VTPC 1BDCA 5E79H 1DEBA 2WT7B 1DH3A 2JEEA 2UWJE 2OYHA 2L5GB 1YTZT 2XV5A 3BASA 1PFIA 2A06E 2FXPA 2RN0A 3SFEC 3RGUA 4JQ0D 4Y99B 2NPSB 3RBXA 4OGQB 3VP9A 2Y0DA 3CCVP 5AW2B 5BU8B 2M5AB 3H32A 4BWNA 4KJMA 2LXCB 5APQA 4B86A 4DCKA 4ZMDA 3B5NB 2BCCE 4JPZB 2Z4EA 2KZIA 1KB9H 3BCCE 3WUUA 2W27A 5KAFH 4YPCA 1Y8AA 2FYUJ 2FKWB 2Q7CA 5AVVB 1JOCA 1BE3J 5KLVK 2RKLA 1LTGC 2IFNA 1FZCB 3G4SP 3IR9A 1URQA 1Y47A 1S3JA 3P8MC 3O6QB 1FZGA 4PD4D 1EZVE 1LTJB 2J59M 2KLUA 3VMZA 1PPJG 1K05A 2FBWC 2QJPB 1GW3A 3M9QA 2KK7A 5AVZB 3RK3C 1ZRTE 4W80A 2W6AA 2WPVB 5GTHH 2HODA 2O01N 1SFCB 1USEA 3R2PA 4RJTA 1HF9A 3VN0A 2JKVA 3L71G 4EIJA 1EZVI 3A0BH 1M1JA 4OVNF 2JR8A 2QEXP 3E1RA 1SQXE 1X0TA 1S5LE 5AVUB 2OYIC 1S1CX 2E76D 1SS1A 1VQ5P 2P10A 4WY4B 1N73C 1IK7A 2A45H 1YJWP 2MJZA 4JYBA 1GDTA 1EDJA 2M3BA 1NYHA 1SQXK 5CBNA 1IFPA 1RF0A 1DD4A 1ZP0C 2QVAA 1L0LE 2W6JH 1NHLA 1OWAA 1VL2A 1CI6B 1NTKG 1T2KC 1SQBD 2O01J 1KN7A 1WRGA 4D6TE 1IZNB 2Y9ZA 3A3YB 1FZAA 1KQSO 3KHUA 1KQLA 3VOPA 2H8PD 2KLVA 5TISE 4OGQD 1L0LK 5AW8B 4ZKPA 4WWIA 1L0NJ 4O9BA 3L71J 4GIFA 1BCCD 2FFDA 1GL2B 1SQPD 3PLNA 3GHGC 2KNCB 1DIPA 1J1DC 1JCDA 1FJPA 1NTZG 3V4QA 5KLIC 1KYOH 4LLHA 3H1LJ 1L4AA 2KZJA 5CCHD 1T8ZA 2H88C 1FZBA 1ZXGA 1E5WA 2QJYB 4PJ0E 1VF5C 3TGUJ 5B5EH 1NTMK 3L73G 4H0LC 4BXLA 1YJ9P 2ZXXA 3WU2E 4CPGA 1VQ4P 1NTKJ 2M0BA 3V2NA 3VMXA 4H44C 1D7MA 3FXDA 3RL0B 1S9KD 1AA0A 4GOFA 4R4MA 3I5CA 2IBZD 3KPEA 1KV4A 1AJYA 4DJGA 3L72G 1NAFA 4AUWA 1BGYG 1YYCA 1KFMA 1H0TA 1NTZJ 1KILC 4PD4E 3VYIA 5CBOA 1HGZA 3CMEP 4IFMA 1RF1C 2M5AA 1R5LA 1ZOYC 1T6AA 1FE6A 2N1TC 4WY4D 1SP4A 2IPPA 4OWFA 3GMAA 1OVUA 2E5TA 1HGVA 4ASWA 3L73J 4UB6H 3V6IA 3GW6A 2OTJP 3KQGA 3ITKA 2KSJA 2XKMA 3IAOA 1SQVG 3W68A 4PD4I 4R4LA 5CCHA 1VQLP 3JCUE 2AXTE 3CPWO 1FZCA 1URQB 1AQ5A 1LJ2A 1PP9G 1JY2P 3H25A 1VQ8P 1FJKA 3O6QA 2QSIA 1LTJA 3HE5B 2KS1B 1BGYJ 3H1HD 4HYTB 2K37A 2YIUC 3C8VA 3Q1MA 3T97B 2KIKA 5KLVD 3BVHA 1VQNP 3CCJP 5TISH 2KUBA 1SQBE 1SFCA 3A0HH 1IC2A 4U3FG 4EI2A 2ZXEB 1HWTC 3CWBG 1M1JB 4UB8H 1YHQP 3MZWB 2FYUD 3HUSB 1SQVJ 1BCCE 1Q82Q 2YKPA 1SQPE 1HVVA 1M7LA 3L70G 3RL0D 4WY4A 1HJBA 2WMMA 1OW6A 1Q2NA 1QVGO 1J1EB 2WVRA 1ZRTD 2A45G 1MFTA 1SQPK 2G3AA 2QRXA 1RH5B 2ZAEB 2K9JA 2B89A 2QA4P 4Y28J 2ZFCA 3BRVB 5AW1B 5KKZC 2N9YB 2OTLP 3CC4P 1K04A 4NPFX 4U3FJ 1S9KE 3WUVA 5AW7B 1GL2A 3G6EP 3CWBJ 4H0LD 2KNCA 2IBZE 2QIWA 1SQQK 4ZNCA 1IFNA 4H44D 2WQYC 1G1JA 3F5HA 3RBZA 5APUA 2E74B 3GF7A 4KHXA 3AEGC 1W5CE 1XTGB 3II6A 3HD7C 1VDFA 1NU1G 4I6MC 3CXHD 3AE1C 2PAJA 2IBZI 3B8EB 1EDKA 2JJLA 1Q86Q 2FYNC 5DJTB 3BCCG 2FYZA 2ZT9B 3KZIH 3CMAP 1KILD 1X8YA 2E76B 2W90A 5KKZB 1U57A 4I2LC 2FY8A 2LR2A 4JYCA 2POHA 1L0ND 3RK3E 3CCUP 1DEEG 3BATA 1NTMD 3NFQA 2XU6A 1N7SB 1JY3O 3G9RA 1PGOA 3I55P 1EZVG 3M91A 4JF7A 3PTZA 5DJUB 1H0TB 1ZV8A 3H1LD 3HE4A 1E79H 3CCRP 5CCGC 1FZFA 2IZ0A 4TLFA 3H1HE 1EQ7A 3L75D 1M57D 5GTIE 1IFMA 1K73Q 1PIXA 4Z1MH 4I7ZC 2OQQA 5KLVE 1NU1J 1W2BO 4W7YA 2FYNB 2C0WA 3TGUD 2E42A 3H1JD 2IYOA 1UIXA 1NTKD 3D71A 3TNUB 2WZ7A 3BCCJ 3AE6C 2D2CC 2W83C 2FYUE 1S72P 2WPQA 3TSIA 2PGDA 2R32A 5APYA 1QX8A 5B66E 2C0XA 1T3UA 1FDMA 1MUUA 3HE5A 2KS1A 2W6BA 1KILA 3EFFK 3CL3D 1FU1A 3M06A 1L0LG 2P58A 1UIIA 1MFZA 1NTZD 2FYUK 1EC5A 2LKMA 3EWKA 2P2UA 3T97A 4AYCA 3CCLP 2QM7A 4D6TG 1AFOA 3Q2YA 4I7ZB 4WVZA 4IFDK 5AVSB 2E74D 3CC2P 2XNDH 2WWWA 1N86A 1Z56A 5AW0B 2VRSA 2OYOA 3HUSA 3TYYA 3PRJA 4H13C 5AVTB 1HBWA 1IO4A 1JY2O 3C9IA 2JP3A 3VMYA 2ZT9D 3B71A 2WITA 3MIWA 2OGUA 3AE8C 5AVYB 1PGQA 4K35A 2AEMA 2E75C 3H1KD 3Q3DA 2I1JA 1ZN5A 2QE7H 2M3EA 1RE4C 3RK3B 3MHVA 3AECC 1N7SD 3CI9A 3CXHE 1NO4A 3FGAD 2K9JB 4OH8B 3PP5A 3AEAC 1KMIZ 2HPCB 3FXEA 1LT9C 4D6TJ 1BDDA 5CJ0A 1PPJE 2M8RA 3UIAA 3HD7D 1PGPA 3L74G 1KILE 3G71P 1GTWA 4RKUJ 1DX7A 2K1AA 4DOJA 1S5LX 1IJDB 1JO5A 1Q7YQ 5H2FE 1L0NE 2OTKE 2YNYA 2I1KA 3CXHI 3OW2O 2OYIB 1OVRA 1JY3P 1U7JA 1BSNA 2HLOA 1NTME 1KB9D 1N73B 2GM4A 3S1KA 1JB0J 2E75B 5APVA 1FOSE 3IN6A 2C9NY 1FAVA 3HTKB 3RL0g 2O3JA 3H1LE 3RK2C 1PL5A 1L0NK 3SFDC 4ZKUA 2OYHC 2KSEA
chains in the Genus database with same CATH topology
2YXQB 3MP7B 2YXRB 1RH5B 1RHZB 3JC22
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YXQ B;  3MP7 B;  2YXR B;  1RH5 B;  1RHZ B;  3JC2 2; 
#chains in the Genus database with same CATH topology
 3L75 E;  2WSC H;  3SWY A;  1SQQ D;  1RE3 A;  2ITA A;  2H89 C;  2V7Q H;  2QG4 A;  3TGU E;  2IX7 C;  3EFG A;  3H1J E;  1NTK E;  3VMA A;  5B66 H;  1LP1 B;  2R5D A;  2H7H A;  3GHG B;  3GLM A;  3L74 J;  1J1D B;  3AE7 C;  1ZME C;  3AED C;  3EQ2 A;  3KXD A;  1NOH A;  4EDF A;  1N7S A;  5KLI B;  1QLE D;  3JC2 2;  1NTK K;  1GU4 A;  3HE4 B;  2D2C D;  2G8Y A;  5AW9 B;  3HD7 A;  1VF5 B;  1M90 Q;  1LNQ A;  1N2D C;  1FOS F;  1NTZ E;  4C46 A;  1SQB G;  5AW3 B;  2C9L Y;  2IFM A;  4H0L B;  2XNX A;  3JSV C;  1X22 A;  3M0D A;  5APX A;  1KQF B;  4H44 B;  1S5L H;  2JWA A;  1AVO A;  3CCM P;  3TNU A;  5BU5 A;  3RK3 D;  4W7Z A;  1NTZ K;  1VQ6 P;  1BCC G;  4AQR D;  4HH2 A;  5AVX B;  1KZU B;  1IFI A;  3L72 J;  1LTT C;  1H8A A;  5KAI E;  1YIJ P;  3CLQ A;  4GT1 A;  1KIL B;  1A02 J;  1W2E A;  3USS A;  4YTP C;  4H13 D;  3H1K E;  3W67 A;  2GA1 A;  2BEZ F;  1RF1 B;  1NAY A;  2SPZ A;  3D70 A;  2P1J A;  1NGM B;  2N1T B;  1KYO D;  2AEJ A;  4TT3 H;  2E75 D;  2QJK C;  3N7N A;  5C39 A;  1RF0 C;  1SQB J;  3H1I G;  1EXJ A;  1YIT P;  4U7J A;  1T2K D;  1QEX A;  1S2E A;  4XE5 B;  1Y9B A;  1OIP A;  2W8Z A;  2IBZ G;  2OAR A;  2ZYG A;  2AEF A;  5KTB A;  3AE2 C;  2YXR B;  1BE3 D;  4WBA A;  5CMZ A;  1CZQ A;  4PJ0 H;  2Y0E A;  4C7R A;  1Q90 D;  1LTA C;  2Y9Y A;  4BRY B;  2XDJ A;  1MV8 A;  1PP9 J;  2FFD C;  3PH0 A;  2KB7 P;  1KB9 E;  2KP8 A;  2NZ2 A;  3LIE A;  1G2C A;  5KAF E;  3WU2 H;  2YIU B;  3B4S A;  1K9M Q;  5L8R J;  3CCE P;  1L4A C;  3MD0 A;  3OA7 A;  1SQV K;  2O1K A;  1NKZ B;  1ZR2 A;  2HPC A;  1SQQ E;  3P8C D;  1VF5 D;  3Q5R A;  1KB9 I;  1JEK A;  1WMK A;  1FC2 C;  3H1I J;  4PV1 C;  2Q3I A;  4N78 D;  3P7K A;  3E1I A;  3MGN A;  4KT0 J;  1JUN A;  2K9Y A;  1VQM P;  3WMM 0;  4JBZ A;  4PD4 H;  1LTB C;  2OYI A;  2A06 G;  5GTH E;  2YO2 A;  1N73 A;  4N6J A;  1BSH A;  3U1A A;  1CSB A;  3LW5 H;  3QWO C;  3L70 J;  3MP7 B;  4C7N A;  3H1H G;  2WTY A;  3HTK A;  1M56 D;  3A0B E;  1HUC A;  1NVO A;  2WSE H;  1RE4 A;  5KLV G;  3SWF A;  1JMM A;  3L35 A;  3N4X A;  2BCC G;  3CC7 P;  1JM0 A;  1PPJ D;  3U1C A;  3JCU H;  2Q6Q A;  4Y99 C;  2AXT H;  1NWQ A;  2NPS C;  2LXB A;  2WPR A;  2E5Y A;  3V2Q A;  4OGQ C;  5AW6 B;  1L2P A;  2Y0C A;  3GG2 A;  4GDO A;  3OAK A;  1NH4 A;  1RQV A;  2ZVN B;  1LWU C;  4PV1 B;  1QL2 A;  1LP1 A;  2ZYA A;  1KD1 Q;  2Q9I A;  3B5N C;  2N1T D;  3GHG A;  3L71 D;  3GF3 A;  3S4R A;  1JY2 N;  1P84 D;  2BEQ D;  1JTH A;  2PP6 A;  5CCH C;  3PHL A;  1X9V A;  1FZC C;  2MKV A;  2A45 I;  5APW A;  2YKQ A;  3HD7 B;  1KFN A;  3ZDM A;  4EOT A;  1IK9 A;  1VPC A;  3V4W A;  3H1H J;  3WUT A;  2CPS A;  3H6P A;  5EFW B;  4LGD E;  1LTJ C;  1YI2 P;  1OW7 A;  5M1B A;  4LC1 A;  2YMK A;  2HG5 D;  5KLV J;  4L74 A;  2QJP C;  1KYO E;  3AE4 C;  1R8E A;  2BCC J;  3PJS K;  3CD6 P;  1NU1 E;  2WSF H;  2R3S A;  1R5S A;  3L37 A;  2WSC J;  1YQ3 C;  1LWU B;  2GUS A;  1SQX G;  1SFC C;  3F89 A;  2V7Q J;  1GD2 E;  5B5E E;  4DT0 A;  2R44 A;  3L74 D;  1G1I A;  4K3A A;  3CCS P;  1BE3 E;  1XTC C;  1J2J B;  1NKN A;  1NU1 K;  1KC8 Q;  1KYO I;  1GK6 A;  1H89 A;  5KJ7 C;  4M3L A;  3AE5 C;  3FWL A;  3CX5 D;  5CJ4 A;  1GU5 A;  1RF1 A;  4WY4 C;  3O8Z A;  4HJG H;  2N1T A;  1LT1 A;  4RES B;  1KTM A;  1CW5 A;  1YTZ I;  3P32 A;  2FXM A;  2HFE D;  2J58 A;  1SVF A;  3P8C E;  4XA4 A;  4ASV A;  4YXW H;  5APT A;  1AV1 A;  3L73 D;  3M9H A;  3M9B A;  1OXZ A;  1L4A D;  1YJN P;  2FXO A;  2D2C B;  1L0N G;  2K88 A;  1RQU A;  4N78 E;  2IDB A;  2AXC A;  1SQX J;  3MUD C;  1NTM G;  3M0A A;  3K5B A;  2JDI H;  4BRY A;  1K8A Q;  2YXQ B;  3L72 D;  4L73 A;  1GL2 C;  1PZQ A;  3H1L G;  4PV1 D;  4UB6 E;  1G2C B;  1BGY D;  1LTS C;  3L75 G;  2BAS A;  1YQ4 C;  5AW5 B;  2NRG A;  1L0L J;  1FDO A;  2B87 A;  3TGU G;  2XZR A;  2QJY C;  2ZYD A;  3FWN A;  3U59 A;  2KOG A;  3H1J G;  3G3Z A;  2N9B A;  3IFM A;  2Q1K A;  5AVR B;  1M8O B;  1WT6 A;  1PGJ A;  2Q5U A;  1FZE A;  1OX3 A;  2P67 A;  4H13 B;  2JWD A;  3MTU E;  2NPS D;  3L71 E;  3RL0 C;  1SQV D;  5CHX A;  2PFX A;  4HB1 A;  1P84 E;  2KXP B;  5GTI H;  3A0H E;  1ZR4 A;  2WPS A;  1NTM J;  4C7N B;  4N3Y B;  2YMY A;  1PP9 D;  3B5N D;  1FS0 E;  3KDP B;  1DD3 A;  3V2R A;  1YBK A;  4UB8 E;  1EXI A;  3OJA B;  5AVW B;  3L75 J;  1LT9 B;  1P84 I;  5CCG D;  2PRR A;  2DW3 A;  1NJI Q;  2V4H A;  3NTN A;  2B88 A;  1GMJ A;  3H1J J;  1VQP P;  1TU3 F;  4GOE A;  3KYQ A;  4U3F D;  1KQG B;  3H1I D;  5AW4 B;  2YO3 A;  1N8R Q;  3TDK A;  1VQ9 P;  3S9O A;  3D6Z A;  3CWB D;  1OVV A;  1JTH B;  4NPD A;  5TJH A;  3L74 E;  1ZW0 A;  1VQO P;  1AVY A;  1URQ C;  1SFC D;  3H1K G;  3RK2 B;  3L70 D;  2WT7 A;  4GKG A;  3FX0 A;  2OYH B;  3Q5S A;  3CX5 E;  1JMB A;  3AEF C;  2IZ1 A;  5AVQ B;  1VQK P;  3LW5 J;  2NPS A;  5KJ7 D;  4IOI H;  4YXD C;  2WSE J;  3H32 B;  2IYP A;  3L36 A;  5APS A;  1LWU A;  3C1L A;  4XFJ A;  1Q81 Q;  3L73 E;  3B5N A;  1SQP G;  1S4X A;  3CX5 I;  3NMD A;  2O1J A;  1EDL A;  5BVZ A;  4IL6 E;  1M1J C;  4A7P A;  3L4F A;  3HUS C;  3KZI E;  2R3C A;  3CXH H;  2HYN A;  5CCG A;  4HKZ H;  3AEB C;  3L72 E;  3R4Y A;  1GZL A;  2B9B A;  2A06 D;  1GW4 A;  2QM8 A;  2O01 H;  1BGY E;  2CPB A;  3H1K J;  1JNM A;  4IFF A;  1SQQ G;  5E79 E;  1GK4 A;  2ZJS E;  1J1E C;  1GL2 D;  1SLQ A;  4MN4 C;  1NU1 D;  3SSU A;  1MKM A;  2H43 A;  5H2F H;  2P7J A;  2ZVO B;  3AEE C;  2HR3 A;  2BCC D;  3E7K A;  2HOD B;  1P84 H;  1QL1 A;  3BCC D;  3QH9 A;  3I56 P;  1RHZ B;  3LID A;  3BRT B;  3HRN A;  1KOR A;  4IL6 X;  1EDI A;  1JY3 N;  4I1L A;  1IFJ A;  2Z5H A;  1BCC J;  1X79 B;  2K3R A;  2WSF J;  1SQP J;  1SQV E;  5K5G B;  3AE9 C;  1FBM A;  1SQB K;  4WB4 A;  3A7O A;  5KJ7 A;  1OFC X;  1EZV D;  1PP9 E;  4RO0 A;  4L75 A;  1U7M A;  3TK1 A;  2YKO A;  3A2A A;  4DZO A;  1LTI C;  4QMA A;  2Q3E A;  1FDI A;  3VP8 A;  1RY3 A;  2E74 C;  1VQ7 P;  2WSS H;  2B87 B;  1OMI A;  3ABV C;  3TF5 A;  4L76 A;  2QJK B;  1MZ9 A;  3A5T A;  1SQQ J;  3RK2 D;  1A02 F;  1CI6 A;  1HTL C;  2E43 A;  2Z5I A;  1N7L A;  1HJ0 A;  4GOD A;  1JCC A;  1RE3 C;  2KYV A;  1PV3 A;  2ZT9 C;  2L91 A;  2E76 C;  1M1K Q;  1T3J A;  3MUD A;  4U3F E;  3H1I E;  3NXS A;  4NPE A;  1QGK B;  3V2P A;  3CWB E;  1SQX D;  3D6Y A;  1OW8 A;  3CX5 H;  2FFD B;  3CCQ P;  2KI7 B;  1HH0 A;  1QVF O;  1N7S C;  2J5U A;  1USD A;  1H88 A;  3Q5P A;  2CK3 H;  1L4A B;  1ZLL A;  3L70 E;  4EYY Q;  1LGH B;  1L0L D;  1LT9 A;  1URQ D;  1OZH A;  4D6T D;  1AQT A;  2R5B A;  4IL6 H;  2I8D A;  2FYU G;  3M0D C;  3V5B A;  5KAI H;  3IF4 A;  3SWK A;  2GUV A;  3AE3 C;  1BE3 G;  2RMZ A;  2RH0 A;  1IFD A;  2JO1 A;  3VTP C;  1BDC A;  5E79 H;  1DEB A;  2WT7 B;  1DH3 A;  2JEE A;  2UWJ E;  2OYH A;  2L5G B;  1YTZ T;  2XV5 A;  3BAS A;  1PFI A;  2A06 E;  2FXP A;  2RN0 A;  3SFE C;  3RGU A;  4JQ0 D;  4Y99 B;  2NPS B;  3RBX A;  4OGQ B;  3VP9 A;  2Y0D A;  3CCV P;  5AW2 B;  5BU8 B;  2M5A B;  3H32 A;  4BWN A;  4KJM A;  2LXC B;  5APQ A;  4B86 A;  4DCK A;  4ZMD A;  3B5N B;  2BCC E;  4JPZ B;  2Z4E A;  2KZI A;  1KB9 H;  3BCC E;  3WUU A;  2W27 A;  5KAF H;  4YPC A;  1Y8A A;  2FYU J;  2FKW B;  2Q7C A;  5AVV B;  1JOC A;  1BE3 J;  5KLV K;  2RKL A;  1LTG C;  2IFN A;  1FZC B;  3G4S P;  3IR9 A;  1URQ A;  1Y47 A;  1S3J A;  3P8M C;  3O6Q B;  1FZG A;  4PD4 D;  1EZV E;  1LTJ B;  2J59 M;  2KLU A;  3VMZ A;  1PPJ G;  1K05 A;  2FBW C;  2QJP B;  1GW3 A;  3M9Q A;  2KK7 A;  5AVZ B;  3RK3 C;  1ZRT E;  4W80 A;  2W6A A;  2WPV B;  5GTH H;  2HOD A;  2O01 N;  1SFC B;  1USE A;  3R2P A;  4RJT A;  1HF9 A;  3VN0 A;  2JKV A;  3L71 G;  4EIJ A;  1EZV I;  3A0B H;  1M1J A;  4OVN F;  2JR8 A;  2QEX P;  3E1R A;  1SQX E;  1X0T A;  1S5L E;  5AVU B;  2OYI C;  1S1C X;  2E76 D;  1SS1 A;  1VQ5 P;  2P10 A;  4WY4 B;  1N73 C;  1IK7 A;  2A45 H;  1YJW P;  2MJZ A;  4JYB A;  1GDT A;  1EDJ A;  2M3B A;  1NYH A;  1SQX K;  5CBN A;  1IFP A;  1RF0 A;  1DD4 A;  1ZP0 C;  2QVA A;  1L0L E;  2W6J H;  1NHL A;  1OWA A;  1VL2 A;  1CI6 B;  1NTK G;  1T2K C;  1SQB D;  2O01 J;  1KN7 A;  1WRG A;  4D6T E;  1IZN B;  2Y9Z A;  3A3Y B;  1FZA A;  1KQS O;  3KHU A;  1KQL A;  3VOP A;  2H8P D;  2KLV A;  5TIS E;  4OGQ D;  1L0L K;  5AW8 B;  4ZKP A;  4WWI A;  1L0N J;  4O9B A;  3L71 J;  4GIF A;  1BCC D;  2FFD A;  1GL2 B;  1SQP D;  3PLN A;  3GHG C;  2KNC B;  1DIP A;  1J1D C;  1JCD A;  1FJP A;  1NTZ G;  3V4Q A;  5KLI C;  1KYO H;  4LLH A;  3H1L J;  1L4A A;  2KZJ A;  5CCH D;  1T8Z A;  2H88 C;  1FZB A;  1ZXG A;  1E5W A;  2QJY B;  4PJ0 E;  1VF5 C;  3TGU J;  5B5E H;  1NTM K;  3L73 G;  4H0L C;  4BXL A;  1YJ9 P;  2ZXX A;  3WU2 E;  4CPG A;  1VQ4 P;  1NTK J;  2M0B A;  3V2N A;  3VMX A;  4H44 C;  1D7M A;  3FXD A;  3RL0 B;  1S9K D;  1AA0 A;  4GOF A;  4R4M A;  3I5C A;  2IBZ D;  3KPE A;  1KV4 A;  1AJY A;  4DJG A;  3L72 G;  1NAF A;  4AUW A;  1BGY G;  1YYC A;  1KFM A;  1H0T A;  1NTZ J;  1KIL C;  4PD4 E;  3VYI A;  5CBO A;  1HGZ A;  3CME P;  4IFM A;  1RF1 C;  2M5A A;  1R5L A;  1ZOY C;  1T6A A;  1FE6 A;  2N1T C;  4WY4 D;  1SP4 A;  2IPP A;  4OWF A;  3GMA A;  1OVU A;  2E5T A;  1HGV A;  4ASW A;  3L73 J;  4UB6 H;  3V6I A;  3GW6 A;  2OTJ P;  3KQG A;  3ITK A;  2KSJ A;  2XKM A;  3IAO A;  1SQV G;  3W68 A;  4PD4 I;  4R4L A;  5CCH A;  1VQL P;  3JCU E;  2AXT E;  3CPW O;  1FZC A;  1URQ B;  1AQ5 A;  1LJ2 A;  1PP9 G;  1JY2 P;  3H25 A;  1VQ8 P;  1FJK A;  3O6Q A;  2QSI A;  1LTJ A;  3HE5 B;  2KS1 B;  1BGY J;  3H1H D;  4HYT B;  2K37 A;  2YIU C;  3C8V A;  3Q1M A;  3T97 B;  2KIK A;  5KLV D;  3BVH A;  1VQN P;  3CCJ P;  5TIS H;  2KUB A;  1SQB E;  1SFC A;  3A0H H;  1IC2 A;  4U3F G;  4EI2 A;  2ZXE B;  1HWT C;  3CWB G;  1M1J B;  4UB8 H;  1YHQ P;  3MZW B;  2FYU D;  3HUS B;  1SQV J;  1BCC E;  1Q82 Q;  2YKP A;  1SQP E;  1HVV A;  1M7L A;  3L70 G;  3RL0 D;  4WY4 A;  1HJB A;  2WMM A;  1OW6 A;  1Q2N A;  1QVG O;  1J1E B;  2WVR A;  1ZRT D;  2A45 G;  1MFT A;  1SQP K;  2G3A A;  2QRX A;  1RH5 B;  2ZAE B;  2K9J A;  2B89 A;  2QA4 P;  4Y28 J;  2ZFC A;  3BRV B;  5AW1 B;  5KKZ C;  2N9Y B;  2OTL P;  3CC4 P;  1K04 A;  4NPF X;  4U3F J;  1S9K E;  3WUV A;  5AW7 B;  1GL2 A;  3G6E P;  3CWB J;  4H0L D;  2KNC A;  2IBZ E;  2QIW A;  1SQQ K;  4ZNC A;  1IFN A;  4H44 D;  2WQY C;  1G1J A;  3F5H A;  3RBZ A;  5APU A;  2E74 B;  3GF7 A;  4KHX A;  3AEG C;  1W5C E;  1XTG B;  3II6 A;  3HD7 C;  1VDF A;  1NU1 G;  4I6M C;  3CXH D;  3AE1 C;  2PAJ A;  2IBZ I;  3B8E B;  1EDK A;  2JJL A;  1Q86 Q;  2FYN C;  5DJT B;  3BCC G;  2FYZ A;  2ZT9 B;  3KZI H;  3CMA P;  1KIL D;  1X8Y A;  2E76 B;  2W90 A;  5KKZ B;  1U57 A;  4I2L C;  2FY8 A;  2LR2 A;  4JYC A;  2POH A;  1L0N D;  3RK3 E;  3CCU P;  1DEE G;  3BAT A;  1NTM D;  3NFQ A;  2XU6 A;  1N7S B;  1JY3 O;  3G9R A;  1PGO A;  3I55 P;  1EZV G;  3M91 A;  4JF7 A;  3PTZ A;  5DJU B;  1H0T B;  1ZV8 A;  3H1L D;  3HE4 A;  1E79 H;  3CCR P;  5CCG C;  1FZF A;  2IZ0 A;  4TLF A;  3H1H E;  1EQ7 A;  3L75 D;  1M57 D;  5GTI E;  1IFM A;  1K73 Q;  1PIX A;  4Z1M H;  4I7Z C;  2OQQ A;  5KLV E;  1NU1 J;  1W2B O;  4W7Y A;  2FYN B;  2C0W A;  3TGU D;  2E42 A;  3H1J D;  2IYO A;  1UIX A;  1NTK D;  3D71 A;  3TNU B;  2WZ7 A;  3BCC J;  3AE6 C;  2D2C C;  2W83 C;  2FYU E;  1S72 P;  2WPQ A;  3TSI A;  2PGD A;  2R32 A;  5APY A;  1QX8 A;  5B66 E;  2C0X A;  1T3U A;  1FDM A;  1MUU A;  3HE5 A;  2KS1 A;  2W6B A;  1KIL A;  3EFF K;  3CL3 D;  1FU1 A;  3M06 A;  1L0L G;  2P58 A;  1UII A;  1MFZ A;  1NTZ D;  2FYU K;  1EC5 A;  2LKM A;  3EWK A;  2P2U A;  3T97 A;  4AYC A;  3CCL P;  2QM7 A;  4D6T G;  1AFO A;  3Q2Y A;  4I7Z B;  4WVZ A;  4IFD K;  5AVS B;  2E74 D;  3CC2 P;  2XND H;  2WWW A;  1N86 A;  1Z56 A;  5AW0 B;  2VRS A;  2OYO A;  3HUS A;  3TYY A;  3PRJ A;  4H13 C;  5AVT B;  1HBW A;  1IO4 A;  1JY2 O;  3C9I A;  2JP3 A;  3VMY A;  2ZT9 D;  3B71 A;  2WIT A;  3MIW A;  2OGU A;  3AE8 C;  5AVY B;  1PGQ A;  4K35 A;  2AEM A;  2E75 C;  3H1K D;  3Q3D A;  2I1J A;  1ZN5 A;  2QE7 H;  2M3E A;  1RE4 C;  3RK3 B;  3MHV A;  3AEC C;  1N7S D;  3CI9 A;  3CXH E;  1NO4 A;  3FGA D;  2K9J B;  4OH8 B;  3PP5 A;  3AEA C;  1KMI Z;  2HPC B;  3FXE A;  1LT9 C;  4D6T J;  1BDD A;  5CJ0 A;  1PPJ E;  2M8R A;  3UIA A;  3HD7 D;  1PGP A;  3L74 G;  1KIL E;  3G71 P;  1GTW A;  4RKU J;  1DX7 A;  2K1A A;  4DOJ A;  1S5L X;  1IJD B;  1JO5 A;  1Q7Y Q;  5H2F E;  1L0N E;  2OTK E;  2YNY A;  2I1K A;  3CXH I;  3OW2 O;  2OYI B;  1OVR A;  1JY3 P;  1U7J A;  1BSN A;  2HLO A;  1NTM E;  1KB9 D;  1N73 B;  2GM4 A;  3S1K A;  1JB0 J;  2E75 B;  5APV A;  1FOS E;  3IN6 A;  2C9N Y;  1FAV A;  3HTK B;  3RL0 g;  2O3J A;  3H1L E;  3RK2 C;  1PL5 A;  1L0N K;  3SFD C;  4ZKU A;  2OYH C;  2KSE A; 
#chains in the Genus database with same CATH homology
 2YXQ B;  3MP7 B;  2YXR B;  1RH5 B;  1RHZ B;  3JC2 2; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...