The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
45
|
sequence length |
313
|
structure length |
269
|
Chain Sequence |
DAVFGDRVRRFQEFLDTFTSYRDSVRSIQVYNSNNAANYILPHRIIISLDDLREFDRSFWSGILVEPAYFIPPAEKALTDLADSMDDVPHPWKLSFKGSFGAHALSPRTLTAQHLNKLVSVEGIVTKTSLVRPKLIRSVHYAAKTGRFHYRDYTDATTTLTTRIPTPAIYPTEDTEGNKLTTEYGYSTFIDHQRITVQEMPEMAPAGQLPRSIDVILDDDLVDKTKPGDRVNVVGVFKSLGAGGMNQSNSNTLIGFKTLILGNTVYPLH
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Replication
|
molecule keywords |
DNA replication licensing factor MCM2
|
publication title |
Structure of the eukaryotic replicative CMG helicase suggests a pumpjack motion for translocation.
pubmed doi rcsb |
source organism |
Saccharomyces cerevisiae
|
total genus |
45
|
structure length |
269
|
sequence length |
313
|
ec nomenclature |
ec
3.6.4.12: DNA helicase. |
pdb deposition date | 2015-11-24 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
3 | PF00493 | MCM | MCM P-loop domain |
3 | PF17207 | MCM_OB | MCM OB domain |
3 | PF17855 | MCM_lid | MCM AAA-lid domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 2-Layer Sandwich | mini-chromosome maintenance (MCM) complex, chain A, domain 1 | mini-chromosome maintenance (MCM) complex, chain A, domain 1 |
#chains in the Genus database with same CATH superfamily 4YWL A; 1LTL A; 4YWM A; 3JC6 3; 4POG A; 4POF A; 3JC6 2; 4ME3 A; 2VL6 A; 4YWK A; 5IY0 A; 3JC6 6; #chains in the Genus database with same CATH topology 4YWL A; 1LTL A; 4YWM A; 3JC6 3; 4POG A; 4POF A; 3JC6 2; 4ME3 A; 2VL6 A; 4YWK A; 5IY0 A; 3JC6 6; 3F8T A; #chains in the Genus database with same CATH homology 4YWL A; 1LTL A; 4YWM A; 3JC6 3; 4POG A; 4POF A; 3JC6 2; 4ME3 A; 2VL6 A; 4YWK A; 5IY0 A; 3JC6 6; 3F8T A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...