3JC22

The structure of the mammalian sec61 channel opened by a signal sequence
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
62
structure length
62
Chain Sequence
FVEPSRQFVKDSIRLVKRCTKPDRKEFQKIAMATAIGFAIMGFIGFFVKLIHIPINNIIVGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein transport protein Sec61 subunit alpha isoform 1
publication title Structure of the Sec61 channel opened by a signal sequence.
pubmed doi rcsb
source organism Bos taurus
molecule tags Transport protein
total genus 11
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2015-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00584 SecE SecE/Sec61-gamma subunits of protein translocation complex
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.820 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Preprotein translocase SecE subunit 3jc2200
1RH5B 3MP7B 3JC22 2YXRB 2YXQB 1RHZB
chains in the Genus database with same CATH superfamily
3TYYA 1CI6A 1P84E 2B9BA 1Y47A 5KTBA 3B5NA 1PGQA 1L4AB 2QJKB 3RK3C 1N73B 2R32A 1LTBC 1SQBK 1OXZA 3ABVC 1VQOP 1NTKK 3L73J 3IF4A 1KTMA 1R8EA 3L73G 4Z1MH 1RF0A 2V7QJ 2KS1B 1BGYE 3WUVA 2WZ7A 1IFIA 2YMKA 1SFCD 1NU1J 1FZEA 2IX7C 1URQD 2E74B 2M8RA 4AUWA 1NU1G 1FU1A 2N1TD 4I7ZC 4RKUJ 3O8ZA 1YITP 3L37A 2FYNB 1J1DC 3HUSB 3AE6C 4H13C 3A0HE 1L4AA 3HD7B 1NKNA 2FBWC 3QH9A 5CMZA 2H88C 2L91A 3R2PA 3LIEA 1VQ8P 2G3AA 4DZOA 3AE5C 1LWUA 1JEKA 1KILE 2HODB 1VQMP 1SQBE 2KS1A 3USSA 1SQXJ 1NTKE 2OQQA 1RF1B 4ZKPA 2AEFA 1SQXG 1K05A 2O01J 2ZT9C 5AW5B 2OYHA 3L4FA 5B66H 2YKPA 1SQPJ 2IDBA 2K1AA 1AV1A 1SQPG 2KZJA 4AQRD 1M1JB 1ZOYC 1T2KC 2N9BA 1JB0J 3H1IJ 3JC22 3H1IG 1L4AC 1Y9BA 1S5LE 2RKLA 3RL0B 2OYIB 2KP8A 1GK4A 3B71A 4OVNF 2WT7B 3U1AA 3AE7C 3CPWO 4UB6E 1GW3A 3MUDA 1LWUC 1GTWA 1KMIZ 1JCCA 3KHUA 1KC8Q 3H1KD 3CCUP 3TNUB 1JMBA 1BE3J 1RH5B 2ZFCA 1N7SD 1BSHA 2L5GB 3WMM0 3NFQA 1ZMEC 1BE3G 3T97A 1NTMD 3TF5A 1EQ7A 4WY4B 2E74C 1YJWP 1Y8AA 3L70E 2KXPB 2FYNC 2Q9IA 3SWKA 2HPCB 2AXCA 3EFGA 1HH0A 3H1LE 3HD7C 1EDKA 1MV8A 5CCHD 3HTKB 2WPSA 1L0NJ 2RN0A 2LXCB 1SVFA 1KQGB 2IFMA 3N7NA 1L0NG 1T8ZA 3VP8A 1ZRTD 3KQGA 3AE3C 1RF1C 1LTTC 3Q5RA 2QM7A 2YXRB 4K3AA 2AEMA 1CSBA 1AVYA 3E7KA 4BRYB 1J1EB 1X0TA 3BVHA 2HPCA 1BSNA 4JYCA 2LR2A 2POHA 2HFED 2A06G 2WSEH 3WU2E 1ZXGA 1SQVE 3H1JD 5AVUB 1Q81Q 1H88A 3MGNA 1IZNB 2GUSA 3AE8C 1KB9I 2Z4EA 2P10A 3SWYA 2O1KA 1DEEG 3RL0C 5BU8B 2OYIC 3SSUA 1IJDB 2E42A 1OFCX 2WTYA 1G1IA 3V6IA 2NPSB 1N7LA 3JCUH 2D2CB 3NTNA 4IFFA 1TU3F 1VQLP 1NAFA 2P67A 2VRSA 2JR8A 3VMYA 4WY4C 1S4XA 3VOPA 2QEXP 3GF3A 2H8PD 3H1KE 1VQPP 1G2CA 1JY2N 4PV1D 1KB9H 3AE9C 2O01H 2WMMA 3GF7A 4U3FD 1FZFA 1LT9B 3FXDA 4U7JA 4IFDK 3HE4A 3G71P 4NPDA 5KAFH 2WQYC 3RBZA 1IK7A 3P8MC 4ZNCA 1FZAA 1NTZJ 4LGDE 4Y99C 5APQA 1VQ6P 1NTZG 3KZIH 3L75E 1UIXA 1BCCD 2WITA 2C0XA 3RK2B 2QE7H 1J1EC 5B66E 1NAYA 2ZYDA 1GL2D 1LT9A 2QG4A 2FFDB 2GM4A 3V2RA 4IL6H 2WSFJ 5KLVD 2IYOA 4OGQD 4XA4A 4C7NB 5CJ0A 1SQQK 3VMZA 3S1KA 2JWAA 2E76B 3L72D 3H1JE 2R44A 4TT3H 4H0LB 5AW9B 3HE5A 1VQKP 3OJAB 2UWJE 3U1CA 2NPSC 1T6AA 3RL0g 1X22A 3G3ZA 2I1JA 3N4XA 3PTZA 2MJZA 4JBZA 1EXIA 2JDIH 4M3LA 4B86A 2BEQD 3PHLA 5KLIB 4EDFA 1K73Q 4JQ0D 1IC2A 1EZVG 4NPFX 1PGJA 1NHLA 2ZXXA 1LT9C 3GMAA 5CCGA 1YJNP 2CK3H 3IFMA 2ITAA 2PRRA 4GOEA 4PD4I 2W6BA 3FWLA 1SQQE 2KLUA 4DT0A 1JY2P 1ZV8A 3OAKA 1OZHA 1FZBA 2QM8A 4YPCA 4U3FE 2Q3EA 1M8OB 2J59M 5DJUB 2XNDH 3CMAP 5KJ7C 1H0TA 3BRVB 1S1CX 1U7JA 3RK2C 3CCVP 3F5HA 1M7LA 2FFDC 3TDKA 2N9YB 5BVZA 1JTHA 4PD4H 1RQUA 5CBOA 1BCCE 1SS1A 3S4RA 4RO0A 3VMAA 1EDLA 5AW1B 1SFCA 1PPJG 4L73A 2E76C 2GA1A 1S5LX 2Y0DA 1M1KQ 4PJ0H 1S72P 1BDCA 1CI6B 1GDTA 2R3SA 4H0LC 5AW3B 3WUTA 1WRGA 2IPPA 2WWWA 1HJBA 1HGVA 2C0WA 3B5NB 3JCUE 1X9VA 3CWBJ 2WPQA 4L75A 2IYPA 2ZJSE 3H1HD 5AVZB 3CWBG 3A3YB 3TGUJ 1FS0E 1KFMA 1KB9E 5KLIC 3TGUG 1VL2A 3A0BH 1ZR4A 3AEAC 1AQTA 3L36A 3D6ZA 4DJGA 5B5EH 5KAFE 1L0LD 3M91A 3PP5A 4H44D 2FYUD 3GW6A 1EZVI 4R4MA 2FY8A 2E5TA 1LWUB 3KZIE 3VN0A 4PD4D 3L70D 1IFMA 2FXPA 2HYNA 4NPEA 4DOJA 3MP7B 1QX8A 5AW4B 1EXJA 4CPGA 2DW3A 1OWAA 3H1LD 1ZP0C 4IL6E 3CC7P 1BE3E 2E5YA 3AEEC 3B8EB 1GD2E 2OTLP 2OYHB 3Q2YA 1N7SA 1HGZA 1RHZB 2Q6QA 3NXSA 4JPZB 3VTPC 1PP9D 1JNMA 4L76A 3IN6A 1KYOI 3RK3D 1LTSC 1OW8A 1VDFA 2J58A 1FOSE 5CBNA 1G1JA 4R4LA 5CCHA 1RY3A 4EIJA 3B5NC 3S9OA 1L0LK 1L0NE 2FYUK 2SPZA 1SQVD 4LLHA 2IBZG 2YKOA 4LC1A 1HUCA 1RF0C 2IZ0A 2A45I 2KUBA 2O01N 4H13D 3T97B 1N8RQ 1K9MQ 4RESB 2Z5HA 3H1HE 2W6AA 3H6PA 3L74J 1N7SC 1A02F 5APXA 3AE2C 3L74G 3FGAD 1YTZI 2XKMA 1JOCA 1MFZA 2FKWB 1IFJA 5AW7B 4YXWH 5K5GB 1L0LE 3BCCD 1AA0A 2ZT9D 2FYUE 3G9RA 4GDOA 2A45H 2BCCJ 1PIXA 5BU5A 1BGYJ 2WVRA 2BCCG 4N78D 1GK6A 3PRJA 3VP9A 4PD4E 1SQVK 1BGYG 1T2KD 3M0AA 2OYHC 3CXHI 2ZAEB 1XTCC 2R5DA 2ZVOB 1L4AD 4EI2A 4PJ0E 2XDJA 4JF7A 1NYHA 3L75D 1MZ9A 2E43A 1OVUA 1PP9E 4Y28J 1WMKA 4Y99B 3RK3E 2HLOA 1SQBJ 1NTKJ 3MUDC 1SQBG 2E74D 2E75B 2NRGA 1NTKG 1OMIA 1VQ9P 2KNCA 4GIFA 3CXHH 3MZWB 2MKVA 2XV5A 4WBAA 3A0BE 2V7QH 4D6TJ 1OW7A 2WSCJ 3HD7D 3H32B 3QWOC 4BWNA 2YXQB 4D6TG 3M0DA 5B5EE 3EFFK 1G2CB 1GL2A 2IBZI 1PL5A 1USDA 3P32A 2Y9ZA 2JKVA 4HYTB 1ZN5A 3CCJP 3L71J 1AVOA 2FYZA 1GU5A 3HE4B 2H43A 3K5BA 1S9KD 2BASA 3L71G 2PP6A 2XU6A 2K9YA 3PLNA 1IFDA 3NMDA 3H32A 5TISH 3D6YA 2ZYGA 1SQQD 3BCCE 1LTJA 2HG5D 1K8AQ 2ZXEB 3AEDC 1HBWA 2FXMA 1EZVE 2WPVB 4N78E 4I1LA 3RL0D 3BATA 4W7ZA 5APWA 3Q5SA 2Q5UA 3GHGA 1FAVA 1S2EA 3L73D 4OGQC 4K35A 5AVYB 2YKQA 1KILB 3HE5B 3CD6P 4WY4D 3V2QA 4EYYQ 1NU1D 2E75C 1GU4A 1NGMB 2LKMA 4AYCA 3MTUE 1HF9A 1FJPA 2IZ1A 3BRTB 1GZLA 1VF5B 4YXDC 3LW5J 2FXOA 2P1JA 1LNQA 1DH3A 2HR3A 3CCRP 1KILA 1Q90D 1ZLLA 3CX5I 1SQXD 2M3EA 4L74A 1RE3A 1GMJA 3CL3D 1X79B 1NVOA 1M90Q 1FZCB 1FDIA 1KB9D 1LP1A 3CCSP 1NKZB 3C1LA 2M0BA 3M9BA 1S9KE 4A7PA 1SLQA 4IL6X 1QL2A 2KZIA 2BEZF 1SQPD 1H0TB 1KQSO 3CWBE 3ZDMA 1QGKB 4HKZH 2JO1A 3I5CA 1KZUB 4EOTA 1YJ9P 2YIUB 2R3CA 1NU1K 2AEJA 3H1KJ 3O6QA 1IFNA 3H1ID 1DD3A 3H1KG 3HRNA 1IK9A 1JTHB 3CX5H 1XTGB 2PGDA 1NTMJ 1RE4A 1LTIC 1SFCB 1NTMG 1FZCA 4UB8H 1URQB 4JYBA 1FJKA 2N1TB 2NPSD 2D2CD 1Q7YQ 1KILC 1BE3D 1R5LA 4GT1A 5DJTB 2YO3A 1KORA 2H89C 1SQXK 4W7YA 3L73E 3CXHE 2Q3IA 1X8YA 1FE6A 1S3JA 3G6EP 1T3UA 1J2JB 2KSEA 5E79H 1VF5C 1NU1E 2H7HA 4HH2A 1SQPK 2OGUA 1CW5A 1MKMA 2M5AA 2V4HA 3I56P 1URQA 5APSA 2N1TA 1L0ND 5CCGC 1JM0A 3E1RA 1JY2O 3H25A 2QJPB 3H1JJ 2PFXA 5AW2B 5KJ7D 1T3JA 3H1JG 1FZCC 4BXLA 3RK2D 3W67A 3CCMP 1PGOA 2A06D 1SQXE 5TISE 5H2FH 2Y0EA 1LJ2A 1NH4A 2XNXA 2W27A 2YIUC 2Z5IA 1QLED 2OARA 4W80A 2E76D 1SQPE 5AW8B 2B87B 5APUA 1KD1Q 4N6JA 1N7SB 3SFEC 4H0LD 2JP3A 2KSJA 2WSFH 1JO5A 1SFCC 1URQC 2N1TC 3L74E 3SWFA 3H1IE 3D71A 4OWFA 3A5TA 5KKZB 4U3FJ 1L0NK 4O9BA 4ZKUA 4U3FG 2R5BA 2JWDA 5KAIH 1HVVA 2GUVA 3M9HA 4I2LC 3Q1MA 2WSSH 2K9JA 2W8ZA 1L2PA 2B87A 2P58A 3P7KA 1Q2NA 1YTZT 2WSEJ 2KI7B 1N86A 2BCCE 1EDIA 1PFIA 1YYCA 1BCCJ 1BCCG 2W83C 1NTZD 2QJPC 1MUUA 1AQ5A 5KLVJ 1JCDA 3A7OA 2W90A 3CI9A 3GG2A 5KLVG 1N73A 2CPBA 1E79H 2KB7P 3V2PA 1Z56A 1YQ4C 3L72J 1KFNA 3L72G 1W5CE 2ZYAA 3KPEA 1YIJP 4C46A 2PAJA 2Q7CA 3AE4C 2A06E 4IOIH 1KYOH 3CC2P 3CX5E 3HUSA 5CJ4A 4D6TE 2B89A 4C7RA 3HD7A 4UB8E 4KT0J 3FX0A 3B5ND 2P7JA 1EDJA 1GW4A 1A02J 4PV1B 5KKZC 1OVRA 2J5UA 1KQLA 1NJIQ 1H8AA 3L71E 2HODA 1KN7A 3AEGC 4WB4A 1WT6A 5CCHC 1NTZK 2KK7A 3MIWA 1Q82Q 2QJKC 1RF1A 1N73C 3UIAA 1EZVD 4GODA 3V4WA 5E79E 1W2EA 2KNCB 4ZMDA 3Q3DA 5AVRB 2K88A 4QMAA 3RGUA 1E5WA 3P8CD 3AEFC 3F89A 4IFMA 1M1JA 3IR9A 1FOSF 1GL2B 3HUSC 3C9IA 1PZQA 3PJSK 2WPRA 1NOHA 1QVFO 1OW6A 4OGQB 2OYIA 3M9QA 5APTA 5GTIH 1EC5A 2WT7A 3PH0A 1FZGA 1W2BO 3JSVC 1KYOD 1YBKA 3CLQA 1NTZE 5H2FE 1N2DC 3TNUA 1OIPA 2C9LY 1QEXA 2K37A 1PPJD 3AE1C 4WY4A 2QVAA 1OX3A 3TSIA 3SFDC 1USEA 1LTJB 2QIWA 5TJHA 3BASA 3H1HJ 3W68A 3OA7A 3H1HG 3HTKA 3OW2O 5APYA 5AVTB 1M1JC 1NTMK 4PV1C 3GLMA 1FC2C 3CWBD 1KV4A 3GHGB 5KAIE 4GOFA 3FXEA 2NZ2A 2M3BA 1L0LJ 4XE5B 1P84I 3TGUD 2FYUJ 2KIKA 3L35A 1L0LG 4ASWA 2FYUG 2CPSA 2B88A 4BRYA 3LIDA 1VQNP 5GTHH 1JMMA 1QL1A 3CCQP 2O3JA 1IO4A 3CCEP 2AXTH 3L70J 2W6JH 2YNYA 1AJYA 1YHQP 2I1KA 1KQFB 1CZQA 5CHXA 3L70G 3FWNA 5APVA 3H1LJ 3MD0A 1LTGC 3M0DC 3D70A 1GL2C 3H1LG 2QA4P 1DD4A 3VYIA 5M1BA 3CXHD 3P8CE 1JY3N 1NTME 1LGHB 2QJYB 3ITKA 1DIPA 3E1IA 4RJTA 1P84H 3V2NA 4WWIA 2JJLA 3II6A 4I6MC 1PP9J 5AW0B 1YI2P 3AEBC 1PP9G 3IAOA 2NPSA 2YMYA 1LP1B 1NO4A 1AFOA 1U7MA 1HJ0A 1R5SA 3WUUA 4KHXA 5AVSB 1KYOE 1U57A 3M06A 1LTJC 1VQ4P 1SQVJ 1ZW0A 1D7MA 1ZRTE 1M56D 3CC4P 1SQVG 3KDPB 3O6QB 1PPJE 3KYQA 3CMEP 2K3RA 2LXBA 3TK1A 4TLFA 4ASVA 3U59A 2JEEA 2OTKE 2KYVA 4WVZA 4XFJA 3V5BA 1FBMA 3A0HH 2E75D 2IBZD 3GHGC 1HTLC 4HB1A 5KJ7A 2Q1KA 3B4SA 4H44B 2QRXA 3RBXA 4OH8B 1H89A 1DEBA 2D2CC 5AVXB 2FFDA 3BCCJ 3TGUE 3L74D 1VQ5P 3BCCG 2RH0A 1JUNA 1NWQA 5C39A 1P84D 4C7NA 3VMXA 2WSCH 5L8RJ 3EWKA 2M5AB 4DCKA 2O1JA 1LTAC 2QJYC 5GTIE 1FDMA 4MN4C 5KLVK 1PGPA 5AW6B 2BCCD 4KJMA 1RE3C 1M57D 1BGYD 2KLVA 3RK3B 1S5LH 3L75J 1JY3P 1BDDA 4UB6H 3L75G 2IFNA 3EQ2A 5AVWB 1VQ7P 1YQ3C 1MFTA 3V4QA 3AECC 1K04A 4I7ZB 1ZR2A 3Q5PA 5EFWB 1J1DB 2XZRA 2ZVNB 2Y9YA 3A2AA 1KILD 1RE4C 2P2UA 4H13B 3G4SP 2QSIA 1SQBD 3C8VA 1PV3A 2OTJP 1IFPA 4HJGH 1NTKD 2RMZA 1QVGO 2C9NY 2YO2A 5KLVE 1LT1A 2G8YA 1SP4A 1RQVA 1FDOA 4H44C 2KOGA 3CX5D 4YTPC 1VF5D 4D6TD 5GTHE 3CCLP 1JY3O 2A45G 2IBZE 3L72E 2Y0CA 3MHVA 3KXDA 5AVQB 4N3YB 2K9JB 2AXTE 3R4YA 3I55P 1DX7A 2ZT9B 5CCGD 1OVVA 5AVVB 3L71D 1UIIA 1SQQJ 2I8DA 3WU2H 1VPCA 4GKGA 1HWTC 3LW5H 1SQQG 1Q86Q 2OYOA
chains in the Genus database with same CATH topology
1RH5B 3MP7B 3JC22 2YXRB 2YXQB 1RHZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RH5 B;  3MP7 B;  3JC2 2;  2YXR B;  2YXQ B;  1RHZ B; 
#chains in the Genus database with same CATH topology
 3TYY A;  1CI6 A;  1P84 E;  2B9B A;  1Y47 A;  5KTB A;  3B5N A;  1PGQ A;  1L4A B;  2QJK B;  3RK3 C;  1N73 B;  2R32 A;  1LTB C;  1SQB K;  1OXZ A;  3ABV C;  1VQO P;  1NTK K;  3L73 J;  3IF4 A;  1KTM A;  1R8E A;  3L73 G;  4Z1M H;  1RF0 A;  2V7Q J;  2KS1 B;  1BGY E;  3WUV A;  2WZ7 A;  1IFI A;  2YMK A;  1SFC D;  1NU1 J;  1FZE A;  2IX7 C;  1URQ D;  2E74 B;  2M8R A;  4AUW A;  1NU1 G;  1FU1 A;  2N1T D;  4I7Z C;  4RKU J;  3O8Z A;  1YIT P;  3L37 A;  2FYN B;  1J1D C;  3HUS B;  3AE6 C;  4H13 C;  3A0H E;  1L4A A;  3HD7 B;  1NKN A;  2FBW C;  3QH9 A;  5CMZ A;  2H88 C;  2L91 A;  3R2P A;  3LIE A;  1VQ8 P;  2G3A A;  4DZO A;  3AE5 C;  1LWU A;  1JEK A;  1KIL E;  2HOD B;  1VQM P;  1SQB E;  2KS1 A;  3USS A;  1SQX J;  1NTK E;  2OQQ A;  1RF1 B;  4ZKP A;  2AEF A;  1SQX G;  1K05 A;  2O01 J;  2ZT9 C;  5AW5 B;  2OYH A;  3L4F A;  5B66 H;  2YKP A;  1SQP J;  2IDB A;  2K1A A;  1AV1 A;  1SQP G;  2KZJ A;  4AQR D;  1M1J B;  1ZOY C;  1T2K C;  2N9B A;  1JB0 J;  3H1I J;  3JC2 2;  3H1I G;  1L4A C;  1Y9B A;  1S5L E;  2RKL A;  3RL0 B;  2OYI B;  2KP8 A;  1GK4 A;  3B71 A;  4OVN F;  2WT7 B;  3U1A A;  3AE7 C;  3CPW O;  4UB6 E;  1GW3 A;  3MUD A;  1LWU C;  1GTW A;  1KMI Z;  1JCC A;  3KHU A;  1KC8 Q;  3H1K D;  3CCU P;  3TNU B;  1JMB A;  1BE3 J;  1RH5 B;  2ZFC A;  1N7S D;  1BSH A;  2L5G B;  3WMM 0;  3NFQ A;  1ZME C;  1BE3 G;  3T97 A;  1NTM D;  3TF5 A;  1EQ7 A;  4WY4 B;  2E74 C;  1YJW P;  1Y8A A;  3L70 E;  2KXP B;  2FYN C;  2Q9I A;  3SWK A;  2HPC B;  2AXC A;  3EFG A;  1HH0 A;  3H1L E;  3HD7 C;  1EDK A;  1MV8 A;  5CCH D;  3HTK B;  2WPS A;  1L0N J;  2RN0 A;  2LXC B;  1SVF A;  1KQG B;  2IFM A;  3N7N A;  1L0N G;  1T8Z A;  3VP8 A;  1ZRT D;  3KQG A;  3AE3 C;  1RF1 C;  1LTT C;  3Q5R A;  2QM7 A;  2YXR B;  4K3A A;  2AEM A;  1CSB A;  1AVY A;  3E7K A;  4BRY B;  1J1E B;  1X0T A;  3BVH A;  2HPC A;  1BSN A;  4JYC A;  2LR2 A;  2POH A;  2HFE D;  2A06 G;  2WSE H;  3WU2 E;  1ZXG A;  1SQV E;  3H1J D;  5AVU B;  1Q81 Q;  1H88 A;  3MGN A;  1IZN B;  2GUS A;  3AE8 C;  1KB9 I;  2Z4E A;  2P10 A;  3SWY A;  2O1K A;  1DEE G;  3RL0 C;  5BU8 B;  2OYI C;  3SSU A;  1IJD B;  2E42 A;  1OFC X;  2WTY A;  1G1I A;  3V6I A;  2NPS B;  1N7L A;  3JCU H;  2D2C B;  3NTN A;  4IFF A;  1TU3 F;  1VQL P;  1NAF A;  2P67 A;  2VRS A;  2JR8 A;  3VMY A;  4WY4 C;  1S4X A;  3VOP A;  2QEX P;  3GF3 A;  2H8P D;  3H1K E;  1VQP P;  1G2C A;  1JY2 N;  4PV1 D;  1KB9 H;  3AE9 C;  2O01 H;  2WMM A;  3GF7 A;  4U3F D;  1FZF A;  1LT9 B;  3FXD A;  4U7J A;  4IFD K;  3HE4 A;  3G71 P;  4NPD A;  5KAF H;  2WQY C;  3RBZ A;  1IK7 A;  3P8M C;  4ZNC A;  1FZA A;  1NTZ J;  4LGD E;  4Y99 C;  5APQ A;  1VQ6 P;  1NTZ G;  3KZI H;  3L75 E;  1UIX A;  1BCC D;  2WIT A;  2C0X A;  3RK2 B;  2QE7 H;  1J1E C;  5B66 E;  1NAY A;  2ZYD A;  1GL2 D;  1LT9 A;  2QG4 A;  2FFD B;  2GM4 A;  3V2R A;  4IL6 H;  2WSF J;  5KLV D;  2IYO A;  4OGQ D;  4XA4 A;  4C7N B;  5CJ0 A;  1SQQ K;  3VMZ A;  3S1K A;  2JWA A;  2E76 B;  3L72 D;  3H1J E;  2R44 A;  4TT3 H;  4H0L B;  5AW9 B;  3HE5 A;  1VQK P;  3OJA B;  2UWJ E;  3U1C A;  2NPS C;  1T6A A;  3RL0 g;  1X22 A;  3G3Z A;  2I1J A;  3N4X A;  3PTZ A;  2MJZ A;  4JBZ A;  1EXI A;  2JDI H;  4M3L A;  4B86 A;  2BEQ D;  3PHL A;  5KLI B;  4EDF A;  1K73 Q;  4JQ0 D;  1IC2 A;  1EZV G;  4NPF X;  1PGJ A;  1NHL A;  2ZXX A;  1LT9 C;  3GMA A;  5CCG A;  1YJN P;  2CK3 H;  3IFM A;  2ITA A;  2PRR A;  4GOE A;  4PD4 I;  2W6B A;  3FWL A;  1SQQ E;  2KLU A;  4DT0 A;  1JY2 P;  1ZV8 A;  3OAK A;  1OZH A;  1FZB A;  2QM8 A;  4YPC A;  4U3F E;  2Q3E A;  1M8O B;  2J59 M;  5DJU B;  2XND H;  3CMA P;  5KJ7 C;  1H0T A;  3BRV B;  1S1C X;  1U7J A;  3RK2 C;  3CCV P;  3F5H A;  1M7L A;  2FFD C;  3TDK A;  2N9Y B;  5BVZ A;  1JTH A;  4PD4 H;  1RQU A;  5CBO A;  1BCC E;  1SS1 A;  3S4R A;  4RO0 A;  3VMA A;  1EDL A;  5AW1 B;  1SFC A;  1PPJ G;  4L73 A;  2E76 C;  2GA1 A;  1S5L X;  2Y0D A;  1M1K Q;  4PJ0 H;  1S72 P;  1BDC A;  1CI6 B;  1GDT A;  2R3S A;  4H0L C;  5AW3 B;  3WUT A;  1WRG A;  2IPP A;  2WWW A;  1HJB A;  1HGV A;  2C0W A;  3B5N B;  3JCU E;  1X9V A;  3CWB J;  2WPQ A;  4L75 A;  2IYP A;  2ZJS E;  3H1H D;  5AVZ B;  3CWB G;  3A3Y B;  3TGU J;  1FS0 E;  1KFM A;  1KB9 E;  5KLI C;  3TGU G;  1VL2 A;  3A0B H;  1ZR4 A;  3AEA C;  1AQT A;  3L36 A;  3D6Z A;  4DJG A;  5B5E H;  5KAF E;  1L0L D;  3M91 A;  3PP5 A;  4H44 D;  2FYU D;  3GW6 A;  1EZV I;  4R4M A;  2FY8 A;  2E5T A;  1LWU B;  3KZI E;  3VN0 A;  4PD4 D;  3L70 D;  1IFM A;  2FXP A;  2HYN A;  4NPE A;  4DOJ A;  3MP7 B;  1QX8 A;  5AW4 B;  1EXJ A;  4CPG A;  2DW3 A;  1OWA A;  3H1L D;  1ZP0 C;  4IL6 E;  3CC7 P;  1BE3 E;  2E5Y A;  3AEE C;  3B8E B;  1GD2 E;  2OTL P;  2OYH B;  3Q2Y A;  1N7S A;  1HGZ A;  1RHZ B;  2Q6Q A;  3NXS A;  4JPZ B;  3VTP C;  1PP9 D;  1JNM A;  4L76 A;  3IN6 A;  1KYO I;  3RK3 D;  1LTS C;  1OW8 A;  1VDF A;  2J58 A;  1FOS E;  5CBN A;  1G1J A;  4R4L A;  5CCH A;  1RY3 A;  4EIJ A;  3B5N C;  3S9O A;  1L0L K;  1L0N E;  2FYU K;  2SPZ A;  1SQV D;  4LLH A;  2IBZ G;  2YKO A;  4LC1 A;  1HUC A;  1RF0 C;  2IZ0 A;  2A45 I;  2KUB A;  2O01 N;  4H13 D;  3T97 B;  1N8R Q;  1K9M Q;  4RES B;  2Z5H A;  3H1H E;  2W6A A;  3H6P A;  3L74 J;  1N7S C;  1A02 F;  5APX A;  3AE2 C;  3L74 G;  3FGA D;  1YTZ I;  2XKM A;  1JOC A;  1MFZ A;  2FKW B;  1IFJ A;  5AW7 B;  4YXW H;  5K5G B;  1L0L E;  3BCC D;  1AA0 A;  2ZT9 D;  2FYU E;  3G9R A;  4GDO A;  2A45 H;  2BCC J;  1PIX A;  5BU5 A;  1BGY J;  2WVR A;  2BCC G;  4N78 D;  1GK6 A;  3PRJ A;  3VP9 A;  4PD4 E;  1SQV K;  1BGY G;  1T2K D;  3M0A A;  2OYH C;  3CXH I;  2ZAE B;  1XTC C;  2R5D A;  2ZVO B;  1L4A D;  4EI2 A;  4PJ0 E;  2XDJ A;  4JF7 A;  1NYH A;  3L75 D;  1MZ9 A;  2E43 A;  1OVU A;  1PP9 E;  4Y28 J;  1WMK A;  4Y99 B;  3RK3 E;  2HLO A;  1SQB J;  1NTK J;  3MUD C;  1SQB G;  2E74 D;  2E75 B;  2NRG A;  1NTK G;  1OMI A;  1VQ9 P;  2KNC A;  4GIF A;  3CXH H;  3MZW B;  2MKV A;  2XV5 A;  4WBA A;  3A0B E;  2V7Q H;  4D6T J;  1OW7 A;  2WSC J;  3HD7 D;  3H32 B;  3QWO C;  4BWN A;  2YXQ B;  4D6T G;  3M0D A;  5B5E E;  3EFF K;  1G2C B;  1GL2 A;  2IBZ I;  1PL5 A;  1USD A;  3P32 A;  2Y9Z A;  2JKV A;  4HYT B;  1ZN5 A;  3CCJ P;  3L71 J;  1AVO A;  2FYZ A;  1GU5 A;  3HE4 B;  2H43 A;  3K5B A;  1S9K D;  2BAS A;  3L71 G;  2PP6 A;  2XU6 A;  2K9Y A;  3PLN A;  1IFD A;  3NMD A;  3H32 A;  5TIS H;  3D6Y A;  2ZYG A;  1SQQ D;  3BCC E;  1LTJ A;  2HG5 D;  1K8A Q;  2ZXE B;  3AED C;  1HBW A;  2FXM A;  1EZV E;  2WPV B;  4N78 E;  4I1L A;  3RL0 D;  3BAT A;  4W7Z A;  5APW A;  3Q5S A;  2Q5U A;  3GHG A;  1FAV A;  1S2E A;  3L73 D;  4OGQ C;  4K35 A;  5AVY B;  2YKQ A;  1KIL B;  3HE5 B;  3CD6 P;  4WY4 D;  3V2Q A;  4EYY Q;  1NU1 D;  2E75 C;  1GU4 A;  1NGM B;  2LKM A;  4AYC A;  3MTU E;  1HF9 A;  1FJP A;  2IZ1 A;  3BRT B;  1GZL A;  1VF5 B;  4YXD C;  3LW5 J;  2FXO A;  2P1J A;  1LNQ A;  1DH3 A;  2HR3 A;  3CCR P;  1KIL A;  1Q90 D;  1ZLL A;  3CX5 I;  1SQX D;  2M3E A;  4L74 A;  1RE3 A;  1GMJ A;  3CL3 D;  1X79 B;  1NVO A;  1M90 Q;  1FZC B;  1FDI A;  1KB9 D;  1LP1 A;  3CCS P;  1NKZ B;  3C1L A;  2M0B A;  3M9B A;  1S9K E;  4A7P A;  1SLQ A;  4IL6 X;  1QL2 A;  2KZI A;  2BEZ F;  1SQP D;  1H0T B;  1KQS O;  3CWB E;  3ZDM A;  1QGK B;  4HKZ H;  2JO1 A;  3I5C A;  1KZU B;  4EOT A;  1YJ9 P;  2YIU B;  2R3C A;  1NU1 K;  2AEJ A;  3H1K J;  3O6Q A;  1IFN A;  3H1I D;  1DD3 A;  3H1K G;  3HRN A;  1IK9 A;  1JTH B;  3CX5 H;  1XTG B;  2PGD A;  1NTM J;  1RE4 A;  1LTI C;  1SFC B;  1NTM G;  1FZC A;  4UB8 H;  1URQ B;  4JYB A;  1FJK A;  2N1T B;  2NPS D;  2D2C D;  1Q7Y Q;  1KIL C;  1BE3 D;  1R5L A;  4GT1 A;  5DJT B;  2YO3 A;  1KOR A;  2H89 C;  1SQX K;  4W7Y A;  3L73 E;  3CXH E;  2Q3I A;  1X8Y A;  1FE6 A;  1S3J A;  3G6E P;  1T3U A;  1J2J B;  2KSE A;  5E79 H;  1VF5 C;  1NU1 E;  2H7H A;  4HH2 A;  1SQP K;  2OGU A;  1CW5 A;  1MKM A;  2M5A A;  2V4H A;  3I56 P;  1URQ A;  5APS A;  2N1T A;  1L0N D;  5CCG C;  1JM0 A;  3E1R A;  1JY2 O;  3H25 A;  2QJP B;  3H1J J;  2PFX A;  5AW2 B;  5KJ7 D;  1T3J A;  3H1J G;  1FZC C;  4BXL A;  3RK2 D;  3W67 A;  3CCM P;  1PGO A;  2A06 D;  1SQX E;  5TIS E;  5H2F H;  2Y0E A;  1LJ2 A;  1NH4 A;  2XNX A;  2W27 A;  2YIU C;  2Z5I A;  1QLE D;  2OAR A;  4W80 A;  2E76 D;  1SQP E;  5AW8 B;  2B87 B;  5APU A;  1KD1 Q;  4N6J A;  1N7S B;  3SFE C;  4H0L D;  2JP3 A;  2KSJ A;  2WSF H;  1JO5 A;  1SFC C;  1URQ C;  2N1T C;  3L74 E;  3SWF A;  3H1I E;  3D71 A;  4OWF A;  3A5T A;  5KKZ B;  4U3F J;  1L0N K;  4O9B A;  4ZKU A;  4U3F G;  2R5B A;  2JWD A;  5KAI H;  1HVV A;  2GUV A;  3M9H A;  4I2L C;  3Q1M A;  2WSS H;  2K9J A;  2W8Z A;  1L2P A;  2B87 A;  2P58 A;  3P7K A;  1Q2N A;  1YTZ T;  2WSE J;  2KI7 B;  1N86 A;  2BCC E;  1EDI A;  1PFI A;  1YYC A;  1BCC J;  1BCC G;  2W83 C;  1NTZ D;  2QJP C;  1MUU A;  1AQ5 A;  5KLV J;  1JCD A;  3A7O A;  2W90 A;  3CI9 A;  3GG2 A;  5KLV G;  1N73 A;  2CPB A;  1E79 H;  2KB7 P;  3V2P A;  1Z56 A;  1YQ4 C;  3L72 J;  1KFN A;  3L72 G;  1W5C E;  2ZYA A;  3KPE A;  1YIJ P;  4C46 A;  2PAJ A;  2Q7C A;  3AE4 C;  2A06 E;  4IOI H;  1KYO H;  3CC2 P;  3CX5 E;  3HUS A;  5CJ4 A;  4D6T E;  2B89 A;  4C7R A;  3HD7 A;  4UB8 E;  4KT0 J;  3FX0 A;  3B5N D;  2P7J A;  1EDJ A;  1GW4 A;  1A02 J;  4PV1 B;  5KKZ C;  1OVR A;  2J5U A;  1KQL A;  1NJI Q;  1H8A A;  3L71 E;  2HOD A;  1KN7 A;  3AEG C;  4WB4 A;  1WT6 A;  5CCH C;  1NTZ K;  2KK7 A;  3MIW A;  1Q82 Q;  2QJK C;  1RF1 A;  1N73 C;  3UIA A;  1EZV D;  4GOD A;  3V4W A;  5E79 E;  1W2E A;  2KNC B;  4ZMD A;  3Q3D A;  5AVR B;  2K88 A;  4QMA A;  3RGU A;  1E5W A;  3P8C D;  3AEF C;  3F89 A;  4IFM A;  1M1J A;  3IR9 A;  1FOS F;  1GL2 B;  3HUS C;  3C9I A;  1PZQ A;  3PJS K;  2WPR A;  1NOH A;  1QVF O;  1OW6 A;  4OGQ B;  2OYI A;  3M9Q A;  5APT A;  5GTI H;  1EC5 A;  2WT7 A;  3PH0 A;  1FZG A;  1W2B O;  3JSV C;  1KYO D;  1YBK A;  3CLQ A;  1NTZ E;  5H2F E;  1N2D C;  3TNU A;  1OIP A;  2C9L Y;  1QEX A;  2K37 A;  1PPJ D;  3AE1 C;  4WY4 A;  2QVA A;  1OX3 A;  3TSI A;  3SFD C;  1USE A;  1LTJ B;  2QIW A;  5TJH A;  3BAS A;  3H1H J;  3W68 A;  3OA7 A;  3H1H G;  3HTK A;  3OW2 O;  5APY A;  5AVT B;  1M1J C;  1NTM K;  4PV1 C;  3GLM A;  1FC2 C;  3CWB D;  1KV4 A;  3GHG B;  5KAI E;  4GOF A;  3FXE A;  2NZ2 A;  2M3B A;  1L0L J;  4XE5 B;  1P84 I;  3TGU D;  2FYU J;  2KIK A;  3L35 A;  1L0L G;  4ASW A;  2FYU G;  2CPS A;  2B88 A;  4BRY A;  3LID A;  1VQN P;  5GTH H;  1JMM A;  1QL1 A;  3CCQ P;  2O3J A;  1IO4 A;  3CCE P;  2AXT H;  3L70 J;  2W6J H;  2YNY A;  1AJY A;  1YHQ P;  2I1K A;  1KQF B;  1CZQ A;  5CHX A;  3L70 G;  3FWN A;  5APV A;  3H1L J;  3MD0 A;  1LTG C;  3M0D C;  3D70 A;  1GL2 C;  3H1L G;  2QA4 P;  1DD4 A;  3VYI A;  5M1B A;  3CXH D;  3P8C E;  1JY3 N;  1NTM E;  1LGH B;  2QJY B;  3ITK A;  1DIP A;  3E1I A;  4RJT A;  1P84 H;  3V2N A;  4WWI A;  2JJL A;  3II6 A;  4I6M C;  1PP9 J;  5AW0 B;  1YI2 P;  3AEB C;  1PP9 G;  3IAO A;  2NPS A;  2YMY A;  1LP1 B;  1NO4 A;  1AFO A;  1U7M A;  1HJ0 A;  1R5S A;  3WUU A;  4KHX A;  5AVS B;  1KYO E;  1U57 A;  3M06 A;  1LTJ C;  1VQ4 P;  1SQV J;  1ZW0 A;  1D7M A;  1ZRT E;  1M56 D;  3CC4 P;  1SQV G;  3KDP B;  3O6Q B;  1PPJ E;  3KYQ A;  3CME P;  2K3R A;  2LXB A;  3TK1 A;  4TLF A;  4ASV A;  3U59 A;  2JEE A;  2OTK E;  2KYV A;  4WVZ A;  4XFJ A;  3V5B A;  1FBM A;  3A0H H;  2E75 D;  2IBZ D;  3GHG C;  1HTL C;  4HB1 A;  5KJ7 A;  2Q1K A;  3B4S A;  4H44 B;  2QRX A;  3RBX A;  4OH8 B;  1H89 A;  1DEB A;  2D2C C;  5AVX B;  2FFD A;  3BCC J;  3TGU E;  3L74 D;  1VQ5 P;  3BCC G;  2RH0 A;  1JUN A;  1NWQ A;  5C39 A;  1P84 D;  4C7N A;  3VMX A;  2WSC H;  5L8R J;  3EWK A;  2M5A B;  4DCK A;  2O1J A;  1LTA C;  2QJY C;  5GTI E;  1FDM A;  4MN4 C;  5KLV K;  1PGP A;  5AW6 B;  2BCC D;  4KJM A;  1RE3 C;  1M57 D;  1BGY D;  2KLV A;  3RK3 B;  1S5L H;  3L75 J;  1JY3 P;  1BDD A;  4UB6 H;  3L75 G;  2IFN A;  3EQ2 A;  5AVW B;  1VQ7 P;  1YQ3 C;  1MFT A;  3V4Q A;  3AEC C;  1K04 A;  4I7Z B;  1ZR2 A;  3Q5P A;  5EFW B;  1J1D B;  2XZR A;  2ZVN B;  2Y9Y A;  3A2A A;  1KIL D;  1RE4 C;  2P2U A;  4H13 B;  3G4S P;  2QSI A;  1SQB D;  3C8V A;  1PV3 A;  2OTJ P;  1IFP A;  4HJG H;  1NTK D;  2RMZ A;  1QVG O;  2C9N Y;  2YO2 A;  5KLV E;  1LT1 A;  2G8Y A;  1SP4 A;  1RQV A;  1FDO A;  4H44 C;  2KOG A;  3CX5 D;  4YTP C;  1VF5 D;  4D6T D;  5GTH E;  3CCL P;  1JY3 O;  2A45 G;  2IBZ E;  3L72 E;  2Y0C A;  3MHV A;  3KXD A;  5AVQ B;  4N3Y B;  2K9J B;  2AXT E;  3R4Y A;  3I55 P;  1DX7 A;  2ZT9 B;  5CCG D;  1OVV A;  5AVV B;  3L71 D;  1UII A;  1SQQ J;  2I8D A;  3WU2 H;  1VPC A;  4GKG A;  1HWT C;  3LW5 H;  1SQQ G;  1Q86 Q;  2OYO A; 
#chains in the Genus database with same CATH homology
 1RH5 B;  3MP7 B;  3JC2 2;  2YXR B;  2YXQ B;  1RHZ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...