3JCMQ

Cryo-em structure of the spliceosomal u4/u6.u5 tri-snrnp
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
90
structure length
89
Chain Sequence
b'ELEEFEFKHGPMSLINDAMVTRTPVIISLRNNHKIIARVKAFDRHCNMVLENVKELWTEKKKNVINRERFISKLFLRGDSVIVVLKTPV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pre-mRNA-splicing factor 8
publication title The 3.8 angstrom structure of the U4/U6.U5 tri-snRNP: Insights into spliceosome assembly and catalysis
pubmed doi rcsb
molecule tags Transcription
total genus 11
structure length 89
sequence length 90
chains with identical sequence U
ec nomenclature
pdb deposition date 2015-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3jcmQ00
1YCYA 5GAMd 3JCMf 2RB6A 1LNXA 2DXTA 4DQ2A 3RESA 3HSBA 3BDUA 3EFSA 5GMKh 5GAMf 4M7DD 5GAOl 1I5LA 4JRKA 3BFMA 3RKXA 1TH7A 4XTWA 4A54A 2EJ9A 2HNIA 3JB9I 3SWNB 4M77D 3JB9F 2FB7A 2RA2A 2DTOA 4M75D 1Y96B 2E65A 4C92C 4M77C 4NL2A 4M75C 3RKWA 4F7UG 2EAYA 4XTXA 4J6WA 4C8QC 5GANd 3JCMV 5GAOr 2EJFA 5GAOm 5GAMj 3RERA 1LJOA 4M78A 4RCBA 4EMKB 1WPYA 5GANf 4M7AF 4N0AC 3V8JA 5GMKi 4PJOE 3JCMb 4M7DA 4C92G 4M77G 5LJ5g 4M75G 4M77A 4M75A 4C8QG 5GANj 3QHSA 4XTUA 5GAN3 2YHTA 2RM4A 3QUIA 3V7RA 2FYKA 3JCMX 3JCMc 3SWNC 2EWNA 1B34A 5LJ5h 5CAIA 1JBMA 1D3BB 2K57A 4M78E 5GMKl 2E10A 4HA8A 4HT9A 4M7AB 4EMKC 4C92D 2Y90A 1WNLA 3RKYA 4M7DE 3V7SA 4C8QD 5GMKe 5GAN7 5GMKm 3V7CA 5LJ3g 4F7UA 5GAOq 4WF2A 1KQ1A 4J5YA 3SWNA 1Y96A 3JCMg 2E1HA 4QVCA 2EJGA 4XU1A 3M4GA 3SB2A 3JCMW 4M7DF 4JLIA 4OP0A 4XQ3A 5LJ3f 1WQ7A 3INZA 4C92A 1I8FA 1N9RA 1U1TA 3V8LA 5LJ3h 2DVEA 4C8QA 4J6XA 3JB9H 2DZ9A 2VXFA 4PJOF 2I2LA 3JCMh 4M7AD 1BIAA 1N9SA 4N0AA 5GANg 3QSUA 4M7AC 5GAMh 5GAN2 1M5Q1 2ZGWA 5GAN4 4F7UE 3JB9G 2JN0A 2E64A 1HK9A 2DZCA 1I81A 4RCCA 2RD1A 5GAOn 4V2SA 4M7AE 4XU0A 2YLCA 3PGGA 4X9CA 4XU3A 1JRIA 5I21A 4M7DB 4MMKA 5LJ5e 1D3BA 4PJOC 5GMKj 5GANh 4NL3A 4XU2A 4M78F 4M7AG 4C92E 4M7AA 4M77E 1U1SA 4M75E 4Y91A 1M8VA 4MMLA 4C8QE 2DTHA 2VXEA 4PJOB 3FJPA 5LJ3d 3JB9J 5GAMg 2DTIA 3JB9D 3QO3A 2E41A 4M77F 4M75F 4EMKA 4PJOG 3JCMd 2DXUA 1BIBA 3JCMQ 2YLBA 1MGQA 4QVDA 3RUXA 4M78C 3VU3C 5LJ5d 4HT8A 4JRIA 3GIBA 5GAOp 3BW1A 5LJ3e 4F7UB 5LJ3j 4EMGA 5LJ5f 2CGHA 4M7DC 2VC8A 4M78B 4XTZA 2DKGA 1I4K1 3L1AA 3JCMe 3L2ZA 3EFRA 3FIFA 3HFOA 3HFNA 3V8KA 4M78G 2DJZA 5GAMe 3FB9A 4PJOD 1HXDA 3RIRA 4PNOA 4NOYA 4C92B 4F7UF 1H641 1WQWA 4M75B 2QTXA 4M77B 5LJ5j 5GAN8 3JCMJ 1LOJA 4C8QB 1KQ2A 1X01A 2DEQA 4M7DG 4J6YA 5GAN6 4X9DA 5GANe 4EMHA 4C92F 4XTVA 3AHUA 1B34B 3BY7A 4JUVA 4A53A 3JCMP 5DY9A 4C8QF 4PJOA 5GAN5 4XTYA 4M78D
chains in the Genus database with same CATH superfamily
2CZ6B 3CBOA 1YFNA 3EFSA 2HQHA 5I2MA 1YNZA 4M75C 1M3BA 3OYYA 2CDTA 2A28A 1TWBA 2QDYB 1Y57A 2KY9A 5FW9A 5FLXE 3V8JA 1YJWT 1W4SA 3CCMT 1I1JA 1OX8A 1GXIE 3G7ZA 1LVKA 2MI6A 3QHSA 3EG9A 1MV0B 1AWXA 1WHMA 3MEAA 1K9MU 1SKUB 3WVEB 4IUQA 2DYBA 1B34A 3I9QA 5LJ5h 1PWTA 2FZGB 2L5QA 1BU1A 4DOVA 1X75C 1VQMQ 1V76A 1TUCA 4DBFA 1YHQT 3CCQA 1W70A 3I56T 1Q86U 4KBMB 3DLMA 4AFUC 3RR6A 3OQ5A 3R6OA 1TXQA 5KYUB 3FC3A 1YIJT 1FX7A 3M5AA 5FRMA 3CMEQ 1BI1A 2JN0A 2DM1A 1HD3A 2KXCA 3OA6A 1ZUKA 3UWNA 2LJ3A 1NBEB 5IXBA 1EZZB 1M90R 1VYUA 3CXCP 3JB9D 2E6NA 2F5TX 1WGSA 3CXCA 2P84A 1RLQC 1VQPQ 2L8DA 4HT8A 1A0NB 1BK2A 4XTZA 2WSFE 2DE0X 2H3JA 2MAMA 2RQTA 3PIOA 2DETA 4PNOA 1YITT 1KQ2A 2V26A 4JZ4A 2JXBA 4X9DA 1M2VA 2CP3A 2DL4A 4C92F 2RHXA 1KC8R 5LJ3f 1VQ8T 1YCYA 1SRMA 3A8OB 1SSHA 1RI9A 3WXMB 3BFMA 3CCRQ 1Q82C 8AT1B 2FB7A 1WZOA 4BUGA 1Y96B 2K79A 2J6OA 5CCAA 2DLPA 2QXFA 2RI3A 3S3NA 1AWJA 1XOVA 2BKDN 4PJNA 1WJRA 3FRNA 1VQOQ 3JCMb 2EVRA 1RI0A 1M8MA 2YUQA 2HEQA 1NM7A 4J7IA 1VQ4A 1M1KR 2A36A 4KGZB 3M57A 1AHJB 1H8KA 3JRZA 4ELZC 4E7IA 4LN2A 2KE9A 1Y0MA 4WCIA 1I5OB 2HCKA 2EYYA 2W10A 3IQLA 3TSZA 2VV5A 5A2QE 3C94A 1M90U 5CKHA 4C8QA 3MP8A 1VQNA 2J6KA 1RABB 2XKOC 3LW5E 4OMNA 4M7AC 5GAN2 2MYSA 1PKSA 2QQ9A 5CKFA 2JMAA 3H6ZA 5D6WA 3OYDA 4C0FA 5GMKj 4MZMA 3GNGA 3CMAA 4JDSA 1M8VA 4MMLA 3CCUT 5DM7R 3META 2RI2A 2E41A 1B3QA 4M77F 2CUDA 2DXUA 3VU3C 4JRIA 2LNVA 1JB0E 5LJ5f 2LCLA 1OX9A 3KXTA 4PFZA 2WACA 1C1AA 4LDUA 3UPUA 4OF1A 4X34A 1OULA 3CC7A 4LUEA 1YI2A 1M1KU 4PJOA 4XTYA 5GAMd 1KQSS 2QTVA 3URGA 2LRQA 5GAOl 2DO3A 2K2VA 1TH7A 1Y71A 3HRSA 1K1ZA 5GANd 2AKKA 3GLXA 2XI9A 1X6BA 2YWWA 4EIKA 3GP8A 1QW1A 4OB2B 3TEEA 3R6NA 4CI0C 1QCNA 2ED0A 2RMOA 1OQKA 4C8QG 2PVGB 4JJDA 4EDUA 1C0MA 4A4KA 1SEMA 4LDXA 2NWMA 4FM4B 1OU9A 4M78E 1ZUUA 3TQ7P 4FYYB 2JTFA 4C0ZA 2NUPB 3VYGA 3E19A 5I2SA 2LMJA 1KQ1A 6AT1B 2B86A 2QASA 2RI5A 1IRXA 3CC4T 1I8FA 4MZPA 4AFSC 3EGXB 3JB9H 1KFZA 3G6EA 2OTJT 2PQWA 3HPWA 4J83A 3CCJT 2DZCA 1QCFA 2YXYA 1G83A 4XU3A 2O88A 3J80E 2ZPHB 2FPDA 2QEXQ 3G71Q 1JXMA 5GAMg 1J3TA 4J9HA 4PJOG 2JNGA 1KD1C 2YLBA 3OS1A 5CKBA 3SD4A 1ACMB 4B9WA 1ZUYA 1WA7A 1VQ9Q 1ZLMA 2K2MA 4GLKA 2F69A 3L2ZA 1WXUA 3VS4A 2DJZA 3PVQA 1K8AU 5LJ5j 5KE2A 2CZ1B 1EIFA 4R0KA 1VQKA 4RTWA 4R56A 3M54A 3REAB 4FYXB 1B7TA 4QT7A 1YJWQ 3DB3A 4PJLA 2JM9A 3EG1A 3BDUA 3L2RA 5AYFA 3JB9I 3SWNB 2COWA 4RG8A 1YJ9T 3VKIA 4XTXA 5IAYA 3H0IA 2GQVA 1NEBA 3OYKA 2FZKB 1Y07A 1MMAA 4BE1A 2VWFA 2DMOA 4M75A 1YHQQ 4AFZC 3VS3A 4VUBA 2FVUA 2YHTA 2EYWA 1VQ6A 1FMVA 2COZA 4IIOA 2L3QA 4PLLA 4PJJA 1WFWA 2L3PA 3UT1A 2GCXA 2KRMA 2PNIA 1WNLA 1YIJQ 4M7DE 5GMKe 2D0QB 2PVOB 4PL6A 2NYSA 1X69A 1D1BA 1K76A 3UA7A 3U23A 4C5IA 2F2WA 1UGPB 1K0XA 2E70A 1UGVA 1M9SA 3SFMA 5GJWB 1QMCA 1S72A 1BCMA 2E4HA 3M0SA 4BI3A 3H9NA 2ROTA 2DAQA 4DOWA 1RAHB 4Y92A 3I55T 2LZ6B 2E3IA 1GCQC 1U1SA 2QQSA 1W6XA 3PMIA 5GJVB 4EMKA 1YITQ 1XTDA 5KCHA 5FRNA 1R8OB 1D0YA 2VVKA 3JCMQ 2FEIA 2X35A 2LTOA 2RK2A 5LJ3e 4BE2A 2RJDA 2BZXA 1BYMA 2CYZB 1O9SA 3V8KA 2OX7A 1WX6A 3C0CA 1OOTA 1OZ3A 4C8QB 2LP5A 2Y4YA 1QKXA 3CC2A 2HQEA 1VQ7T 2WSCE 3M4YA 3G4SQ 1Q82U 4EMHA 2H3EB 4XTVA 3MKDA 1VQLA 1RLPC 3A5ZB 3CBMA 3CCLT 3CCST 3EG3A 2HNIA 4JJCA 4D8DA 1N27A 3QIIA 4NL2A 1LJOA 2QA4A 4JS5A 3M0RA 4PKCC 3OS0A 2MCNA 2OTLA 5EC7A 3A8LB 3G1JA 1OZ2A 2AIRB 3OSVA 5CKEA 2LJ0A 1JBMA 2K57A 1Q81C 2RPNA 2MK5A 3V7SA 3NTHA 2RHIA 2RF0A 4WF2A 1ZSZA 1KG1A 4WTOB 2CT3A 2K9GA 2EJGA 1YWPA 5FU7C 2X51A 2KK4A 3EFOA 1N9RA 1UFFA 3CCUQ 1T0JA 4BE0A 2MF2A 2ROLA 3QKJA 2K4YA 3JCMh 4RTXA 4BY6C 5GAMh 1HK9A 4ZN3A 3MPUB 4V2SA 1JRIA 2GFAA 2QDLA 5LJ5e 4A63B 1OU8A 5GANh 4A4HA 4C92E 4M7AA 3JAME 2RN8A 2F2VA 1VQMA 4RKUE 3RMQA 2J06A 3OYMA 3SDZA 3C12A 2A37A 1ZSGA 3MHXA 1K9MR 4ELYC 1H92A 3CBPA 1ZX6A 4OGCA 1H3ZA 4F04B 1QCOA 2DX1A 2X3XD 1T0HA 4P5NA 1WHHA 2O4XA 3CMEA 1KD1R 3P8DA 1HJDA 3OY9A 2QTXA 3JCMJ 3M0TA 4GLMA 3A8MB 2KEAA 3WVDB 1BI2A 3M0PA 3EH2A 5GAOn 3PNWC 9ATCB 2K3BA 5CIUA 2GBQA 2ZPEB 3HSBA 2XG8D 4BI4A 1VQPA 2FHDA 3OS5A 3OYCA 3OBWA 4M77C 1AT1B 3JCMV 5GAOm 4C5HA 2VYTA 1QP2A 4M78A 4RCBA 3SEMA 3RERA 1UE9A 4JS4A 2HAXA 4E7HA 2L89A 3EAEA 1QVFS 1LPLA 4LD6A 2RHZA 3QJYA 1EX4A 3CC4Q 1PC0A 2EWNA 3SHWA 2E10A 3P8HA 2V1QA 4Z02A 2OTJQ 3RKYA 1NJIC 3CCJQ 1UB4A 4PLIA 5J3BA 1D09B 3CCVQ 2KGTA 1VQOA 3ULRB 2DZ9A 2HKNA 2DD5A 3H8ZA 2D1XA 1KJWA 4N0AA 4AT1B 4FYVB 4OB0B 1TTHB 4F14A 1QVGS 3PGGA 3EHQA 1Z9QA 1SF9A 1KD1U 1PM3A 4MDXA 4JRPA 1VIEA 4M75E 3P8BB 2FO0A 5KH6A 4M4ZA 4QVDA 2NUZA 2R5AA 7AT1B 1IGUA 2GF7A 3TCJA 2ZAEA 1O75A 5GAOp 2FG0A 3VS1A 3KBGA 5CO7A 4M78G 4OGEA 2V8JA 3MCAB 5D6XA 1AWWA 2PVDB 1YJ9Q 2LVMA 4FSXA 1WDXA 4JJBA 3M9QA 1UDLA 1YJNT 4JRQA 4OMFB 1PRMC 3ZL7C 3JCMf 2HBWA 3X25B 5GAMf 2ABLA 2EJ9A 1RAEB 1TSFA 2E65A 3UDCA 3CQTA 2FRYA 2QQBA 4Z89A 4EMKB 1WPYA 5GANf 3TU4K 2JJ9A 4IKFA 1KHIA 1YBYA 3ER0A 4M7DA 5IHIA 2F2XA 3PIPA 4DEXA 2B8AA 1FWZA 1UHFA 2W0ZA 1QQJA 1K4US 2GTJA 2OI3A 3PMTA 2DF6A 3RMSA 4CC4B 4F17A 1GFDA 2LT4A 2MWPA 4HA8A 1WXBA 2RJFA 1RL2A 2DK3A 3J81E 2O01E 2DXBA 3OW2P 1Q81R 3I55Q 4KUDK 3QWXX 1WQ7A 2KRNA 5IHNA 3OW2A 2KQWA 1ZBXA 1WHLA 2VXFA 4CC7A 4E7JA 1W2BS 1WI7A 3VJPA 1M5Q1 2ZGWA 4PFPA 5I21A 1C6VX 2NUTA 4CC2A 1X6GA 2EW3A 4C5GA 2RHUA 2ED1A 3QDFA 1YCSB 1VQ7Q 1GCQA 2SRCA 3OYGA 1NLPC 1ABQA 3KUFA 1HSQA 3HP9A 2QQRA 3L1AA 3OS2A 3FIFA 3CCLQ 3CCSQ 2E12A 2XIDA 4MDWA 2CS7A 4F7UF 4M7DG 2QGFB 3OMCA 1YP5A 5CVIA 2RJEA 2ATCB 2QEXA 3G71A 4A53A 5KYXA 5GAN5 1G3SA 4LE9A 1LNXA 4DQ2A 2DRMA 5KE3A 1ZQ1A 4RTYA 3M59A 4M7AE 4J9EA 2RA2A 1VQ9A 4J6WA 3VRZA 2EJFA 5GAMj 3MEWA 1GRIA 1MMNA 1GBQA 3OYLA 4E6RA 1N8RC 2KI7A 1Q81U 1QKWA 2LNHB 4C0GA 1NPRA 5GANj 3EHRA 2ZZDA 4J9CA 5GAN3 2LQWA 3I5RA 4NS5A 4II1A 1YJWA 1BCOA 5KYYB 3LX7A 4L5GA 5CAIA 5GMKl 1TOVA 1M4ZA 2Y90A 4JPBW 4C8QD 5GAN7 2DBKA 2P0QA 4GY5A 1K8AR 2EQUA 2JS0A 3QXEB 1IO6A 3E1SA 2VASA 3M0QA 4C92A 1NJIR 2AHJB 3VS5A 3NFCA 1YHQA 2EQMA 3CCET 1QWFA 2MOXA 3A8HB 2AZVA 4F16A 1ARKA 2BE9B 4J9IA 1I81A 4RCCA 2JTEA 1RAIB 1F1BB 2C0OA 2YLCA 4X9CA 1N5ZA 2VGNA 3CPWS 2EPDA 1D3BA 1G8XA 3EGUA 1RUWA 2DFUA 4Z88A 5LJ3d 3JB9J 2HD0A 2K5LA 4HCZA 3ZEHA 1BIBA 1X43A 1UGQB 3L2VA 2KDSA 2R5MA 4J9DA 3E9FA 2VC8A 1FMWA 2XU8A 3EFRA 4Q5WA 2LX7A 4PJOD 3RIRA 3M58A 1WQWA 5GAN8 3X20B 1NYGA 3EG9B 2JUFA 1DJ7B 4J9BA 5HY6A 1AD5A 4OB1B 1UJ0A 3ASKA 3JV3A 1B34B 3JCMP 5DY9A 2J7IA 4O5VA 1TU0B 4FCYA 4CRIA 1IREB 2ZPBB 5EG2A 3FLGA 4OMLA 3VV0A 3NTIA 3RKWA 2M02A 4IIMA 2ESWA 2CREA 2HBPA 3RNJA 3X28B 4LDWA 2GTOA 2FZCB 3JSCA 4C92G 2E6ZA 4IUTA 4M77A 1Y7XA 2FRWA 1UGRB 3M0UA 3G4SA 1OV3A 1NJIU 3CCMQ 4BI8B 1G3YA 1WLPB 3JCMc 3SWNC 2V1RA 1D1AA 1Q86C 1ZBJA 1VQMT 1U3OA 3D7SB 2BTTA 1MV3A 1BI3A 1VOMA 5LJ3g 1OYXA 1VQ5T 3CD6T 3MO8A 4JLIA 5FU6B 4AG1C 4HCBA 2DERA 1K9AA 1Q82R 3I35A 2K7AA 4JLGA 1QVGP 4LDYA 3I56Q 3L2UA 1UUEA 5DLQE 1PSEA 4RMOA 1JJ2S 1D0XA 2LCSA 3ME9A 1QVGA 2I0NA 3E9GA 2PZ1A 1QVPA 4XU0A 4LNPA 3TREA 4M7DB 4RTVA 2YUPA 1M2VB 4XU2A 4OVAA 4Y91A 1G2BA 1GCPA 4Y28E 4HCKA 5LL6S 1NYFA 2EGEA 1X27A 2P0KA 3CCUA 3TVTA 1KSWA 2EIFA 1YJNQ 1ABOA 2ECZA 3JCMe 5KYUA 2HQXA 5GAMe 2SEMA 3THKA 1K73C 1LOJA 1SG5A 3OB9A 3MP6A 5HK0A 2DXCA 4ZTJA 2QQAA 4D8KA 5GANe 3LWIA 2YUOA 1TS9A 4QQDA 1PD0A 1OI1A 4FW2A 1E7OA 4KH0B 1B07A 3VUZA 4A54A 4FSSA 1VQ8Q 4M75D 2DTOA 1VQOT 2MPXC 2EAYA 3LWHA 4C8QC 3H0FA 4A4GA 5GMKi 2YRCA 1QLYA 1VIFA 4M75G 5LJ5g 2XDDA 5CK9A 2CP7A 2VB6A 5M9OA 2COYA 2K5FA 2FYKA 3JCMX 1PG5B 2HKQB 2KYBA 5AT1B 2DIQA 3CCQT 5L23A 5CQYA 1RAFB 4LXCA 4RTZA 3PFSA 1SHGA 3QG1A 1Y96A 2XD0A 4QVCA 4K11A 2DL8A 2PTKA 5KYXB 1NG2A 4A4FA 4XQ3A 2RQWA 1CKBA 3INZA 1W2BA 2L3SA 4BDYA 2E5KA 3OMGA 3S3OA 1MMGA 4J8OA 5FROA 4IURA 2ZPFB 3MP1A 2OAWA 3CC4A 1JXOA 2RD1A 2DNUA 2DPPB 1M1GA 2V8KA 2EBPA 4N4IA 1KC8C 4PJOC 3MEUA 5A0DA 3GPLA 2OTJA 4R55A 3CCJA 2O31A 4PJOB 2DL7A 1OEBA 4ATOA 4FYWB 4ME7A 2M0OA 4HKEA 3CCVA 3RUXA 4KUIA 4QVZA 4OMQA 3UF4A 2R58A 1I4K1 2P0PA 2AZSA 2QAZA 1M1KC 2YT6A 1E6GA 4C92B 1PHTA 1NPPA 2XICA 1PKTA 1M27C 4BDZA 5GAN6 2PU9B 2D6FA 1YN8A 2D0NA 5CR2A 1Q7YC 2RB6A 1I0CA 1VUBA 2LQKA 3RESA 3L2QA 3KFVA 2DEUA 2XDPA 3RDVA 4AG2C 2EQIA 4YTLA 3X24B 3QYHB 4HXJA 2QYZA 4C5EA 1VQ4T 2R57A 3A98A 2HL3A 3VYHB 1UEBA 1KQSP 4FU6A 1KK7A 1YJ9A 1Z9ZA 2HL5C 4E7SA 2D8JA 4XTUA 1GBRA 1KQSA 3QUIA 1D0ZA 5CKDA 3V7RA 3OBYA 2CH4A 2XHCA 4EPCA 3CCEQ 2DBMA 2CZ0B 2RJCA 5GMKm 3V7CA 1VQNT 4J5YA 4JZ3A 1IHVA 4ZTFA 4OB3B 3M4GA 4M7DF 2IPOB 1X6OA 1FYNA 2EKHA 2BE7D 2JM8A 4ZNXA 4E7LA 4FW1A 1TG0A 1G5VA 3CPWP 4M7AD 2HSPA 2KVQG 3CMAT 3LGFA 4F7UE 1YWOA 2XMFA 3CPWA 1SRLA 2HSEB 3HTRA 2VKNA 4MMKA 5FWCA 2KYMA 1UG1A 3CCRA 4M7AG 4M77E 2YRDA 1PD1A 3QYGB 2YRVA 3I55A 4LD9K 4J9GA 5IN1A 3EGXA 1JQQA 1V1CA 3CC7T 1YI2T 4E2FB 1HXDA 4ZGEB 1H641 4M75B 2JOYA 2J05A 2DILA 3VUBA 3LYIA 3MJXA 5C6SA 4C8QF 3NHNA 4M78D 1K73R 3DLLA 1VQ7A 3VRYA 2KAFA 2KT8A 2QGGA 3EGDA 1ZA2B 2BZ8A 1NZ9A 4DBRA 2C0IA 3LH5A 2L3RA 3CCSA 3CCLA 3QWYA 2KXDA 1VQ5Q 4N4HA 3CD6Q 1VA7A 2M0YA 2X4XA 2P4TA 2EGCA 4LUDA 1I07A 4KH1B 3REBB 1AOJA 2KROA 4HT9A 4OMMA 4DEYA 4EMKC 2JMCA 3HRTA 2A08A 3SWNA 3G6ET 2CP0A 4KRTA 2JTMA 4OMOA 1JJ2P 4QQ6A 3L42A 3V8LA 1UGSB 2P4RA 2CZ7B 1JJ2A 4PJOF 5GAN4 3JB9G 1AZGB 5HCKA 5IXFA 3F70A 1TUDA 1IHWA 3S6WA 5KYNA 2O9SA 1MUZA 4ZGDB 1M3AA 2KNBB 4NL3A 2X4WA 1FXXA 2DTIA 2CP2A 1AZEA 2CT4A 3PTAA 1MGQA 4IUUA 4DBQA 1K73U 2EQJA 4QQGA 3BW1A 1IGQA 1VQKT 4IUPA 3J7AF 1WHJA 2DD4A 3G4ST 2K6DA 2DEQA 3LGLA 3AT1B 2LT1A 3O5ZA 3GNFB 3OYBA 1SSFA 2DIGA 5IHKA 1M1FA 3OYNA 1MMDA 2GNCA 1ZSZC 4KGVB 1X2KA 2DXTA 4M7DD 1I5LA 2EFIA 1ZSZB 4DA4A 5FWBA 3Q1JA 4UC4A 4JJNK 3CCQQ 2C0TA 1U06A 4J7FA 1XJWB 3EFOB 1Q7YR 1VQ6T 3VS0A 2HMAA 3FEOA 4L6V5 2XK0A 4ESRA 2RQVA 1ZA1B 4RTTA 3BDLA 3X26B 4QW2A 1R77A 2ENMA 3DB4A 1WJQA 5ECAA 3OYFA 5J26A 3DKMA 1JU5C 2DRKA 4M7AB 4MZTA 1JEGA 1MNEA 2GFUA 2F1LA 4B9XA 4FIBA 3EG2A 2KSSA 2MMPA 5KYWA 2RQRA 3SB2A 1PSFA 1TUGB 2DL5A 4KULA 1S72T 2VGMA 4BB7A 2DVEA 2ZCFB 1KC8U 1K0SA 2CUBA 2AK5A 2O4XB 2V8IA 4HVUA 2RK1A 3CCMA 3NGPA 2E64A 2PUOB 2YSQA 3E2UA 3LH0A 8ATCB 2H8HA 1Q95G 2RHYA 2EKOA 4PJMA 4BACA 4IUVA 2E5QA 4M75F 5D7UA 3JCMd 2LX9A 2LCCA 3VS6A 4M78C 3A1PA 4FT4A 2D8HA 5LJ3j 3I56A 3CC2T 4M78B 2EGAA 2DKGA 2IVWA 1PCXA 2HDAA 3HFNA 2O9VA 3EH1A 3NTKA 1R0BG 1Q7YU 1U8RA 3HL8A 1LCKA 1YIJA 4J6YA 1VYTA 1VQLT 4RG2A 1HYOA 3OYHA 1VQ4Q 4GBQA 2F5KA 3AHUA 2ZPGB 2O2OA 4FL6A 5J39A 2QA4T 4HVWA 4JRKA 2VUBA 3MEVA 1BBZA 3QZ9B 3A8GB 1YJNA 1AVZC 3FDRA 4N0AC 2OTLT 2OJ2A 4C0DC 4XK8E 1VQNQ 3T9NA 1UJYA 1AEYA 2M51A 4C0DB 2RM4A 4KT0E 4X1VA 1YITA 4RTUA 2JZ2A 1KIKA 4C92D 3CMAQ 2E3HA 1K9MC 1RAAB 1VQ8A 2MIOA 3CCVT 4F7UA 1QVFP 3JCMg 3JCMW 3OYJA 1QVFA 1QWEA 3PVLA 4D6WA 3EGDB 2JW4A 1PRLC 1WHKA 4ZGJB 1BIAA 1H3HA 2FL7A 1BKBA 5GANg 3QSUA 2IIMA 2FPEA 2QI2A 1UECA 2ZPIB 3H41A 4DBHA 4QKUA 5FU6C 2EYZA 3CC7Q 2RO0A 1NE8A 2HZYA 2MWOA 1YI2Q 2NLUA 2JS2A 1SPKA 3QO3A 1R0CB 4XAXB 3LLRA 1RACB 2BZYA 2LDMA 3CMET 2A3LA 5LJ5d 3OYIA 5HK3A 3M55A 3CXCS 2CKKA 2DJQA 3OSSC 4E7KA 4EMGA 4M7DC 1IXDA 3BE3A 2AT1B 3C4SA 3HFOA 1CSKA 2D9TA 2X9HA 2BUDA 2LQNA 3QPHA 3QJ6A 2CSIA 2M9UA 1WJSA 4AMCA 2EYXA 3FJ5A 3O8VA 2X4YA 1VQPT 2L0AA 3PE0A 4JUVA 1RADB 3OYAA 2KT1A 3UA6A 4J9FA 3GOXA 4M77D 1T3SA 2G6FX 4F7UG 1SHFA 3M53A 2G3RA 4M7AF 2YDLA 5KCOA 1N6AA 2X3WD 1M2OA 1V29B 4M77G 3OYEA 3G6EQ 3ZFJA 2RNAA 2A7YA 5IH2A 3OW2S 2KR3A 3TSWA 3CCRT 2FPFA 1G3TA 2NUTB 1P92A 2OAUA 4A4EA 2XDBA 3S3MA 3QZ5B 2M1HA 5L8RE 4AFQC 2K3XA 5GAOq 2KBTA 2E1HA 4LDVA 2EQKA 1FMKA 4OMPA 2EYQA 4O6JA 1E6HA 3RBBB 4J6XA 3HRUA 2PUKB 1N9SA 2Y4XA 4N4GA 1ZHIA 3NPFA 2LQ8A 1G3WA 1WYXA 1M90C 1S1NA 1N8RR 4TVRA 1KHCA 2CSQA 1OPKA 2AKLA 1VQKQ 3PT9A 4M78F 3CCEA 2CP5A 4ORZA 3NMZC 1CKAA 4C8QE 2DTHA 1W2BP 2VXEA 3FJPA 3EG0A 2K3YA 4FT2A 5A0LA 2KRSA 2BIVA 2RQUA 1NLOC 5D6YA 2K5IA 3GIBA 3M56A 2CGHA 3HKSA 2DL3A 5KYWB 2QG9B 2M16A 2JVVA 1D1CA 4ZN1A 3FB9A 3H0HA 2GQIA 2RH2A 1X01A 1BI0A 1WIEA 1VQ6Q 3UATA 2GGRA 1X2QA 1JO8A 3CEYA 5I11A 2A0FB 4L59A 2LJ1A 5GMKh 3VS2A 3RKXA 2IG0A 2X4JA 4XTWA 3JB9F 2DVJA 4C92C 2JT4A 5GAOr 1QP3A 4ANJA 2J6FA 3VS7A 1M3CA 5C0MA 4PJOE 1NEGA 1WXTA 5FU7B 5CQXA 5IT9E 2L2PA 1S72Q 1D3BB 3QDRB 4BY6B 1N8RU 1IZ6A 4PK4A 2C06A 1XQHA 1W1FA 1MNDA 3N5BB 3GF5A 4XU1A 4OP0A 1MHNA 3I5SA 1U1TA 1GFCA 5LJ3h 4KGXB 2KMTA 5I22A 1XNIA 1VQ5A 3CD6A 5DLOA 2I2LA 3C95A 4B6MA 4Z8AA 1VYVA 1WHGA 3L2WA 3QBYA 1BB9A 2DA9A 5HKCA 1GL5A 2YUNA 2WSEE 3CPFA 5KYYA 3CC2Q 1RAGB 4E7ZA 1T3LA 1PNJA 2CP6A 1Q86R 2CH4W 1AWOA 1UHCA 4HVVA 1U5SA 1UTIA 1IB8A 5A0GA 1VQLQ 4BD3A 4PFOA 1OPLA 2Z0WA 2DYIA 4F7UB 1M30A 3ZBDA 4E47A 2QK0A 2LC4A 1EFNA 2QA4Q 2QEXT 3G71T 4NOYA 4M77B 3HHTB 2NUPA 4RUGA 4HCCA 2OTLQ 3BY7A 4CC3A 1VQ9T 1K8AC 3GBQA
chains in the Genus database with same CATH topology
4O5VA 2CZ6B 2DXTA 1VQLA 4CRIA 3CBOA 1IREB 2ZPBB 3A5ZB 3CBMA 3EFSA 3FLGA 5EG2A 3CCLT 3CCST 1I5LA 4M7DD 2EFIA 5I2MA 2HNIA 4DA4A 3Q1JA 4UC4A 3VV0A 1N27A 3QIIA 3NTIA 4M75C 4NL2A 3OYYA 3RKWA 4JJNK 2QDYB 1LJOA 4J7FA 1VQ6T 2KY9A 2HBPA 3X28B 4LDWA 2QA4A 5FLXE 4JS5A 3V8JA 1YJWT 3JSCA 1W4SA 3CCMT 4C92G 2E6ZA 4IUTA 3FEOA 4L6V5 4PKCC 4M77A 1GXIE 2XK0A 1Y7XA 3G7ZA 2MI6A 3QHSA 1UGRB 3G4SA 3OS0A 1NJIU 3MEAA 1K9MU 2OTLA 3BDLA 1G3YA 3WVEB 4QW2A 4IUQA 3X26B 4BI8B 3A8LB 3DB4A 1OZ2A 1WJQA 3OSVA 3SWNC 5CKEA 3JCMc 1B34A 5LJ5h 5J26A 3OYFA 1JBMA 2K57A 1VQMT 1Q81C 1Q86C 3DKMA 4M7AB 2L5QA 4DOVA 3V7SA 3NTHA 2RHIA 1BI3A 4MZTA 2GFUA 1X75C 5LJ3g 1OYXA 4WF2A 1KG1A 4B9XA 1VQ5T 3CD6T 4FIBA 2KSSA 2MMPA 1YHQT 3CCQA 2EJGA 3MO8A 3SB2A 5FU7C 4JLIA 5FU6B 1PSFA 2KK4A 3I56T 4HCBA 4KULA 1Q86U 1S72T 2VGMA 1N9RA 4BB7A 4BE0A 2DVEA 2ZCFB 2MF2A 4JLGA 1KC8U 4KBMB 3DLMA 3QKJA 4LDYA 2K4YA 3JCMh 3L2UA 3OQ5A 3R6OA 5DLQE 3FC3A 1PSEA 2O4XB 4BY6C 5GAMh 2V8IA 4RMOA 1YIJT 2RK1A 1FX7A 3M5AA 3ME9A 1QVGA 1JJ2S 3CCMA 1BI1A 2JN0A 5FRMA 3E9GA 2E64A 1HK9A 2PUOB 4ZN3A 1QVPA 4V2SA 3OA6A 4XU0A 3TREA 4M7DB 1JRIA 3LH0A 2GFAA 3UWNA 5LJ5e 5GANh 4XU2A 4OVAA 4A4HA 4C92E 2RHYA 4M7AA 4Y91A 3JAME 2EKOA 1VQMA 4RKUE 3RMQA 4BACA 4IUVA 2E5QA 3JB9D 2E6NA 4Y28E 2F5TX 4M75F 3SDZA 1WGSA 5LL6S 3JCMd 3C12A 2LX9A 2LCCA 3OYMA 2P0KA 3MHXA 3CXCA 4M78C 3CCUA 4ELYC 2L8DA 4HT8A 4FT4A 3CBPA 4OGCA 2EIFA 5LJ3j 3I56A 3CC2T 1H3ZA 4M78B 4XTZA 2DKGA 2WSFE 2IVWA 3JCMe 2H3JA 2MAMA 4P5NA 2HQXA 3PIOA 2O4XA 3HFNA 5GAMe 3CMEA 3P8DA 4PNOA 3OY9A 1K73C 2QTXA 3NTKA 3JCMJ 1YITT 1Q7YU 1LOJA 1U8RA 1KQ2A 3HL8A 1YIJA 4J6YA 3OB9A 1VQLT 4RG2A 3MP6A 5HK0A 2DXCA 3OYHA 4ZTJA 2QQAA 3A8MB 4X9DA 5GANe 3LWIA 2F5KA 4C92F 3AHUA 2RHXA 3WVDB 1BI2A 2ZPGB 4FL6A 5LJ3f 5GAOn 1VQ8T 3PNWC 1YCYA 3A8OB 5CIUA 4QQDA 1OI1A 2ZPEB 5J39A 3HSBA 3WXMB 2QA4T 2XG8D 4JRKA 3BFMA 3VUZA 4BI4A 1VQPA 2FHDA 3OS5A 4A54A 3OYCA 1Q82C 3OBWA 2FB7A 2VUBA 2DTOA 4M75D 1Y96B 4BUGA 1VQOT 3MEVA 4M77C 3QZ9B 2EAYA 3A8GB 3LWHA 4C8QC 5CCAA 3JCMV 1YJNA 5GAOm 2QXFA 2RI3A 1QP2A 2VYTA 4M78A 4RCBA 4C5HA 3S3NA 3RERA 1XOVA 2BKDN 3FDRA 4N0AC 1WJRA 4JS4A 2OTLT 3FRNA 2HAXA 4A4GA 5GMKi 3JCMb 1RI0A 4C0DC 4E7HA 2L89A 1VIFA 4XK8E 4M75G 3EAEA 5LJ5g 2XDDA 5CK9A 1QVFS 3T9NA 4LD6A 2RHZA 4J7IA 1VQ4A 4C0DB 5M9OA 3QJYA 2RM4A 4KT0E 3M57A 1AHJB 2K5FA 3JRZA 2FYKA 4ELZC 3JCMX 1YITA 2EWNA 4E7IA 2JZ2A 3CCQT 2DIQA 2E10A 3P8HA 5CQYA 4C92D 4Z02A 3RKYA 1NJIC 1K9MC 1UB4A 3PFSA 1VQ8A 3CCVT 4F7UA 4PLIA 5J3BA 3QG1A 1Y96A 3JCMg 2XD0A 4QVCA 3JCMW 3OYJA 2VV5A 1QVFA 5A2QE 3C94A 1M90U 4A4FA 4XQ3A 5CKHA 1VQOA 3INZA 1W2BA 4D6WA 4BDYA 4C8QA 3OMGA 2DZ9A 3H8ZA 2DD5A 3MP8A 4J8OA 3S3OA 5FROA 1VQNA 4IURA 4ZGJB 2XKOC 1BIAA 3LW5E 4N0AA 2FL7A 1BKBA 2ZPFB 3MP1A 5GANg 5GAN2 3QSUA 4M7AC 4OB0B 3CC4A 2QQ9A 2RD1A 3H6ZA 2QI2A 5CKFA 5D6WA 2DPPB 3OYDA 2ZPIB 1M1GA 2V8KA 3PGGA 4N4IA 1QVGS 1KC8C 4C0FA 1KD1U 4MDXA 4PJOC 3MEUA 5A0DA 5GMKj 4JRPA 4MZMA 3GNGA 5FU6C 3GPLA 3CMAA 1VIEA 4JDSA 4M75E 1M8VA 4R55A 3P8BB 4MMLA 2RO0A 2OTJA 1NE8A 3CCJA 3CCUT 2MWOA 5DM7R 2NLUA 4PJOB 3META 4ATOA 2RI2A 5KH6A 3QO3A 2E41A 4M77F 4ME7A 2DXUA 4XAXB 3LLRA 3CMET 2LDMA 2M0OA 4HKEA 4QVDA 3RUXA 3CCVA 2A3LA 2R5AA 3VU3C 4KUIA 5LJ5d 2GF7A 4JRIA 3TCJA 5HK3A 3OYIA 3M55A 3CXCS 1O75A 4QVZA 2CKKA 5GAOp 2LNVA 1JB0E 3OSSC 4EMGA 5LJ5f 4E7KA 4M7DC 2R58A 1I4K1 2LCLA 2P0PA 3KBGA 5CO7A 3C4SA 3HFOA 1M1KC 2D9TA 4M78G 4OGEA 2BUDA 2V8JA 3MCAB 3QPHA 5D6XA 3KXTA 3QJ6A 2M9UA 2PVDB 1WJSA 4C92B 2LVMA 4FSXA 1NPPA 2XICA 2WACA 4LDUA 4BDZA 3M9QA 3O8VA 3UPUA 5GAN6 4OF1A 2PU9B 2X4YA 4X34A 3CC7A 1VQPT 2D6FA 1YI2A 4JUVA 1M1KU 4PJOA 4XTYA 1YJNT 4JRQA 5GAMd 1KQSS 4OMFB 5CR2A 1Q7YC 3JCMf 3X25B 2RB6A 3URGA 1VUBA 3RESA 2LQKA 2LRQA 3OYAA 3L2QA 5GAMf 2XDPA 5GAOl 2DO3A 2K2VA 1TH7A 2EJ9A 3GOXA 4M77D 4YTLA 3X24B 1Y71A 3HRSA 3QYHB 2E65A 3UDCA 5GANd 2QQBA 4F7UG 4C5EA 3GLXA 1VQ4T 4EMKB 2R57A 3M53A 1WPYA 2XI9A 5GANf 2G3RA 4M7AF 3TU4K 4IKFA 3GP8A 1QW1A 4OB2B 1N6AA 3TEEA 5KCOA 1KHIA 1YBYA 1UEBA 3ER0A 4FU6A 3VYHB 4CI0C 1V29B 1YJ9A 4M7DA 4M77G 3OYEA 3ZFJA 4C8QG 3PIPA 2A7YA 2PVGB 4XTUA 1KQSA 2B8AA 4EDUA 3OW2S 1FWZA 3CCRT 3QUIA 5CKDA 3V7RA 4A4KA 3OBYA 3PMTA 1G3TA 3RMSA 4FM4B 1P92A 4LDXA 2OAUA 4M78E 4A4EA 2XDBA 2LT4A 2MWPA 2XHCA 2JTFA 4HA8A 3QZ5B 4C0ZA 4EPCA 3S3MA 2CZ0B 3VYGA 3E19A 2RJCA 2RJFA 2M1HA 1RL2A 5I2SA 5GMKm 5L8RE 3V7CA 2K3XA 5GAOq 1KQ1A 2DK3A 3J81E 4J5YA 1VQNT 2O01E 2E1HA 2DXBA 4LDVA 4ZTFA 2RI5A 2EQKA 3M4GA 4OB3B 4M7DF 1X6OA 4KUDK 3CC4T 1WQ7A 1I8FA 4MZPA 3OW2A 2KQWA 2EYQA 4O6JA 4E7LA 1ZBXA 4J6XA 3HRUA 3JB9H 1G5VA 2VXFA 3G6EA 4E7JA 1W2BS 2PUKB 4M7AD 1N9SA 2KVQG 2Y4XA 4N4GA 1ZHIA 3VJPA 3CMAT 2LQ8A 2PQWA 1M5Q1 3HPWA 3LGFA 2OTJT 2ZGWA 1G3WA 4J83A 4F7UE 3CCJT 1M90C 2DZCA 3CPWA 4TVRA 5I21A 4XU3A 1KHCA 4MMKA 3J80E 3CCRA 4M7AG 3PT9A 4M78F 3CCEA 4M77E 2ZPHB 4C5GA 2RHUA 4C8QE 2DTHA 2VXEA 3FJPA 2K3YA 5GAMg 3QYGB 2YRVA 4FT2A 4PJOG 5A0LA 2JNGA 1KD1C 3I55A 4LD9K 2BIVA 2YLBA 3OS1A 5CKBA 3SD4A 5D6YA 4B9WA 2K5IA 3OYGA 3GIBA 3M56A 5IN1A 3KUFA 2CGHA 3HP9A 3HKSA 4GLKA 2F69A 2QQRA 3L1AA 3L2ZA 3OS2A 3FIFA 3CC7T 2M16A 2DJZA 2E12A 2JVVA 4ZN1A 1YI2T 2XIDA 3FB9A 1HXDA 4ZGEB 4MDWA 1K8AU 2CS7A 4F7UF 5LJ5j 1H641 4M75B 5KE2A 4M7DG 2CZ1B 2JOYA 1EIFA 1X01A 2RH2A 3OMCA 1VQKA 1BI0A 4R56A 3M54A 5CVIA 2RJEA 3VUBA 3LYIA 2QEXA 3G71A 4A53A 5C6SA 4C8QF 3DB3A 5GAN5 4M78D 1G3SA 3CEYA 4L59A 3DLLA 1VQ7A 1LNXA 4DQ2A 2KAFA 5KE3A 3BDUA 5GMKh 1ZQ1A 3RKXA 2IG0A 2X4JA 3M59A 4XTWA 5AYFA 3L2RA 3JB9I 3JB9F 3SWNB 4M7AE 4RG8A 2RA2A 1YJ9T 4C92C 3VKIA 1VQ9A 5GAOr 1QP3A 4XTXA 4J6WA 1NZ9A 2EJFA 5IAYA 5GAMj 3MEWA 2L3RA 2GQVA 3CCSA 3CCLA 3OYKA 3OYLA 5C0MA 1Y07A 4PJOE 4BE1A 1N8RC 1Q81U 4N4HA 4C0GA 1NPRA 4M75A 5GANj 5FU7B 2ZZDA 5CQXA 2X4XA 4VUBA 5GAN3 5IT9E 4NS5A 2FVUA 2P4TA 2YHTA 1VQ6A 4II1A 4PLLA 1YJWA 3LX7A 4L5GA 5CAIA 5GMKl 1D3BB 3QDRB 3UT1A 4HT9A 4BY6B 1N8RU 1IZ6A 2GCXA 4EMKC 1M4ZA 2Y90A 2C06A 1WNLA 1XQHA 4M7DE 3HRTA 4C8QD 2D0QB 5GMKe 5GAN7 2PVOB 4PL6A 2P0QA 4GY5A 2EQUA 3QXEB 3N5BB 3SWNA 3G6ET 3GF5A 4XU1A 4C5IA 3E1SA 2JTMA 4OP0A 1UGPB 4QQ6A 1MHNA 4C92A 1U1TA 2E70A 2AHJB 3L42A 1UGSB 5LJ3h 3V8LA 2KMTA 2CZ7B 3NFCA 1XNIA 1JJ2A 4PJOF 1VQ5A 5DLOA 3CD6A 2I2LA 3C95A 1YHQA 1M9SA 2EQMA 3CCET 3SFMA 3A8HB 3QBYA 3L2WA 5HKCA 5GAN4 3JB9G 1S72A 3F70A 1I81A 4RCCA 2WSEE 4BI3A 2YLCA 4X9CA 3S6WA 3CPFA 2VGNA 4ZGDB 3CPWS 2DAQA 1D3BA 4DOWA 3I55T 4NL3A 2X4WA 1U1SA 2QQSA 1FXXA 3PMIA 5LJ3d 3JB9J 2HD0A 2DTIA 2K5LA 4EMKA 1XTDA 5KCHA 5FRNA 1R8OB 4HCZA 3ZEHA 5A0GA 1BIBA 4BD3A 3JCMQ 3PTAA 1MGQA 1UGQB 4IUUA 3L2VA 2X35A 1K73U 2EQJA 2LTOA 2KDSA 2RK2A 2R5MA 4QQGA 3BW1A 5LJ3e 4F7UB 4BE2A 3ZBDA 3E9FA 2VC8A 1VQKT 4E47A 2LC4A 2RJDA 2XU8A 1BYMA 3EFRA 4IUPA 2CYZB 1O9SA 3V8KA 2DD4A 3J7AF 3G4ST 4Q5WA 3G71T 2QEXT 3RIRA 4PJOD 3M58A 4NOYA 4M77B 1WQWA 1OZ3A 5GAN8 3X20B 3HHTB 4C8QB 2Y4YA 2DEQA 3LGLA 3CC2A 2HQEA 2JUFA 1VQ7T 2WSCE 2LT1A 3M4YA 4HCCA 1DJ7B 5HY6A 1Q82U 4OB1B 4EMHA 3ASKA 3GNFB 4XTVA 1B34B 3BY7A 3OYBA 1SSFA 3JCMP 5DY9A 1VQ9T 2DIGA 1K8AC 1M1FA 3OYNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YCY A;  5GAM d;  3JCM f;  2RB6 A;  1LNX A;  2DXT A;  4DQ2 A;  3RES A;  3HSB A;  3BDU A;  3EFS A;  5GMK h;  5GAM f;  4M7D D;  5GAO l;  1I5L A;  4JRK A;  3BFM A;  3RKX A;  1TH7 A;  4XTW A;  4A54 A;  2EJ9 A;  2HNI A;  3JB9 I;  3SWN B;  4M77 D;  3JB9 F;  2FB7 A;  2RA2 A;  2DTO A;  4M75 D;  1Y96 B;  2E65 A;  4C92 C;  4M77 C;  4NL2 A;  4M75 C;  3RKW A;  4F7U G;  2EAY A;  4XTX A;  4J6W A;  4C8Q C;  5GAN d;  3JCM V;  5GAO r;  2EJF A;  5GAO m;  5GAM j;  3RER A;  1LJO A;  4M78 A;  4RCB A;  4EMK B;  1WPY A;  5GAN f;  4M7A F;  4N0A C;  3V8J A;  5GMK i;  4PJO E;  3JCM b;  4M7D A;  4C92 G;  4M77 G;  5LJ5 g;  4M75 G;  4M77 A;  4M75 A;  4C8Q G;  5GAN j;  3QHS A;  4XTU A;  5GAN 3;  2YHT A;  2RM4 A;  3QUI A;  3V7R A;  2FYK A;  3JCM X;  3JCM c;  3SWN C;  2EWN A;  1B34 A;  5LJ5 h;  5CAI A;  1JBM A;  1D3B B;  2K57 A;  4M78 E;  5GMK l;  2E10 A;  4HA8 A;  4HT9 A;  4M7A B;  4EMK C;  4C92 D;  2Y90 A;  1WNL A;  3RKY A;  4M7D E;  3V7S A;  4C8Q D;  5GMK e;  5GAN 7;  5GMK m;  3V7C A;  5LJ3 g;  4F7U A;  5GAO q;  4WF2 A;  1KQ1 A;  4J5Y A;  3SWN A;  1Y96 A;  3JCM g;  2E1H A;  4QVC A;  2EJG A;  4XU1 A;  3M4G A;  3SB2 A;  3JCM W;  4M7D F;  4JLI A;  4OP0 A;  4XQ3 A;  5LJ3 f;  1WQ7 A;  3INZ A;  4C92 A;  1I8F A;  1N9R A;  1U1T A;  3V8L A;  5LJ3 h;  2DVE A;  4C8Q A;  4J6X A;  3JB9 H;  2DZ9 A;  2VXF A;  4PJO F;  2I2L A;  3JCM h;  4M7A D;  1BIA A;  1N9S A;  4N0A A;  5GAN g;  3QSU A;  4M7A C;  5GAM h;  5GAN 2;  1M5Q 1;  2ZGW A;  5GAN 4;  4F7U E;  3JB9 G;  2JN0 A;  2E64 A;  1HK9 A;  2DZC A;  1I81 A;  4RCC A;  2RD1 A;  5GAO n;  4V2S A;  4M7A E;  4XU0 A;  2YLC A;  3PGG A;  4X9C A;  4XU3 A;  1JRI A;  5I21 A;  4M7D B;  4MMK A;  5LJ5 e;  1D3B A;  4PJO C;  5GMK j;  5GAN h;  4NL3 A;  4XU2 A;  4M78 F;  4M7A G;  4C92 E;  4M7A A;  4M77 E;  1U1S A;  4M75 E;  4Y91 A;  1M8V A;  4MML A;  4C8Q E;  2DTH A;  2VXE A;  4PJO B;  3FJP A;  5LJ3 d;  3JB9 J;  5GAM g;  2DTI A;  3JB9 D;  3QO3 A;  2E41 A;  4M77 F;  4M75 F;  4EMK A;  4PJO G;  3JCM d;  2DXU A;  1BIB A;  3JCM Q;  2YLB A;  1MGQ A;  4QVD A;  3RUX A;  4M78 C;  3VU3 C;  5LJ5 d;  4HT8 A;  4JRI A;  3GIB A;  5GAO p;  3BW1 A;  5LJ3 e;  4F7U B;  5LJ3 j;  4EMG A;  5LJ5 f;  2CGH A;  4M7D C;  2VC8 A;  4M78 B;  4XTZ A;  2DKG A;  1I4K 1;  3L1A A;  3JCM e;  3L2Z A;  3EFR A;  3FIF A;  3HFO A;  3HFN A;  3V8K A;  4M78 G;  2DJZ A;  5GAM e;  3FB9 A;  4PJO D;  1HXD A;  3RIR A;  4PNO A;  4NOY A;  4C92 B;  4F7U F;  1H64 1;  1WQW A;  4M75 B;  2QTX A;  4M77 B;  5LJ5 j;  5GAN 8;  3JCM J;  1LOJ A;  4C8Q B;  1KQ2 A;  1X01 A;  2DEQ A;  4M7D G;  4J6Y A;  5GAN 6;  4X9D A;  5GAN e;  4EMH A;  4C92 F;  4XTV A;  3AHU A;  1B34 B;  3BY7 A;  4JUV A;  4A53 A;  3JCM P;  5DY9 A;  4C8Q F;  4PJO A;  5GAN 5;  4XTY A;  4M78 D; 
#chains in the Genus database with same CATH topology
 2CZ6 B;  3CBO A;  1YFN A;  3EFS A;  2HQH A;  5I2M A;  1YNZ A;  4M75 C;  1M3B A;  3OYY A;  2CDT A;  2A28 A;  1TWB A;  2QDY B;  1Y57 A;  2KY9 A;  5FW9 A;  5FLX E;  3V8J A;  1YJW T;  1W4S A;  3CCM T;  1I1J A;  1OX8 A;  1GXI E;  3G7Z A;  1LVK A;  2MI6 A;  3QHS A;  3EG9 A;  1MV0 B;  1AWX A;  1WHM A;  3MEA A;  1K9M U;  1SKU B;  3WVE B;  4IUQ A;  2DYB A;  1B34 A;  3I9Q A;  5LJ5 h;  1PWT A;  2FZG B;  2L5Q A;  1BU1 A;  4DOV A;  1X75 C;  1VQM Q;  1V76 A;  1TUC A;  4DBF A;  1YHQ T;  3CCQ A;  1W70 A;  3I56 T;  1Q86 U;  4KBM B;  3DLM A;  4AFU C;  3RR6 A;  3OQ5 A;  3R6O A;  1TXQ A;  5KYU B;  3FC3 A;  1YIJ T;  1FX7 A;  3M5A A;  5FRM A;  3CME Q;  1BI1 A;  2JN0 A;  2DM1 A;  1HD3 A;  2KXC A;  3OA6 A;  1ZUK A;  3UWN A;  2LJ3 A;  1NBE B;  5IXB A;  1EZZ B;  1M90 R;  1VYU A;  3CXC P;  3JB9 D;  2E6N A;  2F5T X;  1WGS A;  3CXC A;  2P84 A;  1RLQ C;  1VQP Q;  2L8D A;  4HT8 A;  1A0N B;  1BK2 A;  4XTZ A;  2WSF E;  2DE0 X;  2H3J A;  2MAM A;  2RQT A;  3PIO A;  2DET A;  4PNO A;  1YIT T;  1KQ2 A;  2V26 A;  4JZ4 A;  2JXB A;  4X9D A;  1M2V A;  2CP3 A;  2DL4 A;  4C92 F;  2RHX A;  1KC8 R;  5LJ3 f;  1VQ8 T;  1YCY A;  1SRM A;  3A8O B;  1SSH A;  1RI9 A;  3WXM B;  3BFM A;  3CCR Q;  1Q82 C;  8AT1 B;  2FB7 A;  1WZO A;  4BUG A;  1Y96 B;  2K79 A;  2J6O A;  5CCA A;  2DLP A;  2QXF A;  2RI3 A;  3S3N A;  1AWJ A;  1XOV A;  2BKD N;  4PJN A;  1WJR A;  3FRN A;  1VQO Q;  3JCM b;  2EVR A;  1RI0 A;  1M8M A;  2YUQ A;  2HEQ A;  1NM7 A;  4J7I A;  1VQ4 A;  1M1K R;  2A36 A;  4KGZ B;  3M57 A;  1AHJ B;  1H8K A;  3JRZ A;  4ELZ C;  4E7I A;  4LN2 A;  2KE9 A;  1Y0M A;  4WCI A;  1I5O B;  2HCK A;  2EYY A;  2W10 A;  3IQL A;  3TSZ A;  2VV5 A;  5A2Q E;  3C94 A;  1M90 U;  5CKH A;  4C8Q A;  3MP8 A;  1VQN A;  2J6K A;  1RAB B;  2XKO C;  3LW5 E;  4OMN A;  4M7A C;  5GAN 2;  2MYS A;  1PKS A;  2QQ9 A;  5CKF A;  2JMA A;  3H6Z A;  5D6W A;  3OYD A;  4C0F A;  5GMK j;  4MZM A;  3GNG A;  3CMA A;  4JDS A;  1M8V A;  4MML A;  3CCU T;  5DM7 R;  3MET A;  2RI2 A;  2E41 A;  1B3Q A;  4M77 F;  2CUD A;  2DXU A;  3VU3 C;  4JRI A;  2LNV A;  1JB0 E;  5LJ5 f;  2LCL A;  1OX9 A;  3KXT A;  4PFZ A;  2WAC A;  1C1A A;  4LDU A;  3UPU A;  4OF1 A;  4X34 A;  1OUL A;  3CC7 A;  4LUE A;  1YI2 A;  1M1K U;  4PJO A;  4XTY A;  5GAM d;  1KQS S;  2QTV A;  3URG A;  2LRQ A;  5GAO l;  2DO3 A;  2K2V A;  1TH7 A;  1Y71 A;  3HRS A;  1K1Z A;  5GAN d;  2AKK A;  3GLX A;  2XI9 A;  1X6B A;  2YWW A;  4EIK A;  3GP8 A;  1QW1 A;  4OB2 B;  3TEE A;  3R6N A;  4CI0 C;  1QCN A;  2ED0 A;  2RMO A;  1OQK A;  4C8Q G;  2PVG B;  4JJD A;  4EDU A;  1C0M A;  4A4K A;  1SEM A;  4LDX A;  2NWM A;  4FM4 B;  1OU9 A;  4M78 E;  1ZUU A;  3TQ7 P;  4FYY B;  2JTF A;  4C0Z A;  2NUP B;  3VYG A;  3E19 A;  5I2S A;  2LMJ A;  1KQ1 A;  6AT1 B;  2B86 A;  2QAS A;  2RI5 A;  1IRX A;  3CC4 T;  1I8F A;  4MZP A;  4AFS C;  3EGX B;  3JB9 H;  1KFZ A;  3G6E A;  2OTJ T;  2PQW A;  3HPW A;  4J83 A;  3CCJ T;  2DZC A;  1QCF A;  2YXY A;  1G83 A;  4XU3 A;  2O88 A;  3J80 E;  2ZPH B;  2FPD A;  2QEX Q;  3G71 Q;  1JXM A;  5GAM g;  1J3T A;  4J9H A;  4PJO G;  2JNG A;  1KD1 C;  2YLB A;  3OS1 A;  5CKB A;  3SD4 A;  1ACM B;  4B9W A;  1ZUY A;  1WA7 A;  1VQ9 Q;  1ZLM A;  2K2M A;  4GLK A;  2F69 A;  3L2Z A;  1WXU A;  3VS4 A;  2DJZ A;  3PVQ A;  1K8A U;  5LJ5 j;  5KE2 A;  2CZ1 B;  1EIF A;  4R0K A;  1VQK A;  4RTW A;  4R56 A;  3M54 A;  3REA B;  4FYX B;  1B7T A;  4QT7 A;  1YJW Q;  3DB3 A;  4PJL A;  2JM9 A;  3EG1 A;  3BDU A;  3L2R A;  5AYF A;  3JB9 I;  3SWN B;  2COW A;  4RG8 A;  1YJ9 T;  3VKI A;  4XTX A;  5IAY A;  3H0I A;  2GQV A;  1NEB A;  3OYK A;  2FZK B;  1Y07 A;  1MMA A;  4BE1 A;  2VWF A;  2DMO A;  4M75 A;  1YHQ Q;  4AFZ C;  3VS3 A;  4VUB A;  2FVU A;  2YHT A;  2EYW A;  1VQ6 A;  1FMV A;  2COZ A;  4IIO A;  2L3Q A;  4PLL A;  4PJJ A;  1WFW A;  2L3P A;  3UT1 A;  2GCX A;  2KRM A;  2PNI A;  1WNL A;  1YIJ Q;  4M7D E;  5GMK e;  2D0Q B;  2PVO B;  4PL6 A;  2NYS A;  1X69 A;  1D1B A;  1K76 A;  3UA7 A;  3U23 A;  4C5I A;  2F2W A;  1UGP B;  1K0X A;  2E70 A;  1UGV A;  1M9S A;  3SFM A;  5GJW B;  1QMC A;  1S72 A;  1BCM A;  2E4H A;  3M0S A;  4BI3 A;  3H9N A;  2ROT A;  2DAQ A;  4DOW A;  1RAH B;  4Y92 A;  3I55 T;  2LZ6 B;  2E3I A;  1GCQ C;  1U1S A;  2QQS A;  1W6X A;  3PMI A;  5GJV B;  4EMK A;  1YIT Q;  1XTD A;  5KCH A;  5FRN A;  1R8O B;  1D0Y A;  2VVK A;  3JCM Q;  2FEI A;  2X35 A;  2LTO A;  2RK2 A;  5LJ3 e;  4BE2 A;  2RJD A;  2BZX A;  1BYM A;  2CYZ B;  1O9S A;  3V8K A;  2OX7 A;  1WX6 A;  3C0C A;  1OOT A;  1OZ3 A;  4C8Q B;  2LP5 A;  2Y4Y A;  1QKX A;  3CC2 A;  2HQE A;  1VQ7 T;  2WSC E;  3M4Y A;  3G4S Q;  1Q82 U;  4EMH A;  2H3E B;  4XTV A;  3MKD A;  1VQL A;  1RLP C;  3A5Z B;  3CBM A;  3CCL T;  3CCS T;  3EG3 A;  2HNI A;  4JJC A;  4D8D A;  1N27 A;  3QII A;  4NL2 A;  1LJO A;  2QA4 A;  4JS5 A;  3M0R A;  4PKC C;  3OS0 A;  2MCN A;  2OTL A;  5EC7 A;  3A8L B;  3G1J A;  1OZ2 A;  2AIR B;  3OSV A;  5CKE A;  2LJ0 A;  1JBM A;  2K57 A;  1Q81 C;  2RPN A;  2MK5 A;  3V7S A;  3NTH A;  2RHI A;  2RF0 A;  4WF2 A;  1ZSZ A;  1KG1 A;  4WTO B;  2CT3 A;  2K9G A;  2EJG A;  1YWP A;  5FU7 C;  2X51 A;  2KK4 A;  3EFO A;  1N9R A;  1UFF A;  3CCU Q;  1T0J A;  4BE0 A;  2MF2 A;  2ROL A;  3QKJ A;  2K4Y A;  3JCM h;  4RTX A;  4BY6 C;  5GAM h;  1HK9 A;  4ZN3 A;  3MPU B;  4V2S A;  1JRI A;  2GFA A;  2QDL A;  5LJ5 e;  4A63 B;  1OU8 A;  5GAN h;  4A4H A;  4C92 E;  4M7A A;  3JAM E;  2RN8 A;  2F2V A;  1VQM A;  4RKU E;  3RMQ A;  2J06 A;  3OYM A;  3SDZ A;  3C12 A;  2A37 A;  1ZSG A;  3MHX A;  1K9M R;  4ELY C;  1H92 A;  3CBP A;  1ZX6 A;  4OGC A;  1H3Z A;  4F04 B;  1QCO A;  2DX1 A;  2X3X D;  1T0H A;  4P5N A;  1WHH A;  2O4X A;  3CME A;  1KD1 R;  3P8D A;  1HJD A;  3OY9 A;  2QTX A;  3JCM J;  3M0T A;  4GLM A;  3A8M B;  2KEA A;  3WVD B;  1BI2 A;  3M0P A;  3EH2 A;  5GAO n;  3PNW C;  9ATC B;  2K3B A;  5CIU A;  2GBQ A;  2ZPE B;  3HSB A;  2XG8 D;  4BI4 A;  1VQP A;  2FHD A;  3OS5 A;  3OYC A;  3OBW A;  4M77 C;  1AT1 B;  3JCM V;  5GAO m;  4C5H A;  2VYT A;  1QP2 A;  4M78 A;  4RCB A;  3SEM A;  3RER A;  1UE9 A;  4JS4 A;  2HAX A;  4E7H A;  2L89 A;  3EAE A;  1QVF S;  1LPL A;  4LD6 A;  2RHZ A;  3QJY A;  1EX4 A;  3CC4 Q;  1PC0 A;  2EWN A;  3SHW A;  2E10 A;  3P8H A;  2V1Q A;  4Z02 A;  2OTJ Q;  3RKY A;  1NJI C;  3CCJ Q;  1UB4 A;  4PLI A;  5J3B A;  1D09 B;  3CCV Q;  2KGT A;  1VQO A;  3ULR B;  2DZ9 A;  2HKN A;  2DD5 A;  3H8Z A;  2D1X A;  1KJW A;  4N0A A;  4AT1 B;  4FYV B;  4OB0 B;  1TTH B;  4F14 A;  1QVG S;  3PGG A;  3EHQ A;  1Z9Q A;  1SF9 A;  1KD1 U;  1PM3 A;  4MDX A;  4JRP A;  1VIE A;  4M75 E;  3P8B B;  2FO0 A;  5KH6 A;  4M4Z A;  4QVD A;  2NUZ A;  2R5A A;  7AT1 B;  1IGU A;  2GF7 A;  3TCJ A;  2ZAE A;  1O75 A;  5GAO p;  2FG0 A;  3VS1 A;  3KBG A;  5CO7 A;  4M78 G;  4OGE A;  2V8J A;  3MCA B;  5D6X A;  1AWW A;  2PVD B;  1YJ9 Q;  2LVM A;  4FSX A;  1WDX A;  4JJB A;  3M9Q A;  1UDL A;  1YJN T;  4JRQ A;  4OMF B;  1PRM C;  3ZL7 C;  3JCM f;  2HBW A;  3X25 B;  5GAM f;  2ABL A;  2EJ9 A;  1RAE B;  1TSF A;  2E65 A;  3UDC A;  3CQT A;  2FRY A;  2QQB A;  4Z89 A;  4EMK B;  1WPY A;  5GAN f;  3TU4 K;  2JJ9 A;  4IKF A;  1KHI A;  1YBY A;  3ER0 A;  4M7D A;  5IHI A;  2F2X A;  3PIP A;  4DEX A;  2B8A A;  1FWZ A;  1UHF A;  2W0Z A;  1QQJ A;  1K4U S;  2GTJ A;  2OI3 A;  3PMT A;  2DF6 A;  3RMS A;  4CC4 B;  4F17 A;  1GFD A;  2LT4 A;  2MWP A;  4HA8 A;  1WXB A;  2RJF A;  1RL2 A;  2DK3 A;  3J81 E;  2O01 E;  2DXB A;  3OW2 P;  1Q81 R;  3I55 Q;  4KUD K;  3QWX X;  1WQ7 A;  2KRN A;  5IHN A;  3OW2 A;  2KQW A;  1ZBX A;  1WHL A;  2VXF A;  4CC7 A;  4E7J A;  1W2B S;  1WI7 A;  3VJP A;  1M5Q 1;  2ZGW A;  4PFP A;  5I21 A;  1C6V X;  2NUT A;  4CC2 A;  1X6G A;  2EW3 A;  4C5G A;  2RHU A;  2ED1 A;  3QDF A;  1YCS B;  1VQ7 Q;  1GCQ A;  2SRC A;  3OYG A;  1NLP C;  1ABQ A;  3KUF A;  1HSQ A;  3HP9 A;  2QQR A;  3L1A A;  3OS2 A;  3FIF A;  3CCL Q;  3CCS Q;  2E12 A;  2XID A;  4MDW A;  2CS7 A;  4F7U F;  4M7D G;  2QGF B;  3OMC A;  1YP5 A;  5CVI A;  2RJE A;  2ATC B;  2QEX A;  3G71 A;  4A53 A;  5KYX A;  5GAN 5;  1G3S A;  4LE9 A;  1LNX A;  4DQ2 A;  2DRM A;  5KE3 A;  1ZQ1 A;  4RTY A;  3M59 A;  4M7A E;  4J9E A;  2RA2 A;  1VQ9 A;  4J6W A;  3VRZ A;  2EJF A;  5GAM j;  3MEW A;  1GRI A;  1MMN A;  1GBQ A;  3OYL A;  4E6R A;  1N8R C;  2KI7 A;  1Q81 U;  1QKW A;  2LNH B;  4C0G A;  1NPR A;  5GAN j;  3EHR A;  2ZZD A;  4J9C A;  5GAN 3;  2LQW A;  3I5R A;  4NS5 A;  4II1 A;  1YJW A;  1BCO A;  5KYY B;  3LX7 A;  4L5G A;  5CAI A;  5GMK l;  1TOV A;  1M4Z A;  2Y90 A;  4JPB W;  4C8Q D;  5GAN 7;  2DBK A;  2P0Q A;  4GY5 A;  1K8A R;  2EQU A;  2JS0 A;  3QXE B;  1IO6 A;  3E1S A;  2VAS A;  3M0Q A;  4C92 A;  1NJI R;  2AHJ B;  3VS5 A;  3NFC A;  1YHQ A;  2EQM A;  3CCE T;  1QWF A;  2MOX A;  3A8H B;  2AZV A;  4F16 A;  1ARK A;  2BE9 B;  4J9I A;  1I81 A;  4RCC A;  2JTE A;  1RAI B;  1F1B B;  2C0O A;  2YLC A;  4X9C A;  1N5Z A;  2VGN A;  3CPW S;  2EPD A;  1D3B A;  1G8X A;  3EGU A;  1RUW A;  2DFU A;  4Z88 A;  5LJ3 d;  3JB9 J;  2HD0 A;  2K5L A;  4HCZ A;  3ZEH A;  1BIB A;  1X43 A;  1UGQ B;  3L2V A;  2KDS A;  2R5M A;  4J9D A;  3E9F A;  2VC8 A;  1FMW A;  2XU8 A;  3EFR A;  4Q5W A;  2LX7 A;  4PJO D;  3RIR A;  3M58 A;  1WQW A;  5GAN 8;  3X20 B;  1NYG A;  3EG9 B;  2JUF A;  1DJ7 B;  4J9B A;  5HY6 A;  1AD5 A;  4OB1 B;  1UJ0 A;  3ASK A;  3JV3 A;  1B34 B;  3JCM P;  5DY9 A;  2J7I A;  4O5V A;  1TU0 B;  4FCY A;  4CRI A;  1IRE B;  2ZPB B;  5EG2 A;  3FLG A;  4OML A;  3VV0 A;  3NTI A;  3RKW A;  2M02 A;  4IIM A;  2ESW A;  2CRE A;  2HBP A;  3RNJ A;  3X28 B;  4LDW A;  2GTO A;  2FZC B;  3JSC A;  4C92 G;  2E6Z A;  4IUT A;  4M77 A;  1Y7X A;  2FRW A;  1UGR B;  3M0U A;  3G4S A;  1OV3 A;  1NJI U;  3CCM Q;  4BI8 B;  1G3Y A;  1WLP B;  3JCM c;  3SWN C;  2V1R A;  1D1A A;  1Q86 C;  1ZBJ A;  1VQM T;  1U3O A;  3D7S B;  2BTT A;  1MV3 A;  1BI3 A;  1VOM A;  5LJ3 g;  1OYX A;  1VQ5 T;  3CD6 T;  3MO8 A;  4JLI A;  5FU6 B;  4AG1 C;  4HCB A;  2DER A;  1K9A A;  1Q82 R;  3I35 A;  2K7A A;  4JLG A;  1QVG P;  4LDY A;  3I56 Q;  3L2U A;  1UUE A;  5DLQ E;  1PSE A;  4RMO A;  1JJ2 S;  1D0X A;  2LCS A;  3ME9 A;  1QVG A;  2I0N A;  3E9G A;  2PZ1 A;  1QVP A;  4XU0 A;  4LNP A;  3TRE A;  4M7D B;  4RTV A;  2YUP A;  1M2V B;  4XU2 A;  4OVA A;  4Y91 A;  1G2B A;  1GCP A;  4Y28 E;  4HCK A;  5LL6 S;  1NYF A;  2EGE A;  1X27 A;  2P0K A;  3CCU A;  3TVT A;  1KSW A;  2EIF A;  1YJN Q;  1ABO A;  2ECZ A;  3JCM e;  5KYU A;  2HQX A;  5GAM e;  2SEM A;  3THK A;  1K73 C;  1LOJ A;  1SG5 A;  3OB9 A;  3MP6 A;  5HK0 A;  2DXC A;  4ZTJ A;  2QQA A;  4D8K A;  5GAN e;  3LWI A;  2YUO A;  1TS9 A;  4QQD A;  1PD0 A;  1OI1 A;  4FW2 A;  1E7O A;  4KH0 B;  1B07 A;  3VUZ A;  4A54 A;  4FSS A;  1VQ8 Q;  4M75 D;  2DTO A;  1VQO T;  2MPX C;  2EAY A;  3LWH A;  4C8Q C;  3H0F A;  4A4G A;  5GMK i;  2YRC A;  1QLY A;  1VIF A;  4M75 G;  5LJ5 g;  2XDD A;  5CK9 A;  2CP7 A;  2VB6 A;  5M9O A;  2COY A;  2K5F A;  2FYK A;  3JCM X;  1PG5 B;  2HKQ B;  2KYB A;  5AT1 B;  2DIQ A;  3CCQ T;  5L23 A;  5CQY A;  1RAF B;  4LXC A;  4RTZ A;  3PFS A;  1SHG A;  3QG1 A;  1Y96 A;  2XD0 A;  4QVC A;  4K11 A;  2DL8 A;  2PTK A;  5KYX B;  1NG2 A;  4A4F A;  4XQ3 A;  2RQW A;  1CKB A;  3INZ A;  1W2B A;  2L3S A;  4BDY A;  2E5K A;  3OMG A;  3S3O A;  1MMG A;  4J8O A;  5FRO A;  4IUR A;  2ZPF B;  3MP1 A;  2OAW A;  3CC4 A;  1JXO A;  2RD1 A;  2DNU A;  2DPP B;  1M1G A;  2V8K A;  2EBP A;  4N4I A;  1KC8 C;  4PJO C;  3MEU A;  5A0D A;  3GPL A;  2OTJ A;  4R55 A;  3CCJ A;  2O31 A;  4PJO B;  2DL7 A;  1OEB A;  4ATO A;  4FYW B;  4ME7 A;  2M0O A;  4HKE A;  3CCV A;  3RUX A;  4KUI A;  4QVZ A;  4OMQ A;  3UF4 A;  2R58 A;  1I4K 1;  2P0P A;  2AZS A;  2QAZ A;  1M1K C;  2YT6 A;  1E6G A;  4C92 B;  1PHT A;  1NPP A;  2XIC A;  1PKT A;  1M27 C;  4BDZ A;  5GAN 6;  2PU9 B;  2D6F A;  1YN8 A;  2D0N A;  5CR2 A;  1Q7Y C;  2RB6 A;  1I0C A;  1VUB A;  2LQK A;  3RES A;  3L2Q A;  3KFV A;  2DEU A;  2XDP A;  3RDV A;  4AG2 C;  2EQI A;  4YTL A;  3X24 B;  3QYH B;  4HXJ A;  2QYZ A;  4C5E A;  1VQ4 T;  2R57 A;  3A98 A;  2HL3 A;  3VYH B;  1UEB A;  1KQS P;  4FU6 A;  1KK7 A;  1YJ9 A;  1Z9Z A;  2HL5 C;  4E7S A;  2D8J A;  4XTU A;  1GBR A;  1KQS A;  3QUI A;  1D0Z A;  5CKD A;  3V7R A;  3OBY A;  2CH4 A;  2XHC A;  4EPC A;  3CCE Q;  2DBM A;  2CZ0 B;  2RJC A;  5GMK m;  3V7C A;  1VQN T;  4J5Y A;  4JZ3 A;  1IHV A;  4ZTF A;  4OB3 B;  3M4G A;  4M7D F;  2IPO B;  1X6O A;  1FYN A;  2EKH A;  2BE7 D;  2JM8 A;  4ZNX A;  4E7L A;  4FW1 A;  1TG0 A;  1G5V A;  3CPW P;  4M7A D;  2HSP A;  2KVQ G;  3CMA T;  3LGF A;  4F7U E;  1YWO A;  2XMF A;  3CPW A;  1SRL A;  2HSE B;  3HTR A;  2VKN A;  4MMK A;  5FWC A;  2KYM A;  1UG1 A;  3CCR A;  4M7A G;  4M77 E;  2YRD A;  1PD1 A;  3QYG B;  2YRV A;  3I55 A;  4LD9 K;  4J9G A;  5IN1 A;  3EGX A;  1JQQ A;  1V1C A;  3CC7 T;  1YI2 T;  4E2F B;  1HXD A;  4ZGE B;  1H64 1;  4M75 B;  2JOY A;  2J05 A;  2DIL A;  3VUB A;  3LYI A;  3MJX A;  5C6S A;  4C8Q F;  3NHN A;  4M78 D;  1K73 R;  3DLL A;  1VQ7 A;  3VRY A;  2KAF A;  2KT8 A;  2QGG A;  3EGD A;  1ZA2 B;  2BZ8 A;  1NZ9 A;  4DBR A;  2C0I A;  3LH5 A;  2L3R A;  3CCS A;  3CCL A;  3QWY A;  2KXD A;  1VQ5 Q;  4N4H A;  3CD6 Q;  1VA7 A;  2M0Y A;  2X4X A;  2P4T A;  2EGC A;  4LUD A;  1I07 A;  4KH1 B;  3REB B;  1AOJ A;  2KRO A;  4HT9 A;  4OMM A;  4DEY A;  4EMK C;  2JMC A;  3HRT A;  2A08 A;  3SWN A;  3G6E T;  2CP0 A;  4KRT A;  2JTM A;  4OMO A;  1JJ2 P;  4QQ6 A;  3L42 A;  3V8L A;  1UGS B;  2P4R A;  2CZ7 B;  1JJ2 A;  4PJO F;  5GAN 4;  3JB9 G;  1AZG B;  5HCK A;  5IXF A;  3F70 A;  1TUD A;  1IHW A;  3S6W A;  5KYN A;  2O9S A;  1MUZ A;  4ZGD B;  1M3A A;  2KNB B;  4NL3 A;  2X4W A;  1FXX A;  2DTI A;  2CP2 A;  1AZE A;  2CT4 A;  3PTA A;  1MGQ A;  4IUU A;  4DBQ A;  1K73 U;  2EQJ A;  4QQG A;  3BW1 A;  1IGQ A;  1VQK T;  4IUP A;  3J7A F;  1WHJ A;  2DD4 A;  3G4S T;  2K6D A;  2DEQ A;  3LGL A;  3AT1 B;  2LT1 A;  3O5Z A;  3GNF B;  3OYB A;  1SSF A;  2DIG A;  5IHK A;  1M1F A;  3OYN A;  1MMD A;  2GNC A;  1ZSZ C;  4KGV B;  1X2K A;  2DXT A;  4M7D D;  1I5L A;  2EFI A;  1ZSZ B;  4DA4 A;  5FWB A;  3Q1J A;  4UC4 A;  4JJN K;  3CCQ Q;  2C0T A;  1U06 A;  4J7F A;  1XJW B;  3EFO B;  1Q7Y R;  1VQ6 T;  3VS0 A;  2HMA A;  3FEO A;  4L6V 5;  2XK0 A;  4ESR A;  2RQV A;  1ZA1 B;  4RTT A;  3BDL A;  3X26 B;  4QW2 A;  1R77 A;  2ENM A;  3DB4 A;  1WJQ A;  5ECA A;  3OYF A;  5J26 A;  3DKM A;  1JU5 C;  2DRK A;  4M7A B;  4MZT A;  1JEG A;  1MNE A;  2GFU A;  2F1L A;  4B9X A;  4FIB A;  3EG2 A;  2KSS A;  2MMP A;  5KYW A;  2RQR A;  3SB2 A;  1PSF A;  1TUG B;  2DL5 A;  4KUL A;  1S72 T;  2VGM A;  4BB7 A;  2DVE A;  2ZCF B;  1KC8 U;  1K0S A;  2CUB A;  2AK5 A;  2O4X B;  2V8I A;  4HVU A;  2RK1 A;  3CCM A;  3NGP A;  2E64 A;  2PUO B;  2YSQ A;  3E2U A;  3LH0 A;  8ATC B;  2H8H A;  1Q95 G;  2RHY A;  2EKO A;  4PJM A;  4BAC A;  4IUV A;  2E5Q A;  4M75 F;  5D7U A;  3JCM d;  2LX9 A;  2LCC A;  3VS6 A;  4M78 C;  3A1P A;  4FT4 A;  2D8H A;  5LJ3 j;  3I56 A;  3CC2 T;  4M78 B;  2EGA A;  2DKG A;  2IVW A;  1PCX A;  2HDA A;  3HFN A;  2O9V A;  3EH1 A;  3NTK A;  1R0B G;  1Q7Y U;  1U8R A;  3HL8 A;  1LCK A;  1YIJ A;  4J6Y A;  1VYT A;  1VQL T;  4RG2 A;  1HYO A;  3OYH A;  1VQ4 Q;  4GBQ A;  2F5K A;  3AHU A;  2ZPG B;  2O2O A;  4FL6 A;  5J39 A;  2QA4 T;  4HVW A;  4JRK A;  2VUB A;  3MEV A;  1BBZ A;  3QZ9 B;  3A8G B;  1YJN A;  1AVZ C;  3FDR A;  4N0A C;  2OTL T;  2OJ2 A;  4C0D C;  4XK8 E;  1VQN Q;  3T9N A;  1UJY A;  1AEY A;  2M51 A;  4C0D B;  2RM4 A;  4KT0 E;  4X1V A;  1YIT A;  4RTU A;  2JZ2 A;  1KIK A;  4C92 D;  3CMA Q;  2E3H A;  1K9M C;  1RAA B;  1VQ8 A;  2MIO A;  3CCV T;  4F7U A;  1QVF P;  3JCM g;  3JCM W;  3OYJ A;  1QVF A;  1QWE A;  3PVL A;  4D6W A;  3EGD B;  2JW4 A;  1PRL C;  1WHK A;  4ZGJ B;  1BIA A;  1H3H A;  2FL7 A;  1BKB A;  5GAN g;  3QSU A;  2IIM A;  2FPE A;  2QI2 A;  1UEC A;  2ZPI B;  3H41 A;  4DBH A;  4QKU A;  5FU6 C;  2EYZ A;  3CC7 Q;  2RO0 A;  1NE8 A;  2HZY A;  2MWO A;  1YI2 Q;  2NLU A;  2JS2 A;  1SPK A;  3QO3 A;  1R0C B;  4XAX B;  3LLR A;  1RAC B;  2BZY A;  2LDM A;  3CME T;  2A3L A;  5LJ5 d;  3OYI A;  5HK3 A;  3M55 A;  3CXC S;  2CKK A;  2DJQ A;  3OSS C;  4E7K A;  4EMG A;  4M7D C;  1IXD A;  3BE3 A;  2AT1 B;  3C4S A;  3HFO A;  1CSK A;  2D9T A;  2X9H A;  2BUD A;  2LQN A;  3QPH A;  3QJ6 A;  2CSI A;  2M9U A;  1WJS A;  4AMC A;  2EYX A;  3FJ5 A;  3O8V A;  2X4Y A;  1VQP T;  2L0A A;  3PE0 A;  4JUV A;  1RAD B;  3OYA A;  2KT1 A;  3UA6 A;  4J9F A;  3GOX A;  4M77 D;  1T3S A;  2G6F X;  4F7U G;  1SHF A;  3M53 A;  2G3R A;  4M7A F;  2YDL A;  5KCO A;  1N6A A;  2X3W D;  1M2O A;  1V29 B;  4M77 G;  3OYE A;  3G6E Q;  3ZFJ A;  2RNA A;  2A7Y A;  5IH2 A;  3OW2 S;  2KR3 A;  3TSW A;  3CCR T;  2FPF A;  1G3T A;  2NUT B;  1P92 A;  2OAU A;  4A4E A;  2XDB A;  3S3M A;  3QZ5 B;  2M1H A;  5L8R E;  4AFQ C;  2K3X A;  5GAO q;  2KBT A;  2E1H A;  4LDV A;  2EQK A;  1FMK A;  4OMP A;  2EYQ A;  4O6J A;  1E6H A;  3RBB B;  4J6X A;  3HRU A;  2PUK B;  1N9S A;  2Y4X A;  4N4G A;  1ZHI A;  3NPF A;  2LQ8 A;  1G3W A;  1WYX A;  1M90 C;  1S1N A;  1N8R R;  4TVR A;  1KHC A;  2CSQ A;  1OPK A;  2AKL A;  1VQK Q;  3PT9 A;  4M78 F;  3CCE A;  2CP5 A;  4ORZ A;  3NMZ C;  1CKA A;  4C8Q E;  2DTH A;  1W2B P;  2VXE A;  3FJP A;  3EG0 A;  2K3Y A;  4FT2 A;  5A0L A;  2KRS A;  2BIV A;  2RQU A;  1NLO C;  5D6Y A;  2K5I A;  3GIB A;  3M56 A;  2CGH A;  3HKS A;  2DL3 A;  5KYW B;  2QG9 B;  2M16 A;  2JVV A;  1D1C A;  4ZN1 A;  3FB9 A;  3H0H A;  2GQI A;  2RH2 A;  1X01 A;  1BI0 A;  1WIE A;  1VQ6 Q;  3UAT A;  2GGR A;  1X2Q A;  1JO8 A;  3CEY A;  5I11 A;  2A0F B;  4L59 A;  2LJ1 A;  5GMK h;  3VS2 A;  3RKX A;  2IG0 A;  2X4J A;  4XTW A;  3JB9 F;  2DVJ A;  4C92 C;  2JT4 A;  5GAO r;  1QP3 A;  4ANJ A;  2J6F A;  3VS7 A;  1M3C A;  5C0M A;  4PJO E;  1NEG A;  1WXT A;  5FU7 B;  5CQX A;  5IT9 E;  2L2P A;  1S72 Q;  1D3B B;  3QDR B;  4BY6 B;  1N8R U;  1IZ6 A;  4PK4 A;  2C06 A;  1XQH A;  1W1F A;  1MND A;  3N5B B;  3GF5 A;  4XU1 A;  4OP0 A;  1MHN A;  3I5S A;  1U1T A;  1GFC A;  5LJ3 h;  4KGX B;  2KMT A;  5I22 A;  1XNI A;  1VQ5 A;  3CD6 A;  5DLO A;  2I2L A;  3C95 A;  4B6M A;  4Z8A A;  1VYV A;  1WHG A;  3L2W A;  3QBY A;  1BB9 A;  2DA9 A;  5HKC A;  1GL5 A;  2YUN A;  2WSE E;  3CPF A;  5KYY A;  3CC2 Q;  1RAG B;  4E7Z A;  1T3L A;  1PNJ A;  2CP6 A;  1Q86 R;  2CH4 W;  1AWO A;  1UHC A;  4HVV A;  1U5S A;  1UTI A;  1IB8 A;  5A0G A;  1VQL Q;  4BD3 A;  4PFO A;  1OPL A;  2Z0W A;  2DYI A;  4F7U B;  1M30 A;  3ZBD A;  4E47 A;  2QK0 A;  2LC4 A;  1EFN A;  2QA4 Q;  2QEX T;  3G71 T;  4NOY A;  4M77 B;  3HHT B;  2NUP A;  4RUG A;  4HCC A;  2OTL Q;  3BY7 A;  4CC3 A;  1VQ9 T;  1K8A C;  3GBQ A; 
#chains in the Genus database with same CATH homology
 4O5V A;  2CZ6 B;  2DXT A;  1VQL A;  4CRI A;  3CBO A;  1IRE B;  2ZPB B;  3A5Z B;  3CBM A;  3EFS A;  3FLG A;  5EG2 A;  3CCL T;  3CCS T;  1I5L A;  4M7D D;  2EFI A;  5I2M A;  2HNI A;  4DA4 A;  3Q1J A;  4UC4 A;  3VV0 A;  1N27 A;  3QII A;  3NTI A;  4M75 C;  4NL2 A;  3OYY A;  3RKW A;  4JJN K;  2QDY B;  1LJO A;  4J7F A;  1VQ6 T;  2KY9 A;  2HBP A;  3X28 B;  4LDW A;  2QA4 A;  5FLX E;  4JS5 A;  3V8J A;  1YJW T;  3JSC A;  1W4S A;  3CCM T;  4C92 G;  2E6Z A;  4IUT A;  3FEO A;  4L6V 5;  4PKC C;  4M77 A;  1GXI E;  2XK0 A;  1Y7X A;  3G7Z A;  2MI6 A;  3QHS A;  1UGR B;  3G4S A;  3OS0 A;  1NJI U;  3MEA A;  1K9M U;  2OTL A;  3BDL A;  1G3Y A;  3WVE B;  4QW2 A;  4IUQ A;  3X26 B;  4BI8 B;  3A8L B;  3DB4 A;  1OZ2 A;  1WJQ A;  3OSV A;  3SWN C;  5CKE A;  3JCM c;  1B34 A;  5LJ5 h;  5J26 A;  3OYF A;  1JBM A;  2K57 A;  1VQM T;  1Q81 C;  1Q86 C;  3DKM A;  4M7A B;  2L5Q A;  4DOV A;  3V7S A;  3NTH A;  2RHI A;  1BI3 A;  4MZT A;  2GFU A;  1X75 C;  5LJ3 g;  1OYX A;  4WF2 A;  1KG1 A;  4B9X A;  1VQ5 T;  3CD6 T;  4FIB A;  2KSS A;  2MMP A;  1YHQ T;  3CCQ A;  2EJG A;  3MO8 A;  3SB2 A;  5FU7 C;  4JLI A;  5FU6 B;  1PSF A;  2KK4 A;  3I56 T;  4HCB A;  4KUL A;  1Q86 U;  1S72 T;  2VGM A;  1N9R A;  4BB7 A;  4BE0 A;  2DVE A;  2ZCF B;  2MF2 A;  4JLG A;  1KC8 U;  4KBM B;  3DLM A;  3QKJ A;  4LDY A;  2K4Y A;  3JCM h;  3L2U A;  3OQ5 A;  3R6O A;  5DLQ E;  3FC3 A;  1PSE A;  2O4X B;  4BY6 C;  5GAM h;  2V8I A;  4RMO A;  1YIJ T;  2RK1 A;  1FX7 A;  3M5A A;  3ME9 A;  1QVG A;  1JJ2 S;  3CCM A;  1BI1 A;  2JN0 A;  5FRM A;  3E9G A;  2E64 A;  1HK9 A;  2PUO B;  4ZN3 A;  1QVP A;  4V2S A;  3OA6 A;  4XU0 A;  3TRE A;  4M7D B;  1JRI A;  3LH0 A;  2GFA A;  3UWN A;  5LJ5 e;  5GAN h;  4XU2 A;  4OVA A;  4A4H A;  4C92 E;  2RHY A;  4M7A A;  4Y91 A;  3JAM E;  2EKO A;  1VQM A;  4RKU E;  3RMQ A;  4BAC A;  4IUV A;  2E5Q A;  3JB9 D;  2E6N A;  4Y28 E;  2F5T X;  4M75 F;  3SDZ A;  1WGS A;  5LL6 S;  3JCM d;  3C12 A;  2LX9 A;  2LCC A;  3OYM A;  2P0K A;  3MHX A;  3CXC A;  4M78 C;  3CCU A;  4ELY C;  2L8D A;  4HT8 A;  4FT4 A;  3CBP A;  4OGC A;  2EIF A;  5LJ3 j;  3I56 A;  3CC2 T;  1H3Z A;  4M78 B;  4XTZ A;  2DKG A;  2WSF E;  2IVW A;  3JCM e;  2H3J A;  2MAM A;  4P5N A;  2HQX A;  3PIO A;  2O4X A;  3HFN A;  5GAM e;  3CME A;  3P8D A;  4PNO A;  3OY9 A;  1K73 C;  2QTX A;  3NTK A;  3JCM J;  1YIT T;  1Q7Y U;  1LOJ A;  1U8R A;  1KQ2 A;  3HL8 A;  1YIJ A;  4J6Y A;  3OB9 A;  1VQL T;  4RG2 A;  3MP6 A;  5HK0 A;  2DXC A;  3OYH A;  4ZTJ A;  2QQA A;  3A8M B;  4X9D A;  5GAN e;  3LWI A;  2F5K A;  4C92 F;  3AHU A;  2RHX A;  3WVD B;  1BI2 A;  2ZPG B;  4FL6 A;  5LJ3 f;  5GAO n;  1VQ8 T;  3PNW C;  1YCY A;  3A8O B;  5CIU A;  4QQD A;  1OI1 A;  2ZPE B;  5J39 A;  3HSB A;  3WXM B;  2QA4 T;  2XG8 D;  4JRK A;  3BFM A;  3VUZ A;  4BI4 A;  1VQP A;  2FHD A;  3OS5 A;  4A54 A;  3OYC A;  1Q82 C;  3OBW A;  2FB7 A;  2VUB A;  2DTO A;  4M75 D;  1Y96 B;  4BUG A;  1VQO T;  3MEV A;  4M77 C;  3QZ9 B;  2EAY A;  3A8G B;  3LWH A;  4C8Q C;  5CCA A;  3JCM V;  1YJN A;  5GAO m;  2QXF A;  2RI3 A;  1QP2 A;  2VYT A;  4M78 A;  4RCB A;  4C5H A;  3S3N A;  3RER A;  1XOV A;  2BKD N;  3FDR A;  4N0A C;  1WJR A;  4JS4 A;  2OTL T;  3FRN A;  2HAX A;  4A4G A;  5GMK i;  3JCM b;  1RI0 A;  4C0D C;  4E7H A;  2L89 A;  1VIF A;  4XK8 E;  4M75 G;  3EAE A;  5LJ5 g;  2XDD A;  5CK9 A;  1QVF S;  3T9N A;  4LD6 A;  2RHZ A;  4J7I A;  1VQ4 A;  4C0D B;  5M9O A;  3QJY A;  2RM4 A;  4KT0 E;  3M57 A;  1AHJ B;  2K5F A;  3JRZ A;  2FYK A;  4ELZ C;  3JCM X;  1YIT A;  2EWN A;  4E7I A;  2JZ2 A;  3CCQ T;  2DIQ A;  2E10 A;  3P8H A;  5CQY A;  4C92 D;  4Z02 A;  3RKY A;  1NJI C;  1K9M C;  1UB4 A;  3PFS A;  1VQ8 A;  3CCV T;  4F7U A;  4PLI A;  5J3B A;  3QG1 A;  1Y96 A;  3JCM g;  2XD0 A;  4QVC A;  3JCM W;  3OYJ A;  2VV5 A;  1QVF A;  5A2Q E;  3C94 A;  1M90 U;  4A4F A;  4XQ3 A;  5CKH A;  1VQO A;  3INZ A;  1W2B A;  4D6W A;  4BDY A;  4C8Q A;  3OMG A;  2DZ9 A;  3H8Z A;  2DD5 A;  3MP8 A;  4J8O A;  3S3O A;  5FRO A;  1VQN A;  4IUR A;  4ZGJ B;  2XKO C;  1BIA A;  3LW5 E;  4N0A A;  2FL7 A;  1BKB A;  2ZPF B;  3MP1 A;  5GAN g;  5GAN 2;  3QSU A;  4M7A C;  4OB0 B;  3CC4 A;  2QQ9 A;  2RD1 A;  3H6Z A;  2QI2 A;  5CKF A;  5D6W A;  2DPP B;  3OYD A;  2ZPI B;  1M1G A;  2V8K A;  3PGG A;  4N4I A;  1QVG S;  1KC8 C;  4C0F A;  1KD1 U;  4MDX A;  4PJO C;  3MEU A;  5A0D A;  5GMK j;  4JRP A;  4MZM A;  3GNG A;  5FU6 C;  3GPL A;  3CMA A;  1VIE A;  4JDS A;  4M75 E;  1M8V A;  4R55 A;  3P8B B;  4MML A;  2RO0 A;  2OTJ A;  1NE8 A;  3CCJ A;  3CCU T;  2MWO A;  5DM7 R;  2NLU A;  4PJO B;  3MET A;  4ATO A;  2RI2 A;  5KH6 A;  3QO3 A;  2E41 A;  4M77 F;  4ME7 A;  2DXU A;  4XAX B;  3LLR A;  3CME T;  2LDM A;  2M0O A;  4HKE A;  4QVD A;  3RUX A;  3CCV A;  2A3L A;  2R5A A;  3VU3 C;  4KUI A;  5LJ5 d;  2GF7 A;  4JRI A;  3TCJ A;  5HK3 A;  3OYI A;  3M55 A;  3CXC S;  1O75 A;  4QVZ A;  2CKK A;  5GAO p;  2LNV A;  1JB0 E;  3OSS C;  4EMG A;  5LJ5 f;  4E7K A;  4M7D C;  2R58 A;  1I4K 1;  2LCL A;  2P0P A;  3KBG A;  5CO7 A;  3C4S A;  3HFO A;  1M1K C;  2D9T A;  4M78 G;  4OGE A;  2BUD A;  2V8J A;  3MCA B;  3QPH A;  5D6X A;  3KXT A;  3QJ6 A;  2M9U A;  2PVD B;  1WJS A;  4C92 B;  2LVM A;  4FSX A;  1NPP A;  2XIC A;  2WAC A;  4LDU A;  4BDZ A;  3M9Q A;  3O8V A;  3UPU A;  5GAN 6;  4OF1 A;  2PU9 B;  2X4Y A;  4X34 A;  3CC7 A;  1VQP T;  2D6F A;  1YI2 A;  4JUV A;  1M1K U;  4PJO A;  4XTY A;  1YJN T;  4JRQ A;  5GAM d;  1KQS S;  4OMF B;  5CR2 A;  1Q7Y C;  3JCM f;  3X25 B;  2RB6 A;  3URG A;  1VUB A;  3RES A;  2LQK A;  2LRQ A;  3OYA A;  3L2Q A;  5GAM f;  2XDP A;  5GAO l;  2DO3 A;  2K2V A;  1TH7 A;  2EJ9 A;  3GOX A;  4M77 D;  4YTL A;  3X24 B;  1Y71 A;  3HRS A;  3QYH B;  2E65 A;  3UDC A;  5GAN d;  2QQB A;  4F7U G;  4C5E A;  3GLX A;  1VQ4 T;  4EMK B;  2R57 A;  3M53 A;  1WPY A;  2XI9 A;  5GAN f;  2G3R A;  4M7A F;  3TU4 K;  4IKF A;  3GP8 A;  1QW1 A;  4OB2 B;  1N6A A;  3TEE A;  5KCO A;  1KHI A;  1YBY A;  1UEB A;  3ER0 A;  4FU6 A;  3VYH B;  4CI0 C;  1V29 B;  1YJ9 A;  4M7D A;  4M77 G;  3OYE A;  3ZFJ A;  4C8Q G;  3PIP A;  2A7Y A;  2PVG B;  4XTU A;  1KQS A;  2B8A A;  4EDU A;  3OW2 S;  1FWZ A;  3CCR T;  3QUI A;  5CKD A;  3V7R A;  4A4K A;  3OBY A;  3PMT A;  1G3T A;  3RMS A;  4FM4 B;  1P92 A;  4LDX A;  2OAU A;  4M78 E;  4A4E A;  2XDB A;  2LT4 A;  2MWP A;  2XHC A;  2JTF A;  4HA8 A;  3QZ5 B;  4C0Z A;  4EPC A;  3S3M A;  2CZ0 B;  3VYG A;  3E19 A;  2RJC A;  2RJF A;  2M1H A;  1RL2 A;  5I2S A;  5GMK m;  5L8R E;  3V7C A;  2K3X A;  5GAO q;  1KQ1 A;  2DK3 A;  3J81 E;  4J5Y A;  1VQN T;  2O01 E;  2E1H A;  2DXB A;  4LDV A;  4ZTF A;  2RI5 A;  2EQK A;  3M4G A;  4OB3 B;  4M7D F;  1X6O A;  4KUD K;  3CC4 T;  1WQ7 A;  1I8F A;  4MZP A;  3OW2 A;  2KQW A;  2EYQ A;  4O6J A;  4E7L A;  1ZBX A;  4J6X A;  3HRU A;  3JB9 H;  1G5V A;  2VXF A;  3G6E A;  4E7J A;  1W2B S;  2PUK B;  4M7A D;  1N9S A;  2KVQ G;  2Y4X A;  4N4G A;  1ZHI A;  3VJP A;  3CMA T;  2LQ8 A;  2PQW A;  1M5Q 1;  3HPW A;  3LGF A;  2OTJ T;  2ZGW A;  1G3W A;  4J83 A;  4F7U E;  3CCJ T;  1M90 C;  2DZC A;  3CPW A;  4TVR A;  5I21 A;  4XU3 A;  1KHC A;  4MMK A;  3J80 E;  3CCR A;  4M7A G;  3PT9 A;  4M78 F;  3CCE A;  4M77 E;  2ZPH B;  4C5G A;  2RHU A;  4C8Q E;  2DTH A;  2VXE A;  3FJP A;  2K3Y A;  5GAM g;  3QYG B;  2YRV A;  4FT2 A;  4PJO G;  5A0L A;  2JNG A;  1KD1 C;  3I55 A;  4LD9 K;  2BIV A;  2YLB A;  3OS1 A;  5CKB A;  3SD4 A;  5D6Y A;  4B9W A;  2K5I A;  3OYG A;  3GIB A;  3M56 A;  5IN1 A;  3KUF A;  2CGH A;  3HP9 A;  3HKS A;  4GLK A;  2F69 A;  2QQR A;  3L1A A;  3L2Z A;  3OS2 A;  3FIF A;  3CC7 T;  2M16 A;  2DJZ A;  2E12 A;  2JVV A;  4ZN1 A;  1YI2 T;  2XID A;  3FB9 A;  1HXD A;  4ZGE B;  4MDW A;  1K8A U;  2CS7 A;  4F7U F;  5LJ5 j;  1H64 1;  4M75 B;  5KE2 A;  4M7D G;  2CZ1 B;  2JOY A;  1EIF A;  1X01 A;  2RH2 A;  3OMC A;  1VQK A;  1BI0 A;  4R56 A;  3M54 A;  5CVI A;  2RJE A;  3VUB A;  3LYI A;  2QEX A;  3G71 A;  4A53 A;  5C6S A;  4C8Q F;  3DB3 A;  5GAN 5;  4M78 D;  1G3S A;  3CEY A;  4L59 A;  3DLL A;  1VQ7 A;  1LNX A;  4DQ2 A;  2KAF A;  5KE3 A;  3BDU A;  5GMK h;  1ZQ1 A;  3RKX A;  2IG0 A;  2X4J A;  3M59 A;  4XTW A;  5AYF A;  3L2R A;  3JB9 I;  3JB9 F;  3SWN B;  4M7A E;  4RG8 A;  2RA2 A;  1YJ9 T;  4C92 C;  3VKI A;  1VQ9 A;  5GAO r;  1QP3 A;  4XTX A;  4J6W A;  1NZ9 A;  2EJF A;  5IAY A;  5GAM j;  3MEW A;  2L3R A;  2GQV A;  3CCS A;  3CCL A;  3OYK A;  3OYL A;  5C0M A;  1Y07 A;  4PJO E;  4BE1 A;  1N8R C;  1Q81 U;  4N4H A;  4C0G A;  1NPR A;  4M75 A;  5GAN j;  5FU7 B;  2ZZD A;  5CQX A;  2X4X A;  4VUB A;  5GAN 3;  5IT9 E;  4NS5 A;  2FVU A;  2P4T A;  2YHT A;  1VQ6 A;  4II1 A;  4PLL A;  1YJW A;  3LX7 A;  4L5G A;  5CAI A;  5GMK l;  1D3B B;  3QDR B;  3UT1 A;  4HT9 A;  4BY6 B;  1N8R U;  1IZ6 A;  2GCX A;  4EMK C;  1M4Z A;  2Y90 A;  2C06 A;  1WNL A;  1XQH A;  4M7D E;  3HRT A;  4C8Q D;  2D0Q B;  5GMK e;  5GAN 7;  2PVO B;  4PL6 A;  2P0Q A;  4GY5 A;  2EQU A;  3QXE B;  3N5B B;  3SWN A;  3G6E T;  3GF5 A;  4XU1 A;  4C5I A;  3E1S A;  2JTM A;  4OP0 A;  1UGP B;  4QQ6 A;  1MHN A;  4C92 A;  1U1T A;  2E70 A;  2AHJ B;  3L42 A;  1UGS B;  5LJ3 h;  3V8L A;  2KMT A;  2CZ7 B;  3NFC A;  1XNI A;  1JJ2 A;  4PJO F;  1VQ5 A;  5DLO A;  3CD6 A;  2I2L A;  3C95 A;  1YHQ A;  1M9S A;  2EQM A;  3CCE T;  3SFM A;  3A8H B;  3QBY A;  3L2W A;  5HKC A;  5GAN 4;  3JB9 G;  1S72 A;  3F70 A;  1I81 A;  4RCC A;  2WSE E;  4BI3 A;  2YLC A;  4X9C A;  3S6W A;  3CPF A;  2VGN A;  4ZGD B;  3CPW S;  2DAQ A;  1D3B A;  4DOW A;  3I55 T;  4NL3 A;  2X4W A;  1U1S A;  2QQS A;  1FXX A;  3PMI A;  5LJ3 d;  3JB9 J;  2HD0 A;  2DTI A;  2K5L A;  4EMK A;  1XTD A;  5KCH A;  5FRN A;  1R8O B;  4HCZ A;  3ZEH A;  5A0G A;  1BIB A;  4BD3 A;  3JCM Q;  3PTA A;  1MGQ A;  1UGQ B;  4IUU A;  3L2V A;  2X35 A;  1K73 U;  2EQJ A;  2LTO A;  2KDS A;  2RK2 A;  2R5M A;  4QQG A;  3BW1 A;  5LJ3 e;  4F7U B;  4BE2 A;  3ZBD A;  3E9F A;  2VC8 A;  1VQK T;  4E47 A;  2LC4 A;  2RJD A;  2XU8 A;  1BYM A;  3EFR A;  4IUP A;  2CYZ B;  1O9S A;  3V8K A;  2DD4 A;  3J7A F;  3G4S T;  4Q5W A;  3G71 T;  2QEX T;  3RIR A;  4PJO D;  3M58 A;  4NOY A;  4M77 B;  1WQW A;  1OZ3 A;  5GAN 8;  3X20 B;  3HHT B;  4C8Q B;  2Y4Y A;  2DEQ A;  3LGL A;  3CC2 A;  2HQE A;  2JUF A;  1VQ7 T;  2WSC E;  2LT1 A;  3M4Y A;  4HCC A;  1DJ7 B;  5HY6 A;  1Q82 U;  4OB1 B;  4EMH A;  3ASK A;  3GNF B;  4XTV A;  1B34 B;  3BY7 A;  3OYB A;  1SSF A;  3JCM P;  5DY9 A;  1VQ9 T;  2DIG A;  1K8A C;  1M1F A;  3OYN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...