3JCMJ

Cryo-em structure of the spliceosomal u4/u6.u5 tri-snrnp
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
79
structure length
79
Chain Sequence
b'GIPVKLLNEAQGHIVSLELTTGATYRGKLVESEDSMNVQLRDVIATEPQGAVTHMDQIFVRGSQIKFIVVPDLLKNAPL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pre-mRNA-splicing factor 8
molecule tags Transcription
publication title The 3.8 angstrom structure of the U4/U6.U5 tri-snRNP: Insights into spliceosome assembly and catalysis
pubmed doi rcsb
total genus 10
structure length 79
sequence length 79
chains with identical sequence R
ec nomenclature
pdb deposition date 2015-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3jcmJ00
4QVDA 5LJ5e 3JB9I 3HFOA 2CGHA 4J6WA 4M78C 4RCBA 5GMKe 4PJOE 5GMKm 1KQ1A 2DTOA 3JB9J 3JCMW 1BIBA 5LJ3e 2VC8A 1WQWA 3JCMg 4C8QE 4M75C 1MGQA 1LJOA 3RKXA 4PJOF 4X9CA 5GAN4 4C92G 4F7UB 3FIFA 2YLBA 5GAOl 4V2SA 4QVCA 5LJ5j 2QTXA 1BIAA 4NOYA 4XQ3A 3JB9F 1I8FA 2DXUA 1N9SA 3JB9H 3SWNA 3GIBA 3RUXA 4C92A 3INZA 1D3BA 2I2LA 3HSBA 5LJ3j 4M7AB 4PJOC 3BW1A 3HFNA 3V7CA 5LJ3g 2ZGWA 3FB9A 4M75F 4XTVA 5DY9A 5GANj 1M8VA 2DXTA 2EJGA 2YLCA 3QO3A 3JCMf 4WF2A 4JRKA 1HK9A 5GAN3 2K57A 4J6YA 1WNLA 3JCMP 2DZ9A 5GMKh 2EAYA 4M78F 5GAOn 3JB9G 4M77D 1I5LA 4C8QG 4PJOD 5GAMj 5LJ5d 3BY7A 2RA2A 5GANf 4HA8A 4MMLA 4DQ2A 4C92E 1M5Q1 2E65A 3M4GA 3L1AA 4NL2A 3RERA 4JRIA 5LJ5g 1WPYA 4M78D 4C8QA 4M77F 3QSUA 5GAMg 4XU3A 5LJ3f 4J6XA 4JUVA 3AHUA 5GAMd 3JCMc 4M75D 3BDUA 4XTYA 1Y96B 3V8JA 5GAN7 4M77E 1Y96A 5GMKj 4XU1A 4NL3A 4PNOA 3RKWA 4A53A 2DJZA 4C92B 5GAMh 1KQ2A 4M77A 4JLIA 2Y90A 5GAOp 1H641 4C92C 3RKYA 3JCMb 1U1TA 3SWNC 2E10A 5LJ3h 4XTUA 5GAOr 4F7UE 4M7DD 4HT8A 4EMHA 5GAOm 2RB6A 4EMKC 1TH7A 5GAN8 1LOJA 3JCMQ 1B34B 2EJ9A 4EMKB 3JCMJ 1B34A 5GANh 4M77C 4M7DC 4J5YA 3EFRA 3VU3C 4EMGA 1I4K1 2RM4A 5GANe 3V8LA 4M77G 3QUIA 4OP0A 5GMKi 4M7AG 4F7UA 1WQ7A 2EJFA 3EFSA 4N0AA 5GANg 2RD1A 5GAMe 5I21A 3JCMe 2DZCA 4M7AC 4A54A 4M7DB 5GAN5 4M7DF 4C8QF 4M7AA 5LJ5f 1JBMA 4M78G 3V8KA 4MMKA 1D3BB 4F7UG 2E41A 4Y91A 4PJOA 4N0AC 4F7UF 2EWNA 5CAIA 1N9RA 4RCCA 4M7DG 4M75G 2FYKA 4XTWA 3FJPA 4C92D 3BFMA 2E1HA 2VXFA 3JCMV 4M7AF 5LJ3d 4M75A 2YHTA 3L2ZA 4M75B 4EMKA 5GAMf 4M7AE 4XTZA 4C92F 5GAN2 2JN0A 4M78A 2E64A 4PJOG 3RIRA 3V7SA 4C8QB 4M78B 4C8QD 3JCMX 1I81A 1HXDA 5GANd 3V7RA 2VXEA 4M78E 4M7DA 2FB7A 2HNIA 4XU2A 5GAOq 2DKGA 3RESA 3SB2A 5GAN6 2DTIA 1LNXA 3QHSA 4M7DE 4C8QC 4PJOB 4M75E 2DTHA 2DEQA 4M77B 4XTXA 1YCYA 3SWNB 3JCMd 4XU0A 4M7AD 5GMKl 3PGGA 1JRIA 5LJ5h 4HT9A 3JB9D 1X01A 2DVEA 4X9DA 3JCMh 1U1SA
chains in the Genus database with same CATH superfamily
4QVDA 4AFZC 2DRMA 2JTFA 2FPFA 2MWPA 1VQLQ 1RAEB 1ZUUA 3JB9J 2VC8A 1WXTA 1ZHIA 1FX7A 2L3SA 2LCCA 4KGXB 1QVFS 2ESWA 2J6KA 3X28B 2O2OA 4PJOC 4D8KA 5DY9A 3QWXX 5GANj 2QEXA 1GCPA 4WF2A 1K8AC 2M0YA 3CD6Q 1K76A 3REBB 5AT1B 1YNZA 3PVLA 5D7UA 2DL5A 4M78D 2BKDN 2E6NA 3RMQA 1ZQ1A 1VIFA 4J7IA 1VQ6T 3AHUA 3TSWA 3CCJT 1BI1A 1N6AA 3UDCA 2KYMA 3L2UA 2VGNA 1AEYA 2X4WA 4M77A 2F2XA 4JLGA 1AWOA 4DOVA 3G6EA 5CKEA 1PNJA 1K73U 3E19A 1SHGA 2PVDB 1X6OA 2X4JA 3OBYA 5GAN8 3S3MA 3CCUA 4FSSA 2LTOA 2HQEA 3V8LA 2K7AA 1VQ6Q 2XKOC 1RAFB 2G6FX 1QWFA 1M2OA 3CQTA 4M7DF 1JO8A 2CP2A 4QQ6A 2EWNA 4RCCA 2GNCA 2C0IA 4IUTA 2D8HA 3JCMV 3VS3A 4HCCA 5GAMf 2GQIA 3RIRA 1Q81R 3H0HA 1I81A 2DA9A 4HXJA 3P8HA 2XICA 1PCXA 1UECA 3G1JA 1ARKA 5IN1A 4E2FB 3CCMA 2JJ9A 3AT1B 3OW2A 4M7DE 2FG0A 2E5QA 4M7AD 3U23A 2DBMA 2FL7A 3RBBB 2VGMA 3ER0A 4M78C 5FU6B 2SEMA 2DTOA 3CBMA 4BD3A 1PG5B 2DYBA 2ABLA 2RQUA 2PNIA 2X3WD 2J05A 5CKBA 2RQWA 2DX1A 1ZSZA 5LJ3g 4M75F 1VQKT 3O5ZA 2KBTA 2WACA 3L42A 2OI3A 2VWFA 3I9QA 2GTJA 4M78F 1AZGB 3EAEA 3ZL7C 4PFPA 1M90U 1M5Q1 3JV3A 3M55A 2HCKA 1ZLMA 4KBMB 4IURA 3PE0A 2LRQA 4GLMA 3OQ5A 1VQNA 2JM9A 1MMGA 2KR3A 3VS4A 1K9MR 2ZPFB 1IGUA 2Y90A 5I2MA 2YXYA 4J9GA 4ANJA 4Z89A 3I56Q 1VQ8Q 3JCMJ 3OYNA 4Z02A 2LDMA 3VU3C 3LLRA 4M77G 2ENMA 3M56A 3L2VA 1Y07A 1WQ7A 3EFSA 4BE0A 2RD1A 1QQJA 2RI2A 1NE8A 2CS7A 3A5ZB 1JBMA 1E7OA 1TUDA 1ZSZB 3QG1A 1K9MC 3RR6A 1PHTA 3FJPA 1PRLC 4ELYC 7AT1B 3E9FA 6AT1B 1X6BA 4PJOG 4QW2A 2DNUA 1KHIA 3WVDB 1ZSGA 1QKWA 2AK5A 3QHSA 4J9CA 2ZPIB 2JMAA 3DLLA 2EYZA 4HT9A 2X4XA 3M0UA 1YI2T 2FO0A 2R57A 5HKCA 1OEBA 4HVVA 4A4HA 1IXDA 2NUTB 2LT4A 4A63B 2RK1A 2DFUA 1X27A 3OYJA 4EPCA 3BE3A 3CBOA 4J9HA 2QTXA 3SEMA 3JB9F 1WYXA 3LYIA 3J7AF 2HQXA 5GJWB 3HFNA 3MEUA 5KYWB 4JJBA 3BY7A 2Y4YA 2L5QA 1MV0B 1ZBJA 1NM7A 1BB9A 2KVQG 3NTKA 1OI1A 2D6FA 4C92B 1W4SA 4FYYB 4PL6A 4C92C 4Z88A 3ZEHA 5IHKA 3TSZA 1QVFA 3CCSA 2XD0A 3CCLA 1OZ3A 3H9NA 4WTOB 3G4SQ 1BYMA 1GCQC 1B34A 2NYSA 1RAIB 2QA4Q 3NGPA 4ZGEB 2QEXQ 1WFWA 3OS5A 4KH1B 3CMAA 1WA7A 5D6WA 1TSFA 2HSPA 4Q5WA 4KUDK 4M78G 4EIKA 1N27A 1VQ4A 2LCLA 5KYXA 4BDZA 1T3SA 2FYKA 4C92D 2DRKA 4KGZB 1OOTA 3KBGA 3MCAB 3CC7Q 2OTJQ 1X43A 1YJ9T 1W70A 3OW2S 3RESA 1LCKA 4F16A 3MP1A 1YCYA 5IAYA 2YT6A 1RACB 3F70A 5CR2A 1VQ7A 3A8HB 1X01A 1F1BB 1M3AA 2YUNA 2O31A 3EHQA 3QXEB 4PJOE 2DBKA 3JCMg 4M75C 2K2VA 1MGQA 2CP0A 1Z9ZA 2MCNA 1WX6A 4XQ3A 2LJ3A 2P4RA 2CP7A 2MIOA 1CKAA 3SWNA 2LJ0A 1T0JA 1WJRA 1OQKA 3PIPA 2HD0A 1H3ZA 3BW1A 1M8VA 1YITQ 2YLCA 3QO3A 2A08A 3QZ9B 3BDLA 4JZ3A 1WXUA 3MP8A 1I5LA 1YBYA 2PUOB 1X2KA 1UUEA 4RG2A 2JS0A 1IZ6A 5J26A 2OAUA 1VQPQ 2EVRA 4JUVA 1SHFA 1KG1A 1WHGA 2DL8A 5KCHA 2E70A 3JRZA 1WHLA 3HP9A 2VASA 1YN8A 5IH2A 2CYZB 1N8RR 2YSQA 3EGXB 3OYKA 2CUDA 3GNGA 3CCRT 2E10A 5LJ3h 4B6MA 4OMQA 1RLPC 2MMPA 2J7IA 1YJNT 2DXBA 3G7ZA 5HK0A 2WSEE 4C0DC 5CKDA 3FEOA 3OYEA 1PKSA 3VS2A 4FIBA 1R0BG 1QP2A 4FYVB 5GAMe 2CZ1B 1OV3A 4M7AA 5LJ5f 5HK3A 2HBWA 2YUQA 1KQSP 1YP5A 4OB3B 3X20B 2I0NA 2FEIA 3N5BB 3T9NA 4ESRA 3H0FA 4M75A 3QBYA 1JEGA 2DL7A 4HKEA 3NMZC 1VQ5A 2RHIA 4F17A 1LNXA 2LQKA 4RTXA 1W2BA 3JCMd 5EC7A 4QQDA 1YJNA 2L3QA 3OYBA 1VQPA 4IKFA 1U3OA 2V1RA 2DK3A 1FWZA 2XK0A 2RJCA 4XAXB 5LJ3e 2OTLQ 1M8MA 4X9CA 4BB7A 2GF7A 3QWYA 1VYUA 1NPPA 1BI0A 3JB9H 3CCRA 2K4YA 1D3BA 1UGVA 2RHXA 4DEXA 1RAHB 2G3RA 1Q86C 5KYXB 4ATOA 2EAYA 1YFNA 4HA8A 2LT1A 4DQ2A 2SRCA 1JU5C 1ZA1B 4NL2A 2HEQA 3S3OA 4LD6A 1VOMA 2HQHA 2R5AA 1R77A 1VQKQ 2KYBA 1G3YA 2J06A 3DLMA 3GF5A 3CCVQ 1Y57A 5GAOp 3VRYA 3QKJA 4CI0C 1U1TA 2EQKA 4A4KA 3I56A 2KAFA 2GFUA 2CKKA 4F04B 3CCVT 2D8JA 1UE9A 4P5NA 5IXFA 4F7UA 3HHTB 3HTRA 3JCMe 3MEVA 1VQMQ 1EFNA 2EIFA 3QDFA 1BU1A 2E1HA 4A4FA 3H8ZA 2ZZDA 2YHTA 2QAZA 3CC2Q 2EBPA 3OSVA 4JS5A 2COWA 2BUDA 2KT8A 5AYFA 3WXMB 3Q1JA 1NLPC 1OU9A 4OGEA 1OYXA 4C0FA 4DBRA 2KI7A 2EYQA 2DM1A 1C0MA 1M1FA 3OYYA 1XJWB 3FDRA 2FPDA 3MPUB 3CCVA 3GP8A 2NWMA 4C8QE 1M9SA 4BACA 4V2SA 2DL3A 1G2BA 2JXBA 4LDUA 3HSBA 3OYAA 5A2QE 2RO0A 3CXCA 4LDYA 4QKUA 4JRKA 1GL5A 1VQ6A 1KC8R 3THKA 3VUZA 3NPFA 4E6RA 2P0PA 2ROLA 1WGSA 4LXCA 4OMNA 1ABQA 4ZNXA 1W1FA 2K3XA 2B86A 1BK2A 2QG9B 3MEWA 3M4YA 1AWWA 2QI2A 5IHIA 4M7DC 4RG8A 3A8MB 2LMJA 5FROA 1VQPT 1QWEA 3LWHA 3J81E 4FU6A 5GANg 2XHCA 4M7AC 2MYSA 2M9UA 1UFFA 3CPWA 2LQ8A 4HVUA 3S3NA 3OY9A 2ROTA 3LX7A 3OYLA 4M7DG 4MZMA 4KRTA 3EH2A 1YITT 1UTIA 1YI2Q 1RI0A 3GPLA 5LJ3d 2RN8A 3EG3A 4RKUE 4K11A 3M5AA 4MZTA 4OB1B 3G71Q 1VA7A 4FYXB 4M78A 3G71A 3JCMX 1HXDA 3M58A 2YRVA 1K8AU 1TWBA 3KXTA 1TG0A 4PLIA 1TOVA 2BE9B 1VQ5T 2DVEA 5DM7R 3EG9A 1YJWT 3CCEA 5FWBA 4RCBA 2CH4W 4DBQA 1WQWA 4LUDA 2JM8A 4AG2C 4FM4B 2XMFA 1NBEB 2HAXA 3H6ZA 2X3XD 1YJ9Q 4FT2A 3GLXA 1MMNA 1BIAA 4NOYA 3CC7T 1MMDA 2PU9B 2OTJT 2EYYA 4J9BA 2EYWA 3C94A 4N4HA 1M4ZA 4B9XA 2QYZA 4OB2B 1HJDA 2EJGA 2ZPGB 1JXOA 3GOXA 3QIIA 2RF0A 2DZ9A 1M1GA 4J9IA 2GCXA 2BTTA 2MPXC 1KHCA 2O88A 4AG1C 4OF1A 4JRIA 1VQ7Q 4DA4A 3CMAT 2HKQB 2DERA 5CK9A 2X9HA 2JOYA 1Y96B 1VQLA 2FZGB 2YWWA 4XU1A 3REAB 3RKWA 3LWIA 2K9GA 1SSFA 4CC2A 1KQSA 1M30A 1M1KR 3X25B 3G71T 4EMKB 1WI7A 3PMTA 2CH4A 3VYHB 3UA7A 2RM4A 3CEYA 3ULRB 2EJFA 1T0HA 1UEBA 2DVJA 3CMEA 1SPKA 3LW5E 1Y71A 4PJOA 3V8KA 3L2QA 1RAGB 1OZ2A 2LCSA 2L2PA 1SF9A 3SD4A 2VXFA 2R58A 4M7AF 3CCSQ 2CSIA 4FW1A 2O4XB 3CPWS 2C0OA 2BZYA 2M02A 4RTUA 1GXIE 4RMOA 2AZVA 4BI3A 4LD9K 2E12A 4HCKA 4M77B 4PK4A 2CT4A 4IUVA 5GMKl 4MDXA 5CQYA 4D8DA 2C06A 2VV5A 5I21A 3I5RA 2Y4XA 1Q82R 2YDLA 1XQHA 1YIJQ 1KQ1A 3P8DA 3KUFA 3CCLT 2RJDA 1QVPA 3FIFA 2CZ7B 3VS7A 1RABB 1VQ4T 3CXCS 2RH2A 1VQ8A 2X51A 2PVGB 2ZGWA 4XTVA 3IQLA 3QYHB 5CIUA 2E3IA 2K57A 2P0QA 2FVUA 4DBFA 1IHVA 4BE1A 4VUBA 3OA6A 2K3YA 1O9SA 4C92E 2NUTA 2R5MA 2IPOB 5LJ5g 3CCJQ 5LJ3f 5FW9A 3BDUA 1QVFP 1YHQA 3PT9A 3SHWA 5GMKj 2JS2A 3I56T 1H641 3CCQT 4CC3A 2H8HA 2KEAA 2DD5A 3I5SA 4HVWA 2XIDA 1YHQQ 4HT8A 1Q7YU 1YWOA 2HBPA 2RB6A 2DIQA 2QDYB 3CC2T 1AVZC 4BY6C 4JRQA 2KE9A 2RI5A 1JJ2A 5CKFA 3QUIA 4OP0A 2P0KA 3CXCP 2X4YA 4M7DB 2RNAA 4C0DB 4ZN1A 2EFIA 4F7UF 4R0KA 2E3HA 2DF6A 2DPPB 1M2VB 1X2QA 2NLUA 3OYFA 2L3PA 2ZPHB 3NHNA 4PFOA 2KRSA 5KE3A 4C92F 1QLYA 2QGGA 2FZKB 4A4GA 5IT9E 4XU2A 2FRWA 2DTIA 4IIMA 1QCFA 2LJ1A 3S6WA 1YITA 3HRUA 2HZYA 3G6ET 1IO6A 3CC4T 2PTKA 3SDZA 1X69A 2KDSA 9ATCB 2QQRA 1XTDA 2LC4A 2QQ9A 1NEGA 2YLBA 4LDVA 3A8GB 4X1VA 1AHJB 4R56A 5GJVB 2D0QB 2DXTA 5GAN3 1AWJA 3HKSA 1WZOA 3J80E 2L3RA 2OTLT 1J3TA 5FU6C 1MUZA 1QCOA 3M0PA 1KD1R 2RQTA 4J6XA 3JCMc 1EIFA 2ZCFB 4XTYA 1FYNA 1Q86U 2DILA 1QVGA 4M77E 4PNOA 4HCZA 1KQ2A 2KXDA 4J8OA 4J83A 3LGLA 1NYFA 4KH0B 2BE7D 4XTUA 3M57A 4M7DD 1UJYA 2CZ6B 3JCMQ 2EJ9A 4JPBW 1NPRA 3VS5A 2K2MA 2XDDA 2LVMA 5KE2A 3M0RA 2EQUA 1ACMB 4A54A 3UF4A 2QXFA 1GFCA 1GBQA 2IG0A 1YIJT 2XU8A 2MOXA 4ZTFA 1D0ZA 4XTWA 1FMKA 5CKHA 1WXBA 2XI9A 1KQSS 1PWTA 5L23A 1FXXA 3V7SA 4IUUA 1YJNQ 1D1CA 3NTIA 1ZA2B 4M7DA 3PTAA 1CKBA 4ME7A 1FMVA 1Q82C 2K5LA 1ZX6A 4E7JA 2F2VA 1D0XA 3CCST 1SKUB 1PRMC 3EHRA 4OMLA 1M90R 1B7TA 4CC7A 5GMKm 2NUZA 3MP6A 2JT4A 2M16A 5KYUA 4C0ZA 1IRXA 2KMTA 1OU8A 4QT7A 1M27C 5GAN4 3H0IA 1VUBA 3ASKA 4QVCA 3HPWA 2K6DA 2D9TA 3MJXA 1K1ZA 2A0FB 3DKMA 5LJ3j 2PVOB 3FB9A 4Z8AA 3JCMf 4JDSA 4KT0E 2LZ6B 2KGTA 3EG2A 3CCEQ 2B8AA 2LQNA 4MMLA 5I2SA 4PJNA 3RERA 4C8QA 1Q7YC 4O6JA 1UJ0A 4RUGA 2KRMA 2EQJA 3UT1A 4M75D 1PM3A 1WHKA 2YUPA 4GY5A 3CCQA 1MMAA 1VQ7T 5J3BA 3A98A 3L2WA 2XG8D 1GCQA 1IREB 1YHQT 3VKIA 2DEUA 2CDTA 2HMAA 1IGQA 2A37A 2AKKA 3E2UA 5KYUB 4NS5A 5GANh 1AZEA 4OMOA 3UA6A 4KULA 4DOWA 2V8IA 4RTWA 4J9DA 4AT1B 4PJLA 1VQ9T 2RHZA 2MI6A 3X24B 1JXMA 4N0AC 4JS4A 2BZ8A 1YWPA 4BI8B 3OS0A 1QMCA 1K73R 2QA4T 5HY6A 4D6WA 4LDXA 2FPEA 1JJ2P 2OX7A 3UWNA 2VXEA 1MV3A 4E7KA 5KH6A 3SB2A 3CD6A 2O9SA 2HDAA 4C8QC 3SWNB 2DTHA 3UPUA 2GTOA 2RQRA 1JJ2S 5LJ5h 4AFQC 2V26A 2QK0A 4E7LA 2CGHA 3R6OA 4J6WA 1S72Q 3M0TA 3EG0A 4OGCA 2DL4A 2AHJB 4J7FA 2JMCA 1MNDA 2RK2A 2F2WA 1AD5A 2F5TX 2M0OA 3LH0A 1WHMA 3R6NA 3INZA 1RUWA 3E9GA 2KY9A 3L2RA 1VYVA 3HL8A 5IHNA 2JW4A 1HK9A 3NTHA 3TEEA 3JB9G 1SRMA 3EH1A 5FLXE 5GAMj 2WSCE 5GANf 4BUGA 3C12A 5DLQE 4JJNK 3O8VA 5KCOA 2RHYA 2E6ZA 3V8JA 1V29B 3A8LB 1JQQA 4JLIA 3RKYA 1LVKA 3M0SA 3PMIA 2EQMA 1BCOA 1KIKA 4EMHA 2DIGA 1O75A 1B34B 1B3QA 3TVTA 4OMMA 3C95A 4OMFB 2FHDA 4E47A 3CMAQ 4Y92A 3M9QA 2DZCA 4ORZA 4QVZA 1VQOT 2NUPA 3CMEQ 1G8XA 4IUPA 3RDVA 3CC7A 2OTJA 2BZXA 2LNVA 4A4EA 1TS9A 2OJ2A 3META 4LDWA 2AIRB 4PLLA 5I22A 1I07A 1K8AR 3L2ZA 4M7AE 2H3EB 3M53A 2E64A 1E6HA 4C8QB 2KNBB 1RLQC 5GANd 1NLOC 2A3LA 4RTZA 4LUEA 3VS0A 5GAOq 3ME9A 2RJFA 1VQOQ 4II1A 4RTYA 4XTXA 1VQOA 1IB8A 2K5FA 2ATCB 1XNIA 4XU0A 4J9FA 1YJWQ 2CP6A 3QZ5B 2K3BA 1VQ5Q 3C0CA 1Q81C 3OB9A 1WIEA 5GMKe 4PKCC 3G4ST 1S72A 2GGRA 3PNWC 3RKXA 1NJIU 1WHJA 1GRIA 1QW1A 2KROA 1G3SA 1A0NB 1G3WA 4N4GA 1I8FA 2W10A 1VYTA 4FL6A 4M7AB 2P4TA 3OYIA 4OB0B 2LQWA 5D6YA 4C8QG 2KQWA 4CC4B 5LJ5d 1WLPB 1N5ZA 3M4GA 1E6GA 5FU7C 5J39A 1SSHA 4M77F 2XDPA 4JJCA 2CUBA 2A7YA 1EX4A 2E5KA 5KYWA 1PD1A 4HCBA 3QPHA 3ZBDA 4J9EA 1WJSA 1H92A 1ABOA 2EKOA 2ECZA 1S72T 3FRNA 4M77C 2D1XA 1KK7A 2VB6A 1Q81U 4M7AG 5D6XA 4PFZA 1NJIC 1TXQA 2LNHB 2GQVA 5GAN5 1D0YA 1CSKA 1D3BB 1V76A 1UGQB 4O5VA 8ATCB 4FCYA 2A28A 2EPDA 4ZGDB 5A0GA 4OMPA 3VV0A 2DO3A 2HL3A 1YIJA 2ED0A 1M1KU 4EMKA 4M75B 1T3LA 1UGPB 4XTZA 2JTEA 1K0SA 3M59A 1H3HA 2RHUA 4M78B 4C5EA 2DKGA 4JRPA 2V8JA 2NUPB 4EDUA 1UHCA 1JRIA 1QCNA 4X9DA 1QP3A 4C5IA 1C6VX 2QASA 2EYXA 1KC8U 3PVQA 4PJMA 3GNFB 5KYYB 3JCMW 3UATA 1OPKA 1LJOA 4PJOF 4E7SA 2LP5A 4YTLA 5GAOl 2RJEA 2JNGA 2IIMA 4OVAA 3LH5A 2OTLA 2IVWA 2EGEA 3DB4A 2MF2A 1I0CA 3P8BB 3VS6A 3LGFA 3JCMP 3WVEB 5CCAA 4PJOD 1P92A 3MKDA 3CCRQ 2RA2A 1VQMT 2HKNA 2PQWA 5IXBA 2M1HA 1LPLA 1VQLT 2LX7A 2XDBA 2AT1B 1K73C 3QYGB 3QSUA 4XU3A 3VUBA 3MO8A 3TU4K 1IHWA 5GAN7 1ZUYA 3EG1A 2EW3A 2DJZA 3SWNC 2V8KA 2X35A 1TH7A 1LOJA 3OMGA 2AKLA 2A36A 4RTVA 1FMWA 2DE0X 2MAMA 4N4IA 1MHNA 1KC8C 5GANe 1BCMA 2QQSA 2CREA 1VQKA 2RI3A 1VQMA 1OX9A 1SG5A 4F7UG 2KRNA 3CPFA 5A0DA 3MHXA 4Y91A 3EGDA 3EGDB 4AFUC 3VS1A 3OYHA 1R0CB 3OS2A 3OYCA 3JAME 1Q7YR 5EG2A 5HCKA 2DMOA 4BE2A 3DB3A 5ECAA 1I1JA 2L0AA 2HNIA 3NFCA 2JTMA 2BIVA 2HL5C 4IIOA 1U8RA 3CC2A 2J6FA 4GBQA 4LN2A 2M51A 1U06A 3PGGA 3CCJA 3OYDA 3C4SA 5LJ5e 3JB9I 5DLOA 1BIBA 1TUGB 2VKNA 3HRTA 1YCSB 1D1AA 1BBZA 1ZUKA 8AT1B 4C92G 4F7UB 1M90C 3OYGA 4BDYA 2QEXT 4C92A 3EGUA 3V7CA 4M4ZA 2W0ZA 1W2BP 3VJPA 2CP5A 1WNLA 3A8OB 3HRSA 3EG9B 1M3CA 2DLPA 1PSEA 4FSXA 5KYYA 4E7HA 1UDLA 4DBHA 1VQNT 2V1QA 3X26B 1PKTA 5GAMg 1D09B 2E4HA 1VIEA 3ZFJA 1SRLA 1OPLA 3QJYA 2DJQA 1PD0A 3EGXA 1X75C 4FW2A 1HD3A 1RAAB 4EMKC 1RI9A 1AOJA 1RL2A 3OSSC 3M54A 2CT3A 1KD1U 4EMGA 1I4K1 2OAWA 3CC4Q 3OS1A 3I55A 5GMKi 2L89A 3FLGA 4L59A 1H8KA 1QVGP 5C6SA 2QA4A 4C0GA 4M75G 3OBWA 2PUKB 3RMSA 3CPWP 4L6V5 3BFMA 1BKBA 3CCMQ 2FRYA 1NJIR 2JN0A 2QDLA 4M78E 1WDXA 2CSQA 4M75E 4AMCA 1WJQA 4C5GA 2GBQA 1K9AA 4GLKA 3JCMh 1U1SA 2C0TA 4E7ZA 3HFOA 2VVKA 2O9VA 2F1LA 2KK4A 3A1PA 1NZ9A 4AFSC 1VQ9Q 3I35A 1WHHA 3TQ7P 3VYGA 1I5OB 3I55T 1N8RC 1KD1C 4ELZC 3CCQQ 5FRMA 1QVGS 1DJ7B 1JB0E 4MDWA 3GIBA 1K4US 2CP3A 4KUIA 1ZBXA 4LE9A 2ZAEA 4J6YA 3I55Q 5GAOn 4RTTA 3OYMA 4M77D 3CMET 2E65A 2K79A 3M0QA 2COZA 2JUFA 1TUCA 1D1BA 3SFMA 5I11A 2ZPEB 1YI2A 1Y96A 1R8OB 5M9OA 1ZSZC 4A53A 2PZ1A 1VQ4Q 3JCMb 3CCET 4F14A 1OX8A 2RMOA 4F7UE 5GAOr 1Q95G 3CCLQ 2FZCB 1AT1B 2QQBA 3QJ6A 1NYGA 1W2BS 1Z9QA 5CQXA 3EFRA 3FC3A 2VYTA 3OMCA 5L8RE 1Y7XA 2O01E 3OW2P 3KFVA 4C8QF 1G3TA 3PFSA 2JVVA 2VUBA 4ZN3A 1YJWA 5CAIA 4XK8E 1N9RA 1RADB 1KFZA 4WCIA 4B9WA 2MK5A 4DEYA 2MWOA 1NEBA 2YUOA 1NG2A 2YRCA 3G4SA 1K0XA 4BY6B 5GAN2 2QTVA 4C8QD 1N8RU 1YJ9A 4C5HA 4L5GA 1PSFA 2K5IA 5FRNA 2EKHA 3CBPA 1Q86R 4IUQA 2LX9A 2DAQA 1XOVA 2COYA 3TCJA 2AZSA 1UHFA 2DETA 2EGAA 3D7SB 4Y28E 5FWCA 1VQNQ 2L8DA 2J6OA 3URGA 3E1SA 2DYIA 4QQGA 1HYOA 1HSQA 2RQVA 1PC0A 2H3JA 5LJ5j 3TREA 3QDRB 1Y0MA 2DXUA 1N9SA 4BI4A 3RUXA 2I2LA 1UG1A 2WSFE 3EFOA 2ZPBB 5CVIA 3EFOB 2GFAA 2CZ0B 2D0NA 5GMKh 1QKXA 1TU0B 5C0MA 1M2VA 1SEMA 4PJJA 3L1AA 2DXCA 2Z0WA 1WPYA 2F5KA 1C1AA 1V1CA 5GAMd 3H41A 3GBQA 2JZ2A 1KJWA 1W6XA 2QQAA 4NL3A 5GAMh 1VQ8T 5FU7B 4FYWB 1TTHB 1AWXA 3JSCA 1MNEA 2KXCA 1KSWA 3CD6T 3RNJA 5KYNA 1B07A 5GAOm 4MZPA 3FJ5A 4JZ4A 5A0LA 2O4XA 1BI2A 2DD4A 2EQIA 4J5YA 4UC4A 1BI3A 1GBRA 1X6GA 1U5SA 2KT1A 2KSSA 4N0AA 4LNPA 1Q82U 2F69A 4FT4A 3MEAA 4KGVB 1G5VA 1UB4A 2YRDA 4MMKA 2E41A 1VQ9A 1G83A 4X34A 2EGCA 2RPNA 4ZGJB 4ZTJA 2ED1A 3G6EQ 3VRZA 2P84A 3CCMT 1EZZB 4CRIA 4E7IA 3CCUT 1GFDA 5LL6S 2QGFB 1UGRB 1UGSB 5CO7A 3V7RA 1K9MU 2FB7A 5GAN6 4TVRA 1M3BA 4JJDA 3CCUQ 3PIOA 4PJOB 4R55A 2DEQA 1OULA 3CC4A 1M1KC 1S1NA 3JB9D 2HSEB
chains in the Genus database with same CATH topology
4QVDA 3CC4T 4IKFA 3SDZA 2JTFA 2DK3A 1FWZA 2MWPA 2XK0A 2RJCA 1KC8U 3GNFB 2KDSA 3JCMW 3JB9J 4XAXB 5LJ3e 2VC8A 2QQRA 1LJOA 1XTDA 1ZHIA 2LC4A 2QQ9A 4X9CA 4PJOF 4YTLA 1FX7A 2LCCA 2YLBA 2GF7A 4LDVA 4BB7A 5GAOl 2RJEA 2JNGA 3A8GB 1NPPA 4OVAA 1AHJB 4R56A 1QVFS 1BI0A 3JB9H 3CCRA 2K4YA 3X28B 1D3BA 2OTLA 2IVWA 2D0QB 4PJOC 2RHXA 5DY9A 3DB4A 5GANj 2DXTA 2G3RA 2QEXA 1Q86C 2MF2A 4WF2A 5GAN3 3HKSA 3P8BB 1K8AC 3LGFA 3JCMP 4ATOA 2EAYA 3J80E 3WVEB 5CCAA 1VQPT 4PJOD 1P92A 2L3RA 2RA2A 1VQMT 4HA8A 2LT1A 4DQ2A 2OTLT 2PQWA 5FU6C 2M1HA 4NL2A 1VQLT 2XDBA 4M78D 3S3OA 3QYGB 1K73C 2BKDN 2E6NA 4LD6A 4XU3A 1ZQ1A 3RMQA 3VUBA 3QSUA 1VIFA 3MO8A 4J6XA 4J7IA 1VQ6T 3AHUA 2R5AA 3JCMc 1EIFA 2ZCFB 4XTYA 1G3YA 1Q86U 3DLMA 3TU4K 5GAN7 4M77E 3CCJT 1QVGA 1BI1A 3GF5A 1N6AA 3UDCA 4PNOA 4HCZA 1KQ2A 2DJZA 2VGNA 3L2UA 2X4WA 4M77A 4J8OA 4J83A 5GAOp 3LGLA 3QKJA 4CI0C 1U1TA 3SWNC 4JLGA 2EQKA 4DOVA 2V8KA 4XTUA 3M57A 4A4KA 3G6EA 2X35A 4M7DD 5CKEA 3I56A 1K73U 3E19A 2KAFA 2X4JA 2PVDB 1X6OA 3OBYA 1TH7A 2CZ6B 2GFUA 1LOJA 2CKKA 3OMGA 3JCMQ 5GAN8 2EJ9A 3CCUA 3CCVT 1NPRA 2MAMA 4N4IA 1MHNA 2LTOA 4P5NA 1KC8C 2HQEA 5GANe 2XDDA 2LVMA 2QQSA 3V8LA 5KE2A 4F7UA 2EQUA 2XKOC 3HHTB 1VQKA 3JCMe 4A54A 2RI3A 1VQMA 2QXFA 4M7DF 3MEVA 4F7UG 5A0DA 3CPFA 3MHXA 4Y91A 4QQ6A 2IG0A 1YIJT 2EWNA 2XU8A 4ZTFA 4RCCA 4XTWA 2EIFA 4IUTA 5CKHA 3OYHA 2E1HA 4A4FA 3JCMV 3H8ZA 4HCCA 3OS2A 3OYCA 3JAME 2ZZDA 2YHTA 5EG2A 5GAMf 2XI9A 1KQSS 3OSVA 4JS5A 1FXXA 3RIRA 3V7SA 4BE2A 4IUUA 3DB3A 1I81A 3NTIA 2BUDA 3P8HA 5AYFA 2XICA 3WXMB 4M7DA 3Q1JA 2HNIA 3PTAA 4ME7A 5IN1A 3NFCA 3CCMA 2JTMA 3OW2A 1Q82C 2BIVA 2K5LA 4M7DE 4OGEA 1OYXA 1U8RA 4C0FA 3CC2A 4E7JA 2E5QA 4M7AD 3PGGA 3CCST 3CCJA 3OYDA 3C4SA 2EYQA 2FL7A 5LJ5e 3JB9I 3OYYA 1M1FA 2VGMA 3ER0A 4M78C 3FDRA 5FU6B 5DLOA 5GMKm 2DTOA 3CBMA 3MP6A 1BIBA 2M16A 3CCVA 3HRTA 4C0ZA 4BD3A 3GP8A 4C8QE 2KMTA 1M9SA 4BACA 5GAN4 4C92G 4F7UB 1M90C 4V2SA 1VUBA 3ASKA 4QVCA 3OYGA 4BDYA 3HPWA 5CKBA 2D9TA 2QEXT 4LDUA 4C92A 3DKMA 3HSBA 5LJ3j 2PVOB 3OYAA 5A2QE 2RO0A 3CXCA 4LDYA 3V7CA 3FB9A 4M75F 5LJ3g 1VQKT 3JCMf 2WACA 3L42A 4JDSA 4KT0E 4JRKA 3VJPA 1VQ6A 1WNLA 4M78F 3A8OB 3HRSA 3EAEA 1PSEA 1M90U 2B8AA 3VUZA 4FSXA 4MMLA 1M5Q1 2P0PA 4E7HA 3M55A 5I2SA 1VQNT 3RERA 4C8QA 3X26B 1Q7YC 4O6JA 5GAMg 1WGSA 4KBMB 4IURA 2EQJA 1VIEA 2LRQA 4M75D 3UT1A 3ZFJA 3OQ5A 4GY5A 1VQNA 3CCQA 3QJYA 1VQ7T 5J3BA 2K3XA 2ZPFB 2Y90A 3L2WA 2XG8D 5I2MA 1IREB 1YHQT 3VKIA 3MEWA 1X75C 3M4YA 4EMKC 2QI2A 1RL2A 3OSSC 3M54A 4NS5A 5GANh 3JCMJ 3OYNA 4Z02A 2LDMA 1KD1U 4M7DC 3VU3C 4RG8A 4EMGA 1I4K1 3A8MB 3LLRA 4KULA 5FROA 4M77G 3OS1A 4DOWA 3M56A 3L2VA 3I55A 1Y07A 2L89A 2V8IA 3FLGA 5GMKi 1WQ7A 3J81E 3EFSA 4FU6A 3LWHA 4L59A 5GANg 2XHCA 4BE0A 2RD1A 4M7AC 2RI2A 1VQ9T 1NE8A 2M9UA 5C6SA 3CPWA 2CS7A 3A5ZB 2RHZA 1JBMA 2LQ8A 2MI6A 3X24B 2QA4A 3OY9A 3QG1A 3S3NA 1K9MC 4N0AC 4JS4A 3LX7A 4C0GA 3OYLA 4M7DG 4M75G 4BI8B 4MZMA 3OBWA 2PUKB 3FJPA 3RMSA 3OS0A 1YITT 4L6V5 3BFMA 1RI0A 4ELYC 1BKBA 3GPLA 5LJ3d 2QA4T 3E9FA 5HY6A 4D6WA 4LDXA 4RKUE 4MZTA 3M5AA 4OB1B 2JN0A 4M78A 4QW2A 4PJOG 3JCMX 3G71A 3UWNA 1HXDA 1KHIA 3M58A 2VXEA 2YRVA 4M78E 3WVDB 1K8AU 4E7KA 5KH6A 3SB2A 3CD6A 3QHSA 4C8QC 2ZPIB 3KXTA 4M75E 2DTHA 3SWNB 3UPUA 1WJQA 4C5GA 4PLIA 1JJ2S 3DLLA 4GLKA 4HT9A 2X4XA 5LJ5h 1VQ5T 1YI2T 2DVEA 3JCMh 1U1SA 2R57A 5DM7R 5HKCA 1YJWT 3HFOA 3CCEA 4E7LA 4A4HA 2CGHA 3R6OA 4J6WA 4RCBA 2KK4A 4OGCA 2LT4A 1WQWA 2AHJB 1NZ9A 4J7FA 4FM4B 2RK1A 3VYGA 2RK2A 2HAXA 3H6ZA 3I55T 1N8RC 1KD1C 2F5TX 2M0OA 3GLXA 4FT2A 4ELZC 4EPCA 3CBOA 3OYJA 5FRMA 2QTXA 1QVGS 1BIAA 4NOYA 3LH0A 1DJ7B 2PU9B 3CC7T 3LYIA 1JB0E 4MDWA 3JB9F 3GIBA 3INZA 3J7AF 2HQXA 4B9XA 3C94A 4N4HA 1M4ZA 4KUIA 1ZBXA 4OB2B 3E9GA 2KY9A 3HFNA 3L2RA 3MEUA 3HL8A 2EJGA 2ZPGB 3GOXA 3QIIA 1HK9A 3NTHA 4J6YA 3TEEA 3JB9G 2DZ9A 5GAOn 3OYMA 1M1GA 4M77D 2GCXA 5FLXE 5GAMj 3BY7A 2WSCE 2Y4YA 2L5QA 5GANf 4BUGA 1KHCA 3C12A 5DLQE 3CMET 2E65A 4JJNK 4OF1A 4JRIA 2JUFA 3O8VA 2KVQG 3NTKA 4DA4A 3CMAT 5KCOA 3SFMA 1OI1A 2RHYA 2ZPEB 5CK9A 2E6ZA 2JOYA 1Y96B 3V8JA 1YI2A 1VQLA 1V29B 1R8OB 1Y96A 3A8LB 5M9OA 4XU1A 2D6FA 3RKWA 4A53A 3LWIA 4C92B 1W4SA 4JLIA 4PL6A 1SSFA 3RKYA 4C92C 3JCMb 3CCET 1KQSA 3PMIA 2EQMA 3ZEHA 5GAOr 4F7UE 1QVFA 4EMHA 3CCSA 2XD0A 3X25B 3CCLA 1OZ3A 2DIGA 1O75A 1B34B 3G71T 1BYMA 2QQBA 4EMKB 1B34A 3QJ6A 3PMTA 1W2BS 3C95A 4OMFB 5CQXA 3EFRA 3VYHB 3FC3A 2RM4A 4ZGEB 2VYTA 3OMCA 3OS5A 3CEYA 2FHDA 3CMAA 5L8RE 4E47A 2EJFA 1UEBA 1Y7XA 5D6WA 2O01E 3M9QA 2DZCA 4QVZA 3CMEA 4Q5WA 4C8QF 1G3TA 3LW5E 3PFSA 1Y71A 2JVVA 4M78G 2VUBA 3V8KA 1VQOT 4ZN3A 4IUPA 1YJWA 4KUDK 4PJOA 3L2QA 3CC7A 1N27A 5CAIA 1VQ4A 2OTJA 2LNVA 1N9RA 4XK8E 1OZ2A 2LCLA 4A4EA 4BDZA 2FYKA 3META 4B9WA 4C92D 4LDWA 3SD4A 2VXFA 2R58A 2MWOA 4PLLA 4M7AF 3KBGA 2O4XB 3CPWS 3MCAB 3L2ZA 4M7AE 3G4SA 4BY6B 5GAN2 3M53A 4C8QD 2E64A 4C8QB 1YJ9T 1YJ9A 4C5HA 1N8RU 4L5GA 1GXIE 5GANd 1PSFA 2K5IA 4RMOA 2A3LA 5FRNA 3OW2S 3CBPA 4BI3A 5GAOq 3RESA 3ME9A 4IUQA 4LD9K 2LX9A 2E12A 2RJFA 2DAQA 1XOVA 3MP1A 4II1A 4M77B 4XTXA 1YCYA 5IAYA 1VQOA 2K5FA 1XNIA 4XU0A 3F70A 4IUVA 3TCJA 5GMKl 5CR2A 1VQ7A 4MDXA 5CQYA 3QZ5B 2VV5A 1X01A 3A8HB 5I21A 2C06A 2Y4XA 1Q81C 4Y28E 3OB9A 1XQHA 3QXEB 4PJOE 2L8DA 5GMKe 1KQ1A 4PKCC 3P8DA 3G4ST 3URGA 3E1SA 1S72A 3KUFA 3PNWC 4QQGA 3JCMg 4M75C 2K2VA 3CCLT 1MGQA 3RKXA 1NJIU 2RJDA 1QVPA 1QW1A 2CZ7B 3FIFA 1G3SA 2H3JA 5LJ5j 1VQ4T 3TREA 1G3WA 3QDRB 4N4GA 4XQ3A 1I8FA 2DXUA 1N9SA 3SWNA 4BI4A 2RH2A 3CXCS 3RUXA 1WJRA 3S3MA 1VQ8A 3PIPA 2I2LA 2HD0A 1H3ZA 4FL6A 4M7AB 2PVGB 2P4TA 3BW1A 2WSFE 2ZGWA 1M8VA 4XTVA 2ZPBB 5CVIA 2GFAA 2YLCA 3QO3A 2CZ0B 3BDLA 3QZ9B 3QYHB 5CIUA 2K57A 2P0QA 3OYIA 4OB0B 5GMKh 3MP8A 2FVUA 5D6YA 1I5LA 4C8QG 1YBYA 2KQWA 4BE1A 5LJ5d 2PUOB 4VUBA 5C0MA 3OA6A 2K3YA 1O9SA 4RG2A 4C92E 3M4GA 1IZ6A 3L1AA 5FU7C 2DXCA 2R5MA 1WPYA 2F5KA 5J39A 4M77F 5LJ5g 5J26A 2OAUA 5LJ3f 2XDPA 4JUVA 1KG1A 5GAMd 5KCHA 3BDUA 2E70A 3JRZA 1YHQA 2A7YA 3HP9A 3PT9A 5GMKj 2JZ2A 4NL3A 2QQAA 2CYZB 5GAMh 1VQ8T 5FU7B 3I56T 3OYKA 1H641 3CCQT 3GNGA 3JSCA 3CCRT 4HCBA 2E10A 2DD5A 3QPHA 5LJ3h 3ZBDA 3CD6T 1WJSA 2XIDA 4HT8A 1Q7YU 2MMPA 5GAOm 4MZPA 1YJNT 2EKOA 2HBPA 2RB6A 2DXBA 3G7ZA 2DIQA 2QDYB 5HK0A 3CC2T 5A0LA 1S72T 2O4XA 3FRNA 4BY6C 4M77C 4JRQA 2WSEE 1BI2A 2DD4A 4J5YA 2RI5A 4UC4A 3FEOA 1BI3A 4C0DC 5CKDA 3OYBA 1Q81U 5CKFA 3OYEA 1JJ2A 3QUIA 4OP0A 4M7AG 4FIBA 2P0KA 5D6XA 2KSSA 4N0AA 1NJIC 1QP2A 2X4YA 5GAMe 4M7DB 1Q82U 2CZ1B 2GQVA 5GAN5 2F69A 4M7AA 4FT4A 3MEAA 5LJ5f 1G5VA 1UB4A 1D3BB 4MMKA 1UGQB 2E41A 4O5VA 4C0DB 4ZN1A 5HK3A 2EFIA 4F7UF 3G6ET 1VQ9A 4ZGDB 5A0GA 4X34A 4OB3B 3X20B 3N5BB 3VV0A 4ZGJB 4ZTJA 2DO3A 3T9NA 2DPPB 1YIJA 1M1KU 3CCMT 2NLUA 3OYFA 4M75A 3QBYA 2ZPHB 4EMKA 4M75B 4C5IA 4CRIA 1UGPB 4XTZA 5KE3A 4E7IA 4C92F 3M59A 3CCUT 2RHUA 4HKEA 4M78B 5LL6S 1UGRB 1UGSB 5CO7A 3V7RA 4C5EA 1K9MU 4A4GA 5IT9E 2FB7A 4XU2A 1VQ5A 2DKGA 2RHIA 4TVRA 5GAN6 2DTIA 1LNXA 4JRPA 2V8JA 2LQKA 3PIOA 1W2BA 3JCMd 4R55A 2DEQA 4PJOB 2OTJT 3S6WA 4EDUA 1YITA 3CC4A 1M1KC 3HRUA 4QQDA 1YJNA 1JRIA 3JB9D 4X9DA 1QP3A 1VQPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QVD A;  5LJ5 e;  3JB9 I;  3HFO A;  2CGH A;  4J6W A;  4M78 C;  4RCB A;  5GMK e;  4PJO E;  5GMK m;  1KQ1 A;  2DTO A;  3JB9 J;  3JCM W;  1BIB A;  5LJ3 e;  2VC8 A;  1WQW A;  3JCM g;  4C8Q E;  4M75 C;  1MGQ A;  1LJO A;  3RKX A;  4PJO F;  4X9C A;  5GAN 4;  4C92 G;  4F7U B;  3FIF A;  2YLB A;  5GAO l;  4V2S A;  4QVC A;  5LJ5 j;  2QTX A;  1BIA A;  4NOY A;  4XQ3 A;  3JB9 F;  1I8F A;  2DXU A;  1N9S A;  3JB9 H;  3SWN A;  3GIB A;  3RUX A;  4C92 A;  3INZ A;  1D3B A;  2I2L A;  3HSB A;  5LJ3 j;  4M7A B;  4PJO C;  3BW1 A;  3HFN A;  3V7C A;  5LJ3 g;  2ZGW A;  3FB9 A;  4M75 F;  4XTV A;  5DY9 A;  5GAN j;  1M8V A;  2DXT A;  2EJG A;  2YLC A;  3QO3 A;  3JCM f;  4WF2 A;  4JRK A;  1HK9 A;  5GAN 3;  2K57 A;  4J6Y A;  1WNL A;  3JCM P;  2DZ9 A;  5GMK h;  2EAY A;  4M78 F;  5GAO n;  3JB9 G;  4M77 D;  1I5L A;  4C8Q G;  4PJO D;  5GAM j;  5LJ5 d;  3BY7 A;  2RA2 A;  5GAN f;  4HA8 A;  4MML A;  4DQ2 A;  4C92 E;  1M5Q 1;  2E65 A;  3M4G A;  3L1A A;  4NL2 A;  3RER A;  4JRI A;  5LJ5 g;  1WPY A;  4M78 D;  4C8Q A;  4M77 F;  3QSU A;  5GAM g;  4XU3 A;  5LJ3 f;  4J6X A;  4JUV A;  3AHU A;  5GAM d;  3JCM c;  4M75 D;  3BDU A;  4XTY A;  1Y96 B;  3V8J A;  5GAN 7;  4M77 E;  1Y96 A;  5GMK j;  4XU1 A;  4NL3 A;  4PNO A;  3RKW A;  4A53 A;  2DJZ A;  4C92 B;  5GAM h;  1KQ2 A;  4M77 A;  4JLI A;  2Y90 A;  5GAO p;  1H64 1;  4C92 C;  3RKY A;  3JCM b;  1U1T A;  3SWN C;  2E10 A;  5LJ3 h;  4XTU A;  5GAO r;  4F7U E;  4M7D D;  4HT8 A;  4EMH A;  5GAO m;  2RB6 A;  4EMK C;  1TH7 A;  5GAN 8;  1LOJ A;  3JCM Q;  1B34 B;  2EJ9 A;  4EMK B;  3JCM J;  1B34 A;  5GAN h;  4M77 C;  4M7D C;  4J5Y A;  3EFR A;  3VU3 C;  4EMG A;  1I4K 1;  2RM4 A;  5GAN e;  3V8L A;  4M77 G;  3QUI A;  4OP0 A;  5GMK i;  4M7A G;  4F7U A;  1WQ7 A;  2EJF A;  3EFS A;  4N0A A;  5GAN g;  2RD1 A;  5GAM e;  5I21 A;  3JCM e;  2DZC A;  4M7A C;  4A54 A;  4M7D B;  5GAN 5;  4M7D F;  4C8Q F;  4M7A A;  5LJ5 f;  1JBM A;  4M78 G;  3V8K A;  4MMK A;  1D3B B;  4F7U G;  2E41 A;  4Y91 A;  4PJO A;  4N0A C;  4F7U F;  2EWN A;  5CAI A;  1N9R A;  4RCC A;  4M7D G;  4M75 G;  2FYK A;  4XTW A;  3FJP A;  4C92 D;  3BFM A;  2E1H A;  2VXF A;  3JCM V;  4M7A F;  5LJ3 d;  4M75 A;  2YHT A;  3L2Z A;  4M75 B;  4EMK A;  5GAM f;  4M7A E;  4XTZ A;  4C92 F;  5GAN 2;  2JN0 A;  4M78 A;  2E64 A;  4PJO G;  3RIR A;  3V7S A;  4C8Q B;  4M78 B;  4C8Q D;  3JCM X;  1I81 A;  1HXD A;  5GAN d;  3V7R A;  2VXE A;  4M78 E;  4M7D A;  2FB7 A;  2HNI A;  4XU2 A;  5GAO q;  2DKG A;  3RES A;  3SB2 A;  5GAN 6;  2DTI A;  1LNX A;  3QHS A;  4M7D E;  4C8Q C;  4PJO B;  4M75 E;  2DTH A;  2DEQ A;  4M77 B;  4XTX A;  1YCY A;  3SWN B;  3JCM d;  4XU0 A;  4M7A D;  5GMK l;  3PGG A;  1JRI A;  5LJ5 h;  4HT9 A;  3JB9 D;  1X01 A;  2DVE A;  4X9D A;  3JCM h;  1U1S A; 
#chains in the Genus database with same CATH topology
 4QVD A;  4AFZ C;  2DRM A;  2JTF A;  2FPF A;  2MWP A;  1VQL Q;  1RAE B;  1ZUU A;  3JB9 J;  2VC8 A;  1WXT A;  1ZHI A;  1FX7 A;  2L3S A;  2LCC A;  4KGX B;  1QVF S;  2ESW A;  2J6K A;  3X28 B;  2O2O A;  4PJO C;  4D8K A;  5DY9 A;  3QWX X;  5GAN j;  2QEX A;  1GCP A;  4WF2 A;  1K8A C;  2M0Y A;  3CD6 Q;  1K76 A;  3REB B;  5AT1 B;  1YNZ A;  3PVL A;  5D7U A;  2DL5 A;  4M78 D;  2BKD N;  2E6N A;  3RMQ A;  1ZQ1 A;  1VIF A;  4J7I A;  1VQ6 T;  3AHU A;  3TSW A;  3CCJ T;  1BI1 A;  1N6A A;  3UDC A;  2KYM A;  3L2U A;  2VGN A;  1AEY A;  2X4W A;  4M77 A;  2F2X A;  4JLG A;  1AWO A;  4DOV A;  3G6E A;  5CKE A;  1PNJ A;  1K73 U;  3E19 A;  1SHG A;  2PVD B;  1X6O A;  2X4J A;  3OBY A;  5GAN 8;  3S3M A;  3CCU A;  4FSS A;  2LTO A;  2HQE A;  3V8L A;  2K7A A;  1VQ6 Q;  2XKO C;  1RAF B;  2G6F X;  1QWF A;  1M2O A;  3CQT A;  4M7D F;  1JO8 A;  2CP2 A;  4QQ6 A;  2EWN A;  4RCC A;  2GNC A;  2C0I A;  4IUT A;  2D8H A;  3JCM V;  3VS3 A;  4HCC A;  5GAM f;  2GQI A;  3RIR A;  1Q81 R;  3H0H A;  1I81 A;  2DA9 A;  4HXJ A;  3P8H A;  2XIC A;  1PCX A;  1UEC A;  3G1J A;  1ARK A;  5IN1 A;  4E2F B;  3CCM A;  2JJ9 A;  3AT1 B;  3OW2 A;  4M7D E;  2FG0 A;  2E5Q A;  4M7A D;  3U23 A;  2DBM A;  2FL7 A;  3RBB B;  2VGM A;  3ER0 A;  4M78 C;  5FU6 B;  2SEM A;  2DTO A;  3CBM A;  4BD3 A;  1PG5 B;  2DYB A;  2ABL A;  2RQU A;  2PNI A;  2X3W D;  2J05 A;  5CKB A;  2RQW A;  2DX1 A;  1ZSZ A;  5LJ3 g;  4M75 F;  1VQK T;  3O5Z A;  2KBT A;  2WAC A;  3L42 A;  2OI3 A;  2VWF A;  3I9Q A;  2GTJ A;  4M78 F;  1AZG B;  3EAE A;  3ZL7 C;  4PFP A;  1M90 U;  1M5Q 1;  3JV3 A;  3M55 A;  2HCK A;  1ZLM A;  4KBM B;  4IUR A;  3PE0 A;  2LRQ A;  4GLM A;  3OQ5 A;  1VQN A;  2JM9 A;  1MMG A;  2KR3 A;  3VS4 A;  1K9M R;  2ZPF B;  1IGU A;  2Y90 A;  5I2M A;  2YXY A;  4J9G A;  4ANJ A;  4Z89 A;  3I56 Q;  1VQ8 Q;  3JCM J;  3OYN A;  4Z02 A;  2LDM A;  3VU3 C;  3LLR A;  4M77 G;  2ENM A;  3M56 A;  3L2V A;  1Y07 A;  1WQ7 A;  3EFS A;  4BE0 A;  2RD1 A;  1QQJ A;  2RI2 A;  1NE8 A;  2CS7 A;  3A5Z B;  1JBM A;  1E7O A;  1TUD A;  1ZSZ B;  3QG1 A;  1K9M C;  3RR6 A;  1PHT A;  3FJP A;  1PRL C;  4ELY C;  7AT1 B;  3E9F A;  6AT1 B;  1X6B A;  4PJO G;  4QW2 A;  2DNU A;  1KHI A;  3WVD B;  1ZSG A;  1QKW A;  2AK5 A;  3QHS A;  4J9C A;  2ZPI B;  2JMA A;  3DLL A;  2EYZ A;  4HT9 A;  2X4X A;  3M0U A;  1YI2 T;  2FO0 A;  2R57 A;  5HKC A;  1OEB A;  4HVV A;  4A4H A;  1IXD A;  2NUT B;  2LT4 A;  4A63 B;  2RK1 A;  2DFU A;  1X27 A;  3OYJ A;  4EPC A;  3BE3 A;  3CBO A;  4J9H A;  2QTX A;  3SEM A;  3JB9 F;  1WYX A;  3LYI A;  3J7A F;  2HQX A;  5GJW B;  3HFN A;  3MEU A;  5KYW B;  4JJB A;  3BY7 A;  2Y4Y A;  2L5Q A;  1MV0 B;  1ZBJ A;  1NM7 A;  1BB9 A;  2KVQ G;  3NTK A;  1OI1 A;  2D6F A;  4C92 B;  1W4S A;  4FYY B;  4PL6 A;  4C92 C;  4Z88 A;  3ZEH A;  5IHK A;  3TSZ A;  1QVF A;  3CCS A;  2XD0 A;  3CCL A;  1OZ3 A;  3H9N A;  4WTO B;  3G4S Q;  1BYM A;  1GCQ C;  1B34 A;  2NYS A;  1RAI B;  2QA4 Q;  3NGP A;  4ZGE B;  2QEX Q;  1WFW A;  3OS5 A;  4KH1 B;  3CMA A;  1WA7 A;  5D6W A;  1TSF A;  2HSP A;  4Q5W A;  4KUD K;  4M78 G;  4EIK A;  1N27 A;  1VQ4 A;  2LCL A;  5KYX A;  4BDZ A;  1T3S A;  2FYK A;  4C92 D;  2DRK A;  4KGZ B;  1OOT A;  3KBG A;  3MCA B;  3CC7 Q;  2OTJ Q;  1X43 A;  1YJ9 T;  1W70 A;  3OW2 S;  3RES A;  1LCK A;  4F16 A;  3MP1 A;  1YCY A;  5IAY A;  2YT6 A;  1RAC B;  3F70 A;  5CR2 A;  1VQ7 A;  3A8H B;  1X01 A;  1F1B B;  1M3A A;  2YUN A;  2O31 A;  3EHQ A;  3QXE B;  4PJO E;  2DBK A;  3JCM g;  4M75 C;  2K2V A;  1MGQ A;  2CP0 A;  1Z9Z A;  2MCN A;  1WX6 A;  4XQ3 A;  2LJ3 A;  2P4R A;  2CP7 A;  2MIO A;  1CKA A;  3SWN A;  2LJ0 A;  1T0J A;  1WJR A;  1OQK A;  3PIP A;  2HD0 A;  1H3Z A;  3BW1 A;  1M8V A;  1YIT Q;  2YLC A;  3QO3 A;  2A08 A;  3QZ9 B;  3BDL A;  4JZ3 A;  1WXU A;  3MP8 A;  1I5L A;  1YBY A;  2PUO B;  1X2K A;  1UUE A;  4RG2 A;  2JS0 A;  1IZ6 A;  5J26 A;  2OAU A;  1VQP Q;  2EVR A;  4JUV A;  1SHF A;  1KG1 A;  1WHG A;  2DL8 A;  5KCH A;  2E70 A;  3JRZ A;  1WHL A;  3HP9 A;  2VAS A;  1YN8 A;  5IH2 A;  2CYZ B;  1N8R R;  2YSQ A;  3EGX B;  3OYK A;  2CUD A;  3GNG A;  3CCR T;  2E10 A;  5LJ3 h;  4B6M A;  4OMQ A;  1RLP C;  2MMP A;  2J7I A;  1YJN T;  2DXB A;  3G7Z A;  5HK0 A;  2WSE E;  4C0D C;  5CKD A;  3FEO A;  3OYE A;  1PKS A;  3VS2 A;  4FIB A;  1R0B G;  1QP2 A;  4FYV B;  5GAM e;  2CZ1 B;  1OV3 A;  4M7A A;  5LJ5 f;  5HK3 A;  2HBW A;  2YUQ A;  1KQS P;  1YP5 A;  4OB3 B;  3X20 B;  2I0N A;  2FEI A;  3N5B B;  3T9N A;  4ESR A;  3H0F A;  4M75 A;  3QBY A;  1JEG A;  2DL7 A;  4HKE A;  3NMZ C;  1VQ5 A;  2RHI A;  4F17 A;  1LNX A;  2LQK A;  4RTX A;  1W2B A;  3JCM d;  5EC7 A;  4QQD A;  1YJN A;  2L3Q A;  3OYB A;  1VQP A;  4IKF A;  1U3O A;  2V1R A;  2DK3 A;  1FWZ A;  2XK0 A;  2RJC A;  4XAX B;  5LJ3 e;  2OTL Q;  1M8M A;  4X9C A;  4BB7 A;  2GF7 A;  3QWY A;  1VYU A;  1NPP A;  1BI0 A;  3JB9 H;  3CCR A;  2K4Y A;  1D3B A;  1UGV A;  2RHX A;  4DEX A;  1RAH B;  2G3R A;  1Q86 C;  5KYX B;  4ATO A;  2EAY A;  1YFN A;  4HA8 A;  2LT1 A;  4DQ2 A;  2SRC A;  1JU5 C;  1ZA1 B;  4NL2 A;  2HEQ A;  3S3O A;  4LD6 A;  1VOM A;  2HQH A;  2R5A A;  1R77 A;  1VQK Q;  2KYB A;  1G3Y A;  2J06 A;  3DLM A;  3GF5 A;  3CCV Q;  1Y57 A;  5GAO p;  3VRY A;  3QKJ A;  4CI0 C;  1U1T A;  2EQK A;  4A4K A;  3I56 A;  2KAF A;  2GFU A;  2CKK A;  4F04 B;  3CCV T;  2D8J A;  1UE9 A;  4P5N A;  5IXF A;  4F7U A;  3HHT B;  3HTR A;  3JCM e;  3MEV A;  1VQM Q;  1EFN A;  2EIF A;  3QDF A;  1BU1 A;  2E1H A;  4A4F A;  3H8Z A;  2ZZD A;  2YHT A;  2QAZ A;  3CC2 Q;  2EBP A;  3OSV A;  4JS5 A;  2COW A;  2BUD A;  2KT8 A;  5AYF A;  3WXM B;  3Q1J A;  1NLP C;  1OU9 A;  4OGE A;  1OYX A;  4C0F A;  4DBR A;  2KI7 A;  2EYQ A;  2DM1 A;  1C0M A;  1M1F A;  3OYY A;  1XJW B;  3FDR A;  2FPD A;  3MPU B;  3CCV A;  3GP8 A;  2NWM A;  4C8Q E;  1M9S A;  4BAC A;  4V2S A;  2DL3 A;  1G2B A;  2JXB A;  4LDU A;  3HSB A;  3OYA A;  5A2Q E;  2RO0 A;  3CXC A;  4LDY A;  4QKU A;  4JRK A;  1GL5 A;  1VQ6 A;  1KC8 R;  3THK A;  3VUZ A;  3NPF A;  4E6R A;  2P0P A;  2ROL A;  1WGS A;  4LXC A;  4OMN A;  1ABQ A;  4ZNX A;  1W1F A;  2K3X A;  2B86 A;  1BK2 A;  2QG9 B;  3MEW A;  3M4Y A;  1AWW A;  2QI2 A;  5IHI A;  4M7D C;  4RG8 A;  3A8M B;  2LMJ A;  5FRO A;  1VQP T;  1QWE A;  3LWH A;  3J81 E;  4FU6 A;  5GAN g;  2XHC A;  4M7A C;  2MYS A;  2M9U A;  1UFF A;  3CPW A;  2LQ8 A;  4HVU A;  3S3N A;  3OY9 A;  2ROT A;  3LX7 A;  3OYL A;  4M7D G;  4MZM A;  4KRT A;  3EH2 A;  1YIT T;  1UTI A;  1YI2 Q;  1RI0 A;  3GPL A;  5LJ3 d;  2RN8 A;  3EG3 A;  4RKU E;  4K11 A;  3M5A A;  4MZT A;  4OB1 B;  3G71 Q;  1VA7 A;  4FYX B;  4M78 A;  3G71 A;  3JCM X;  1HXD A;  3M58 A;  2YRV A;  1K8A U;  1TWB A;  3KXT A;  1TG0 A;  4PLI A;  1TOV A;  2BE9 B;  1VQ5 T;  2DVE A;  5DM7 R;  3EG9 A;  1YJW T;  3CCE A;  5FWB A;  4RCB A;  2CH4 W;  4DBQ A;  1WQW A;  4LUD A;  2JM8 A;  4AG2 C;  4FM4 B;  2XMF A;  1NBE B;  2HAX A;  3H6Z A;  2X3X D;  1YJ9 Q;  4FT2 A;  3GLX A;  1MMN A;  1BIA A;  4NOY A;  3CC7 T;  1MMD A;  2PU9 B;  2OTJ T;  2EYY A;  4J9B A;  2EYW A;  3C94 A;  4N4H A;  1M4Z A;  4B9X A;  2QYZ A;  4OB2 B;  1HJD A;  2EJG A;  2ZPG B;  1JXO A;  3GOX A;  3QII A;  2RF0 A;  2DZ9 A;  1M1G A;  4J9I A;  2GCX A;  2BTT A;  2MPX C;  1KHC A;  2O88 A;  4AG1 C;  4OF1 A;  4JRI A;  1VQ7 Q;  4DA4 A;  3CMA T;  2HKQ B;  2DER A;  5CK9 A;  2X9H A;  2JOY A;  1Y96 B;  1VQL A;  2FZG B;  2YWW A;  4XU1 A;  3REA B;  3RKW A;  3LWI A;  2K9G A;  1SSF A;  4CC2 A;  1KQS A;  1M30 A;  1M1K R;  3X25 B;  3G71 T;  4EMK B;  1WI7 A;  3PMT A;  2CH4 A;  3VYH B;  3UA7 A;  2RM4 A;  3CEY A;  3ULR B;  2EJF A;  1T0H A;  1UEB A;  2DVJ A;  3CME A;  1SPK A;  3LW5 E;  1Y71 A;  4PJO A;  3V8K A;  3L2Q A;  1RAG B;  1OZ2 A;  2LCS A;  2L2P A;  1SF9 A;  3SD4 A;  2VXF A;  2R58 A;  4M7A F;  3CCS Q;  2CSI A;  4FW1 A;  2O4X B;  3CPW S;  2C0O A;  2BZY A;  2M02 A;  4RTU A;  1GXI E;  4RMO A;  2AZV A;  4BI3 A;  4LD9 K;  2E12 A;  4HCK A;  4M77 B;  4PK4 A;  2CT4 A;  4IUV A;  5GMK l;  4MDX A;  5CQY A;  4D8D A;  2C06 A;  2VV5 A;  5I21 A;  3I5R A;  2Y4X A;  1Q82 R;  2YDL A;  1XQH A;  1YIJ Q;  1KQ1 A;  3P8D A;  3KUF A;  3CCL T;  2RJD A;  1QVP A;  3FIF A;  2CZ7 B;  3VS7 A;  1RAB B;  1VQ4 T;  3CXC S;  2RH2 A;  1VQ8 A;  2X51 A;  2PVG B;  2ZGW A;  4XTV A;  3IQL A;  3QYH B;  5CIU A;  2E3I A;  2K57 A;  2P0Q A;  2FVU A;  4DBF A;  1IHV A;  4BE1 A;  4VUB A;  3OA6 A;  2K3Y A;  1O9S A;  4C92 E;  2NUT A;  2R5M A;  2IPO B;  5LJ5 g;  3CCJ Q;  5LJ3 f;  5FW9 A;  3BDU A;  1QVF P;  1YHQ A;  3PT9 A;  3SHW A;  5GMK j;  2JS2 A;  3I56 T;  1H64 1;  3CCQ T;  4CC3 A;  2H8H A;  2KEA A;  2DD5 A;  3I5S A;  4HVW A;  2XID A;  1YHQ Q;  4HT8 A;  1Q7Y U;  1YWO A;  2HBP A;  2RB6 A;  2DIQ A;  2QDY B;  3CC2 T;  1AVZ C;  4BY6 C;  4JRQ A;  2KE9 A;  2RI5 A;  1JJ2 A;  5CKF A;  3QUI A;  4OP0 A;  2P0K A;  3CXC P;  2X4Y A;  4M7D B;  2RNA A;  4C0D B;  4ZN1 A;  2EFI A;  4F7U F;  4R0K A;  2E3H A;  2DF6 A;  2DPP B;  1M2V B;  1X2Q A;  2NLU A;  3OYF A;  2L3P A;  2ZPH B;  3NHN A;  4PFO A;  2KRS A;  5KE3 A;  4C92 F;  1QLY A;  2QGG A;  2FZK B;  4A4G A;  5IT9 E;  4XU2 A;  2FRW A;  2DTI A;  4IIM A;  1QCF A;  2LJ1 A;  3S6W A;  1YIT A;  3HRU A;  2HZY A;  3G6E T;  1IO6 A;  3CC4 T;  2PTK A;  3SDZ A;  1X69 A;  2KDS A;  9ATC B;  2QQR A;  1XTD A;  2LC4 A;  2QQ9 A;  1NEG A;  2YLB A;  4LDV A;  3A8G B;  4X1V A;  1AHJ B;  4R56 A;  5GJV B;  2D0Q B;  2DXT A;  5GAN 3;  1AWJ A;  3HKS A;  1WZO A;  3J80 E;  2L3R A;  2OTL T;  1J3T A;  5FU6 C;  1MUZ A;  1QCO A;  3M0P A;  1KD1 R;  2RQT A;  4J6X A;  3JCM c;  1EIF A;  2ZCF B;  4XTY A;  1FYN A;  1Q86 U;  2DIL A;  1QVG A;  4M77 E;  4PNO A;  4HCZ A;  1KQ2 A;  2KXD A;  4J8O A;  4J83 A;  3LGL A;  1NYF A;  4KH0 B;  2BE7 D;  4XTU A;  3M57 A;  4M7D D;  1UJY A;  2CZ6 B;  3JCM Q;  2EJ9 A;  4JPB W;  1NPR A;  3VS5 A;  2K2M A;  2XDD A;  2LVM A;  5KE2 A;  3M0R A;  2EQU A;  1ACM B;  4A54 A;  3UF4 A;  2QXF A;  1GFC A;  1GBQ A;  2IG0 A;  1YIJ T;  2XU8 A;  2MOX A;  4ZTF A;  1D0Z A;  4XTW A;  1FMK A;  5CKH A;  1WXB A;  2XI9 A;  1KQS S;  1PWT A;  5L23 A;  1FXX A;  3V7S A;  4IUU A;  1YJN Q;  1D1C A;  3NTI A;  1ZA2 B;  4M7D A;  3PTA A;  1CKB A;  4ME7 A;  1FMV A;  1Q82 C;  2K5L A;  1ZX6 A;  4E7J A;  2F2V A;  1D0X A;  3CCS T;  1SKU B;  1PRM C;  3EHR A;  4OML A;  1M90 R;  1B7T A;  4CC7 A;  5GMK m;  2NUZ A;  3MP6 A;  2JT4 A;  2M16 A;  5KYU A;  4C0Z A;  1IRX A;  2KMT A;  1OU8 A;  4QT7 A;  1M27 C;  5GAN 4;  3H0I A;  1VUB A;  3ASK A;  4QVC A;  3HPW A;  2K6D A;  2D9T A;  3MJX A;  1K1Z A;  2A0F B;  3DKM A;  5LJ3 j;  2PVO B;  3FB9 A;  4Z8A A;  3JCM f;  4JDS A;  4KT0 E;  2LZ6 B;  2KGT A;  3EG2 A;  3CCE Q;  2B8A A;  2LQN A;  4MML A;  5I2S A;  4PJN A;  3RER A;  4C8Q A;  1Q7Y C;  4O6J A;  1UJ0 A;  4RUG A;  2KRM A;  2EQJ A;  3UT1 A;  4M75 D;  1PM3 A;  1WHK A;  2YUP A;  4GY5 A;  3CCQ A;  1MMA A;  1VQ7 T;  5J3B A;  3A98 A;  3L2W A;  2XG8 D;  1GCQ A;  1IRE B;  1YHQ T;  3VKI A;  2DEU A;  2CDT A;  2HMA A;  1IGQ A;  2A37 A;  2AKK A;  3E2U A;  5KYU B;  4NS5 A;  5GAN h;  1AZE A;  4OMO A;  3UA6 A;  4KUL A;  4DOW A;  2V8I A;  4RTW A;  4J9D A;  4AT1 B;  4PJL A;  1VQ9 T;  2RHZ A;  2MI6 A;  3X24 B;  1JXM A;  4N0A C;  4JS4 A;  2BZ8 A;  1YWP A;  4BI8 B;  3OS0 A;  1QMC A;  1K73 R;  2QA4 T;  5HY6 A;  4D6W A;  4LDX A;  2FPE A;  1JJ2 P;  2OX7 A;  3UWN A;  2VXE A;  1MV3 A;  4E7K A;  5KH6 A;  3SB2 A;  3CD6 A;  2O9S A;  2HDA A;  4C8Q C;  3SWN B;  2DTH A;  3UPU A;  2GTO A;  2RQR A;  1JJ2 S;  5LJ5 h;  4AFQ C;  2V26 A;  2QK0 A;  4E7L A;  2CGH A;  3R6O A;  4J6W A;  1S72 Q;  3M0T A;  3EG0 A;  4OGC A;  2DL4 A;  2AHJ B;  4J7F A;  2JMC A;  1MND A;  2RK2 A;  2F2W A;  1AD5 A;  2F5T X;  2M0O A;  3LH0 A;  1WHM A;  3R6N A;  3INZ A;  1RUW A;  3E9G A;  2KY9 A;  3L2R A;  1VYV A;  3HL8 A;  5IHN A;  2JW4 A;  1HK9 A;  3NTH A;  3TEE A;  3JB9 G;  1SRM A;  3EH1 A;  5FLX E;  5GAM j;  2WSC E;  5GAN f;  4BUG A;  3C12 A;  5DLQ E;  4JJN K;  3O8V A;  5KCO A;  2RHY A;  2E6Z A;  3V8J A;  1V29 B;  3A8L B;  1JQQ A;  4JLI A;  3RKY A;  1LVK A;  3M0S A;  3PMI A;  2EQM A;  1BCO A;  1KIK A;  4EMH A;  2DIG A;  1O75 A;  1B34 B;  1B3Q A;  3TVT A;  4OMM A;  3C95 A;  4OMF B;  2FHD A;  4E47 A;  3CMA Q;  4Y92 A;  3M9Q A;  2DZC A;  4ORZ A;  4QVZ A;  1VQO T;  2NUP A;  3CME Q;  1G8X A;  4IUP A;  3RDV A;  3CC7 A;  2OTJ A;  2BZX A;  2LNV A;  4A4E A;  1TS9 A;  2OJ2 A;  3MET A;  4LDW A;  2AIR B;  4PLL A;  5I22 A;  1I07 A;  1K8A R;  3L2Z A;  4M7A E;  2H3E B;  3M53 A;  2E64 A;  1E6H A;  4C8Q B;  2KNB B;  1RLQ C;  5GAN d;  1NLO C;  2A3L A;  4RTZ A;  4LUE A;  3VS0 A;  5GAO q;  3ME9 A;  2RJF A;  1VQO Q;  4II1 A;  4RTY A;  4XTX A;  1VQO A;  1IB8 A;  2K5F A;  2ATC B;  1XNI A;  4XU0 A;  4J9F A;  1YJW Q;  2CP6 A;  3QZ5 B;  2K3B A;  1VQ5 Q;  3C0C A;  1Q81 C;  3OB9 A;  1WIE A;  5GMK e;  4PKC C;  3G4S T;  1S72 A;  2GGR A;  3PNW C;  3RKX A;  1NJI U;  1WHJ A;  1GRI A;  1QW1 A;  2KRO A;  1G3S A;  1A0N B;  1G3W A;  4N4G A;  1I8F A;  2W10 A;  1VYT A;  4FL6 A;  4M7A B;  2P4T A;  3OYI A;  4OB0 B;  2LQW A;  5D6Y A;  4C8Q G;  2KQW A;  4CC4 B;  5LJ5 d;  1WLP B;  1N5Z A;  3M4G A;  1E6G A;  5FU7 C;  5J39 A;  1SSH A;  4M77 F;  2XDP A;  4JJC A;  2CUB A;  2A7Y A;  1EX4 A;  2E5K A;  5KYW A;  1PD1 A;  4HCB A;  3QPH A;  3ZBD A;  4J9E A;  1WJS A;  1H92 A;  1ABO A;  2EKO A;  2ECZ A;  1S72 T;  3FRN A;  4M77 C;  2D1X A;  1KK7 A;  2VB6 A;  1Q81 U;  4M7A G;  5D6X A;  4PFZ A;  1NJI C;  1TXQ A;  2LNH B;  2GQV A;  5GAN 5;  1D0Y A;  1CSK A;  1D3B B;  1V76 A;  1UGQ B;  4O5V A;  8ATC B;  4FCY A;  2A28 A;  2EPD A;  4ZGD B;  5A0G A;  4OMP A;  3VV0 A;  2DO3 A;  2HL3 A;  1YIJ A;  2ED0 A;  1M1K U;  4EMK A;  4M75 B;  1T3L A;  1UGP B;  4XTZ A;  2JTE A;  1K0S A;  3M59 A;  1H3H A;  2RHU A;  4M78 B;  4C5E A;  2DKG A;  4JRP A;  2V8J A;  2NUP B;  4EDU A;  1UHC A;  1JRI A;  1QCN A;  4X9D A;  1QP3 A;  4C5I A;  1C6V X;  2QAS A;  2EYX A;  1KC8 U;  3PVQ A;  4PJM A;  3GNF B;  5KYY B;  3JCM W;  3UAT A;  1OPK A;  1LJO A;  4PJO F;  4E7S A;  2LP5 A;  4YTL A;  5GAO l;  2RJE A;  2JNG A;  2IIM A;  4OVA A;  3LH5 A;  2OTL A;  2IVW A;  2EGE A;  3DB4 A;  2MF2 A;  1I0C A;  3P8B B;  3VS6 A;  3LGF A;  3JCM P;  3WVE B;  5CCA A;  4PJO D;  1P92 A;  3MKD A;  3CCR Q;  2RA2 A;  1VQM T;  2HKN A;  2PQW A;  5IXB A;  2M1H A;  1LPL A;  1VQL T;  2LX7 A;  2XDB A;  2AT1 B;  1K73 C;  3QYG B;  3QSU A;  4XU3 A;  3VUB A;  3MO8 A;  3TU4 K;  1IHW A;  5GAN 7;  1ZUY A;  3EG1 A;  2EW3 A;  2DJZ A;  3SWN C;  2V8K A;  2X35 A;  1TH7 A;  1LOJ A;  3OMG A;  2AKL A;  2A36 A;  4RTV A;  1FMW A;  2DE0 X;  2MAM A;  4N4I A;  1MHN A;  1KC8 C;  5GAN e;  1BCM A;  2QQS A;  2CRE A;  1VQK A;  2RI3 A;  1VQM A;  1OX9 A;  1SG5 A;  4F7U G;  2KRN A;  3CPF A;  5A0D A;  3MHX A;  4Y91 A;  3EGD A;  3EGD B;  4AFU C;  3VS1 A;  3OYH A;  1R0C B;  3OS2 A;  3OYC A;  3JAM E;  1Q7Y R;  5EG2 A;  5HCK A;  2DMO A;  4BE2 A;  3DB3 A;  5ECA A;  1I1J A;  2L0A A;  2HNI A;  3NFC A;  2JTM A;  2BIV A;  2HL5 C;  4IIO A;  1U8R A;  3CC2 A;  2J6F A;  4GBQ A;  4LN2 A;  2M51 A;  1U06 A;  3PGG A;  3CCJ A;  3OYD A;  3C4S A;  5LJ5 e;  3JB9 I;  5DLO A;  1BIB A;  1TUG B;  2VKN A;  3HRT A;  1YCS B;  1D1A A;  1BBZ A;  1ZUK A;  8AT1 B;  4C92 G;  4F7U B;  1M90 C;  3OYG A;  4BDY A;  2QEX T;  4C92 A;  3EGU A;  3V7C A;  4M4Z A;  2W0Z A;  1W2B P;  3VJP A;  2CP5 A;  1WNL A;  3A8O B;  3HRS A;  3EG9 B;  1M3C A;  2DLP A;  1PSE A;  4FSX A;  5KYY A;  4E7H A;  1UDL A;  4DBH A;  1VQN T;  2V1Q A;  3X26 B;  1PKT A;  5GAM g;  1D09 B;  2E4H A;  1VIE A;  3ZFJ A;  1SRL A;  1OPL A;  3QJY A;  2DJQ A;  1PD0 A;  3EGX A;  1X75 C;  4FW2 A;  1HD3 A;  1RAA B;  4EMK C;  1RI9 A;  1AOJ A;  1RL2 A;  3OSS C;  3M54 A;  2CT3 A;  1KD1 U;  4EMG A;  1I4K 1;  2OAW A;  3CC4 Q;  3OS1 A;  3I55 A;  5GMK i;  2L89 A;  3FLG A;  4L59 A;  1H8K A;  1QVG P;  5C6S A;  2QA4 A;  4C0G A;  4M75 G;  3OBW A;  2PUK B;  3RMS A;  3CPW P;  4L6V 5;  3BFM A;  1BKB A;  3CCM Q;  2FRY A;  1NJI R;  2JN0 A;  2QDL A;  4M78 E;  1WDX A;  2CSQ A;  4M75 E;  4AMC A;  1WJQ A;  4C5G A;  2GBQ A;  1K9A A;  4GLK A;  3JCM h;  1U1S A;  2C0T A;  4E7Z A;  3HFO A;  2VVK A;  2O9V A;  2F1L A;  2KK4 A;  3A1P A;  1NZ9 A;  4AFS C;  1VQ9 Q;  3I35 A;  1WHH A;  3TQ7 P;  3VYG A;  1I5O B;  3I55 T;  1N8R C;  1KD1 C;  4ELZ C;  3CCQ Q;  5FRM A;  1QVG S;  1DJ7 B;  1JB0 E;  4MDW A;  3GIB A;  1K4U S;  2CP3 A;  4KUI A;  1ZBX A;  4LE9 A;  2ZAE A;  4J6Y A;  3I55 Q;  5GAO n;  4RTT A;  3OYM A;  4M77 D;  3CME T;  2E65 A;  2K79 A;  3M0Q A;  2COZ A;  2JUF A;  1TUC A;  1D1B A;  3SFM A;  5I11 A;  2ZPE B;  1YI2 A;  1Y96 A;  1R8O B;  5M9O A;  1ZSZ C;  4A53 A;  2PZ1 A;  1VQ4 Q;  3JCM b;  3CCE T;  4F14 A;  1OX8 A;  2RMO A;  4F7U E;  5GAO r;  1Q95 G;  3CCL Q;  2FZC B;  1AT1 B;  2QQB A;  3QJ6 A;  1NYG A;  1W2B S;  1Z9Q A;  5CQX A;  3EFR A;  3FC3 A;  2VYT A;  3OMC A;  5L8R E;  1Y7X A;  2O01 E;  3OW2 P;  3KFV A;  4C8Q F;  1G3T A;  3PFS A;  2JVV A;  2VUB A;  4ZN3 A;  1YJW A;  5CAI A;  4XK8 E;  1N9R A;  1RAD B;  1KFZ A;  4WCI A;  4B9W A;  2MK5 A;  4DEY A;  2MWO A;  1NEB A;  2YUO A;  1NG2 A;  2YRC A;  3G4S A;  1K0X A;  4BY6 B;  5GAN 2;  2QTV A;  4C8Q D;  1N8R U;  1YJ9 A;  4C5H A;  4L5G A;  1PSF A;  2K5I A;  5FRN A;  2EKH A;  3CBP A;  1Q86 R;  4IUQ A;  2LX9 A;  2DAQ A;  1XOV A;  2COY A;  3TCJ A;  2AZS A;  1UHF A;  2DET A;  2EGA A;  3D7S B;  4Y28 E;  5FWC A;  1VQN Q;  2L8D A;  2J6O A;  3URG A;  3E1S A;  2DYI A;  4QQG A;  1HYO A;  1HSQ A;  2RQV A;  1PC0 A;  2H3J A;  5LJ5 j;  3TRE A;  3QDR B;  1Y0M A;  2DXU A;  1N9S A;  4BI4 A;  3RUX A;  2I2L A;  1UG1 A;  2WSF E;  3EFO A;  2ZPB B;  5CVI A;  3EFO B;  2GFA A;  2CZ0 B;  2D0N A;  5GMK h;  1QKX A;  1TU0 B;  5C0M A;  1M2V A;  1SEM A;  4PJJ A;  3L1A A;  2DXC A;  2Z0W A;  1WPY A;  2F5K A;  1C1A A;  1V1C A;  5GAM d;  3H41 A;  3GBQ A;  2JZ2 A;  1KJW A;  1W6X A;  2QQA A;  4NL3 A;  5GAM h;  1VQ8 T;  5FU7 B;  4FYW B;  1TTH B;  1AWX A;  3JSC A;  1MNE A;  2KXC A;  1KSW A;  3CD6 T;  3RNJ A;  5KYN A;  1B07 A;  5GAO m;  4MZP A;  3FJ5 A;  4JZ4 A;  5A0L A;  2O4X A;  1BI2 A;  2DD4 A;  2EQI A;  4J5Y A;  4UC4 A;  1BI3 A;  1GBR A;  1X6G A;  1U5S A;  2KT1 A;  2KSS A;  4N0A A;  4LNP A;  1Q82 U;  2F69 A;  4FT4 A;  3MEA A;  4KGV B;  1G5V A;  1UB4 A;  2YRD A;  4MMK A;  2E41 A;  1VQ9 A;  1G83 A;  4X34 A;  2EGC A;  2RPN A;  4ZGJ B;  4ZTJ A;  2ED1 A;  3G6E Q;  3VRZ A;  2P84 A;  3CCM T;  1EZZ B;  4CRI A;  4E7I A;  3CCU T;  1GFD A;  5LL6 S;  2QGF B;  1UGR B;  1UGS B;  5CO7 A;  3V7R A;  1K9M U;  2FB7 A;  5GAN 6;  4TVR A;  1M3B A;  4JJD A;  3CCU Q;  3PIO A;  4PJO B;  4R55 A;  2DEQ A;  1OUL A;  3CC4 A;  1M1K C;  1S1N A;  3JB9 D;  2HSE B; 
#chains in the Genus database with same CATH homology
 4QVD A;  3CC4 T;  4IKF A;  3SDZ A;  2JTF A;  2DK3 A;  1FWZ A;  2MWP A;  2XK0 A;  2RJC A;  1KC8 U;  3GNF B;  2KDS A;  3JCM W;  3JB9 J;  4XAX B;  5LJ3 e;  2VC8 A;  2QQR A;  1LJO A;  1XTD A;  1ZHI A;  2LC4 A;  2QQ9 A;  4X9C A;  4PJO F;  4YTL A;  1FX7 A;  2LCC A;  2YLB A;  2GF7 A;  4LDV A;  4BB7 A;  5GAO l;  2RJE A;  2JNG A;  3A8G B;  1NPP A;  4OVA A;  1AHJ B;  4R56 A;  1QVF S;  1BI0 A;  3JB9 H;  3CCR A;  2K4Y A;  3X28 B;  1D3B A;  2OTL A;  2IVW A;  2D0Q B;  4PJO C;  2RHX A;  5DY9 A;  3DB4 A;  5GAN j;  2DXT A;  2G3R A;  2QEX A;  1Q86 C;  2MF2 A;  4WF2 A;  5GAN 3;  3HKS A;  3P8B B;  1K8A C;  3LGF A;  3JCM P;  4ATO A;  2EAY A;  3J80 E;  3WVE B;  5CCA A;  1VQP T;  4PJO D;  1P92 A;  2L3R A;  2RA2 A;  1VQM T;  4HA8 A;  2LT1 A;  4DQ2 A;  2OTL T;  2PQW A;  5FU6 C;  2M1H A;  4NL2 A;  1VQL T;  2XDB A;  4M78 D;  3S3O A;  3QYG B;  1K73 C;  2BKD N;  2E6N A;  4LD6 A;  4XU3 A;  1ZQ1 A;  3RMQ A;  3VUB A;  3QSU A;  1VIF A;  3MO8 A;  4J6X A;  4J7I A;  1VQ6 T;  3AHU A;  2R5A A;  3JCM c;  1EIF A;  2ZCF B;  4XTY A;  1G3Y A;  1Q86 U;  3DLM A;  3TU4 K;  5GAN 7;  4M77 E;  3CCJ T;  1QVG A;  1BI1 A;  3GF5 A;  1N6A A;  3UDC A;  4PNO A;  4HCZ A;  1KQ2 A;  2DJZ A;  2VGN A;  3L2U A;  2X4W A;  4M77 A;  4J8O A;  4J83 A;  5GAO p;  3LGL A;  3QKJ A;  4CI0 C;  1U1T A;  3SWN C;  4JLG A;  2EQK A;  4DOV A;  2V8K A;  4XTU A;  3M57 A;  4A4K A;  3G6E A;  2X35 A;  4M7D D;  5CKE A;  3I56 A;  1K73 U;  3E19 A;  2KAF A;  2X4J A;  2PVD B;  1X6O A;  3OBY A;  1TH7 A;  2CZ6 B;  2GFU A;  1LOJ A;  2CKK A;  3OMG A;  3JCM Q;  5GAN 8;  2EJ9 A;  3CCU A;  3CCV T;  1NPR A;  2MAM A;  4N4I A;  1MHN A;  2LTO A;  4P5N A;  1KC8 C;  2HQE A;  5GAN e;  2XDD A;  2LVM A;  2QQS A;  3V8L A;  5KE2 A;  4F7U A;  2EQU A;  2XKO C;  3HHT B;  1VQK A;  3JCM e;  4A54 A;  2RI3 A;  1VQM A;  2QXF A;  4M7D F;  3MEV A;  4F7U G;  5A0D A;  3CPF A;  3MHX A;  4Y91 A;  4QQ6 A;  2IG0 A;  1YIJ T;  2EWN A;  2XU8 A;  4ZTF A;  4RCC A;  4XTW A;  2EIF A;  4IUT A;  5CKH A;  3OYH A;  2E1H A;  4A4F A;  3JCM V;  3H8Z A;  4HCC A;  3OS2 A;  3OYC A;  3JAM E;  2ZZD A;  2YHT A;  5EG2 A;  5GAM f;  2XI9 A;  1KQS S;  3OSV A;  4JS5 A;  1FXX A;  3RIR A;  3V7S A;  4BE2 A;  4IUU A;  3DB3 A;  1I81 A;  3NTI A;  2BUD A;  3P8H A;  5AYF A;  2XIC A;  3WXM B;  4M7D A;  3Q1J A;  2HNI A;  3PTA A;  4ME7 A;  5IN1 A;  3NFC A;  3CCM A;  2JTM A;  3OW2 A;  1Q82 C;  2BIV A;  2K5L A;  4M7D E;  4OGE A;  1OYX A;  1U8R A;  4C0F A;  3CC2 A;  4E7J A;  2E5Q A;  4M7A D;  3PGG A;  3CCS T;  3CCJ A;  3OYD A;  3C4S A;  2EYQ A;  2FL7 A;  5LJ5 e;  3JB9 I;  3OYY A;  1M1F A;  2VGM A;  3ER0 A;  4M78 C;  3FDR A;  5FU6 B;  5DLO A;  5GMK m;  2DTO A;  3CBM A;  3MP6 A;  1BIB A;  2M16 A;  3CCV A;  3HRT A;  4C0Z A;  4BD3 A;  3GP8 A;  4C8Q E;  2KMT A;  1M9S A;  4BAC A;  5GAN 4;  4C92 G;  4F7U B;  1M90 C;  4V2S A;  1VUB A;  3ASK A;  4QVC A;  3OYG A;  4BDY A;  3HPW A;  5CKB A;  2D9T A;  2QEX T;  4LDU A;  4C92 A;  3DKM A;  3HSB A;  5LJ3 j;  2PVO B;  3OYA A;  5A2Q E;  2RO0 A;  3CXC A;  4LDY A;  3V7C A;  3FB9 A;  4M75 F;  5LJ3 g;  1VQK T;  3JCM f;  2WAC A;  3L42 A;  4JDS A;  4KT0 E;  4JRK A;  3VJP A;  1VQ6 A;  1WNL A;  4M78 F;  3A8O B;  3HRS A;  3EAE A;  1PSE A;  1M90 U;  2B8A A;  3VUZ A;  4FSX A;  4MML A;  1M5Q 1;  2P0P A;  4E7H A;  3M55 A;  5I2S A;  1VQN T;  3RER A;  4C8Q A;  3X26 B;  1Q7Y C;  4O6J A;  5GAM g;  1WGS A;  4KBM B;  4IUR A;  2EQJ A;  1VIE A;  2LRQ A;  4M75 D;  3UT1 A;  3ZFJ A;  3OQ5 A;  4GY5 A;  1VQN A;  3CCQ A;  3QJY A;  1VQ7 T;  5J3B A;  2K3X A;  2ZPF B;  2Y90 A;  3L2W A;  2XG8 D;  5I2M A;  1IRE B;  1YHQ T;  3VKI A;  3MEW A;  1X75 C;  3M4Y A;  4EMK C;  2QI2 A;  1RL2 A;  3OSS C;  3M54 A;  4NS5 A;  5GAN h;  3JCM J;  3OYN A;  4Z02 A;  2LDM A;  1KD1 U;  4M7D C;  3VU3 C;  4RG8 A;  4EMG A;  1I4K 1;  3A8M B;  3LLR A;  4KUL A;  5FRO A;  4M77 G;  3OS1 A;  4DOW A;  3M56 A;  3L2V A;  3I55 A;  1Y07 A;  2L89 A;  2V8I A;  3FLG A;  5GMK i;  1WQ7 A;  3J81 E;  3EFS A;  4FU6 A;  3LWH A;  4L59 A;  5GAN g;  2XHC A;  4BE0 A;  2RD1 A;  4M7A C;  2RI2 A;  1VQ9 T;  1NE8 A;  2M9U A;  5C6S A;  3CPW A;  2CS7 A;  3A5Z B;  2RHZ A;  1JBM A;  2LQ8 A;  2MI6 A;  3X24 B;  2QA4 A;  3OY9 A;  3QG1 A;  3S3N A;  1K9M C;  4N0A C;  4JS4 A;  3LX7 A;  4C0G A;  3OYL A;  4M7D G;  4M75 G;  4BI8 B;  4MZM A;  3OBW A;  2PUK B;  3FJP A;  3RMS A;  3OS0 A;  1YIT T;  4L6V 5;  3BFM A;  1RI0 A;  4ELY C;  1BKB A;  3GPL A;  5LJ3 d;  2QA4 T;  3E9F A;  5HY6 A;  4D6W A;  4LDX A;  4RKU E;  4MZT A;  3M5A A;  4OB1 B;  2JN0 A;  4M78 A;  4QW2 A;  4PJO G;  3JCM X;  3G71 A;  3UWN A;  1HXD A;  1KHI A;  3M58 A;  2VXE A;  2YRV A;  4M78 E;  3WVD B;  1K8A U;  4E7K A;  5KH6 A;  3SB2 A;  3CD6 A;  3QHS A;  4C8Q C;  2ZPI B;  3KXT A;  4M75 E;  2DTH A;  3SWN B;  3UPU A;  1WJQ A;  4C5G A;  4PLI A;  1JJ2 S;  3DLL A;  4GLK A;  4HT9 A;  2X4X A;  5LJ5 h;  1VQ5 T;  1YI2 T;  2DVE A;  3JCM h;  1U1S A;  2R57 A;  5DM7 R;  5HKC A;  1YJW T;  3HFO A;  3CCE A;  4E7L A;  4A4H A;  2CGH A;  3R6O A;  4J6W A;  4RCB A;  2KK4 A;  4OGC A;  2LT4 A;  1WQW A;  2AHJ B;  1NZ9 A;  4J7F A;  4FM4 B;  2RK1 A;  3VYG A;  2RK2 A;  2HAX A;  3H6Z A;  3I55 T;  1N8R C;  1KD1 C;  2F5T X;  2M0O A;  3GLX A;  4FT2 A;  4ELZ C;  4EPC A;  3CBO A;  3OYJ A;  5FRM A;  2QTX A;  1QVG S;  1BIA A;  4NOY A;  3LH0 A;  1DJ7 B;  2PU9 B;  3CC7 T;  3LYI A;  1JB0 E;  4MDW A;  3JB9 F;  3GIB A;  3INZ A;  3J7A F;  2HQX A;  4B9X A;  3C94 A;  4N4H A;  1M4Z A;  4KUI A;  1ZBX A;  4OB2 B;  3E9G A;  2KY9 A;  3HFN A;  3L2R A;  3MEU A;  3HL8 A;  2EJG A;  2ZPG B;  3GOX A;  3QII A;  1HK9 A;  3NTH A;  4J6Y A;  3TEE A;  3JB9 G;  2DZ9 A;  5GAO n;  3OYM A;  1M1G A;  4M77 D;  2GCX A;  5FLX E;  5GAM j;  3BY7 A;  2WSC E;  2Y4Y A;  2L5Q A;  5GAN f;  4BUG A;  1KHC A;  3C12 A;  5DLQ E;  3CME T;  2E65 A;  4JJN K;  4OF1 A;  4JRI A;  2JUF A;  3O8V A;  2KVQ G;  3NTK A;  4DA4 A;  3CMA T;  5KCO A;  3SFM A;  1OI1 A;  2RHY A;  2ZPE B;  5CK9 A;  2E6Z A;  2JOY A;  1Y96 B;  3V8J A;  1YI2 A;  1VQL A;  1V29 B;  1R8O B;  1Y96 A;  3A8L B;  5M9O A;  4XU1 A;  2D6F A;  3RKW A;  4A53 A;  3LWI A;  4C92 B;  1W4S A;  4JLI A;  4PL6 A;  1SSF A;  3RKY A;  4C92 C;  3JCM b;  3CCE T;  1KQS A;  3PMI A;  2EQM A;  3ZEH A;  5GAO r;  4F7U E;  1QVF A;  4EMH A;  3CCS A;  2XD0 A;  3X25 B;  3CCL A;  1OZ3 A;  2DIG A;  1O75 A;  1B34 B;  3G71 T;  1BYM A;  2QQB A;  4EMK B;  1B34 A;  3QJ6 A;  3PMT A;  1W2B S;  3C95 A;  4OMF B;  5CQX A;  3EFR A;  3VYH B;  3FC3 A;  2RM4 A;  4ZGE B;  2VYT A;  3OMC A;  3OS5 A;  3CEY A;  2FHD A;  3CMA A;  5L8R E;  4E47 A;  2EJF A;  1UEB A;  1Y7X A;  5D6W A;  2O01 E;  3M9Q A;  2DZC A;  4QVZ A;  3CME A;  4Q5W A;  4C8Q F;  1G3T A;  3LW5 E;  3PFS A;  1Y71 A;  2JVV A;  4M78 G;  2VUB A;  3V8K A;  1VQO T;  4ZN3 A;  4IUP A;  1YJW A;  4KUD K;  4PJO A;  3L2Q A;  3CC7 A;  1N27 A;  5CAI A;  1VQ4 A;  2OTJ A;  2LNV A;  1N9R A;  4XK8 E;  1OZ2 A;  2LCL A;  4A4E A;  4BDZ A;  2FYK A;  3MET A;  4B9W A;  4C92 D;  4LDW A;  3SD4 A;  2VXF A;  2R58 A;  2MWO A;  4PLL A;  4M7A F;  3KBG A;  2O4X B;  3CPW S;  3MCA B;  3L2Z A;  4M7A E;  3G4S A;  4BY6 B;  5GAN 2;  3M53 A;  4C8Q D;  2E64 A;  4C8Q B;  1YJ9 T;  1YJ9 A;  4C5H A;  1N8R U;  4L5G A;  1GXI E;  5GAN d;  1PSF A;  2K5I A;  4RMO A;  2A3L A;  5FRN A;  3OW2 S;  3CBP A;  4BI3 A;  5GAO q;  3RES A;  3ME9 A;  4IUQ A;  4LD9 K;  2LX9 A;  2E12 A;  2RJF A;  2DAQ A;  1XOV A;  3MP1 A;  4II1 A;  4M77 B;  4XTX A;  1YCY A;  5IAY A;  1VQO A;  2K5F A;  1XNI A;  4XU0 A;  3F70 A;  4IUV A;  3TCJ A;  5GMK l;  5CR2 A;  1VQ7 A;  4MDX A;  5CQY A;  3QZ5 B;  2VV5 A;  1X01 A;  3A8H B;  5I21 A;  2C06 A;  2Y4X A;  1Q81 C;  4Y28 E;  3OB9 A;  1XQH A;  3QXE B;  4PJO E;  2L8D A;  5GMK e;  1KQ1 A;  4PKC C;  3P8D A;  3G4S T;  3URG A;  3E1S A;  1S72 A;  3KUF A;  3PNW C;  4QQG A;  3JCM g;  4M75 C;  2K2V A;  3CCL T;  1MGQ A;  3RKX A;  1NJI U;  2RJD A;  1QVP A;  1QW1 A;  2CZ7 B;  3FIF A;  1G3S A;  2H3J A;  5LJ5 j;  1VQ4 T;  3TRE A;  1G3W A;  3QDR B;  4N4G A;  4XQ3 A;  1I8F A;  2DXU A;  1N9S A;  3SWN A;  4BI4 A;  2RH2 A;  3CXC S;  3RUX A;  1WJR A;  3S3M A;  1VQ8 A;  3PIP A;  2I2L A;  2HD0 A;  1H3Z A;  4FL6 A;  4M7A B;  2PVG B;  2P4T A;  3BW1 A;  2WSF E;  2ZGW A;  1M8V A;  4XTV A;  2ZPB B;  5CVI A;  2GFA A;  2YLC A;  3QO3 A;  2CZ0 B;  3BDL A;  3QZ9 B;  3QYH B;  5CIU A;  2K57 A;  2P0Q A;  3OYI A;  4OB0 B;  5GMK h;  3MP8 A;  2FVU A;  5D6Y A;  1I5L A;  4C8Q G;  1YBY A;  2KQW A;  4BE1 A;  5LJ5 d;  2PUO B;  4VUB A;  5C0M A;  3OA6 A;  2K3Y A;  1O9S A;  4RG2 A;  4C92 E;  3M4G A;  1IZ6 A;  3L1A A;  5FU7 C;  2DXC A;  2R5M A;  1WPY A;  2F5K A;  5J39 A;  4M77 F;  5LJ5 g;  5J26 A;  2OAU A;  5LJ3 f;  2XDP A;  4JUV A;  1KG1 A;  5GAM d;  5KCH A;  3BDU A;  2E70 A;  3JRZ A;  1YHQ A;  2A7Y A;  3HP9 A;  3PT9 A;  5GMK j;  2JZ2 A;  4NL3 A;  2QQA A;  2CYZ B;  5GAM h;  1VQ8 T;  5FU7 B;  3I56 T;  3OYK A;  1H64 1;  3CCQ T;  3GNG A;  3JSC A;  3CCR T;  4HCB A;  2E10 A;  2DD5 A;  3QPH A;  5LJ3 h;  3ZBD A;  3CD6 T;  1WJS A;  2XID A;  4HT8 A;  1Q7Y U;  2MMP A;  5GAO m;  4MZP A;  1YJN T;  2EKO A;  2HBP A;  2RB6 A;  2DXB A;  3G7Z A;  2DIQ A;  2QDY B;  5HK0 A;  3CC2 T;  5A0L A;  1S72 T;  2O4X A;  3FRN A;  4BY6 C;  4M77 C;  4JRQ A;  2WSE E;  1BI2 A;  2DD4 A;  4J5Y A;  2RI5 A;  4UC4 A;  3FEO A;  1BI3 A;  4C0D C;  5CKD A;  3OYB A;  1Q81 U;  5CKF A;  3OYE A;  1JJ2 A;  3QUI A;  4OP0 A;  4M7A G;  4FIB A;  2P0K A;  5D6X A;  2KSS A;  4N0A A;  1NJI C;  1QP2 A;  2X4Y A;  5GAM e;  4M7D B;  1Q82 U;  2CZ1 B;  2GQV A;  5GAN 5;  2F69 A;  4M7A A;  4FT4 A;  3MEA A;  5LJ5 f;  1G5V A;  1UB4 A;  1D3B B;  4MMK A;  1UGQ B;  2E41 A;  4O5V A;  4C0D B;  4ZN1 A;  5HK3 A;  2EFI A;  4F7U F;  3G6E T;  1VQ9 A;  4ZGD B;  5A0G A;  4X34 A;  4OB3 B;  3X20 B;  3N5B B;  3VV0 A;  4ZGJ B;  4ZTJ A;  2DO3 A;  3T9N A;  2DPP B;  1YIJ A;  1M1K U;  3CCM T;  2NLU A;  3OYF A;  4M75 A;  3QBY A;  2ZPH B;  4EMK A;  4M75 B;  4C5I A;  4CRI A;  1UGP B;  4XTZ A;  5KE3 A;  4E7I A;  4C92 F;  3M59 A;  3CCU T;  2RHU A;  4HKE A;  4M78 B;  5LL6 S;  1UGR B;  1UGS B;  5CO7 A;  3V7R A;  4C5E A;  1K9M U;  4A4G A;  5IT9 E;  2FB7 A;  4XU2 A;  1VQ5 A;  2DKG A;  2RHI A;  4TVR A;  5GAN 6;  2DTI A;  1LNX A;  4JRP A;  2V8J A;  2LQK A;  3PIO A;  1W2B A;  3JCM d;  4R55 A;  2DEQ A;  4PJO B;  2OTJ T;  3S6W A;  4EDU A;  1YIT A;  3CC4 A;  1M1K C;  3HRU A;  4QQD A;  1YJN A;  1JRI A;  3JB9 D;  4X9D A;  1QP3 A;  1VQP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...