3JCMJ

Cryo-em structure of the spliceosomal u4/u6.u5 tri-snrnp
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
79
structure length
79
Chain Sequence
GIPVKLLNEAQGHIVSLELTTGATYRGKLVESEDSMNVQLRDVIATEPQGAVTHMDQIFVRGSQIKFIVVPDLLKNAPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pre-mRNA-splicing factor 8
publication title The 3.8 angstrom structure of the U4/U6.U5 tri-snRNP: Insights into spliceosome assembly and catalysis
pubmed doi rcsb
molecule tags Transcription
total genus 10
structure length 79
sequence length 79
chains with identical sequence R
ec nomenclature
pdb deposition date 2015-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3jcmJ00
4XTWA 4M7DC 3L1AA 4M7DB 1M8VA 4JRKA 3JCMe 4XTYA 1U1TA 5GAMj 3JB9F 2E41A 2Y90A 4M7AB 5GAN6 5LJ5e 4XU2A 2DJZA 2DTIA 4M78G 3JB9I 1JBMA 1H641 2VXFA 2RA2A 4PNOA 5GMKl 4Y91A 2EJFA 1I4K1 1B34A 4C92D 3JCMX 4XTZA 3SWNB 2DXTA 3V8KA 3AHUA 4M7DG 3QHSA 4M77D 2VC8A 4EMKA 5GAMh 4J6YA 3SB2A 4N0AC 5GAOp 1WQWA 4M78E 4M77A 3JCMh 4EMHA 4PJOD 4C8QD 5I21A 1KQ1A 3FIFA 2YHTA 2E1HA 2VXEA 5LJ5g 5LJ5h 5GANg 3JCMV 1I8FA 3V7SA 5LJ3e 2EWNA 3RKYA 4M7AE 1N9SA 1N9RA 4XQ3A 5GAN3 2YLBA 4M7AF 1D3BB 2I2LA 4QVCA 2YLCA 4M75C 4M75B 3BFMA 2DKGA 4RCCA 4JUVA 4EMGA 1Y96B 3RKWA 2CGHA 2RM4A 4MMLA 5GAOr 5GAMf 3BW1A 2EJGA 2E64A 4M78A 4XTVA 3RESA 5LJ3g 2FB7A 1BIAA 3JCMf 3V7CA 5LJ5j 1BIBA 5GMKe 5GAN4 3JB9H 1I81A 4HT8A 4HT9A 4JLIA 1LOJA 3QUIA 5LJ5f 4M7DA 4M75G 4NL2A 5GAMd 4M7AD 2EAYA 1HXDA 3HFOA 5GMKi 3JCMd 4M7AA 3EFRA 4M78F 5GAN8 4F7UB 3JCMb 1MGQA 4M7DE 3QSUA 4C92C 5GANe 4M75E 4C92B 3BY7A 4M7DF 3BDUA 4M77C 3L2ZA 3SWNA 5GAOn 5GMKh 5LJ3j 5GANj 4RCBA 2DZ9A 4PJOB 4PJOC 4N0AA 4C8QC 3EFSA 4X9CA 4C8QB 5GAN5 1LJOA 3V8LA 4F7UG 5LJ3f 5GANf 4A54A 3JCMP 4V2SA 4XU3A 5GAOq 2HNIA 4XTXA 4XU1A 4M78D 4C92G 2QTXA 5GMKm 3M4GA 5GANh 1TH7A 4M77G 5LJ3h 3VU3C 3JB9J 3HSBA 4J6WA 3V8JA 4PJOG 4F7UE 3JCMQ 4C8QG 1D3BA 3JCMc 5CAIA 4M7DD 1U1SA 2DZCA 2FYKA 3FJPA 3PGGA 4M75D 5GMKj 3JB9G 2E65A 4MMKA 1M5Q1 4M75A 3HFNA 4QVDA 1Y96A 4XU0A 4C8QE 1B34B 2DVEA 2E10A 5GAOl 5LJ5d 1LNXA 3FB9A 4NL3A 4EMKC 4EMKB 4OP0A 1WNLA 4M77B 4M75F 1WQ7A 1I5LA 4M7AC 4HA8A 3JCMW 4XTUA 4F7UA 3INZA 4J6XA 3SWNC 4WF2A 2DTOA 1WPYA 4C92A 2ZGWA 3RIRA 2EJ9A 4NOYA 2DXUA 4A53A 5GAMg 2RD1A 5GANd 5GAN7 3RERA 5LJ3d 3JCMg 1HK9A 4M7AG 4JRIA 5GAN2 4J5YA 4PJOA 2RB6A 3RKXA 4C8QA 4F7UF 2K57A 4C92E 3JB9D 1KQ2A 1YCYA 2DTHA 4M77E 4X9DA 4C92F 1X01A 2DEQA 2JN0A 4M78C 4M78B 3RUXA 3GIBA 4PJOE 4M77F 3V7RA 5GAOm 3QO3A 1JRIA 4DQ2A 3JCMJ 5DY9A 4PJOF 5GAMe 4C8QF
chains in the Genus database with same CATH superfamily
3HL8A 3M0TA 2E41A 2NUZA 1UFFA 3CCRT 3RDVA 3UDCA 4PNOA 1YI2Q 2B86A 4ZGJB 3AHUA 2JXBA 4OMFB 5IN1A 1PRMC 3E19A 2EQKA 4C8QD 5CIUA 3OYYA 1YJWQ 4HCBA 2H3EB 4PK4A 5LJ3e 3LH5A 2L8DA 4M7AE 4AFUC 1VQ4Q 3M5AA 4RTUA 5GAN3 1TXQA 4ORZA 2YLCA 1K8AR 2K6DA 4JJCA 4RCCA 2CGHA 3BW1A 3DKMA 2E64A 5GANg 2DO3A 2FB7A 5I2MA 1WHGA 2CH4A 5GAN4 1E6HA 3RMSA 5KYWA 4PFPA 3CC7Q 1NEGA 2A37A 4PJLA 4F7UB 3I56A 1WI7A 1K4US 4M75E 4A63B 2O9VA 1Z9ZA 3CCRQ 1ZHIA 3C4SA 3FDRA 4A4HA 1M30A 1QVFS 4OMNA 4QVZA 4M77G 3DLLA 2PUOB 2DE0X 1XJWB 5IAYA 3VUZA 4M7DD 2CZ1B 3QPHA 4PFZA 2RI5A 3BE3A 5IXBA 4FSXA 2A28A 5M9OA 3EGXA 3JV3A 3CCJT 1D0XA 2I0NA 3M54A 3OW2S 4EMKB 2QA4T 1Q86C 3REAB 2CT3A 3SFMA 1VIFA 2VVKA 2AIRB 2KR3A 1WXBA 1AHJB 4BI3A 3CPFA 1VQKA 1BI2A 2G3RA 1Y0MA 4C8QA 2X3XD 3NMZC 4RG8A 2DTHA 4X9DA 3QWXX 2MK5A 1B3QA 4CC3A 3V7RA 4PJOF 1FYNA 1VQ7Q 2C0IA 2XU8A 5FU6B 4DBRA 3A8LB 1K73R 1VYVA 2EYQA 1NJIR 1KHCA 3LW5E 1X27A 4OB0B 3PVLA 2VGNA 2HQHA 4LD6A 1AZEA 2HBPA 2OTJQ 3JCMh 1C1AA 3OYAA 3CCJQ 1JXMA 2E1HA 2VXEA 5LJ5h 1A0NB 2COYA 3C0CA 2QA4Q 4JJBA 5C6SA 1TU0B 2PZ1A 2FPDA 3G6EA 1VQLA 1HYOA 2NUPA 1WFWA 1Y96B 5D6WA 5LJ3g 1RI9A 1SHGA 2PUKB 2RQVA 3QBYA 4M75G 4M7DA 1MV3A 4EIKA 3S6WA 5KYNA 1O75A 3EFRA 1AZGB 2X4YA 4IKFA 1K76A 2FRYA 4II1A 3M0QA 3OMGA 4C92B 1N6AA 5DM7R 2O01E 4JS5A 1SKUB 2K2MA 3FRNA 5GJVB 4QKUA 1WHJA 1Y71A 3JB9J 2P84A 1YJNT 5KYXB 5IHNA 3L2UA 2C0TA 1U1SA 2JTFA 1M1GA 2DAQA 3M0UA 4BDZA 2RO0A 2QGGA 3MKDA 5KCHA 1M2OA 1WNLA 4HVUA 4DEXA 2CZ6B 4J9CA 2EGAA 1YIJA 4J6XA 2DTOA 2V8IA 3GOXA 5GANd 1KD1C 1S1NA 3PIOA 1NE8A 2K7AA 1OX9A 2FEIA 4LNPA 1JB0E 2ZPBB 5I22A 1BB9A 5GAMe 1AWXA 1FX7A 1X43A 2CP0A 4RTWA 4KUDK 3DB4A 3EG0A 2NUTA 3OBYA 2CDTA 1ABOA 3QG1A 4N4GA 1PWTA 2CH4W 3EH1A 1WQWA 4M77A 5KE3A 3BDLA 2YHTA 1M90C 4PFOA 3OYFA 1I8FA 7AT1B 4ZNXA 1VQNT 4M7AF 2M51A 1PC0A 4QVCA 4WCIA 4ESRA 4OB2B 4EMGA 2DXCA 1K9MC 2X3WD 2LMJA 3TU4K 3RESA 5IHIA 5LJ5j 3SD4A 2JT4A 2L3SA 3UF4A 3I35A 2HDAA 2E6NA 4EDUA 4J9FA 5FRNA 3S3OA 3CCSA 4QT7A 3M58A 1RI0A 3QKJA 3MP1A 1NM7A 1Q86R 2CREA 1LJOA 1P92A 4GY5A 3CMAQ 2RQWA 2DPPB 4AG1C 3G7ZA 3HSBA 2X35A 3CXCS 1I5OB 1UECA 1RL2A 5LL6S 5IHKA 3EAEA 1VQNQ 3WVEB 2L3RA 1HJDA 4F17A 1VQ6T 3CCUA 1TUCA 2FRWA 2ABLA 1J3TA 1QWFA 4OMQA 2HL5C 2DILA 1V76A 1JQQA 2MIOA 5FU7B 3VYGA 1NYGA 1QW1A 2IPOB 2LQKA 1ZQ1A 5LJ3d 2IIMA 2K57A 4KULA 4XAXB 4ELYC 5KCOA 2LX9A 4KUIA 2BZXA 2GNCA 3HHTB 2KVQG 3OYNA 2QASA 3LWHA 3M9QA 4M7AB 3CCMQ 1RAGB 3VYHB 2AHJB 1VQ5Q 2DA9A 2EJFA 3SWNB 3CCQT 3OQ5A 2DL4A 2YT6A 3CCEQ 4OMMA 5D6XA 3M57A 1BK2A 2FL7A 2RF0A 2A08A 3CMET 1N9RA 4DA4A 2PU9B 4IUTA 2JMCA 2ATCB 4M75B 1SSFA 2C0OA 1YJ9Q 1W4SA 3EGDA 1Q7YR 2RM4A 2DJQA 2AZVA 3M0RA 1GXIE 4ZGEB 4KH1B 4QQDA 5J39A 1MGQA 1PM3A 3T9NA 2DLPA 2LCCA 4BY6B 3J81E 3GPLA 3EHRA 3L2ZA 4PJJA 1QWEA 1PKSA 3MHXA 2FHDA 3V8LA 2DIQA 4KBMB 1YITT 5KYYB 2BZ8A 2P4RA 1O9SA 2D9TA 4KT0E 5IT9E 3CMEQ 4IUPA 2DK3A 2GQVA 1OZ3A 4C8QE 2KT8A 4VUBA 4C5HA 1N8RU 2DL7A 2P0PA 4KGXB 1EX4A 1V29B 2D6FA 1M1KC 3CD6Q 1FWZA 1AWJA 2ZGWA 3JCMg 1HK9A 2LRQA 2DEUA 2J05A 3MEAA 3RKXA 4C92E 3ASKA 2O2OA 2DF6A 2KNBB 1X6OA 2RHXA 3FEOA 3ZL7C 4E7KA 2ZZDA 4DQ2A 1M8MA 2KSSA 1WHKA 1G83A 3L1AA 2KBTA 1YITQ 2BKDN 2Y90A 5GAN6 4XU2A 3CC4Q 1IZ6A 2CYZB 4Y91A 4J9BA 1VQ8A 3JCMX 3EFOB 2RHZA 5GAOp 1ZSZB 1KQ1A 4BI4A 1FXXA 3V7SA 2OTLT 2YLBA 1Z9QA 3VS5A 1D1BA 2RJDA 3OS5A 3VS7A 1YWOA 2QDLA 3L2VA 4E7HA 1RADB 3VJPA 1H92A 3NPFA 4FW1A 1UE9A 3LX7A 2DYIA 2JZ2A 2ZAEA 1Q81U 1MNEA 4M78F 2MMPA 5GANe 1YJNA 2NWMA 2B8AA 4PJOC 1X6GA 5GANf 2BTTA 3D7SB 4AT1B 2O31A 3H9NA 2GQIA 1W2BA 4C8QG 1JEGA 1YCSB 2NLUA 1GBRA 4Z02A 2V1RA 1QMCA 1SHFA 2SRCA 2WSFE 4FYYB 2OTLQ 3MEVA 1IHVA 3X25B 2MI6A 5CKHA 2HQEA 1JXOA 2FG0A 2LCLA 2ZPEB 1VA7A 2EYZA 3G4SA 3RNJA 1K0SA 3INZA 1Y07A 5FWBA 2EGCA 3P8BB 4Q5WA 2LVMA 5CKFA 2EJ9A 1YI2T 5AT1B 2QQRA 2XHCA 4F7UF 1WGSA 5CK9A 3OYHA 4M77E 8ATCB 2PQWA 3GIBA 2F69A 3NTKA 1YJWT 3HTRA 3JCMJ 5HK0A 5D7UA 3OYDA 4JRKA 2LTOA 1VQ4T 2EQIA 1ZA1B 2H3JA 1YP5A 2KGTA 2ESWA 4BUGA 1ZUUA 1S72A 4XTZA 1ZUYA 1WA7A 2DXTA 1UHFA 1VQNA 4M7DG 2VC8A 4HCKA 1PSEA 2YRCA 4LUDA 4RUGA 2YUQA 3LLRA 4JDSA 1U8RA 4FT2A 3X28B 3CC7T 2XKOC 4A4KA 3SHWA 3UA6A 4B6MA 3FC3A 2CSIA 1JU5C 2YUNA 5DLQE 3S3MA 4D8KA 4J9EA 4CC4B 4BDYA 2FPFA 2YDLA 5A0GA 2X4JA 2RNAA 3R6OA 5KYUA 2KK4A 3JCMd 1MMDA 2RJFA 2KY9A 1RAIB 1QVGS 4X34A 2HEQA 1VQ9T 3CBMA 5GMKh 1W6XA 1G8XA 1K73U 1M9SA 3E9FA 5LJ3f 4D6WA 4A54A 2E5KA 2HNIA 5FU7C 2HD0A 4JJNK 3VU3C 1VQ6A 1MV0B 4DOWA 3OYIA 1D3BA 2XMFA 3FJPA 2FZGB 1M5Q1 3C95A 2MWPA 5FLXE 1AWWA 2F5TX 4D8DA 1MMGA 1YBYA 3M0PA 1LNXA 1C6VX 1M4ZA 1YWPA 2KROA 5CCAA 1TUDA 1WQ7A 4M7AC 1IXDA 3CCLQ 4ANJA 1VQ7T 2HSPA 1Q82R 3HRUA 3U23A 1Q95G 4YTLA 1E6GA 3SWNC 2O4XA 4A53A 2DXUA 2VYTA 1QVFP 1KSWA 2LQ8A 2GTOA 3JB9D 2BZYA 1BI0A 4OF1A 4C92F 2OTJT 1X01A 2DEQA 1VQ9Q 2D8HA 3KUFA 3M0SA 3CCQA 2CKKA 5KYWB 4TVRA 1U1TA 2K4YA 5AYFA 3JB9F 2QQAA 2QTVA 3OW2P 4J9IA 2DJZA 2O88A 2KT1A 3OY9A 1WYXA 2NYSA 5GMKl 3CMEA 4GBQA 2DETA 1UGPB 3OBWA 2XG8D 4RMOA 4PJOD 1AEYA 1UJ0A 1G2BA 2G6FX 4E7ZA 2ED1A 3MP8A 2RMOA 2DKGA 4J9HA 3EGXB 2CSQA 1PNJA 1M27C 2HKQB 1H3HA 1YITA 5GAN8 3L2RA 2E3IA 5KE2A 4ZN3A 2X4WA 4LXCA 4C8QB 2ZPGB 1MUZA 3A1PA 1BCOA 3GNFB 5DLOA 3CPWS 3UA7A 2CP2A 4ZN1A 1TH7A 1ZUKA 4DOVA 4IIOA 2JTMA 4CI0C 5GMKj 2HBWA 2BE9B 1VQOA 2E65A 4RTTA 4LDUA 4QVDA 2J6KA 3O5ZA 2EFIA 2F2WA 4AMCA 1LVKA 2EGEA 5GAOl 1NPRA 1VQPT 4HA8A 3I9QA 1XNIA 2DX1A 3I55Q 2RQRA 4KGVB 1PD1A 1WJSA 4L59A 1EFNA 2ZCFB 4A4EA 1ZSZC 3PVQA 3S3NA 2DD5A 3KFVA 2NUPB 4PJOA 2L3PA 4RTVA 3CCVA 3LGLA 3CC2Q 1NZ9A 4M77F 3QO3A 4J9DA 1PRLC 1G5VA 4M7DB 3MO8A 5GAMj 5CKEA 4JZ4A 2OJ2A 4XK8E 4B9XA 1GCQA 1JBMA 3OYKA 2EYWA 2OTLA 2YRDA 3QJYA 4L6V5 2DD4A 5FRMA 1SRMA 3EH2A 4E6RA 1KQSS 1VQPQ 3RKYA 2JS2A 2QDYB 1BI1A 2LQWA 1B7TA 3BFMA 2HL3A 5GAOr 5GAMf 2EJGA 4XTVA 2BIVA 3CMAT 4M7AD 1TUGB 2RHUA 1GRIA 4OGCA 4E7JA 3A5ZB 3PFSA 4LN2A 2MF2A 4MDWA 4C5EA 2VKNA 1M2VA 2EQUA 1T0JA 2KRMA 1NLOC 4FM4B 1MMAA 3G71A 3JCMQ 2L89A 1QVFA 5HY6A 2YXYA 4M75D 1SG5A 1OV3A 3OYLA 2NUTB 4C0DC 4NL3A 2YUPA 4B9WA 4M77B 4M75F 1YI2A 5J3BA 2QEXT 1Q7YU 1JJ2S 2GFUA 4RTYA 5FWCA 4PJMA 3OW2A 1E7OA 4IIMA 4Z88A 3E2UA 1YJWA 3CCMT 2CP3A 1WPYA 4ELZC 4HCZA 3OA6A 1VQ5T 1SEMA 5GAN2 2DL5A 5CR2A 1LCKA 2JTEA 1VQ4A 1YN8A 3H6ZA 5A0DA 3CXCP 3TQ7P 4ATOA 2JN0A 4M78C 4HXJA 3CCET 2YWWA 2KE9A 2FZKB 3JCMe 1RUWA 2LJ3A 5LJ5e 2DL8A 2K5FA 4R0KA 3CC7A 1YJ9T 2LNHB 1KHIA 2E70A 2F2VA 4O6JA 3GF5A 3E1SA 2QI2A 3CCRA 3A98A 2BE7D 1KC8U 1BKBA 1C0MA 1N9SA 2QEXQ 1YHQQ 1GFCA 3MPUB 1BYMA 2YUOA 2VASA 2R5AA 1N8RC 3NTHA 1HSQA 1I81A 2YSQA 4NL2A 4LDXA 2CT4A 3URGA 4OMLA 3O8VA 1NLPC 3JCMb 4RTXA 1N5ZA 3QSUA 3BY7A 5L23A 2PVGB 1OEBA 5GAN5 3ZFJA 5HCKA 1KJWA 4CRIA 3ER0A 3ME9A 1X75C 2XI9A 3CD6T 4HVVA 4DBHA 4Y28E 1RACB 4MMKA 4JLGA 1VQ7A 4FYWB 3PTAA 1CKAA 2DVEA 3NFCA 1VQKT 4JRQA 4EMKC 1G3SA 3PE0A 3I56Q 3CEYA 4OGEA 2XIDA 2OTJA 2GBQA 3PMIA 3CCJA 5A2QE 3RIRA 3LYIA 3CC4T 1KD1R 1CKBA 3QJ6A 2CUBA 1T0HA 1ZX6A 3HKSA 2QA4A 4E7SA 2RB6A 3EGDB 3QDFA 3OS2A 1Q81C 5GAOm 2KXCA 1OPLA 5FU6C 2RPNA 4KRTA 1Y7XA 4IUUA 3FJ5A 3KXTA 2RA2A 3A8OB 1B34A 3EG9A 2P0QA 4J6YA 3G6ET 1F1BB 4EMHA 3TSWA 3TREA 1WHMA 1M90R 5LJ5g 1VQKQ 1BBZA 1RAFB 3PIPA 1UEBA 4QQ6A 1IB8A 3A8MB 4XQ3A 4X1VA 2PVDB 3NHNA 1K1ZA 2RQTA 2OAUA 4BE0A 1K9MR 4N4IA 2AK5A 1KFZA 3RBBB 1WHHA 1WLPB 2JVVA 2EQJA 1QCNA 1LOJA 2JUFA 1TTHB 1GL5A 5KH6A 2V26A 4M7DE 4AFZC 2JNGA 1D0ZA 1D1AA 4C92C 2HSEB 3BDUA 1QCOA 5GANj 1MHNA 4FIBA 1NYFA 2D8JA 4BI8B 3X26B 3OS0A 2LJ1A 4XU3A 2XDPA 4M78D 3ZBDA 1RABB 3G6EQ 1VQLQ 1WIEA 1VQPA 1B07A 3JCMc 5CAIA 2EVRA 1W70A 1H8KA 1YIJT 4J7IA 4Z8AA 1VUBA 2RK2A 3DLMA 2ROTA 1IRXA 4HVWA 3H41A 1OQKA 2DBMA 2JM9A 4NOYA 3P8DA 2HZYA 4OB1B 4JRIA 3PMTA 1RAEB 3OYEA 2IVWA 2FZCB 2EIFA 1K8AU 1N8RR 1VYTA 3VS3A 4JRPA 2VGMA 1T3LA 1BU1A 2J6FA 5CQYA 3Q1JA 1K73C 1TWBA 2QQBA 3LGFA 2MPXC 1AWOA 2IG0A 1YIJQ 4E2FB 4FU6A 2QK0A 4FYVB 4F14A 4J83A 1IREB 2ZPIB 3P8HA 4DEYA 3CMAA 2WACA 1U5SA 4C5GA 4AFSC 2O9SA 1Q82U 2QYZA 4ZTJA 5J26A 2HCKA 3CCST 3OYBA 4M78A 1RAAB 2XD0A 3I5RA 4JLIA 1VYUA 1TS9A 2MYSA 3QUIA 4RKUE 2HMAA 3M56A 3JAME 3VS1A 5CKDA 2J7IA 4M77C 5LJ3j 2LC4A 2DZ9A 1ZBJA 2CZ7B 3GLXA 2RHIA 1OZ2A 5D6YA 3CCLT 5CQXA 2ECZA 3V8JA 1X6BA 4PJOG 1M3CA 2RH2A 3NGPA 4BE2A 3N5BB 3H8ZA 1TOVA 3CCMA 5LJ5d 4Y92A 2K3BA 4KGZB 1VQ5A 3VV0A 2M02A 3CCSQ 4A4GA 1QVGP 1NJIU 2JW4A 1R0BG 1M1KR 4JZ3A 4F7UA 3EG2A 3CCEA 4Z89A 1M1FA 2GGRA 2OX7A 3H0HA 2KDSA 1SF9A 2DIGA 3CBOA 1KIKA 2VV5A 1YJ9A 1JRIA 4CC7A 4OMOA 3OSSC 4C8QF 4WTOB 4PLIA 1SRLA 3NTIA 5KYUB 3JB9I 2DNUA 3CCUQ 1M3AA 1I4K1 4C92D 2LX7A 4EMKA 5GAMh 4N0AC 4ZGDB 2K5IA 5I11A 5I21A 1IHWA 2XK0A 3IQLA 5CO7A 3UPUA 1IGUA 2K3XA 4JPBW 2A7YA 2DBKA 2CS7A 2K79A 3MP6A 2DVJA 2XDDA 2YRVA 4E7IA 1D3BB 1WHLA 2EKOA 4UC4A 1X2KA 2W10A 4M75C 1N27A 1I07A 4JUVA 3RKWA 4F04B 1BIBA 3JB9H 1AT1B 4QW2A 3OYJA 1R8OB 2OAWA 2M0YA 5GMKi 2FO0A 1VQMT 1ZA2B 2VWFA 2DRKA 5HK3A 2JOYA 4BY6C 2DFUA 2O4XB 4M7DF 2EPDA 2R5MA 3GBQA 3CD6A 1WJQA 3C94A 2EBPA 3REBB 2OI3A 3VKIA 2P0KA 3AT1B 4XTXA 1TG0A 3QZ9B 3I55T 1QQJA 1R0CB 3JSCA 1BI3A 1T3SA 3C12A 2QAZA 1OYXA 5ECAA 3OYCA 1Y96A 4OVAA 4J8OA 4M4ZA 4JJDA 3LWIA 3CC4A 3CC2T 2JM8A 3HRTA 3QIIA 2FPEA 3EG3A 3CBPA 3JCMW 2HKNA 1WX6A 4C0FA 2KXDA 1FMKA 1QLYA 4C92A 3CPWP 4JS4A 4LDVA 4M7AG 1VQMQ 2LJ0A 1ARKA 2Y4YA 1OI1A 2L0AA 2A0FB 1K0XA 5EC7A 4ZTFA 2R57A 2V1QA 2MCNA 1VQ8T 1X2QA 2K2VA 5KYXA 3A8HB 2M9UA 4IUQA 3QYHB 3VS2A 1WDXA 1EIFA 3QYGB 4E47A 3QHSA 4M77D 2F2XA 3EGUA 2RK1A 2HAXA 2SEMA 2KYBA 1U3OA 2KI7A 2QQSA 5A0LA 1VOMA 3TVTA 1Q86U 1RLPC 1M3BA 2JMAA 1UUEA 1GCPA 1ACMB 1Q7YC 3L42A 1UG1A 3L2QA 5GMKe 4HT9A 2J06A 1FMVA 3HFOA 3MEUA 1U06A 1VQ8Q 1OOTA 2KMTA 2K5LA 5GAOn 4PJOB 2L2PA 2RJCA 1KQSP 1QVGA 2H8HA 1G3TA 3CQTA 1PKTA 1TSFA 3X20B 2LDMA 3OYGA 2DZCA 3PGGA 3TEEA 3THKA 2PVOB 2EYYA 2VB6A 1ZLMA 3G4ST 3QZ5B 3HFNA 3OYMA 1VIEA 2E10A 3FB9A 3UWNA 1KC8C 4AFQC 3I5SA 1ZSGA 5HKCA 3RR6A 1YJNQ 2MWOA 2QGFB 3EHQA 1V1CA 4MZTA 2QQ9A 4J5YA 3L2WA 2X4XA 1PCXA 3GP8A 1YCYA 3KBGA 2RN8A 4KH0B 1S72T 6AT1B 1LPLA 2L5QA 1G3YA 2AZSA 3FLGA 3J80E 2DL3A 1OU9A 1YHQT 3QWYA 2DTIA 2VXFA 1R77A 3A8GB 2EW3A 1JJ2P 4C5IA 1W1FA 2E3HA 3G4SQ 1WXTA 2RHYA 4M78E 2E6ZA 1M2VB 1ABQA 5L8RE 3QDRB 4A4FA 2J6OA 1KG1A 3VS4A 3VS0A 2KRSA 4J7FA 1NPPA 2I2LA 3F70A 4MZPA 2WSCE 2LQNA 2Y4XA 1IO6A 2A3LA 1KD1U 1OU8A 2RQUA 3JCMf 1BIAA 1X69A 2ZPHB 3EG1A 3VRZA 2K3YA 4HT8A 1Y57A 5LJ5f 2DMOA 1PHTA 2EAYA 3M59A 1S72Q 4M7AA 1GBQA 3HPWA 4IUVA 3CCLA 1AD5A 4MDXA 3OB9A 1D0YA 3SWNA 1D1CA 4N0AA 3EFSA 4R56A 3M53A 3JCMP 4V2SA 3I56T 1W2BS 2AT1B 4XU1A 1DJ7B 5GMKm 5GANh 1QCFA 3CPWA 1W2BP 4J6WA 4F7UE 1VQ9A 3JRZA 1UDLA 1M90U 4RG2A 4M75A 1GFDA 4PJNA 3RMQA 2MOXA 2EKHA 2CP7A 1BCMA 2LT1A 1EZZB 5IH2A 2KYMA 1QKXA 4FT4A 2EYXA 1K9AA 4BE1A 2M16A 1K9MU 1KK7A 2QXFA 2E12A 3MEWA 1MMNA 1WZOA 2JS0A 5GAMg 3RERA 1YNZA 1I1JA 1OPKA 2M0OA 1AVZC 4PLLA 2DXBA 2A36A 1WXUA 4GLKA 5KYYA 1VQ6Q 5FW9A 2KRNA 5FROA 2F5KA 2DYBA 2PNIA 2RI2A 1M8VA 4XTYA 1UGQB 1QP3A 1SPKA 4M78G 2E4HA 2X9HA 1H3ZA 2GCXA 1WJRA 1XOVA 4PL6A 1CSKA 3META 2GFAA 4FSSA 1I0CA 1IGQA 1MNDA 4LE9A 4GLMA 3JCMV 3ZEHA 2EWNA 4HKEA 1QVPA 1PD0A 1PSFA 4C0ZA 3PNWC 1KQSA 1FMWA 2CP6A 1XTDA 1VQMA 1SSHA 3CCQQ 2XICA 4LUEA 1NBEB 2COWA 1VQLT 4FYXB 4E7LA 2HQXA 2LP5A 3WXMB 4FCYA 3I55A 1KC8R 2VUBA 2D0QB 3EFOA 3QXEB 4PKCC 4C8QC 2V8KA 2W0ZA 1ZSZA 1VQOT 4EPCA 4F7UG 1K8AC 1QP2A 2M1HA 4HCCA 2QTXA 5LJ3h 1G3WA 3CC2A 1XQHA 4F16A 2PTKA 3TCJA 1UB4A 3MJXA 4XU0A 2KAFA 1B34B 4N4HA 2GF7A 3M4YA 3EG9B 4J9GA 3HP9A 4OP0A 3E9GA 4NS5A 2ED0A 5C0MA 3CCVT 1D09B 1YFNA 2LNVA 3OMCA 2CZ0B 2Z0WA 4XTUA 1Q82C 4IURA 3UT1A 4K11A 1JJ2A 1UJYA 2GTJA 2RD1A 5GAN7 3SDZA 1UGVA 3M55A 3H0FA 3TSZA 3R6NA 2RI3A 3CXCA 8AT1B 4PJOE 2C06A 2COZA 3X24B 5DY9A 3UATA 1VQOQ 4DBFA 4XTWA 4M7DC 2JJ9A 1OULA 2RJEA 2CUDA 3PT9A 1NG2A 3VS6A 2X51A 1H641 2ROLA 5EG2A 2EQMA 5GJWB 3V8KA 3SB2A 4LDYA 4OMPA 4LDWA 3FIFA 2V8JA 1JO8A 1NEBA 2FVUA 1HD3A 1UGSB 2DERA 4RTZA 3WVDB 2MAMA 3OSVA 4L5GA 4O5VA 3CCVQ 2LT4A 1AOJA 1M1KU 2AKKA 4LD9K 2D0NA 2F1LA 1RLQC 4MMLA 3MCAB 1NJIC 1ZBXA 4FW2A 3V7CA 2WSEE 5IXFA 2DRMA 2BUDA 5GAMd 1GCQC 1HXDA 4ME7A 2R58A 2CP5A 4BB7A 4FL6A 3OS1A 1OX8A 2QG9B 3G71T 1QKWA 2KEAA 5CVIA 4RCBA 9ATCB 4X9CA 1PG5B 5GAOq 4C92G 4QQGA 3M4GA 3LH0A 5CKBA 1UHCA 2L3QA 1UTIA 2D1XA 3VRYA 2FYKA 4AG2C 3JB9G 3HRSA 4C0GA 2DM1A 2LZ6B 2E5QA 2XDBA 4C0DB 4MZMA 3VUBA 1RAHB 4BACA 1I5LA 4OB3B 4CC2A 2AKLA 4BD3A 4DBQA 2P4TA 1UGRB 2K9GA 4WF2A 5I2SA 4P5NA 2ZPFB 3SEMA 3CCUT 3J7AF 4R55A 3H0IA 2QEXA 1KQ2A 2LCSA 1YHQA 2ENMA 3ULRB 3G71Q 3RUXA 4M78B 1Q81R 2KQWA 3GNGA 3G1JA 3DB3A
chains in the Genus database with same CATH topology
3L1AA 3JCMe 3HL8A 2BKDN 3A8HB 2E41A 2Y90A 5GAN6 5LJ5e 3CCRT 2K5FA 4XU2A 3UDCA 4PNOA 3CC7A 1IZ6A 2CYZB 2M9UA 4IUQA 3QYHB 4Y91A 4ZGJB 1VQ8A 1YJ9T 3AHUA 3JCMX 1EIFA 3QYGB 4E47A 1KHIA 2E70A 3QHSA 4M77D 2RHZA 4OMFB 5IN1A 5GAOp 3E19A 2EQKA 4O6JA 4C8QD 1KQ1A 5CIUA 3OYYA 2RK1A 4HCBA 3GF5A 4BI4A 3E1SA 2HAXA 2QI2A 3CCRA 1KC8U 1FXXA 1BKBA 3V7SA 5LJ3e 2L8DA 4M7AE 1N9SA 2QQSA 3M5AA 5A0LA 2OTLT 5GAN3 2YLBA 1Q86U 2RJDA 3OS5A 1BYMA 2YLCA 2R5AA 4RCCA 1N8RC 3L2VA 3NTHA 4E7HA 1Q7YC 2CGHA 3L42A 3L2QA 3BW1A 3DKMA 2E64A 5GANg 2DO3A 3VJPA 2FB7A 5I2MA 5GMKe 5GAN4 4HT9A 1I81A 3RMSA 3LX7A 4NL2A 2JZ2A 3HFOA 3MEUA 4LDXA 1Q81U 4M78F 3URGA 3O8VA 4F7UB 3I56A 2KMTA 2MMPA 3JCMb 3QSUA 5GANe 4M75E 3BY7A 1YJNA 2K5LA 5GAOn 2B8AA 2PVGB 4PJOC 4PJOB 2RJCA 5GAN5 1QVGA 1ZHIA 1G3TA 3ZFJA 5GANf 3C4SA 3FDRA 4A4HA 1QVFS 4QVZA 4CRIA 3ER0A 3ME9A 1X75C 4M77G 2XI9A 3X20B 3DLLA 2PUOB 5IAYA 3CD6T 2LDMA 3VUZA 4C8QG 1W2BA 4M7DD 2NLUA 2DZCA 3PGGA 3TEEA 3OYGA 2CZ1B 2PVOB 3QPHA 4Y28E 4Z02A 3G4ST 2RI5A 3QZ5B 4JLGA 4MMKA 1VQ7A 4FSXA 3HFNA 2WSFE 5M9OA 3PTAA 3OYMA 1VIEA 3CCJT 3MEVA 2DVEA 2E10A 3X25B 3NFCA 3M54A 3FB9A 2MI6A 4JRQA 5CKHA 4EMKC 3OW2S 3UWNA 4EMKB 1G3SA 1KC8C 2HQEA 2QA4T 2ZPEB 2LCLA 3CEYA 4OGEA 1Q86C 5HKCA 3G4SA 2XIDA 3SFMA 2OTJA 1VIFA 3INZA 1Y07A 3PMIA 3P8BB 4Q5WA 2LVMA 2MWOA 5CKFA 3CCJA 1AHJB 4BI3A 3RIRA 3LYIA 5A2QE 2EJ9A 3CPFA 3CC4T 1VQKA 1BI2A 3QJ6A 1YI2T 2G3RA 4MZTA 2QQ9A 3HKSA 4J5YA 3L2WA 2QA4A 2QQRA 2RB6A 2X4XA 2XHCA 4C8QA 1WGSA 4F7UF 4RG8A 5CK9A 3GP8A 3OYHA 1YCYA 2DTHA 4M77E 4X9DA 3KBGA 3OS2A 2PQWA 1S72T 3GIBA 1Q81C 2F69A 3NTKA 3V7RA 5GAOm 2L5QA 1YJWT 3JCMJ 5HK0A 4PJOF 3OYDA 2XU8A 4JRKA 5FU6C 5FU6B 2LTOA 1G3YA 3J80E 3A8LB 3FLGA 1VQ4T 1Y7XA 4IUUA 3KXTA 1YHQT 2EYQA 2DTIA 1KHCA 2H3JA 3LW5E 2VXFA 2RA2A 3A8OB 4BUGA 4OB0B 1S72A 3A8GB 1B34A 2VGNA 4LD6A 4XTZA 2DXTA 4C5IA 1VQNA 4M7DG 2P0QA 2VC8A 1PSEA 4J6YA 3G6ET 2RHYA 4M78E 2HBPA 3JCMh 4EMHA 2E6ZA 5L8RE 3LLRA 3OYAA 3TREA 3QDRB 4JDSA 1U8RA 4FT2A 2E1HA 2VXEA 3X28B 4A4FA 5LJ5g 5LJ5h 1KG1A 3PIPA 3CC7T 2XKOC 1UEBA 4QQ6A 4A4KA 3A8MB 5C6SA 4J7FA 4XQ3A 3FC3A 1NPPA 2PVDB 2I2LA 3F70A 3G6EA 5DLQE 3S3MA 1VQLA 4MZPA 2WSCE 2OAUA 2Y4XA 4BE0A 4N4IA 1Y96B 2A3LA 5D6WA 2JVVA 1KD1U 4BDYA 5LJ3g 2EQJA 3JCMf 1BIAA 2ZPHB 2PUKB 2K3YA 4HT8A 5A0GA 1LOJA 2JUFA 3QBYA 2X4JA 4M75G 5LJ5f 4M7DA 2EAYA 3M59A 3S6WA 3R6OA 3JCMd 2KK4A 1O75A 3EFRA 2X4YA 4IKFA 4M7AA 5KH6A 3HPWA 2RJFA 4IUVA 3CCLA 4M7DE 2KY9A 4II1A 2JNGA 4MDXA 3OMGA 4C92C 4C92B 1QVGS 3OB9A 4X34A 1N6AA 5DM7R 2O01E 3BDUA 3SWNA 1VQ9T 5GANj 3CBMA 5GMKh 4JS5A 1MHNA 4FIBA 4N0AA 3EFSA 4BI8B 4R56A 1M9SA 3M53A 3X26B 1K73U 3OS0A 3E9FA 5LJ3f 4D6WA 4A54A 3JCMP 4V2SA 4XU3A 2XDPA 3I56T 2HNIA 3FRNA 5FU7C 1W2BS 4XU1A 2HD0A 4M78D 3ZBDA 1DJ7B 5GMKm 4JJNK 5GANh 3VU3C 1Y71A 3JB9J 3CPWA 1YJNT 1VQ6A 4J6WA 4F7UE 4DOWA 1VQPA 1VQ9A 3OYIA 1D3BA 3JCMc 5CAIA 3L2UA 1U1SA 3FJPA 2JTFA 1M1GA 3JRZA 1M90U 4RG2A 1M5Q1 4M75A 1YIJT 3C95A 2MWPA 2DAQA 1VUBA 2RK2A 4J7IA 2F5TX 3RMQA 5FLXE 1YBYA 3DLMA 2LT1A 1LNXA 4BDZA 1M4ZA 2RO0A 4FT4A 5KCHA 1WNLA 5CCAA 4BE1A 2CZ6B 1WQ7A 2M16A 1K9MU 4M7AC 2QXFA 1VQ7T 1YIJA 3HRUA 2E12A 3MEWA 4J6XA 4YTLA 3SWNC 2DTOA 2V8IA 2O4XA 4NOYA 2DXUA 4A53A 5GAMg 2VYTA 3P8DA 4OB1B 5GANd 3GOXA 1KD1C 3RERA 4JRIA 2LQ8A 3PIOA 2M0OA 3PMTA 4PLLA 3JB9D 1BI0A 1NE8A 2DXBA 4GLKA 4OF1A 4C92F 2OTJT 1X01A 2DEQA 3OYEA 5FROA 2IVWA 1JB0E 2ZPBB 3KUFA 2F5KA 3CCQA 2EIFA 5GAMe 2CKKA 2RI2A 1M8VA 1K8AU 4TVRA 1FX7A 1U1TA 1UGQB 2K4YA 4XTYA 5AYFA 4JRPA 2QQAA 2VGMA 4KUDK 3JB9F 3DB4A 1QP3A 5CQYA 3Q1JA 2DJZA 4M78G 1K73C 3OY9A 1H3ZA 5GMKl 2GCXA 1WJRA 3OBYA 1XOVA 3CMEA 2QQBA 3QG1A 4PL6A 3LGFA 1UGPB 4N4GA 3OBWA 2XG8D 2IG0A 4RMOA 3META 1WQWA 4M77A 4PJOD 5KE3A 2GFAA 4FU6A 3BDLA 2YHTA 1M90C 3OYFA 4J83A 3JCMV 1IREB 1I8FA 3ZEHA 2EWNA 2ZPIB 4HKEA 3P8HA 1QVPA 1VQNT 3MP8A 3CMAA 4M7AF 2WACA 1PSFA 4C0ZA 4C5GA 3PNWC 4QVCA 1VQ4A 1KQSA 1Q82U 2DKGA 1XTDA 4OB2B 4EMGA 2DXCA 4ZTJA 5J26A 1VQMA 3CCST 1K9MC 2XICA 3OYBA 3TU4K 3RESA 4M78A 5LJ5j 2XD0A 3SD4A 4JLIA 3QUIA 4RKUE 1VQLT 3M56A 2E6NA 3JAME 4E7LA 4EDUA 2HQXA 1YITA 5GAN8 5CKDA 5FRNA 3S3OA 3CCSA 3L2RA 3WXMB 3DB3A 3I55A 2VUBA 5KE2A 2D0QB 4M77C 3M58A 4ZN3A 1RI0A 2X4WA 3QKJA 3MP1A 3QXEB 4PKCC 2LC4A 5LJ3j 2DZ9A 4C8QC 2V8KA 4C8QB 2ZPGB 1VQOT 4EPCA 3GNFB 2CZ7B 5DLOA 3GLXA 1LJOA 2RHIA 4F7UG 3CPWS 1K8AC 1P92A 1OZ2A 5D6YA 4GY5A 1QP2A 2M1HA 4HCCA 4ZN1A 5CQXA 2DPPB 3CCLT 2QTXA 1TH7A 3G7ZA 5LJ3h 3HSBA 1G3WA 2X35A 3CXCS 3CC2A 3V8JA 4PJOG 4DOVA 1XQHA 1RL2A 2JTMA 4CI0C 5LL6S 5GMKj 3TCJA 1VQOA 1UB4A 2E65A 4LDUA 2RH2A 4QVDA 3EAEA 4BE2A 3WVEB 2L3RA 2EFIA 4XU0A 3N5BB 2KAFA 3H8ZA 1B34B 4N4HA 5GAOl 2GF7A 3M4YA 5LJ5d 3CCMA 1NPRA 3HP9A 4OP0A 1VQ5A 3E9GA 1VQ6T 3VV0A 4NS5A 1VQPT 3CCUA 5C0MA 3CCVT 4A4GA 4HA8A 1XNIA 1NJIU 2LNVA 3OMCA 2CZ0B 4XTUA 1Q82C 4F7UA 1WJSA 4IURA 4L59A 3UT1A 5FU7B 3VYGA 3CCEA 1QW1A 1JJ2A 1M1FA 4A4EA 2ZCFB 2LQKA 2RD1A 5GAN7 2KDSA 1ZQ1A 5LJ3d 3SDZA 3S3NA 2DD5A 3M55A 4PJOA 2DIGA 2K57A 4KULA 3CCVA 4XAXB 4ELYC 3LGLA 2RI3A 3CBOA 2VV5A 3CXCA 1NZ9A 5KCOA 2LX9A 4M77F 4KUIA 2C06A 3QO3A 1JRIA 1YJ9A 4PJOE 3X24B 3OSSC 5DY9A 3HHTB 4C8QF 2KVQG 4XTWA 4M7DC 3OYNA 4M7DB 1G5VA 3MO8A 4PLIA 5CKEA 2RJEA 5GAMj 3NTIA 3LWHA 3M9QA 3PT9A 4M7AB 3J7AF 4XK8E 3VYHB 4B9XA 2AHJB 3JB9I 1JBMA 1H641 5EG2A 2EJFA 3OYKA 1I4K1 2EQMA 4C92D 3SWNB 3V8KA 2OTLA 3CCQT 4EMKA 3QJYA 4L6V5 3SB2A 5GAMh 4N0AC 4LDYA 4ZGDB 3OQ5A 2K5IA 4LDWA 5I21A 3FIFA 2XK0A 2V8JA 5CO7A 2DD4A 5D6XA 3UPUA 2K3XA 5FRMA 2FVUA 1UGSB 2A7YA 3M57A 2CS7A 2FL7A 3MP6A 1KQSS 3RKYA 3CMET 2XDDA 2YRVA 3WVDB 2MAMA 1N9RA 3OSVA 4L5GA 4O5VA 4DA4A 4E7IA 2QDYB 1D3BB 2PU9B 1BI1A 2EKOA 4M7DF 2LT4A 4IUTA 4UC4A 4M75C 1N27A 1SSFA 4M75B 3BFMA 1M1KU 4JUVA 4LD9K 1W4SA 3RKWA 2RM4A 4MMLA 5GAOr 3MCAB 5GAMf 1NJIC 1ZBXA 2EJGA 4XTVA 2BIVA 3V7CA 2WSEE 1BIBA 3JB9H 3CMAT 2BUDA 4ZGEB 4QW2A 3OYJA 5GAMd 2RHUA 1VQKT 4M7AD 1GXIE 4QQDA 1HXDA 1R8OB 5GMKi 4ME7A 1VQMT 4OGCA 2R58A 5J39A 4BB7A 4E7JA 1MGQA 3A5ZB 4FL6A 3T9NA 3PFSA 2JOYA 5HK3A 2LCCA 2MF2A 2O4XB 4BY6C 4BY6B 3J81E 3OS1A 3GPLA 2R5MA 3L2ZA 3G71T 4MDWA 5CVIA 3CD6A 4RCBA 4C5EA 1WJQA 3MHXA 4X9CA 3C94A 2FHDA 3VKIA 2EQUA 3V8LA 2DIQA 4KBMB 2P0KA 1YITT 5GAOq 1O9SA 4XTXA 4C92G 3QZ9B 4QQGA 2D9TA 3I55T 3M4GA 3LH0A 5CKBA 4FM4B 4KT0E 3G71A 3JSCA 3JCMQ 2L89A 1QVFA 1BI3A 3C12A 5HY6A 2FYKA 4M75D 3JB9G 5IT9E 3HRSA 4C0GA 1OYXA 4IUPA 2DK3A 3OYCA 1Y96A 4OVAA 3OYLA 2GQVA 1OZ3A 4C8QE 2E5QA 4J8OA 4C0DB 4C0DC 4MZMA 2XDBA 3VUBA 4NL3A 3LWIA 3CC4A 3CC2T 4VUBA 4B9WA 4C5HA 1N8RU 4M77B 4M75F 4BACA 5J3BA 3HRTA 1YI2A 1I5LA 3QIIA 4OB3B 2QEXT 1Q7YU 2P0PA 3CBPA 1JJ2S 2GFUA 3OW2A 3JCMW 4BD3A 1V29B 2D6FA 2P4TA 1M1KC 4C0FA 1UGRB 1YJWA 4WF2A 3CCMT 1FWZA 4ELZC 1WPYA 4P5NA 4HCZA 4C92A 2ZGWA 5I2SA 3OA6A 4JS4A 1VQ5T 4LDVA 2ZPFB 3JCMg 4M7AG 1HK9A 3CCUT 2LRQA 5GAN2 2Y4YA 5CR2A 3MEAA 3RKXA 4R55A 1OI1A 2QEXA 3H6ZA 4C92E 3ASKA 5A0DA 1KQ2A 1YHQA 4ZTFA 2R57A 1X6OA 2RHXA 4ATOA 2JN0A 4M78C 3FEOA 4M78B 3RUXA 4E7KA 1VQ8T 2KQWA 2ZZDA 3CCET 4DQ2A 2KSSA 3GNGA 2K2VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XTW A;  4M7D C;  3L1A A;  4M7D B;  1M8V A;  4JRK A;  3JCM e;  4XTY A;  1U1T A;  5GAM j;  3JB9 F;  2E41 A;  2Y90 A;  4M7A B;  5GAN 6;  5LJ5 e;  4XU2 A;  2DJZ A;  2DTI A;  4M78 G;  3JB9 I;  1JBM A;  1H64 1;  2VXF A;  2RA2 A;  4PNO A;  5GMK l;  4Y91 A;  2EJF A;  1I4K 1;  1B34 A;  4C92 D;  3JCM X;  4XTZ A;  3SWN B;  2DXT A;  3V8K A;  3AHU A;  4M7D G;  3QHS A;  4M77 D;  2VC8 A;  4EMK A;  5GAM h;  4J6Y A;  3SB2 A;  4N0A C;  5GAO p;  1WQW A;  4M78 E;  4M77 A;  3JCM h;  4EMH A;  4PJO D;  4C8Q D;  5I21 A;  1KQ1 A;  3FIF A;  2YHT A;  2E1H A;  2VXE A;  5LJ5 g;  5LJ5 h;  5GAN g;  3JCM V;  1I8F A;  3V7S A;  5LJ3 e;  2EWN A;  3RKY A;  4M7A E;  1N9S A;  1N9R A;  4XQ3 A;  5GAN 3;  2YLB A;  4M7A F;  1D3B B;  2I2L A;  4QVC A;  2YLC A;  4M75 C;  4M75 B;  3BFM A;  2DKG A;  4RCC A;  4JUV A;  4EMG A;  1Y96 B;  3RKW A;  2CGH A;  2RM4 A;  4MML A;  5GAO r;  5GAM f;  3BW1 A;  2EJG A;  2E64 A;  4M78 A;  4XTV A;  3RES A;  5LJ3 g;  2FB7 A;  1BIA A;  3JCM f;  3V7C A;  5LJ5 j;  1BIB A;  5GMK e;  5GAN 4;  3JB9 H;  1I81 A;  4HT8 A;  4HT9 A;  4JLI A;  1LOJ A;  3QUI A;  5LJ5 f;  4M7D A;  4M75 G;  4NL2 A;  5GAM d;  4M7A D;  2EAY A;  1HXD A;  3HFO A;  5GMK i;  3JCM d;  4M7A A;  3EFR A;  4M78 F;  5GAN 8;  4F7U B;  3JCM b;  1MGQ A;  4M7D E;  3QSU A;  4C92 C;  5GAN e;  4M75 E;  4C92 B;  3BY7 A;  4M7D F;  3BDU A;  4M77 C;  3L2Z A;  3SWN A;  5GAO n;  5GMK h;  5LJ3 j;  5GAN j;  4RCB A;  2DZ9 A;  4PJO B;  4PJO C;  4N0A A;  4C8Q C;  3EFS A;  4X9C A;  4C8Q B;  5GAN 5;  1LJO A;  3V8L A;  4F7U G;  5LJ3 f;  5GAN f;  4A54 A;  3JCM P;  4V2S A;  4XU3 A;  5GAO q;  2HNI A;  4XTX A;  4XU1 A;  4M78 D;  4C92 G;  2QTX A;  5GMK m;  3M4G A;  5GAN h;  1TH7 A;  4M77 G;  5LJ3 h;  3VU3 C;  3JB9 J;  3HSB A;  4J6W A;  3V8J A;  4PJO G;  4F7U E;  3JCM Q;  4C8Q G;  1D3B A;  3JCM c;  5CAI A;  4M7D D;  1U1S A;  2DZC A;  2FYK A;  3FJP A;  3PGG A;  4M75 D;  5GMK j;  3JB9 G;  2E65 A;  4MMK A;  1M5Q 1;  4M75 A;  3HFN A;  4QVD A;  1Y96 A;  4XU0 A;  4C8Q E;  1B34 B;  2DVE A;  2E10 A;  5GAO l;  5LJ5 d;  1LNX A;  3FB9 A;  4NL3 A;  4EMK C;  4EMK B;  4OP0 A;  1WNL A;  4M77 B;  4M75 F;  1WQ7 A;  1I5L A;  4M7A C;  4HA8 A;  3JCM W;  4XTU A;  4F7U A;  3INZ A;  4J6X A;  3SWN C;  4WF2 A;  2DTO A;  1WPY A;  4C92 A;  2ZGW A;  3RIR A;  2EJ9 A;  4NOY A;  2DXU A;  4A53 A;  5GAM g;  2RD1 A;  5GAN d;  5GAN 7;  3RER A;  5LJ3 d;  3JCM g;  1HK9 A;  4M7A G;  4JRI A;  5GAN 2;  4J5Y A;  4PJO A;  2RB6 A;  3RKX A;  4C8Q A;  4F7U F;  2K57 A;  4C92 E;  3JB9 D;  1KQ2 A;  1YCY A;  2DTH A;  4M77 E;  4X9D A;  4C92 F;  1X01 A;  2DEQ A;  2JN0 A;  4M78 C;  4M78 B;  3RUX A;  3GIB A;  4PJO E;  4M77 F;  3V7R A;  5GAO m;  3QO3 A;  1JRI A;  4DQ2 A;  3JCM J;  5DY9 A;  4PJO F;  5GAM e;  4C8Q F; 
#chains in the Genus database with same CATH topology
 3HL8 A;  3M0T A;  2E41 A;  2NUZ A;  1UFF A;  3CCR T;  3RDV A;  3UDC A;  4PNO A;  1YI2 Q;  2B86 A;  4ZGJ B;  3AHU A;  2JXB A;  4OMF B;  5IN1 A;  1PRM C;  3E19 A;  2EQK A;  4C8Q D;  5CIU A;  3OYY A;  1YJW Q;  4HCB A;  2H3E B;  4PK4 A;  5LJ3 e;  3LH5 A;  2L8D A;  4M7A E;  4AFU C;  1VQ4 Q;  3M5A A;  4RTU A;  5GAN 3;  1TXQ A;  4ORZ A;  2YLC A;  1K8A R;  2K6D A;  4JJC A;  4RCC A;  2CGH A;  3BW1 A;  3DKM A;  2E64 A;  5GAN g;  2DO3 A;  2FB7 A;  5I2M A;  1WHG A;  2CH4 A;  5GAN 4;  1E6H A;  3RMS A;  5KYW A;  4PFP A;  3CC7 Q;  1NEG A;  2A37 A;  4PJL A;  4F7U B;  3I56 A;  1WI7 A;  1K4U S;  4M75 E;  4A63 B;  2O9V A;  1Z9Z A;  3CCR Q;  1ZHI A;  3C4S A;  3FDR A;  4A4H A;  1M30 A;  1QVF S;  4OMN A;  4QVZ A;  4M77 G;  3DLL A;  2PUO B;  2DE0 X;  1XJW B;  5IAY A;  3VUZ A;  4M7D D;  2CZ1 B;  3QPH A;  4PFZ A;  2RI5 A;  3BE3 A;  5IXB A;  4FSX A;  2A28 A;  5M9O A;  3EGX A;  3JV3 A;  3CCJ T;  1D0X A;  2I0N A;  3M54 A;  3OW2 S;  4EMK B;  2QA4 T;  1Q86 C;  3REA B;  2CT3 A;  3SFM A;  1VIF A;  2VVK A;  2AIR B;  2KR3 A;  1WXB A;  1AHJ B;  4BI3 A;  3CPF A;  1VQK A;  1BI2 A;  2G3R A;  1Y0M A;  4C8Q A;  2X3X D;  3NMZ C;  4RG8 A;  2DTH A;  4X9D A;  3QWX X;  2MK5 A;  1B3Q A;  4CC3 A;  3V7R A;  4PJO F;  1FYN A;  1VQ7 Q;  2C0I A;  2XU8 A;  5FU6 B;  4DBR A;  3A8L B;  1K73 R;  1VYV A;  2EYQ A;  1NJI R;  1KHC A;  3LW5 E;  1X27 A;  4OB0 B;  3PVL A;  2VGN A;  2HQH A;  4LD6 A;  1AZE A;  2HBP A;  2OTJ Q;  3JCM h;  1C1A A;  3OYA A;  3CCJ Q;  1JXM A;  2E1H A;  2VXE A;  5LJ5 h;  1A0N B;  2COY A;  3C0C A;  2QA4 Q;  4JJB A;  5C6S A;  1TU0 B;  2PZ1 A;  2FPD A;  3G6E A;  1VQL A;  1HYO A;  2NUP A;  1WFW A;  1Y96 B;  5D6W A;  5LJ3 g;  1RI9 A;  1SHG A;  2PUK B;  2RQV A;  3QBY A;  4M75 G;  4M7D A;  1MV3 A;  4EIK A;  3S6W A;  5KYN A;  1O75 A;  3EFR A;  1AZG B;  2X4Y A;  4IKF A;  1K76 A;  2FRY A;  4II1 A;  3M0Q A;  3OMG A;  4C92 B;  1N6A A;  5DM7 R;  2O01 E;  4JS5 A;  1SKU B;  2K2M A;  3FRN A;  5GJV B;  4QKU A;  1WHJ A;  1Y71 A;  3JB9 J;  2P84 A;  1YJN T;  5KYX B;  5IHN A;  3L2U A;  2C0T A;  1U1S A;  2JTF A;  1M1G A;  2DAQ A;  3M0U A;  4BDZ A;  2RO0 A;  2QGG A;  3MKD A;  5KCH A;  1M2O A;  1WNL A;  4HVU A;  4DEX A;  2CZ6 B;  4J9C A;  2EGA A;  1YIJ A;  4J6X A;  2DTO A;  2V8I A;  3GOX A;  5GAN d;  1KD1 C;  1S1N A;  3PIO A;  1NE8 A;  2K7A A;  1OX9 A;  2FEI A;  4LNP A;  1JB0 E;  2ZPB B;  5I22 A;  1BB9 A;  5GAM e;  1AWX A;  1FX7 A;  1X43 A;  2CP0 A;  4RTW A;  4KUD K;  3DB4 A;  3EG0 A;  2NUT A;  3OBY A;  2CDT A;  1ABO A;  3QG1 A;  4N4G A;  1PWT A;  2CH4 W;  3EH1 A;  1WQW A;  4M77 A;  5KE3 A;  3BDL A;  2YHT A;  1M90 C;  4PFO A;  3OYF A;  1I8F A;  7AT1 B;  4ZNX A;  1VQN T;  4M7A F;  2M51 A;  1PC0 A;  4QVC A;  4WCI A;  4ESR A;  4OB2 B;  4EMG A;  2DXC A;  1K9M C;  2X3W D;  2LMJ A;  3TU4 K;  3RES A;  5IHI A;  5LJ5 j;  3SD4 A;  2JT4 A;  2L3S A;  3UF4 A;  3I35 A;  2HDA A;  2E6N A;  4EDU A;  4J9F A;  5FRN A;  3S3O A;  3CCS A;  4QT7 A;  3M58 A;  1RI0 A;  3QKJ A;  3MP1 A;  1NM7 A;  1Q86 R;  2CRE A;  1LJO A;  1P92 A;  4GY5 A;  3CMA Q;  2RQW A;  2DPP B;  4AG1 C;  3G7Z A;  3HSB A;  2X35 A;  3CXC S;  1I5O B;  1UEC A;  1RL2 A;  5LL6 S;  5IHK A;  3EAE A;  1VQN Q;  3WVE B;  2L3R A;  1HJD A;  4F17 A;  1VQ6 T;  3CCU A;  1TUC A;  2FRW A;  2ABL A;  1J3T A;  1QWF A;  4OMQ A;  2HL5 C;  2DIL A;  1V76 A;  1JQQ A;  2MIO A;  5FU7 B;  3VYG A;  1NYG A;  1QW1 A;  2IPO B;  2LQK A;  1ZQ1 A;  5LJ3 d;  2IIM A;  2K57 A;  4KUL A;  4XAX B;  4ELY C;  5KCO A;  2LX9 A;  4KUI A;  2BZX A;  2GNC A;  3HHT B;  2KVQ G;  3OYN A;  2QAS A;  3LWH A;  3M9Q A;  4M7A B;  3CCM Q;  1RAG B;  3VYH B;  2AHJ B;  1VQ5 Q;  2DA9 A;  2EJF A;  3SWN B;  3CCQ T;  3OQ5 A;  2DL4 A;  2YT6 A;  3CCE Q;  4OMM A;  5D6X A;  3M57 A;  1BK2 A;  2FL7 A;  2RF0 A;  2A08 A;  3CME T;  1N9R A;  4DA4 A;  2PU9 B;  4IUT A;  2JMC A;  2ATC B;  4M75 B;  1SSF A;  2C0O A;  1YJ9 Q;  1W4S A;  3EGD A;  1Q7Y R;  2RM4 A;  2DJQ A;  2AZV A;  3M0R A;  1GXI E;  4ZGE B;  4KH1 B;  4QQD A;  5J39 A;  1MGQ A;  1PM3 A;  3T9N A;  2DLP A;  2LCC A;  4BY6 B;  3J81 E;  3GPL A;  3EHR A;  3L2Z A;  4PJJ A;  1QWE A;  1PKS A;  3MHX A;  2FHD A;  3V8L A;  2DIQ A;  4KBM B;  1YIT T;  5KYY B;  2BZ8 A;  2P4R A;  1O9S A;  2D9T A;  4KT0 E;  5IT9 E;  3CME Q;  4IUP A;  2DK3 A;  2GQV A;  1OZ3 A;  4C8Q E;  2KT8 A;  4VUB A;  4C5H A;  1N8R U;  2DL7 A;  2P0P A;  4KGX B;  1EX4 A;  1V29 B;  2D6F A;  1M1K C;  3CD6 Q;  1FWZ A;  1AWJ A;  2ZGW A;  3JCM g;  1HK9 A;  2LRQ A;  2DEU A;  2J05 A;  3MEA A;  3RKX A;  4C92 E;  3ASK A;  2O2O A;  2DF6 A;  2KNB B;  1X6O A;  2RHX A;  3FEO A;  3ZL7 C;  4E7K A;  2ZZD A;  4DQ2 A;  1M8M A;  2KSS A;  1WHK A;  1G83 A;  3L1A A;  2KBT A;  1YIT Q;  2BKD N;  2Y90 A;  5GAN 6;  4XU2 A;  3CC4 Q;  1IZ6 A;  2CYZ B;  4Y91 A;  4J9B A;  1VQ8 A;  3JCM X;  3EFO B;  2RHZ A;  5GAO p;  1ZSZ B;  1KQ1 A;  4BI4 A;  1FXX A;  3V7S A;  2OTL T;  2YLB A;  1Z9Q A;  3VS5 A;  1D1B A;  2RJD A;  3OS5 A;  3VS7 A;  1YWO A;  2QDL A;  3L2V A;  4E7H A;  1RAD B;  3VJP A;  1H92 A;  3NPF A;  4FW1 A;  1UE9 A;  3LX7 A;  2DYI A;  2JZ2 A;  2ZAE A;  1Q81 U;  1MNE A;  4M78 F;  2MMP A;  5GAN e;  1YJN A;  2NWM A;  2B8A A;  4PJO C;  1X6G A;  5GAN f;  2BTT A;  3D7S B;  4AT1 B;  2O31 A;  3H9N A;  2GQI A;  1W2B A;  4C8Q G;  1JEG A;  1YCS B;  2NLU A;  1GBR A;  4Z02 A;  2V1R A;  1QMC A;  1SHF A;  2SRC A;  2WSF E;  4FYY B;  2OTL Q;  3MEV A;  1IHV A;  3X25 B;  2MI6 A;  5CKH A;  2HQE A;  1JXO A;  2FG0 A;  2LCL A;  2ZPE B;  1VA7 A;  2EYZ A;  3G4S A;  3RNJ A;  1K0S A;  3INZ A;  1Y07 A;  5FWB A;  2EGC A;  3P8B B;  4Q5W A;  2LVM A;  5CKF A;  2EJ9 A;  1YI2 T;  5AT1 B;  2QQR A;  2XHC A;  4F7U F;  1WGS A;  5CK9 A;  3OYH A;  4M77 E;  8ATC B;  2PQW A;  3GIB A;  2F69 A;  3NTK A;  1YJW T;  3HTR A;  3JCM J;  5HK0 A;  5D7U A;  3OYD A;  4JRK A;  2LTO A;  1VQ4 T;  2EQI A;  1ZA1 B;  2H3J A;  1YP5 A;  2KGT A;  2ESW A;  4BUG A;  1ZUU A;  1S72 A;  4XTZ A;  1ZUY A;  1WA7 A;  2DXT A;  1UHF A;  1VQN A;  4M7D G;  2VC8 A;  4HCK A;  1PSE A;  2YRC A;  4LUD A;  4RUG A;  2YUQ A;  3LLR A;  4JDS A;  1U8R A;  4FT2 A;  3X28 B;  3CC7 T;  2XKO C;  4A4K A;  3SHW A;  3UA6 A;  4B6M A;  3FC3 A;  2CSI A;  1JU5 C;  2YUN A;  5DLQ E;  3S3M A;  4D8K A;  4J9E A;  4CC4 B;  4BDY A;  2FPF A;  2YDL A;  5A0G A;  2X4J A;  2RNA A;  3R6O A;  5KYU A;  2KK4 A;  3JCM d;  1MMD A;  2RJF A;  2KY9 A;  1RAI B;  1QVG S;  4X34 A;  2HEQ A;  1VQ9 T;  3CBM A;  5GMK h;  1W6X A;  1G8X A;  1K73 U;  1M9S A;  3E9F A;  5LJ3 f;  4D6W A;  4A54 A;  2E5K A;  2HNI A;  5FU7 C;  2HD0 A;  4JJN K;  3VU3 C;  1VQ6 A;  1MV0 B;  4DOW A;  3OYI A;  1D3B A;  2XMF A;  3FJP A;  2FZG B;  1M5Q 1;  3C95 A;  2MWP A;  5FLX E;  1AWW A;  2F5T X;  4D8D A;  1MMG A;  1YBY A;  3M0P A;  1LNX A;  1C6V X;  1M4Z A;  1YWP A;  2KRO A;  5CCA A;  1TUD A;  1WQ7 A;  4M7A C;  1IXD A;  3CCL Q;  4ANJ A;  1VQ7 T;  2HSP A;  1Q82 R;  3HRU A;  3U23 A;  1Q95 G;  4YTL A;  1E6G A;  3SWN C;  2O4X A;  4A53 A;  2DXU A;  2VYT A;  1QVF P;  1KSW A;  2LQ8 A;  2GTO A;  3JB9 D;  2BZY A;  1BI0 A;  4OF1 A;  4C92 F;  2OTJ T;  1X01 A;  2DEQ A;  1VQ9 Q;  2D8H A;  3KUF A;  3M0S A;  3CCQ A;  2CKK A;  5KYW B;  4TVR A;  1U1T A;  2K4Y A;  5AYF A;  3JB9 F;  2QQA A;  2QTV A;  3OW2 P;  4J9I A;  2DJZ A;  2O88 A;  2KT1 A;  3OY9 A;  1WYX A;  2NYS A;  5GMK l;  3CME A;  4GBQ A;  2DET A;  1UGP B;  3OBW A;  2XG8 D;  4RMO A;  4PJO D;  1AEY A;  1UJ0 A;  1G2B A;  2G6F X;  4E7Z A;  2ED1 A;  3MP8 A;  2RMO A;  2DKG A;  4J9H A;  3EGX B;  2CSQ A;  1PNJ A;  1M27 C;  2HKQ B;  1H3H A;  1YIT A;  5GAN 8;  3L2R A;  2E3I A;  5KE2 A;  4ZN3 A;  2X4W A;  4LXC A;  4C8Q B;  2ZPG B;  1MUZ A;  3A1P A;  1BCO A;  3GNF B;  5DLO A;  3CPW S;  3UA7 A;  2CP2 A;  4ZN1 A;  1TH7 A;  1ZUK A;  4DOV A;  4IIO A;  2JTM A;  4CI0 C;  5GMK j;  2HBW A;  2BE9 B;  1VQO A;  2E65 A;  4RTT A;  4LDU A;  4QVD A;  2J6K A;  3O5Z A;  2EFI A;  2F2W A;  4AMC A;  1LVK A;  2EGE A;  5GAO l;  1NPR A;  1VQP T;  4HA8 A;  3I9Q A;  1XNI A;  2DX1 A;  3I55 Q;  2RQR A;  4KGV B;  1PD1 A;  1WJS A;  4L59 A;  1EFN A;  2ZCF B;  4A4E A;  1ZSZ C;  3PVQ A;  3S3N A;  2DD5 A;  3KFV A;  2NUP B;  4PJO A;  2L3P A;  4RTV A;  3CCV A;  3LGL A;  3CC2 Q;  1NZ9 A;  4M77 F;  3QO3 A;  4J9D A;  1PRL C;  1G5V A;  4M7D B;  3MO8 A;  5GAM j;  5CKE A;  4JZ4 A;  2OJ2 A;  4XK8 E;  4B9X A;  1GCQ A;  1JBM A;  3OYK A;  2EYW A;  2OTL A;  2YRD A;  3QJY A;  4L6V 5;  2DD4 A;  5FRM A;  1SRM A;  3EH2 A;  4E6R A;  1KQS S;  1VQP Q;  3RKY A;  2JS2 A;  2QDY B;  1BI1 A;  2LQW A;  1B7T A;  3BFM A;  2HL3 A;  5GAO r;  5GAM f;  2EJG A;  4XTV A;  2BIV A;  3CMA T;  4M7A D;  1TUG B;  2RHU A;  1GRI A;  4OGC A;  4E7J A;  3A5Z B;  3PFS A;  4LN2 A;  2MF2 A;  4MDW A;  4C5E A;  2VKN A;  1M2V A;  2EQU A;  1T0J A;  2KRM A;  1NLO C;  4FM4 B;  1MMA A;  3G71 A;  3JCM Q;  2L89 A;  1QVF A;  5HY6 A;  2YXY A;  4M75 D;  1SG5 A;  1OV3 A;  3OYL A;  2NUT B;  4C0D C;  4NL3 A;  2YUP A;  4B9W A;  4M77 B;  4M75 F;  1YI2 A;  5J3B A;  2QEX T;  1Q7Y U;  1JJ2 S;  2GFU A;  4RTY A;  5FWC A;  4PJM A;  3OW2 A;  1E7O A;  4IIM A;  4Z88 A;  3E2U A;  1YJW A;  3CCM T;  2CP3 A;  1WPY A;  4ELZ C;  4HCZ A;  3OA6 A;  1VQ5 T;  1SEM A;  5GAN 2;  2DL5 A;  5CR2 A;  1LCK A;  2JTE A;  1VQ4 A;  1YN8 A;  3H6Z A;  5A0D A;  3CXC P;  3TQ7 P;  4ATO A;  2JN0 A;  4M78 C;  4HXJ A;  3CCE T;  2YWW A;  2KE9 A;  2FZK B;  3JCM e;  1RUW A;  2LJ3 A;  5LJ5 e;  2DL8 A;  2K5F A;  4R0K A;  3CC7 A;  1YJ9 T;  2LNH B;  1KHI A;  2E70 A;  2F2V A;  4O6J A;  3GF5 A;  3E1S A;  2QI2 A;  3CCR A;  3A98 A;  2BE7 D;  1KC8 U;  1BKB A;  1C0M A;  1N9S A;  2QEX Q;  1YHQ Q;  1GFC A;  3MPU B;  1BYM A;  2YUO A;  2VAS A;  2R5A A;  1N8R C;  3NTH A;  1HSQ A;  1I81 A;  2YSQ A;  4NL2 A;  4LDX A;  2CT4 A;  3URG A;  4OML A;  3O8V A;  1NLP C;  3JCM b;  4RTX A;  1N5Z A;  3QSU A;  3BY7 A;  5L23 A;  2PVG B;  1OEB A;  5GAN 5;  3ZFJ A;  5HCK A;  1KJW A;  4CRI A;  3ER0 A;  3ME9 A;  1X75 C;  2XI9 A;  3CD6 T;  4HVV A;  4DBH A;  4Y28 E;  1RAC B;  4MMK A;  4JLG A;  1VQ7 A;  4FYW B;  3PTA A;  1CKA A;  2DVE A;  3NFC A;  1VQK T;  4JRQ A;  4EMK C;  1G3S A;  3PE0 A;  3I56 Q;  3CEY A;  4OGE A;  2XID A;  2OTJ A;  2GBQ A;  3PMI A;  3CCJ A;  5A2Q E;  3RIR A;  3LYI A;  3CC4 T;  1KD1 R;  1CKB A;  3QJ6 A;  2CUB A;  1T0H A;  1ZX6 A;  3HKS A;  2QA4 A;  4E7S A;  2RB6 A;  3EGD B;  3QDF A;  3OS2 A;  1Q81 C;  5GAO m;  2KXC A;  1OPL A;  5FU6 C;  2RPN A;  4KRT A;  1Y7X A;  4IUU A;  3FJ5 A;  3KXT A;  2RA2 A;  3A8O B;  1B34 A;  3EG9 A;  2P0Q A;  4J6Y A;  3G6E T;  1F1B B;  4EMH A;  3TSW A;  3TRE A;  1WHM A;  1M90 R;  5LJ5 g;  1VQK Q;  1BBZ A;  1RAF B;  3PIP A;  1UEB A;  4QQ6 A;  1IB8 A;  3A8M B;  4XQ3 A;  4X1V A;  2PVD B;  3NHN A;  1K1Z A;  2RQT A;  2OAU A;  4BE0 A;  1K9M R;  4N4I A;  2AK5 A;  1KFZ A;  3RBB B;  1WHH A;  1WLP B;  2JVV A;  2EQJ A;  1QCN A;  1LOJ A;  2JUF A;  1TTH B;  1GL5 A;  5KH6 A;  2V26 A;  4M7D E;  4AFZ C;  2JNG A;  1D0Z A;  1D1A A;  4C92 C;  2HSE B;  3BDU A;  1QCO A;  5GAN j;  1MHN A;  4FIB A;  1NYF A;  2D8J A;  4BI8 B;  3X26 B;  3OS0 A;  2LJ1 A;  4XU3 A;  2XDP A;  4M78 D;  3ZBD A;  1RAB B;  3G6E Q;  1VQL Q;  1WIE A;  1VQP A;  1B07 A;  3JCM c;  5CAI A;  2EVR A;  1W70 A;  1H8K A;  1YIJ T;  4J7I A;  4Z8A A;  1VUB A;  2RK2 A;  3DLM A;  2ROT A;  1IRX A;  4HVW A;  3H41 A;  1OQK A;  2DBM A;  2JM9 A;  4NOY A;  3P8D A;  2HZY A;  4OB1 B;  4JRI A;  3PMT A;  1RAE B;  3OYE A;  2IVW A;  2FZC B;  2EIF A;  1K8A U;  1N8R R;  1VYT A;  3VS3 A;  4JRP A;  2VGM A;  1T3L A;  1BU1 A;  2J6F A;  5CQY A;  3Q1J A;  1K73 C;  1TWB A;  2QQB A;  3LGF A;  2MPX C;  1AWO A;  2IG0 A;  1YIJ Q;  4E2F B;  4FU6 A;  2QK0 A;  4FYV B;  4F14 A;  4J83 A;  1IRE B;  2ZPI B;  3P8H A;  4DEY A;  3CMA A;  2WAC A;  1U5S A;  4C5G A;  4AFS C;  2O9S A;  1Q82 U;  2QYZ A;  4ZTJ A;  5J26 A;  2HCK A;  3CCS T;  3OYB A;  4M78 A;  1RAA B;  2XD0 A;  3I5R A;  4JLI A;  1VYU A;  1TS9 A;  2MYS A;  3QUI A;  4RKU E;  2HMA A;  3M56 A;  3JAM E;  3VS1 A;  5CKD A;  2J7I A;  4M77 C;  5LJ3 j;  2LC4 A;  2DZ9 A;  1ZBJ A;  2CZ7 B;  3GLX A;  2RHI A;  1OZ2 A;  5D6Y A;  3CCL T;  5CQX A;  2ECZ A;  3V8J A;  1X6B A;  4PJO G;  1M3C A;  2RH2 A;  3NGP A;  4BE2 A;  3N5B B;  3H8Z A;  1TOV A;  3CCM A;  5LJ5 d;  4Y92 A;  2K3B A;  4KGZ B;  1VQ5 A;  3VV0 A;  2M02 A;  3CCS Q;  4A4G A;  1QVG P;  1NJI U;  2JW4 A;  1R0B G;  1M1K R;  4JZ3 A;  4F7U A;  3EG2 A;  3CCE A;  4Z89 A;  1M1F A;  2GGR A;  2OX7 A;  3H0H A;  2KDS A;  1SF9 A;  2DIG A;  3CBO A;  1KIK A;  2VV5 A;  1YJ9 A;  1JRI A;  4CC7 A;  4OMO A;  3OSS C;  4C8Q F;  4WTO B;  4PLI A;  1SRL A;  3NTI A;  5KYU B;  3JB9 I;  2DNU A;  3CCU Q;  1M3A A;  1I4K 1;  4C92 D;  2LX7 A;  4EMK A;  5GAM h;  4N0A C;  4ZGD B;  2K5I A;  5I11 A;  5I21 A;  1IHW A;  2XK0 A;  3IQL A;  5CO7 A;  3UPU A;  1IGU A;  2K3X A;  4JPB W;  2A7Y A;  2DBK A;  2CS7 A;  2K79 A;  3MP6 A;  2DVJ A;  2XDD A;  2YRV A;  4E7I A;  1D3B B;  1WHL A;  2EKO A;  4UC4 A;  1X2K A;  2W10 A;  4M75 C;  1N27 A;  1I07 A;  4JUV A;  3RKW A;  4F04 B;  1BIB A;  3JB9 H;  1AT1 B;  4QW2 A;  3OYJ A;  1R8O B;  2OAW A;  2M0Y A;  5GMK i;  2FO0 A;  1VQM T;  1ZA2 B;  2VWF A;  2DRK A;  5HK3 A;  2JOY A;  4BY6 C;  2DFU A;  2O4X B;  4M7D F;  2EPD A;  2R5M A;  3GBQ A;  3CD6 A;  1WJQ A;  3C94 A;  2EBP A;  3REB B;  2OI3 A;  3VKI A;  2P0K A;  3AT1 B;  4XTX A;  1TG0 A;  3QZ9 B;  3I55 T;  1QQJ A;  1R0C B;  3JSC A;  1BI3 A;  1T3S A;  3C12 A;  2QAZ A;  1OYX A;  5ECA A;  3OYC A;  1Y96 A;  4OVA A;  4J8O A;  4M4Z A;  4JJD A;  3LWI A;  3CC4 A;  3CC2 T;  2JM8 A;  3HRT A;  3QII A;  2FPE A;  3EG3 A;  3CBP A;  3JCM W;  2HKN A;  1WX6 A;  4C0F A;  2KXD A;  1FMK A;  1QLY A;  4C92 A;  3CPW P;  4JS4 A;  4LDV A;  4M7A G;  1VQM Q;  2LJ0 A;  1ARK A;  2Y4Y A;  1OI1 A;  2L0A A;  2A0F B;  1K0X A;  5EC7 A;  4ZTF A;  2R57 A;  2V1Q A;  2MCN A;  1VQ8 T;  1X2Q A;  2K2V A;  5KYX A;  3A8H B;  2M9U A;  4IUQ A;  3QYH B;  3VS2 A;  1WDX A;  1EIF A;  3QYG B;  4E47 A;  3QHS A;  4M77 D;  2F2X A;  3EGU A;  2RK1 A;  2HAX A;  2SEM A;  2KYB A;  1U3O A;  2KI7 A;  2QQS A;  5A0L A;  1VOM A;  3TVT A;  1Q86 U;  1RLP C;  1M3B A;  2JMA A;  1UUE A;  1GCP A;  1ACM B;  1Q7Y C;  3L42 A;  1UG1 A;  3L2Q A;  5GMK e;  4HT9 A;  2J06 A;  1FMV A;  3HFO A;  3MEU A;  1U06 A;  1VQ8 Q;  1OOT A;  2KMT A;  2K5L A;  5GAO n;  4PJO B;  2L2P A;  2RJC A;  1KQS P;  1QVG A;  2H8H A;  1G3T A;  3CQT A;  1PKT A;  1TSF A;  3X20 B;  2LDM A;  3OYG A;  2DZC A;  3PGG A;  3TEE A;  3THK A;  2PVO B;  2EYY A;  2VB6 A;  1ZLM A;  3G4S T;  3QZ5 B;  3HFN A;  3OYM A;  1VIE A;  2E10 A;  3FB9 A;  3UWN A;  1KC8 C;  4AFQ C;  3I5S A;  1ZSG A;  5HKC A;  3RR6 A;  1YJN Q;  2MWO A;  2QGF B;  3EHQ A;  1V1C A;  4MZT A;  2QQ9 A;  4J5Y A;  3L2W A;  2X4X A;  1PCX A;  3GP8 A;  1YCY A;  3KBG A;  2RN8 A;  4KH0 B;  1S72 T;  6AT1 B;  1LPL A;  2L5Q A;  1G3Y A;  2AZS A;  3FLG A;  3J80 E;  2DL3 A;  1OU9 A;  1YHQ T;  3QWY A;  2DTI A;  2VXF A;  1R77 A;  3A8G B;  2EW3 A;  1JJ2 P;  4C5I A;  1W1F A;  2E3H A;  3G4S Q;  1WXT A;  2RHY A;  4M78 E;  2E6Z A;  1M2V B;  1ABQ A;  5L8R E;  3QDR B;  4A4F A;  2J6O A;  1KG1 A;  3VS4 A;  3VS0 A;  2KRS A;  4J7F A;  1NPP A;  2I2L A;  3F70 A;  4MZP A;  2WSC E;  2LQN A;  2Y4X A;  1IO6 A;  2A3L A;  1KD1 U;  1OU8 A;  2RQU A;  3JCM f;  1BIA A;  1X69 A;  2ZPH B;  3EG1 A;  3VRZ A;  2K3Y A;  4HT8 A;  1Y57 A;  5LJ5 f;  2DMO A;  1PHT A;  2EAY A;  3M59 A;  1S72 Q;  4M7A A;  1GBQ A;  3HPW A;  4IUV A;  3CCL A;  1AD5 A;  4MDX A;  3OB9 A;  1D0Y A;  3SWN A;  1D1C A;  4N0A A;  3EFS A;  4R56 A;  3M53 A;  3JCM P;  4V2S A;  3I56 T;  1W2B S;  2AT1 B;  4XU1 A;  1DJ7 B;  5GMK m;  5GAN h;  1QCF A;  3CPW A;  1W2B P;  4J6W A;  4F7U E;  1VQ9 A;  3JRZ A;  1UDL A;  1M90 U;  4RG2 A;  4M75 A;  1GFD A;  4PJN A;  3RMQ A;  2MOX A;  2EKH A;  2CP7 A;  1BCM A;  2LT1 A;  1EZZ B;  5IH2 A;  2KYM A;  1QKX A;  4FT4 A;  2EYX A;  1K9A A;  4BE1 A;  2M16 A;  1K9M U;  1KK7 A;  2QXF A;  2E12 A;  3MEW A;  1MMN A;  1WZO A;  2JS0 A;  5GAM g;  3RER A;  1YNZ A;  1I1J A;  1OPK A;  2M0O A;  1AVZ C;  4PLL A;  2DXB A;  2A36 A;  1WXU A;  4GLK A;  5KYY A;  1VQ6 Q;  5FW9 A;  2KRN A;  5FRO A;  2F5K A;  2DYB A;  2PNI A;  2RI2 A;  1M8V A;  4XTY A;  1UGQ B;  1QP3 A;  1SPK A;  4M78 G;  2E4H A;  2X9H A;  1H3Z A;  2GCX A;  1WJR A;  1XOV A;  4PL6 A;  1CSK A;  3MET A;  2GFA A;  4FSS A;  1I0C A;  1IGQ A;  1MND A;  4LE9 A;  4GLM A;  3JCM V;  3ZEH A;  2EWN A;  4HKE A;  1QVP A;  1PD0 A;  1PSF A;  4C0Z A;  3PNW C;  1KQS A;  1FMW A;  2CP6 A;  1XTD A;  1VQM A;  1SSH A;  3CCQ Q;  2XIC A;  4LUE A;  1NBE B;  2COW A;  1VQL T;  4FYX B;  4E7L A;  2HQX A;  2LP5 A;  3WXM B;  4FCY A;  3I55 A;  1KC8 R;  2VUB A;  2D0Q B;  3EFO A;  3QXE B;  4PKC C;  4C8Q C;  2V8K A;  2W0Z A;  1ZSZ A;  1VQO T;  4EPC A;  4F7U G;  1K8A C;  1QP2 A;  2M1H A;  4HCC A;  2QTX A;  5LJ3 h;  1G3W A;  3CC2 A;  1XQH A;  4F16 A;  2PTK A;  3TCJ A;  1UB4 A;  3MJX A;  4XU0 A;  2KAF A;  1B34 B;  4N4H A;  2GF7 A;  3M4Y A;  3EG9 B;  4J9G A;  3HP9 A;  4OP0 A;  3E9G A;  4NS5 A;  2ED0 A;  5C0M A;  3CCV T;  1D09 B;  1YFN A;  2LNV A;  3OMC A;  2CZ0 B;  2Z0W A;  4XTU A;  1Q82 C;  4IUR A;  3UT1 A;  4K11 A;  1JJ2 A;  1UJY A;  2GTJ A;  2RD1 A;  5GAN 7;  3SDZ A;  1UGV A;  3M55 A;  3H0F A;  3TSZ A;  3R6N A;  2RI3 A;  3CXC A;  8AT1 B;  4PJO E;  2C06 A;  2COZ A;  3X24 B;  5DY9 A;  3UAT A;  1VQO Q;  4DBF A;  4XTW A;  4M7D C;  2JJ9 A;  1OUL A;  2RJE A;  2CUD A;  3PT9 A;  1NG2 A;  3VS6 A;  2X51 A;  1H64 1;  2ROL A;  5EG2 A;  2EQM A;  5GJW B;  3V8K A;  3SB2 A;  4LDY A;  4OMP A;  4LDW A;  3FIF A;  2V8J A;  1JO8 A;  1NEB A;  2FVU A;  1HD3 A;  1UGS B;  2DER A;  4RTZ A;  3WVD B;  2MAM A;  3OSV A;  4L5G A;  4O5V A;  3CCV Q;  2LT4 A;  1AOJ A;  1M1K U;  2AKK A;  4LD9 K;  2D0N A;  2F1L A;  1RLQ C;  4MML A;  3MCA B;  1NJI C;  1ZBX A;  4FW2 A;  3V7C A;  2WSE E;  5IXF A;  2DRM A;  2BUD A;  5GAM d;  1GCQ C;  1HXD A;  4ME7 A;  2R58 A;  2CP5 A;  4BB7 A;  4FL6 A;  3OS1 A;  1OX8 A;  2QG9 B;  3G71 T;  1QKW A;  2KEA A;  5CVI A;  4RCB A;  9ATC B;  4X9C A;  1PG5 B;  5GAO q;  4C92 G;  4QQG A;  3M4G A;  3LH0 A;  5CKB A;  1UHC A;  2L3Q A;  1UTI A;  2D1X A;  3VRY A;  2FYK A;  4AG2 C;  3JB9 G;  3HRS A;  4C0G A;  2DM1 A;  2LZ6 B;  2E5Q A;  2XDB A;  4C0D B;  4MZM A;  3VUB A;  1RAH B;  4BAC A;  1I5L A;  4OB3 B;  4CC2 A;  2AKL A;  4BD3 A;  4DBQ A;  2P4T A;  1UGR B;  2K9G A;  4WF2 A;  5I2S A;  4P5N A;  2ZPF B;  3SEM A;  3CCU T;  3J7A F;  4R55 A;  3H0I A;  2QEX A;  1KQ2 A;  2LCS A;  1YHQ A;  2ENM A;  3ULR B;  3G71 Q;  3RUX A;  4M78 B;  1Q81 R;  2KQW A;  3GNG A;  3G1J A;  3DB3 A; 
#chains in the Genus database with same CATH homology
 3L1A A;  3JCM e;  3HL8 A;  2BKD N;  3A8H B;  2E41 A;  2Y90 A;  5GAN 6;  5LJ5 e;  3CCR T;  2K5F A;  4XU2 A;  3UDC A;  4PNO A;  3CC7 A;  1IZ6 A;  2CYZ B;  2M9U A;  4IUQ A;  3QYH B;  4Y91 A;  4ZGJ B;  1VQ8 A;  1YJ9 T;  3AHU A;  3JCM X;  1EIF A;  3QYG B;  4E47 A;  1KHI A;  2E70 A;  3QHS A;  4M77 D;  2RHZ A;  4OMF B;  5IN1 A;  5GAO p;  3E19 A;  2EQK A;  4O6J A;  4C8Q D;  1KQ1 A;  5CIU A;  3OYY A;  2RK1 A;  4HCB A;  3GF5 A;  4BI4 A;  3E1S A;  2HAX A;  2QI2 A;  3CCR A;  1KC8 U;  1FXX A;  1BKB A;  3V7S A;  5LJ3 e;  2L8D A;  4M7A E;  1N9S A;  2QQS A;  3M5A A;  5A0L A;  2OTL T;  5GAN 3;  2YLB A;  1Q86 U;  2RJD A;  3OS5 A;  1BYM A;  2YLC A;  2R5A A;  4RCC A;  1N8R C;  3L2V A;  3NTH A;  4E7H A;  1Q7Y C;  2CGH A;  3L42 A;  3L2Q A;  3BW1 A;  3DKM A;  2E64 A;  5GAN g;  2DO3 A;  3VJP A;  2FB7 A;  5I2M A;  5GMK e;  5GAN 4;  4HT9 A;  1I81 A;  3RMS A;  3LX7 A;  4NL2 A;  2JZ2 A;  3HFO A;  3MEU A;  4LDX A;  1Q81 U;  4M78 F;  3URG A;  3O8V A;  4F7U B;  3I56 A;  2KMT A;  2MMP A;  3JCM b;  3QSU A;  5GAN e;  4M75 E;  3BY7 A;  1YJN A;  2K5L A;  5GAO n;  2B8A A;  2PVG B;  4PJO C;  4PJO B;  2RJC A;  5GAN 5;  1QVG A;  1ZHI A;  1G3T A;  3ZFJ A;  5GAN f;  3C4S A;  3FDR A;  4A4H A;  1QVF S;  4QVZ A;  4CRI A;  3ER0 A;  3ME9 A;  1X75 C;  4M77 G;  2XI9 A;  3X20 B;  3DLL A;  2PUO B;  5IAY A;  3CD6 T;  2LDM A;  3VUZ A;  4C8Q G;  1W2B A;  4M7D D;  2NLU A;  2DZC A;  3PGG A;  3TEE A;  3OYG A;  2CZ1 B;  2PVO B;  3QPH A;  4Y28 E;  4Z02 A;  3G4S T;  2RI5 A;  3QZ5 B;  4JLG A;  4MMK A;  1VQ7 A;  4FSX A;  3HFN A;  2WSF E;  5M9O A;  3PTA A;  3OYM A;  1VIE A;  3CCJ T;  3MEV A;  2DVE A;  2E10 A;  3X25 B;  3NFC A;  3M54 A;  3FB9 A;  2MI6 A;  4JRQ A;  5CKH A;  4EMK C;  3OW2 S;  3UWN A;  4EMK B;  1G3S A;  1KC8 C;  2HQE A;  2QA4 T;  2ZPE B;  2LCL A;  3CEY A;  4OGE A;  1Q86 C;  5HKC A;  3G4S A;  2XID A;  3SFM A;  2OTJ A;  1VIF A;  3INZ A;  1Y07 A;  3PMI A;  3P8B B;  4Q5W A;  2LVM A;  2MWO A;  5CKF A;  3CCJ A;  1AHJ B;  4BI3 A;  3RIR A;  3LYI A;  5A2Q E;  2EJ9 A;  3CPF A;  3CC4 T;  1VQK A;  1BI2 A;  3QJ6 A;  1YI2 T;  2G3R A;  4MZT A;  2QQ9 A;  3HKS A;  4J5Y A;  3L2W A;  2QA4 A;  2QQR A;  2RB6 A;  2X4X A;  2XHC A;  4C8Q A;  1WGS A;  4F7U F;  4RG8 A;  5CK9 A;  3GP8 A;  3OYH A;  1YCY A;  2DTH A;  4M77 E;  4X9D A;  3KBG A;  3OS2 A;  2PQW A;  1S72 T;  3GIB A;  1Q81 C;  2F69 A;  3NTK A;  3V7R A;  5GAO m;  2L5Q A;  1YJW T;  3JCM J;  5HK0 A;  4PJO F;  3OYD A;  2XU8 A;  4JRK A;  5FU6 C;  5FU6 B;  2LTO A;  1G3Y A;  3J80 E;  3A8L B;  3FLG A;  1VQ4 T;  1Y7X A;  4IUU A;  3KXT A;  1YHQ T;  2EYQ A;  2DTI A;  1KHC A;  2H3J A;  3LW5 E;  2VXF A;  2RA2 A;  3A8O B;  4BUG A;  4OB0 B;  1S72 A;  3A8G B;  1B34 A;  2VGN A;  4LD6 A;  4XTZ A;  2DXT A;  4C5I A;  1VQN A;  4M7D G;  2P0Q A;  2VC8 A;  1PSE A;  4J6Y A;  3G6E T;  2RHY A;  4M78 E;  2HBP A;  3JCM h;  4EMH A;  2E6Z A;  5L8R E;  3LLR A;  3OYA A;  3TRE A;  3QDR B;  4JDS A;  1U8R A;  4FT2 A;  2E1H A;  2VXE A;  3X28 B;  4A4F A;  5LJ5 g;  5LJ5 h;  1KG1 A;  3PIP A;  3CC7 T;  2XKO C;  1UEB A;  4QQ6 A;  4A4K A;  3A8M B;  5C6S A;  4J7F A;  4XQ3 A;  3FC3 A;  1NPP A;  2PVD B;  2I2L A;  3F70 A;  3G6E A;  5DLQ E;  3S3M A;  1VQL A;  4MZP A;  2WSC E;  2OAU A;  2Y4X A;  4BE0 A;  4N4I A;  1Y96 B;  2A3L A;  5D6W A;  2JVV A;  1KD1 U;  4BDY A;  5LJ3 g;  2EQJ A;  3JCM f;  1BIA A;  2ZPH B;  2PUK B;  2K3Y A;  4HT8 A;  5A0G A;  1LOJ A;  2JUF A;  3QBY A;  2X4J A;  4M75 G;  5LJ5 f;  4M7D A;  2EAY A;  3M59 A;  3S6W A;  3R6O A;  3JCM d;  2KK4 A;  1O75 A;  3EFR A;  2X4Y A;  4IKF A;  4M7A A;  5KH6 A;  3HPW A;  2RJF A;  4IUV A;  3CCL A;  4M7D E;  2KY9 A;  4II1 A;  2JNG A;  4MDX A;  3OMG A;  4C92 C;  4C92 B;  1QVG S;  3OB9 A;  4X34 A;  1N6A A;  5DM7 R;  2O01 E;  3BDU A;  3SWN A;  1VQ9 T;  5GAN j;  3CBM A;  5GMK h;  4JS5 A;  1MHN A;  4FIB A;  4N0A A;  3EFS A;  4BI8 B;  4R56 A;  1M9S A;  3M53 A;  3X26 B;  1K73 U;  3OS0 A;  3E9F A;  5LJ3 f;  4D6W A;  4A54 A;  3JCM P;  4V2S A;  4XU3 A;  2XDP A;  3I56 T;  2HNI A;  3FRN A;  5FU7 C;  1W2B S;  4XU1 A;  2HD0 A;  4M78 D;  3ZBD A;  1DJ7 B;  5GMK m;  4JJN K;  5GAN h;  3VU3 C;  1Y71 A;  3JB9 J;  3CPW A;  1YJN T;  1VQ6 A;  4J6W A;  4F7U E;  4DOW A;  1VQP A;  1VQ9 A;  3OYI A;  1D3B A;  3JCM c;  5CAI A;  3L2U A;  1U1S A;  3FJP A;  2JTF A;  1M1G A;  3JRZ A;  1M90 U;  4RG2 A;  1M5Q 1;  4M75 A;  1YIJ T;  3C95 A;  2MWP A;  2DAQ A;  1VUB A;  2RK2 A;  4J7I A;  2F5T X;  3RMQ A;  5FLX E;  1YBY A;  3DLM A;  2LT1 A;  1LNX A;  4BDZ A;  1M4Z A;  2RO0 A;  4FT4 A;  5KCH A;  1WNL A;  5CCA A;  4BE1 A;  2CZ6 B;  1WQ7 A;  2M16 A;  1K9M U;  4M7A C;  2QXF A;  1VQ7 T;  1YIJ A;  3HRU A;  2E12 A;  3MEW A;  4J6X A;  4YTL A;  3SWN C;  2DTO A;  2V8I A;  2O4X A;  4NOY A;  2DXU A;  4A53 A;  5GAM g;  2VYT A;  3P8D A;  4OB1 B;  5GAN d;  3GOX A;  1KD1 C;  3RER A;  4JRI A;  2LQ8 A;  3PIO A;  2M0O A;  3PMT A;  4PLL A;  3JB9 D;  1BI0 A;  1NE8 A;  2DXB A;  4GLK A;  4OF1 A;  4C92 F;  2OTJ T;  1X01 A;  2DEQ A;  3OYE A;  5FRO A;  2IVW A;  1JB0 E;  2ZPB B;  3KUF A;  2F5K A;  3CCQ A;  2EIF A;  5GAM e;  2CKK A;  2RI2 A;  1M8V A;  1K8A U;  4TVR A;  1FX7 A;  1U1T A;  1UGQ B;  2K4Y A;  4XTY A;  5AYF A;  4JRP A;  2QQA A;  2VGM A;  4KUD K;  3JB9 F;  3DB4 A;  1QP3 A;  5CQY A;  3Q1J A;  2DJZ A;  4M78 G;  1K73 C;  3OY9 A;  1H3Z A;  5GMK l;  2GCX A;  1WJR A;  3OBY A;  1XOV A;  3CME A;  2QQB A;  3QG1 A;  4PL6 A;  3LGF A;  1UGP B;  4N4G A;  3OBW A;  2XG8 D;  2IG0 A;  4RMO A;  3MET A;  1WQW A;  4M77 A;  4PJO D;  5KE3 A;  2GFA A;  4FU6 A;  3BDL A;  2YHT A;  1M90 C;  3OYF A;  4J83 A;  3JCM V;  1IRE B;  1I8F A;  3ZEH A;  2EWN A;  2ZPI B;  4HKE A;  3P8H A;  1QVP A;  1VQN T;  3MP8 A;  3CMA A;  4M7A F;  2WAC A;  1PSF A;  4C0Z A;  4C5G A;  3PNW C;  4QVC A;  1VQ4 A;  1KQS A;  1Q82 U;  2DKG A;  1XTD A;  4OB2 B;  4EMG A;  2DXC A;  4ZTJ A;  5J26 A;  1VQM A;  3CCS T;  1K9M C;  2XIC A;  3OYB A;  3TU4 K;  3RES A;  4M78 A;  5LJ5 j;  2XD0 A;  3SD4 A;  4JLI A;  3QUI A;  4RKU E;  1VQL T;  3M56 A;  2E6N A;  3JAM E;  4E7L A;  4EDU A;  2HQX A;  1YIT A;  5GAN 8;  5CKD A;  5FRN A;  3S3O A;  3CCS A;  3L2R A;  3WXM B;  3DB3 A;  3I55 A;  2VUB A;  5KE2 A;  2D0Q B;  4M77 C;  3M58 A;  4ZN3 A;  1RI0 A;  2X4W A;  3QKJ A;  3MP1 A;  3QXE B;  4PKC C;  2LC4 A;  5LJ3 j;  2DZ9 A;  4C8Q C;  2V8K A;  4C8Q B;  2ZPG B;  1VQO T;  4EPC A;  3GNF B;  2CZ7 B;  5DLO A;  3GLX A;  1LJO A;  2RHI A;  4F7U G;  3CPW S;  1K8A C;  1P92 A;  1OZ2 A;  5D6Y A;  4GY5 A;  1QP2 A;  2M1H A;  4HCC A;  4ZN1 A;  5CQX A;  2DPP B;  3CCL T;  2QTX A;  1TH7 A;  3G7Z A;  5LJ3 h;  3HSB A;  1G3W A;  2X35 A;  3CXC S;  3CC2 A;  3V8J A;  4PJO G;  4DOV A;  1XQH A;  1RL2 A;  2JTM A;  4CI0 C;  5LL6 S;  5GMK j;  3TCJ A;  1VQO A;  1UB4 A;  2E65 A;  4LDU A;  2RH2 A;  4QVD A;  3EAE A;  4BE2 A;  3WVE B;  2L3R A;  2EFI A;  4XU0 A;  3N5B B;  2KAF A;  3H8Z A;  1B34 B;  4N4H A;  5GAO l;  2GF7 A;  3M4Y A;  5LJ5 d;  3CCM A;  1NPR A;  3HP9 A;  4OP0 A;  1VQ5 A;  3E9G A;  1VQ6 T;  3VV0 A;  4NS5 A;  1VQP T;  3CCU A;  5C0M A;  3CCV T;  4A4G A;  4HA8 A;  1XNI A;  1NJI U;  2LNV A;  3OMC A;  2CZ0 B;  4XTU A;  1Q82 C;  4F7U A;  1WJS A;  4IUR A;  4L59 A;  3UT1 A;  5FU7 B;  3VYG A;  3CCE A;  1QW1 A;  1JJ2 A;  1M1F A;  4A4E A;  2ZCF B;  2LQK A;  2RD1 A;  5GAN 7;  2KDS A;  1ZQ1 A;  5LJ3 d;  3SDZ A;  3S3N A;  2DD5 A;  3M55 A;  4PJO A;  2DIG A;  2K57 A;  4KUL A;  3CCV A;  4XAX B;  4ELY C;  3LGL A;  2RI3 A;  3CBO A;  2VV5 A;  3CXC A;  1NZ9 A;  5KCO A;  2LX9 A;  4M77 F;  4KUI A;  2C06 A;  3QO3 A;  1JRI A;  1YJ9 A;  4PJO E;  3X24 B;  3OSS C;  5DY9 A;  3HHT B;  4C8Q F;  2KVQ G;  4XTW A;  4M7D C;  3OYN A;  4M7D B;  1G5V A;  3MO8 A;  4PLI A;  5CKE A;  2RJE A;  5GAM j;  3NTI A;  3LWH A;  3M9Q A;  3PT9 A;  4M7A B;  3J7A F;  4XK8 E;  3VYH B;  4B9X A;  2AHJ B;  3JB9 I;  1JBM A;  1H64 1;  5EG2 A;  2EJF A;  3OYK A;  1I4K 1;  2EQM A;  4C92 D;  3SWN B;  3V8K A;  2OTL A;  3CCQ T;  4EMK A;  3QJY A;  4L6V 5;  3SB2 A;  5GAM h;  4N0A C;  4LDY A;  4ZGD B;  3OQ5 A;  2K5I A;  4LDW A;  5I21 A;  3FIF A;  2XK0 A;  2V8J A;  5CO7 A;  2DD4 A;  5D6X A;  3UPU A;  2K3X A;  5FRM A;  2FVU A;  1UGS B;  2A7Y A;  3M57 A;  2CS7 A;  2FL7 A;  3MP6 A;  1KQS S;  3RKY A;  3CME T;  2XDD A;  2YRV A;  3WVD B;  2MAM A;  1N9R A;  3OSV A;  4L5G A;  4O5V A;  4DA4 A;  4E7I A;  2QDY B;  1D3B B;  2PU9 B;  1BI1 A;  2EKO A;  4M7D F;  2LT4 A;  4IUT A;  4UC4 A;  4M75 C;  1N27 A;  1SSF A;  4M75 B;  3BFM A;  1M1K U;  4JUV A;  4LD9 K;  1W4S A;  3RKW A;  2RM4 A;  4MML A;  5GAO r;  3MCA B;  5GAM f;  1NJI C;  1ZBX A;  2EJG A;  4XTV A;  2BIV A;  3V7C A;  2WSE E;  1BIB A;  3JB9 H;  3CMA T;  2BUD A;  4ZGE B;  4QW2 A;  3OYJ A;  5GAM d;  2RHU A;  1VQK T;  4M7A D;  1GXI E;  4QQD A;  1HXD A;  1R8O B;  5GMK i;  4ME7 A;  1VQM T;  4OGC A;  2R58 A;  5J39 A;  4BB7 A;  4E7J A;  1MGQ A;  3A5Z B;  4FL6 A;  3T9N A;  3PFS A;  2JOY A;  5HK3 A;  2LCC A;  2MF2 A;  2O4X B;  4BY6 C;  4BY6 B;  3J81 E;  3OS1 A;  3GPL A;  2R5M A;  3L2Z A;  3G71 T;  4MDW A;  5CVI A;  3CD6 A;  4RCB A;  4C5E A;  1WJQ A;  3MHX A;  4X9C A;  3C94 A;  2FHD A;  3VKI A;  2EQU A;  3V8L A;  2DIQ A;  4KBM B;  2P0K A;  1YIT T;  5GAO q;  1O9S A;  4XTX A;  4C92 G;  3QZ9 B;  4QQG A;  2D9T A;  3I55 T;  3M4G A;  3LH0 A;  5CKB A;  4FM4 B;  4KT0 E;  3G71 A;  3JSC A;  3JCM Q;  2L89 A;  1QVF A;  1BI3 A;  3C12 A;  5HY6 A;  2FYK A;  4M75 D;  3JB9 G;  5IT9 E;  3HRS A;  4C0G A;  1OYX A;  4IUP A;  2DK3 A;  3OYC A;  1Y96 A;  4OVA A;  3OYL A;  2GQV A;  1OZ3 A;  4C8Q E;  2E5Q A;  4J8O A;  4C0D B;  4C0D C;  4MZM A;  2XDB A;  3VUB A;  4NL3 A;  3LWI A;  3CC4 A;  3CC2 T;  4VUB A;  4B9W A;  4C5H A;  1N8R U;  4M77 B;  4M75 F;  4BAC A;  5J3B A;  3HRT A;  1YI2 A;  1I5L A;  3QII A;  4OB3 B;  2QEX T;  1Q7Y U;  2P0P A;  3CBP A;  1JJ2 S;  2GFU A;  3OW2 A;  3JCM W;  4BD3 A;  1V29 B;  2D6F A;  2P4T A;  1M1K C;  4C0F A;  1UGR B;  1YJW A;  4WF2 A;  3CCM T;  1FWZ A;  4ELZ C;  1WPY A;  4P5N A;  4HCZ A;  4C92 A;  2ZGW A;  5I2S A;  3OA6 A;  4JS4 A;  1VQ5 T;  4LDV A;  2ZPF B;  3JCM g;  4M7A G;  1HK9 A;  3CCU T;  2LRQ A;  5GAN 2;  2Y4Y A;  5CR2 A;  3MEA A;  3RKX A;  4R55 A;  1OI1 A;  2QEX A;  3H6Z A;  4C92 E;  3ASK A;  5A0D A;  1KQ2 A;  1YHQ A;  4ZTF A;  2R57 A;  1X6O A;  2RHX A;  4ATO A;  2JN0 A;  4M78 C;  3FEO A;  4M78 B;  3RUX A;  4E7K A;  1VQ8 T;  2KQW A;  2ZZD A;  3CCE T;  4DQ2 A;  2KSS A;  3GNG A;  2K2V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...