3JCMQ

Cryo-em structure of the spliceosomal u4/u6.u5 tri-snrnp
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
90
structure length
89
Chain Sequence
ELEEFEFKHGPMSLINDAMVTRTPVIISLRNNHKIIARVKAFDRHCNMVLENVKELWTEKKKNVINRERFISKLFLRGDSVIVVLKTPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pre-mRNA-splicing factor 8
publication title The 3.8 angstrom structure of the U4/U6.U5 tri-snRNP: Insights into spliceosome assembly and catalysis
pubmed doi rcsb
molecule tags Transcription
total genus 11
structure length 89
sequence length 90
chains with identical sequence U
ec nomenclature
pdb deposition date 2015-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3jcmQ00
2DXUA 4F7UA 3PGGA 4M77G 2DZ9A 3HFOA 2YLBA 4C92B 5LJ5d 5CAIA 3JCMb 4XTZA 1M5Q1 2EJGA 4M75B 3JB9J 5GAOm 4M7DD 2HNIA 4PJOG 5GAN4 4EMGA 4NL3A 3RKWA 4XTUA 4PJOF 1MGQA 3JB9D 4M78B 4EMKC 2E10A 1TH7A 1X01A 4XU3A 4RCCA 2DEQA 5GAOp 3GIBA 4M7AE 3V7RA 3V7CA 5GMKl 4M7AA 4C8QE 1U1SA 4HT8A 5LJ3e 3V8LA 3L2ZA 3VU3C 4A53A 4M77D 3JCMV 4M7DC 1N9SA 4C92E 1KQ2A 2RD1A 5GAMe 3QHSA 4JLIA 4M75E 1LJOA 1Y96A 3JCMf 5GANe 4M75A 5LJ5g 5GAMj 4M7DF 2CGHA 1WQ7A 4M78E 4PJOB 4M7DA 3SWNC 4HT9A 3INZA 3SB2A 3JB9F 4HA8A 2I2LA 4M77C 3JB9I 4JUVA 4QVCA 1BIBA 2DZCA 1WQWA 5LJ5j 1H641 1Y96B 3RUXA 3EFRA 2QTXA 4XTYA 4M77F 5GMKj 4J5YA 2VXEA 4M77A 1I8FA 5LJ3f 4M7DB 2FB7A 4PJOE 2VXFA 4X9DA 3RKXA 3V8KA 4PJOA 4PNOA 3RKYA 3RERA 2EAYA 4MMLA 5GANf 4XU0A 2E64A 2RM4A 5DY9A 3JCMW 4QVDA 1KQ1A 1HK9A 5LJ5e 4EMKA 4X9CA 4XTWA 4A54A 3V7SA 2DTHA 2K57A 4M77B 4XU1A 3BFMA 1JRIA 3RESA 5LJ3d 2EJ9A 2FYKA 2YHTA 1LOJA 3JCMg 4M7DE 3EFSA 1U1TA 3FB9A 4RCBA 4MMKA 5GAN2 5LJ5h 1WNLA 5GMKm 5GANd 5GMKh 2JN0A 3QSUA 4N0AC 2RA2A 3BW1A 4EMKB 1N9RA 5GMKi 1M8VA 4C8QG 3JCMd 3SWNA 4C92C 4M77E 3BDUA 5GAN8 4C92G 3BY7A 5GAOq 4J6YA 3HFNA 2DTIA 5LJ3g 3AHUA 4J6XA 5GAOr 5GAMf 3L1AA 4NL2A 5GAOn 5GAOl 2EJFA 4M78G 2VC8A 5GAN5 4M7AD 3HSBA 4PJOC 2Y90A 5GANg 3SWNB 4C8QD 5GAN3 4F7UG 5I21A 3JB9H 4XTVA 1HXDA 4J6WA 4XQ3A 4C92D 4F7UF 5GMKe 5LJ3j 2E41A 4M75D 3JCMQ 3JCMc 3QUIA 5GAMd 3RIRA 3JCMh 4M7AC 5GANj 4M78D 4JRIA 1LNXA 2RB6A 4XU2A 4C8QC 2DJZA 4M7AG 2DTOA 1I5LA 1B34A 4DQ2A 3JCMX 2ZGWA 4M7AF 2E1HA 1D3BB 4M75C 5GAN7 4C8QF 1I81A 1YCYA 2E65A 4Y91A 4F7UB 4C8QA 4M75G 2DVEA 4EMHA 1JBMA 4N0AA 3JCMP 4C92F 4M78C 4V2SA 4M75F 5LJ5f 4C92A 4M7DG 4PJOD 3FIFA 5GAMg 4NOYA 4XTXA 5LJ3h 4WF2A 2EWNA 1B34B 2YLCA 1I4K1 4JRKA 4M78F 3V8JA 3JB9G 1BIAA 3JCMe 3QO3A 4M7AB 2DXTA 4M78A 5GAMh 4OP0A 3FJPA 1WPYA 1D3BA 4C8QB 5GANh 5GAN6 2DKGA 4F7UE 3JCMJ 3M4GA
chains in the Genus database with same CATH superfamily
2YLBA 3JB9J 1JJ2S 4JJNK 1VQ7A 1K73C 4EMKC 2E10A 4XU3A 4ZNXA 4M7AE 1W6XA 1WJQA 1M90C 4DOVA 1YJWT 1NZ9A 2DL3A 1S72A 4CC3A 2EQIA 2Y4XA 2E5QA 4O6JA 2XIDA 2AZSA 3SB2A 2YSQA 3JV3A 1ZSZC 2L3QA 3RUXA 1VQLQ 4FT2A 1R8OB 1BCMA 1VQNT 2FB7A 3QDFA 4J9DA 2LQWA 2X35A 3LWIA 3G6ET 3SEMA 5LJ5e 1KHIA 1OV3A 2QAZA 1O75A 2QQSA 2HQXA 5GAN2 4LDVA 3FC3A 4ZGDB 2KT1A 4F04B 2JS2A 2M02A 2HQHA 2ROLA 1AHJB 1UHFA 2KGTA 3GNGA 5L23A 1NM7A 2VC8A 2DD5A 3EAEA 1GBQA 1PD0A 2WACA 1AWJA 1UHCA 1RLPC 3PVLA 3JCMQ 3KXTA 2DILA 3HPWA 3DB4A 2RHZA 2X3XD 4M78D 1LNXA 4CC7A 3REAB 3CCLA 2VWFA 1OPLA 4LDYA 3M0UA 8AT1B 2GFUA 4C0ZA 1PCXA 4CC4B 3FIFA 5LJ3h 4QKUA 2CZ6B 1UJ0A 5J3BA 1BI1A 3CPWA 3CC2T 1R0BG 3X24B 4J9CA 5GANh 2KNBB 2LT1A 4JS5A 1Q86U 2OTJQ 4F7UA 3L2VA 4BE2A 2IPOB 4M75B 3EGUA 3CC7T 3MJXA 3JB9D 3LH0A 3I35A 3CC4A 5GAOp 1M3CA 2DEQA 2J05A 3JAME 1M90R 4FW2A 8ATCB 2MK5A 4M77D 1LJOA 4AFUC 1MNDA 1Y7XA 2FZKB 2Y4YA 3QWXX 4M7DF 1D0ZA 2EKOA 2RQRA 1SRMA 1TUGB 2BIVA 1Q86C 3JB9I 4QVCA 1Y96B 1QW1A 2GCXA 2DEUA 4HCCA 2E3IA 3REBB 2KR3A 2D8JA 2WSEE 4AFQC 2RF0A 3A8GB 4ZN1A 1QVGA 3OYIA 3VS7A 2K4YA 1PWTA 1UECA 3CCUA 3CMAT 3VS0A 5GMKm 1Q82U 1PNJA 2XI9A 2EW3A 3CPWP 2H3JA 2ZCFB 4BE0A 4OB1B 1VQ4Q 1N8RR 3G7ZA 3PTAA 4C8QD 4J7FA 1TG0A 4KBMB 3EGXA 1UGRB 3CCEQ 1AVZC 3THKA 1Q82C 2KE9A 2DTOA 3L2RA 1PC0A 2CSIA 3BDLA 5J39A 3FEOA 1B34A 4E7SA 3OYGA 5IHIA 2E1HA 1YJ9A 2EYZA 3UDCA 3HRUA 1JBMA 3H9NA 4JJDA 2C0OA 2FPDA 1FXXA 5EC7A 1G5VA 2QQ9A 4AT1B 2JOYA 1ZLMA 3VUBA 3G71A 1BKBA 5IXBA 1IZ6A 1QCFA 1XNIA 4RTVA 6AT1B 5GAOm 2GQVA 4ZN3A 3RMSA 5KE2A 1XJWB 5CO7A 1OI1A 2OTLA 2VV5A 2XDPA 4M75E 2PVOB 2CZ1B 1Q81U 2JMAA 2AHJB 1NJIR 2I2LA 1Q86R 2A28A 1VYUA 3CCVA 4FCYA 2M51A 3MCAB 1QWEA 4C0DB 5KE3A 2RQWA 1YJWQ 4AG2C 2DD4A 3V8KA 2PZ1A 1VQ7T 2A7YA 2RM4A 1PG5B 4OB0B 3CCRA 1RI9A 2LVMA 3P8HA 2DIGA 5LJ3d 5HCKA 1S72T 3OYCA 1WZOA 1NYGA 5GANd 1HD3A 2FPEA 4BE1A 1KD1U 2XMFA 4PJMA 2VGNA 4N4IA 1K76A 5FW9A 4M4ZA 3JCMd 3QZ5B 4FT4A 3NMZC 2K79A 4FU6A 4A4FA 3G6EQ 5KCOA 2C06A 3QXEB 4Y28E 2PNIA 1PM3A 4L59A 1D09B 4C5GA 2BZ8A 2LDMA 4F7UF 2HCKA 2ESWA 1Z9ZA 3A8HB 1KD1C 2RNAA 2O4XA 4DBQA 3FLGA 1BK2A 3E1SA 2QA4A 1G3YA 4E7IA 5KYXB 4C92F 1OZ3A 2KRSA 2LC4A 2YXYA 2B86A 4HCZA 3TQ7P 1M30A 4PJOC 1HYOA 1TOVA 3VJPA 1FX7A 1ZA1B 3RKWA 3OW2A 2QXFA 5KYUA 2RHIA 2DRMA 3V7CA 1E7OA 1OEBA 4J9IA 4ZTJA 3CCLT 3CC2Q 3JCMV 3M5AA 2RD1A 3X20B 3NPFA 4X34A 1YJNQ 5HK3A 1BI0A 3CC7Q 1VQNA 1T0HA 4JZ3A 2CUBA 2VXEA 4M7DB 3UPUA 1QKXA 3UWNA 2E12A 7AT1B 1KC8U 2HL5C 4RTUA 1VQKA 2H3EB 1X43A 4DEXA 2C0IA 3CC4T 2O31A 2BUDA 1W2BA 3QBYA 2DPPB 3NTKA 1OPKA 1EZZB 2XD0A 2HZYA 2K2VA 3QSUA 3BW1A 3SWNA 3URGA 4KH0B 4JRQA 1YP5A 2DTIA 4JRPA 1RLQC 4BD3A 1M27C 3AT1B 3GF5A 4LDXA 2RK2A 2ED1A 3BE3A 3VRYA 3CMAQ 2KROA 1HXDA 4CRIA 1GFCA 1NG2A 3EHRA 3X25B 2P84A 1K8AR 2RB6A 3SD4A 5KCHA 1KD1R 4JJCA 2AZVA 3CCUT 4X1VA 1LVKA 2X3WD 2HDAA 3CCSQ 2L5QA 1KIKA 2VGMA 1R0CB 3A8MB 1I4K1 3SHWA 2DO3A 5GAMh 1G8XA 3FJPA 1W70A 5GAN6 2DKGA 3KFVA 5GAMj 1I07A 4XTZA 3VV0A 1X75C 2GFAA 1K0XA 2CREA 1ABOA 2EGEA 1G2BA 2K3YA 1W2BP 3CCJA 1Y07A 4A53A 2K2MA 1D1CA 1JQQA 3LX7A 1Y71A 1ABQA 2CGHA 2KK4A 1UE9A 1FYNA 2ZPHB 1H8KA 4E7JA 1X6BA 4RUGA 2M16A 1PHTA 3FDRA 1MNEA 4IUPA 3G71T 3E9GA 4D8KA 4PNOA 3N5BB 4BI8B 2DYBA 4XAXB 4EMKA 1YCSB 2LX9A 3META 4E2FB 2OTLT 4E7ZA 2EJ9A 2ED0A 4M7DE 1GBRA 3FB9A 4Z89A 2KBTA 2F2WA 2LNVA 2VKNA 1XQHA 2CUDA 2E3HA 1KG1A 1VQPA 1AD5A 1QWFA 1NLOC 2OI3A 4IURA 1M8VA 1X6OA 1VQ7Q 4D8DA 2XKOC 3CCVT 1GRIA 3ZFJA 1X27A 2RHYA 1KQSS 3AHUA 2F5KA 1WLPB 3NTHA 1KK7A 1KFZA 3HHTB 3EG9A 1S72Q 1UTIA 4TVRA 1IHWA 5GMKe 2BE9B 1BBZA 3CCRT 3MP6A 1YITA 2EGAA 1VIFA 1JJ2A 3RDVA 5A2QE 4DQ2A 4L5GA 1YBYA 2L89A 4C0DC 4F7UB 5CKDA 1X6GA 2DLPA 2YRCA 3OMGA 4PJOD 4D6WA 5GAMg 2VASA 4M78F 2RI2A 3JCMe 3QO3A 4BI4A 2FZGB 2VUBA 4C92B 2RJCA 5CR2A 2HNIA 5GAN4 1WXBA 3CXCS 3C4SA 4ESRA 3LH5A 4LUEA 1MMAA 1K9MU 2EBPA 2LCLA 2D6FA 3CMEA 3DLMA 3WVEB 1P92A 2GGRA 3JB9F 1IB8A 2WSFE 1RAAB 5AT1B 2L8DA 4M77F 4N4HA 1E6HA 1WHMA 2DBMA 3R6NA 3RERA 3MP1A 2OJ2A 2K5IA 2QQRA 1HK9A 1K9MC 4X9CA 1QVFS 1JJ2P 1LOJA 3M56A 1WFWA 2NUTA 3M0TA 4GLKA 4ZTFA 2R57A 5CK9A 2X4XA 2CP3A 4ELYC 3EGXB 3OYDA 2ABLA 2D8HA 2PUOB 2QGFB 1QVFP 5L8RE 1VQOT 5HY6A 3I56T 2BE7D 3M55A 1N8RU 4Z8AA 1T3SA 3M53A 3QJ6A 4EDUA 3L2QA 3PIOA 3M0PA 5GAN3 3UA6A 3CCMA 1VQKT 3RBBB 4ME7A 2O88A 4NS5A 1UGSB 3VS6A 4DOWA 1ZBJA 3ZBDA 3QUIA 1EX4A 4JJBA 5LL6S 4C5HA 3CBOA 5IXFA 1I5LA 3HTRA 4BB7A 4C8QF 1JB0E 1VQMA 2K5LA 4EMHA 1VQ9T 2DXBA 1N8RC 2QQBA 4BDZA 2LP5A 2MF2A 1PSEA 3VS2A 2EGCA 1WHHA 3HL8A 3DLLA 1M4ZA 4F7UE 1G83A 2DXCA 2JTMA 3CCUQ 4IIMA 4PJOG 2Z0WA 4FYYB 2RH2A 3EFOB 4FSXA 1IRXA 4NL3A 2HKNA 5GMKl 1N5ZA 1U1SA 2LMJA 4LNPA 3VU3C 4C92E 1KQ2A 1SKUB 2V1RA 4Z88A 4IUTA 1YN8A 4FIBA 1NJIU 1AEYA 1TU0B 3OQ5A 5GMKj 3GLXA 1SF9A 3CBPA 2DK3A 1YJ9Q 5I2MA 2EAYA 5DY9A 2CZ7B 3LLRA 1K9MR 4XTWA 4KGVB 3RESA 3BFMA 1JXMA 1NEBA 3CCJT 5FU7B 4BACA 3OYLA 4RCBA 4PFOA 3DKMA 1I1JA 1NJIC 3MEAA 2BTTA 4LE9A 3G71Q 2RA2A 2YUNA 4OB3B 3GBQA 2CP2A 3OBWA 1RADB 2O2OA 3TU4K 3OY9A 4HVWA 5GAMf 5GAOl 4R55A 2OTLQ 1RL2A 1H3ZA 4HKEA 4MDXA 3SDZA 2XDBA 2ZPBB 4M7AC 1BU1A 2K5FA 4JRIA 3CCVQ 1WHGA 3ZEHA 3EGDA 1NE8A 4OMPA 1U8RA 1VQPT 4FYXB 4OMOA 4Y92A 1BI2A 4KUDK 1N6AA 4LD9K 2CP0A 1M1FA 4E7KA 4PJNA 4QT7A 3NGPA 5FU6B 4E6RA 4JRKA 3CCRQ 3PIPA 1NEGA 3M4GA 3PFSA 3JCMb 3G4SA 5AYFA 3WXMB 1M5Q1 1RAGB 3H6ZA 3OYEA 2HSEB 2DIQA 4M78B 4AMCA 1YITT 3V7RA 3I55Q 3IQLA 2RJFA 3VS3A 4A4HA 1XOVA 3M54A 1KJWA 1SEMA 1PSFA 2JJ9A 1WXTA 5C0MA 5FRNA 2X4YA 2QDYB 2MYSA 2K6DA 3WVDB 1UJYA 2FEIA 5LJ5j 1M2OA 3OSSC 1T3LA 2RQTA 2VXFA 4X9DA 1M3AA 2EPDA 4PJOA 2JMCA 2QA4Q 4ZGJB 2LX7A 4GBQA 2FG0A 2DTHA 4M77B 1JRIA 3JCMg 4LDWA 2BKDN 1K0SA 2YUOA 1U1TA 4OMLA 2O9VA 3PNWC 2JN0A 3CMET 2KYMA 2KAFA 5GMKi 4C92C 2JM9A 2DF6A 1ZX6A 2ZAEA 1A0NB 2RMOA 2ZZDA 2MWOA 4OF1A 2JS0A 5FWCA 3ULRB 2QDLA 3LW5E 1ZUYA 3L2UA 5FROA 1PKSA 1GCPA 1C0MA 1G3WA 2A0FB 2NUZA 2RN8A 3MPUB 4PFZA 1K8AU 1VQNQ 1QP3A 4DA4A 1WDXA 2PVDB 2J6FA 4VUBA 2ZPFB 4HVUA 2ZGWA 1VQ4A 2HL3A 1VYVA 4JS4A 4Y91A 5IHKA 1AZGB 3H0IA 2G3RA 2YRVA 1Q7YU 1VIEA 1VQKQ 4NOYA 3FJ5A 1K1ZA 3V8JA 3J81E 1OX8A 2DXTA 1D3BA 4C8QB 4E7HA 3U23A 3CCMT 4ELZC 2DYIA 1SRLA 1H3HA 2XU8A 3CCQT 1K8AC 4B6MA 3FRNA 1MGQA 1WYXA 1X01A 3DB3A 4RCCA 2JZ2A 1V1CA 1CKBA 4HT8A 4A63B 1Q7YC 1YWPA 5A0DA 2KRMA 3KBGA 1Y96A 2RI3A 5LJ5g 1VQMT 1MMDA 4M78E 1GCQA 1OU8A 2HQEA 1M2VA 1JXOA 1ZUUA 3EFRA 1TUDA 1ZQ1A 4CC2A 4HCKA 1GFDA 2NUPA 2LQKA 1FMKA 1PKTA 3NHNA 2C0TA 2LZ6B 2PVGB 1ZSZB 3LYIA 2FZCB 4GLMA 4MMKA 3QYHB 1AWWA 3EG9B 4E47A 1VQOA 2RI5A 4M77E 5KYWA 3I56A 4QVZA 4FSSA 2RQUA 3QG1A 5CKFA 3TREA 2A3LA 4RG2A 1M1GA 2V8KA 3CCJQ 4M7AD 2HSPA 3UA7A 5CVIA 2RO0A 4J9FA 2LQ8A 2YUPA 2K3XA 2E5KA 4OB2B 3RIRA 2VVKA 5KH6A 1NYFA 1OX9A 2FL7A 3JCMX 1YWOA 2PQWA 5KYYA 4M75C 4RTWA 1VA7A 1VQ9A 1NLPC 2QTVA 1Y57A 1YHQA 4B9XA 1SHGA 4M7DG 2LCCA 2MMPA 1M3BA 2E6NA 1VYTA 4Q5WA 1M1KU 1MUZA 1BIAA 3VS1A 3GOXA 3UT1A 1QLYA 1ZBXA 4KGZB 3PGGA 2DL8A 1EIFA 1VQPQ 5DLOA 2LRQA 4AFSC 2L3RA 4PJOF 1E6GA 3OA6A 4C8QE 3V8LA 2E6ZA 3MEUA 1GCQC 1OQKA 1Q7YR 3H41A 3OBYA 3JCMf 2GNCA 1B07A 1M9SA 2NYSA 1M1KC 3EH1A 2RQVA 4HA8A 2VYTA 4MDWA 4JZ4A 4PLLA 3LWHA 4HXJA 3TSZA 3G4ST 3RKYA 1KQSA 3M57A 4Z02A 1CSKA 4KT0E 4DEYA 2QASA 1U3OA 4A54A 5DLQE 1VQ5A 2YWWA 4A4EA 2SRCA 1RI0A 2NLUA 1WNLA 2JTFA 1EFNA 3F70A 1T0JA 4PK4A 1RACB 1OOTA 2M1HA 4IIOA 2ZPGB 1QCNA 2XG8D 2HMAA 2GTJA 2EVRA 4WCIA 4N4GA 2E41A 1I0CA 4HCBA 2R5MA 3EG1A 4XU2A 4M7AG 2CS7A 3CXCA 3MEWA 1JO8A 1WXUA 1I81A 2QYZA 4F16A 5LJ5f 5IHNA 2JNGA 4DBFA 2YLCA 4OP0A 2MOXA 3S6WA 2DXUA 1UEBA 2EJGA 1KQSP 3PVQA 4PLIA 3X28B 3GIBA 3CCSA 2B8AA 5LJ3e 5I22A 1KHCA 1VQ4T 1HSQA 4JPBW 1ACMB 5GANe 3HKSA 1QVFA 1M1KR 3CCMQ 4M7DA 2FPFA 2CH4W 4IKFA 1IHVA 4OGEA 4A4KA 4JUVA 2P0QA 4EPCA 1RUWA 3RNJA 2FVUA 1H641 3LGLA 3VS5A 3QPHA 3RR6A 2QTXA 1JU5C 2I0NA 4J5YA 1YI2A 2F1LA 1UDLA 4EIKA 1MV3A 4MMLA 1VQMQ 1UUEA 1SPKA 4P5NA 3PT9A 2LNHB 4OMQA 1H92A 2FYKA 2CP5A 1G3SA 3CXCP 3I9QA 2KXCA 3EHQA 1XTDA 1LCKA 3L2WA 3UF4A 4L6V5 2DBKA 1MMGA 4C92G 3R6OA 3E2UA 3CCLQ 3OS0A 4J6YA 2DL4A 2LQNA 5CIUA 1Q95G 3CD6A 5IT9E 2ENMA 2RJDA 2KY9A 1UGQB 2FRWA 3QKJA 2FO0A 4LXCA 4XTVA 2QEXA 4M75D 1AOJA 4QQDA 2D0QB 2K9GA 5GAMd 1M8MA 3M0QA 5KYNA 1ZUKA 4MZPA 2L2PA 1WHJA 2O01E 1G3TA 4ATOA 1U5SA 2BZYA 2R5AA 3CQTA 2DM1A 3CC4Q 4LUDA 1BB9A 2AK5A 4V2SA 1YFNA 3OS2A 4C5IA 3MO8A 4WF2A 2EWNA 1B34B 5CQXA 5GJVB 1SSHA 2GF7A 3CCQA 2PU9B 2LJ3A 4LDUA 3VS4A 3OS5A 4EMGA 2ZPIB 4OMFB 4II1A 1TH7A 2LTOA 2ZPEB 4YTLA 3JSCA 4M7AA 3M0SA 3VRZA 2EQJA 3M0RA 4M7DC 1N9SA 1WGSA 3QHSA 1NBEB 1AWOA 5M9OA 2KSSA 3RMQA 1WQ7A 1MHNA 1YHQT 4PJOB 2CSQA 4KRTA 2XICA 4KULA 1VQ8A 3O5ZA 1BIBA 2V8IA 2DZCA 1FMVA 4XTYA 2COYA 4PFPA 1I8FA 3HP9A 3RKXA 4BI3A 2HEQA 2IG0A 1WHKA 1YIJA 4F14A 4QVDA 4C0GA 1FMWA 4PJJA 2DMOA 1ARKA 2AT1B 4J9EA 1IGUA 2A36A 2K57A 4BY6B 1VQ6A 3MEVA 2K3BA 3A5ZB 3OYKA 4KH1B 4CI0C 1TWBA 2EQMA 5GMKh 4ORZA 4N0AC 3G4SQ 3QYGB 1D1BA 1BCOA 1MV0B 2AKLA 3S3OA 1QVPA 2DL5A 1PRMC 5GAOq 2XK0A 2J6KA 2KRNA 5GAOn 1F1BB 2EJFA 2HAXA 4ANJA 5I21A 5LJ3j 4OGCA 2A37A 2FRYA 2EYQA 3JCMc 1YJNT 2X9HA 1VQ5T 1PD1A 2KI7A 3JCMh 1RAEB 5GANj 1VQLA 2MAMA 2EYXA 2DAQA 3I5RA 3EG2A 1K73R 4KGXB 1D3BB 1WIEA 1YCYA 4M75G 4PL6A 1TTHB 4C92A 4C0FA 2O4XB 3QZ9B 1UFFA 1C6VX 1QCOA 1OU9A 1DJ7B 2OX7A 4FW1A 2PTKA 2CKKA 4RTXA 1M2VB 2LT4A 3L2ZA 3ZL7C 1CKAA 1QP2A 3OYHA 4AG1C 3CPWS 2DVJA 5CCAA 3OYYA 3VKIA 5KYUB 2DERA 4LN2A 1RAIB 4C5EA 1ZHIA 2NUPB 2FHDA 2F69A 1W4SA 1O9SA 3NTIA 1N27A 1SHFA 2CH4A 2QI2A 1K4US 4PJOE 1WJRA 1BI3A 2JXBA 1OZ2A 1RAHB 3CCST 5KYWB 4FM4B 1WJSA 3PMTA 2AIRB 3VYHB 1D1AA 4PJLA 2OTJA 5LJ5h 4J7IA 4PKCC 5FLXE 2F5TX 2AKKA 1RABB 1OULA 1AZEA 2RJEA 3M58A 2X4JA 3GNFB 5LJ3g 4RG8A 1WHLA 2D9TA 2JT4A 5GAOr 3VUZA 3C0CA 4M78G 3P8DA 1YI2T 5GANg 3SWNB 1U06A 5KYYB 1QVGS 3JB9H 2L3PA 2DL7A 1WA7A 2V1QA 4XQ3A 2MIOA 1NPRA 1Z9QA 3A1PA 1ZA2B 2OAWA 3CBMA 3OMCA 2P4TA 4XK8E 5DM7R 4M7AF 2HBWA 1AWXA 5GAN7 4MZMA 1QVGP 2G6FX 2DVEA 2DRKA 3JCMP 4QW2A 4GY5A 2LJ0A 1IGQA 4XTXA 5I2SA 3ER0A 3EFOA 3JB9G 3Q1JA 5D6YA 2KVQG 3M4YA 1SSFA 3UATA 3G1JA 2X4WA 1MMNA 3CD6T 4RTZA 1IO6A 4KUIA 1PRLC 4M77G 1X69A 5CAIA 2QEXT 4M7DD 2CZ0B 4FYWB 1QQJA 4RMOA 3C94A 1VQOQ 2XDDA 2EFIA 2EQKA 2JVVA 5D7UA 3I56Q 1KSWA 3MP8A 2DA9A 2MI6A 2R58A 3SFMA 5GAMe 4M75A 3H0FA 2CDTA 4AFZC 3CCEA 1Q81C 1B7TA 2JW4A 3OYMA 4K11A 3A8LB 3MHXA 2NWMA 3OYAA 3CPFA 3M9QA 4MZTA 2YRDA 3I55A 2O9SA 3O8VA 2HKQB 1VQ9Q 2E64A 4UC4A 1YHQQ 2KQWA 1GXIE 3EH2A 1V29B 3TEEA 2VB6A 1ZSGA 4J9HA 1J3TA 3VYGA 2WSCE 4IUUA 3PMIA 3NFCA 1Q82R 4BDYA 3QDRB 4WTOB 4EMKB 5C6SA 4C8QG 1VQ8T 2J06A 2IVWA 4FYVB 5GAN8 3BY7A 4RTTA 1FWZA 3HFNA 1VOMA 2CT4A 2IIMA 4J6XA 4LD6A 2Y90A 1WX6A 1SG5A 4JLGA 1QKWA 1YIJT 2KT8A 2CYZB 4J6WA 1TXQA 1V76A 5GJWB 1VQ6T 2M0OA 2D1XA 1YJWA 4QQ6A 5IAYA 1K9AA 2RPNA 2E65A 2H8HA 3HRTA 1VUBA 2DX1A 4FL6A 3S3MA 2COZA 2RHUA 2GBQA 1HJDA 2L0AA 3A98A 3J80E 2V8JA 3P8BB 9ATCB 3KUFA 4M78A 2LCSA 4R56A 1VQ5Q 4HVVA 2CP7A 1QMCA 1WPYA 4BY6C 1RAFB 3E9FA 3JCMJ 3OB9A 1UGVA 2DZ9A 5LJ5d 2E70A 1BYMA 2YUQA 3G6EA 3LGFA 1VQLT 2ATCB 2GTOA 2W10A 1S1NA 2XHCA 1UB4A 4JLIA 4J9BA 5I11A 1Y0MA 2QK0A 1Q81R 2KMTA 2ECZA 2P0PA 4HT9A 3INZA 1TUCA 2CT3A 3C12A 5FU7C 1WQWA 2A08A 2EYWA 1W1FA 4A4GA 2OAUA 3I5SA 4DBRA 5HK0A 3OW2S 4M77A 5LJ3f 1KC8C 1X2KA 2M9UA 5GANf 3GPLA 4BUGA 3L42A 5FRMA 3QIIA 3V7SA 5IN1A 4XU1A 5HKCA 2KXDA 3OW2P 4OMMA 2COWA 3ME9A 5ECAA 3CEYA 1YITQ 2ROTA 3BDUA 2F2VA 3X26B 2MWPA 3J7AF 2YT6A 2NUTB 3CC2A 2HD0A 3L1AA 3GP8A 4NL2A 2X51A 5GAN5 1YJNA 1GL5A 1W2BS 4C92D 2J7IA 1LPLA 3CC7A 2MCNA 5FU6C 2EQUA 2BZXA 1TSFA 2YDLA 2DJZA 3H0HA 2OTJT 2DNUA 3EG3A 2EIFA 2KYBA 1YI2Q 3JRZA 4C8QA 3OSVA 5J26A 2DETA 5A0GA 2P4RA 4M78C 2K7AA 4M75F 1YJ9T 2RK1A 3A8OB 1NPPA 2SEMA 3OYFA 1D0XA 4M7AB 2PUKB 2F2XA 3CMEQ 3S3NA 5KYXA 3HFOA 2D0NA 5D6WA 2W0ZA 2RHXA 2P0KA 4B9WA 3OYJA 4XTUA 2DE0X 4RTYA 5CKBA 5CKHA 5EG2A 5D6XA 4IUVA 3ASKA 3CMAA 3HRSA 1I5OB 3CD6Q 4O5VA 1UGPB 1D0YA 3EG0A 4R0KA 3SWNC 3D7SB 4JDSA 2QEXQ 1X2QA 1IXDA 4M77C 2QQAA 2CP6A 2HBPA 1C1AA 1OYXA 3QWYA 1IREB 1AT1B 3H8ZA 4J83A 1KC8R 1ZSZA 3TVTA 3JCMW 4XU0A 3M59A 1KQ1A 2MPXC 2JM8A 2YHTA 1B3QA 3EFSA 4J9GA 4DBHA 2LJ1A 3TCJA 4F17A 3CCQQ 3CCET 2DJQA 5FWBA 3E19A 1JEGA 1N9RA 1WI7A 2QG9B 4ZGEB 2KDSA 3OYNA 2DFUA 1YNZA 3PE0A 3I55T 2M0YA 5CQYA 3HSBA 3OS1A 2L3SA 4RKUE 4F7UG 2E4HA 3C95A 1TS9A 2V26A 1R77A 3OYBA 4OVAA 4J8OA 1VQ8Q 5CKEA 3MKDA 4C8QC 4QQGA 1K73U 1UG1A 2EYYA 2J6OA 1M90U 3TSWA 2QGGA 2KEAA 4N0AA 4OMNA 5A0LA 3T9NA 3QJYA 5IH2A 2QA4T 1YIJQ 3EGDB 2JUFA 4IUQA 2JTEA 2GQIA 1VQ6Q 2EKHA 4E7LA
chains in the Genus database with same CATH topology
3CCMT 4ELZC 5GAMj 2YLBA 3JB9J 4XTZA 3VV0A 1JJ2S 2XU8A 3CCQT 4JJNK 1K8AC 1X75C 1VQ7A 1K73C 2GFAA 3FRNA 1MGQA 1DJ7B 4EMKC 2E10A 1X01A 3DB3A 4XU3A 4RCCA 4M7AE 2JZ2A 1WJQA 2CKKA 1M90C 4DOVA 4HT8A 1YJWT 2K3YA 2LT4A 3L2ZA 3CCJA 1Y07A 1NZ9A 4A53A 1Q7YC 5A0DA 1QP2A 3KBGA 1S72A 3OYHA 1Y96A 3CPWS 2RI3A 3LX7A 1Y71A 5LJ5g 5CCAA 3OYYA 3VKIA 1VQMT 2Y4XA 2CGHA 2E5QA 2KK4A 4M78E 4O6JA 2XIDA 4C5EA 3SB2A 2ZPHB 2HQEA 1ZHIA 2FHDA 2F69A 4E7JA 1W4SA 1O9SA 3RUXA 3EFRA 2M16A 3NTIA 4FT2A 1N27A 3FDRA 1R8OB 4IUPA 1VQNT 3G71T 2FB7A 2QI2A 3E9GA 4PJOE 1ZQ1A 1WJRA 4PNOA 1BI3A 2X35A 3LWIA 3N5BB 4BI8B 1OZ2A 3G6ET 2LQKA 4XAXB 5LJ5e 4EMKA 3CCST 1KHIA 4FM4B 2LX9A 3META 1WJSA 2OTLT 1O75A 2QQSA 2EJ9A 3PMTA 2HQXA 4M7DE 2PVGB 3FB9A 3LYIA 4MMKA 2LNVA 3VYHB 5GAN2 3QYHB 1XQHA 4LDVA 3FC3A 5LJ5h 2OTJA 4ZGDB 4J7IA 1VQPA 1KG1A 4E47A 4IURA 4PKCC 5FLXE 1M8VA 1X6OA 2F5TX 1VQOA 2RI5A 4M77E 3I56A 1AHJB 2XKOC 4QVZA 3CCVT 2RJEA 3M58A 2X4JA 3GNFB 3ZFJA 2RHYA 3QG1A 4RG8A 2F5KA 2A3LA 2D9TA 1M1GA 3GNGA 3NTHA 4RG2A 3TREA 3VUZA 3CPWA 5GAOr 3CC2T 3HHTB 2V8KA 4M78G 3P8DA 1YI2T 2VC8A 4M7AD 2DD5A 5GANg 3EAEA 3SWNB 5CVIA 2RO0A 1QVGS 3JB9H 2WACA 4TVRA 2LQ8A 4XQ3A 5GMKe 1NPRA 3AHUA 2K3XA 3JCMQ 3KXTA 3CCRT 4OB2B 3MP6A 3HPWA 3RIRA 3DB4A 2RHZA 1YITA 4M78D 5KH6A 1LNXA 1VIFA 1JJ2A 3CBMA 3OMCA 2P4TA 3CCLA 4XK8E 5A2QE 2FL7A 5DM7R 3JCMX 4DQ2A 2PQWA 4L5GA 4M7AF 1YBYA 4LDYA 4M75C 5GAN7 4MZMA 1VQ9A 2GFUA 4C0ZA 2L89A 4C0DC 4F7UB 2DVEA 5CKDA 3JCMP 4QW2A 4GY5A 1YHQA 4B9XA 4M7DG 3OMGA 4PJOD 2LCCA 2MMPA 4D6WA 3FIFA 5GAMg 2E6NA 4XTXA 2CZ6B 5J3BA 5LJ3h 1BI1A 3ER0A 4Q5WA 4M78F 5I2SA 3JB9G 3Q1JA 1M1KU 1BIAA 2RI2A 5D6YA 2KVQG 3M4YA 1SSFA 3QO3A 3X24B 3JCMe 4BI4A 3GOXA 5GANh 4JS5A 2LT1A 3UT1A 1Q86U 2VUBA 1ZBXA 2X4WA 3CD6T 4KUIA 4F7UA 3PGGA 4M77G 4C92B 3L2VA 4BE2A 5CAIA 2QEXT 4M7DD 1EIFA 2CZ0B 2RJCA 4M75B 2LRQA 5DLOA 2HNIA 5CR2A 3CC7T 5GAN4 4RMOA 3CXCS 2L3RA 3C4SA 4PJOF 3C94A 3JB9D 3LH0A 2EFIA 2XDDA 3CC4A 2EQKA 5GAOp 2DEQA 3JAME 3OA6A 2JVVA 4C8QE 3MP8A 3V8LA 2E6ZA 3MEUA 4M77D 2MI6A 2R58A 3SFMA 1K9MU 5GAMe 1LJOA 3OBYA 3JCMf 1Y7XA 2LCLA 4M75A 2Y4YA 1Q81C 3CCEA 1M9SA 2D6FA 4M7DF 1M1KC 3OYMA 3CMEA 3DLMA 2EKOA 3WVEB 1P92A 3JB9F 4HA8A 2BIVA 3A8LB 3MHXA 2WSFE 3JB9I 2VYTA 4MDWA 4QVCA 1Q86C 1Y96B 1QW1A 2L8DA 4PLLA 3OYAA 3LWHA 4M77F 3CPFA 3M9QA 2GCXA 4MZTA 4N4HA 4HCCA 3I55A 3O8VA 3G4ST 3RKYA 1KQSA 3MP1A 3RERA 3M57A 4Z02A 4KT0E 2E64A 2K5IA 2QQRA 4UC4A 1HK9A 1K9MC 2WSEE 2KQWA 4X9CA 4A54A 1GXIE 1V29B 5DLQE 1VQ5A 1QVFS 3A8GB 3TEEA 4A4EA 4ZN1A 1QVGA 3OYIA 1LOJA 2K4YA 3VYGA 3M56A 1RI0A 2NLUA 3CCUA 1WNLA 2WSCE 4IUUA 2JTFA 3NFCA 3PMIA 4GLKA 5GMKm 4ZTFA 2R57A 5CK9A 2X4XA 4BDYA 3QDRB 1Q82U 3F70A 4EMKB 2XI9A 4ELYC 5C6SA 4C8QG 1VQ8T 3OYDA 2IVWA 5GAN8 2PUOB 2H3JA 3BY7A 5L8RE 2M1HA 2ZCFB 1FWZA 3HFNA 4OB1B 5HY6A 4BE0A 1VQOT 2ZPGB 4J6XA 4LD6A 3I56T 2XG8D 3M55A 1N8RU 3G7ZA 3M53A 3PTAA 2Y90A 3QJ6A 4C8QD 4J7FA 4EDUA 4JLGA 4KBMB 3PIOA 3L2QA 5GAN3 3CCMA 1VQKT 1YIJT 4ME7A 1KQSS 2CYZB 4NS5A 1UGRB 4J6WA 4N4GA 2E41A 1UGSB 4DOWA 3ZBDA 3QUIA 1Q82C 1VQ6T 4HCBA 2M0OA 5LL6S 4C5HA 3CBOA 2R5MA 4XU2A 4M7AG 2DTOA 2CS7A 3L2RA 1YJWA 4QQ6A 1I5LA 3BDLA 5J39A 5IAYA 3CXCA 3FEOA 1B34A 3OYGA 3MEWA 2E1HA 4BB7A 1YJ9A 4C8QF 1I81A 2E65A 3HRTA 3UDCA 3HRUA 1JB0E 1VQMA 1VUBA 2K5LA 1JBMA 4EMHA 4FL6A 3S3MA 5LJ5f 1VQ9T 2DXBA 1FXXA 2JNGA 1N8RC 2RHUA 2QQBA 1G5VA 2YLCA 3J80E 2V8JA 3P8BB 4BDZA 2QQ9A 4R56A 3KUFA 4M78A 5LJ3g 4OP0A 2MF2A 1PSEA 1WPYA 2JOYA 3HL8A 3E9FA 4BY6C 1M4ZA 3OB9A 3S6WA 3VUBA 4F7UE 3DLLA 3JCMJ 2DXUA 3G71A 2DXCA 1BKBA 2DZ9A 2JTMA 5LJ5d 1UEBA 2EJGA 1IZ6A 5GAOm 1XNIA 4PJOG 2RH2A 2E70A 2GQVA 4FSXA 4PLIA 4NL3A 1BYMA 3X28B 3G6EA 3LGFA 3GIBA 1VQLT 4ZN3A 3RMSA 5KE2A 3CCSA 5GMKl 2B8AA 5CO7A 1U1SA 5LJ3e 1OI1A 2OTLA 2VV5A 2XDPA 1KHCA 2XHCA 3VU3C 1UB4A 4C92E 1VQ4T 1KQ2A 4JLIA 4M75E 2PVOB 5GANe 2CZ1B 3HKSA 1QVFA 1Q81U 2AHJB 4IUTA 2KMTA 4M7DA 4FIBA 2P0PA 4HT9A 3INZA 1NJIU 4IKFA 4OGEA 2I2LA 4A4KA 4JUVA 2P0QA 4EPCA 3C12A 5FU7C 1WQWA 3CCVA 2FVUA 1H641 3LGLA 3MCAB 3QPHA 4A4GA 3OQ5A 2QTXA 2OAUA 5HK0A 5GMKj 3GLXA 4J5YA 4C0DB 5KE3A 4M77A 3OW2S 5LJ3f 3CBPA 5CKFA 1YI2A 1KC8C 2DD4A 2DK3A 3V8KA 5I2MA 1VQ7T 2M9UA 2EAYA 4MMLA 5GANf 2A7YA 2RM4A 2CZ7B 5DY9A 3GPLA 4BUGA 4OB0B 3LLRA 3L42A 5FRMA 3CCRA 4XTWA 4P5NA 3QIIA 3CMAT 2LVMA 5IN1A 3PT9A 4XU1A 3RESA 3BFMA 3V7SA 5HKCA 3P8HA 2DIGA 2FYKA 5LJ3d 5FU7B 3CCJT 4BACA 3OYLA 1G3SA 4RCBA 1S72T 3OYCA 3DKMA 1NJIC 3MEAA 5GANd 4BE1A 1KD1U 3ME9A 1XTDA 2RA2A 3CEYA 2VGNA 4N4IA 4OB3B 3L2WA 3JCMd 3OBWA 3QZ5B 4L6V5 3BDUA 4FT4A 3X26B 4C92G 3R6OA 2MWPA 4FU6A 4A4FA 3TU4K 3J7AF 3OS0A 4J6YA 3OY9A 3CC2A 5KCOA 5GAMf 2C06A 2HD0A 3L1AA 3GP8A 4NL2A 5GAOl 4R55A 3QXEB 5GAN5 4Y28E 1RL2A 5CIUA 3CD6A 5IT9E 4HKEA 1YJNA 1H3ZA 2RJDA 2KY9A 4L59A 1UGQB 4MDXA 4C5GA 3QKJA 4XTVA 2QEXA 1W2BS 2LDMA 3SDZA 4C92D 4F7UF 3CC7A 4M75D 5FU6C 4QQDA 2D0QB 2EQUA 5GAMd 2XDBA 2ZPBB 4M7AC 2K5FA 3A8HB 4JRIA 1KD1C 2DJZA 3ZEHA 2OTJT 1NE8A 2EIFA 4MZPA 1U8RA 2O4XA 1VQPT 2O01E 1G3TA 3FLGA 3E1SA 2QA4A 4ATOA 1G3YA 2R5AA 3JRZA 4E7IA 4C8QA 3OSVA 1BI2A 5J26A 1N6AA 4KUDK 4LD9K 5A0GA 4C92F 4PJOB 1OZ3A 4M78C 4V2SA 4M75F 2LC4A 1M1FA 2RK1A 1YJ9T 3OS2A 4E7KA 3A8OB 4C5IA 1NPPA 3MO8A 4WF2A 2EWNA 1B34B 5CQXA 5FU6B 4JRKA 3OYFA 2GF7A 4M7AB 2PUKB 3PIPA 4HCZA 3CCQA 3S3NA 2PU9B 3M4GA 3PFSA 3JCMb 3HFOA 3G4SA 4PJOC 5AYFA 3WXMB 1M5Q1 4LDUA 3H6ZA 3OYEA 3OS5A 5D6WA 2RHXA 2P0KA 3VJPA 4EMGA 1FX7A 4B9WA 2ZPIB 3RKWA 3OYJA 3OW2A 4XTUA 2QXFA 2DIQA 4M78B 4OMFB 2RHIA 1TH7A 4II1A 1YITT 5CKBA 2LTOA 2ZPEB 3V7RA 3V7CA 4YTLA 3JSCA 5CKHA 5EG2A 4M7AA 2RJFA 3CCLT 4ZTJA 5D6XA 2EQJA 3JCMV 4M7DC 3M5AA 1N9SA 1WGSA 3ASKA 1XOVA 2RD1A 4IUVA 3M54A 3QHSA 3X20B 4A4HA 1PSFA 3HRSA 3CMAA 5M9OA 2KSSA 3RMQA 4X34A 1WQ7A 1MHNA 4O5VA 1UGPB 1YHQT 5C0MA 2XICA 4KULA 3SWNC 5HK3A 4JDSA 5FRNA 1VQ8A 1BI0A 2X4YA 4M77C 2QDYB 2QQAA 1BIBA 1VQNA 2V8IA 2DZCA 3WVDB 5LJ5j 2HBPA 1OYXA 1IREB 4XTYA 3H8ZA 3OSSC 2VXEA 1I8FA 4M7DB 3HP9A 3UPUA 4J83A 3UWNA 2VXFA 4X9DA 2E12A 3RKXA 4BI3A 1KC8U 4PJOA 2IG0A 4ZGJB 3JCMW 1VQKA 1YIJA 4XU0A 3M59A 4QVDA 1KQ1A 4C0GA 3CC4T 2BUDA 2DTHA 2K57A 4M77B 4BY6B 1JRIA 1VQ6A 2YHTA 4LDWA 3JCMg 1W2BA 2BKDN 3MEVA 3EFSA 1U1TA 3QBYA 2DPPB 3TCJA 3NTKA 3A5ZB 3CCET 3OYKA 4CI0C 2EQMA 2JN0A 3PNWC 5GMKh 3CMET 2XD0A 2K2VA 4N0AC 2KAFA 3BW1A 3E19A 1N9RA 3QYGB 5GMKi 3QSUA 3SWNA 4C92C 3S3OA 3URGA 1QVPA 5GAOq 4JRQA 2XK0A 2KDSA 4ZGEB 3OYNA 2DTIA 2ZZDA 2MWOA 4OF1A 4JRPA 4BD3A 5GAOn 3I55T 2EJFA 3GF5A 4LDXA 2RK2A 5CQYA 3HSBA 3OS1A 3LW5E 4RKUE 3L2UA 2HAXA 5FROA 4F7UG 5I21A 3C95A 1HXDA 5LJ3j 1G3WA 4OGCA 4CRIA 2EYQA 3JCMc 3OYBA 4OVAA 3X25B 4J8OA 1YJNT 1VQ5T 3JCMh 5GANj 1VQLA 5CKEA 2MAMA 1K8AU 1QP3A 2RB6A 2DAQA 4QQGA 3SD4A 4C8QC 2PVDB 5KCHA 4DA4A 1K73U 4VUBA 3CCUT 2ZPFB 2ZGWA 1VQ4A 1D3BB 1M90U 4JS4A 1YCYA 4Y91A 4M75G 4PL6A 2G3RA 2YRVA 4N0AA 1Q7YU 5A0LA 1VIEA 2L5QA 2VGMA 3T9NA 3QJYA 4C92A 2QA4T 3A8MB 4NOYA 2JUFA 4IUQA 1I4K1 4C0FA 2O4XB 3QZ9B 3V8JA 2DO3A 3J81E 2DXTA 5GAMh 3FJPA 1D3BA 4C8QB 5GAN6 2DKGA 4E7HA 4E7LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DXU A;  4F7U A;  3PGG A;  4M77 G;  2DZ9 A;  3HFO A;  2YLB A;  4C92 B;  5LJ5 d;  5CAI A;  3JCM b;  4XTZ A;  1M5Q 1;  2EJG A;  4M75 B;  3JB9 J;  5GAO m;  4M7D D;  2HNI A;  4PJO G;  5GAN 4;  4EMG A;  4NL3 A;  3RKW A;  4XTU A;  4PJO F;  1MGQ A;  3JB9 D;  4M78 B;  4EMK C;  2E10 A;  1TH7 A;  1X01 A;  4XU3 A;  4RCC A;  2DEQ A;  5GAO p;  3GIB A;  4M7A E;  3V7R A;  3V7C A;  5GMK l;  4M7A A;  4C8Q E;  1U1S A;  4HT8 A;  5LJ3 e;  3V8L A;  3L2Z A;  3VU3 C;  4A53 A;  4M77 D;  3JCM V;  4M7D C;  1N9S A;  4C92 E;  1KQ2 A;  2RD1 A;  5GAM e;  3QHS A;  4JLI A;  4M75 E;  1LJO A;  1Y96 A;  3JCM f;  5GAN e;  4M75 A;  5LJ5 g;  5GAM j;  4M7D F;  2CGH A;  1WQ7 A;  4M78 E;  4PJO B;  4M7D A;  3SWN C;  4HT9 A;  3INZ A;  3SB2 A;  3JB9 F;  4HA8 A;  2I2L A;  4M77 C;  3JB9 I;  4JUV A;  4QVC A;  1BIB A;  2DZC A;  1WQW A;  5LJ5 j;  1H64 1;  1Y96 B;  3RUX A;  3EFR A;  2QTX A;  4XTY A;  4M77 F;  5GMK j;  4J5Y A;  2VXE A;  4M77 A;  1I8F A;  5LJ3 f;  4M7D B;  2FB7 A;  4PJO E;  2VXF A;  4X9D A;  3RKX A;  3V8K A;  4PJO A;  4PNO A;  3RKY A;  3RER A;  2EAY A;  4MML A;  5GAN f;  4XU0 A;  2E64 A;  2RM4 A;  5DY9 A;  3JCM W;  4QVD A;  1KQ1 A;  1HK9 A;  5LJ5 e;  4EMK A;  4X9C A;  4XTW A;  4A54 A;  3V7S A;  2DTH A;  2K57 A;  4M77 B;  4XU1 A;  3BFM A;  1JRI A;  3RES A;  5LJ3 d;  2EJ9 A;  2FYK A;  2YHT A;  1LOJ A;  3JCM g;  4M7D E;  3EFS A;  1U1T A;  3FB9 A;  4RCB A;  4MMK A;  5GAN 2;  5LJ5 h;  1WNL A;  5GMK m;  5GAN d;  5GMK h;  2JN0 A;  3QSU A;  4N0A C;  2RA2 A;  3BW1 A;  4EMK B;  1N9R A;  5GMK i;  1M8V A;  4C8Q G;  3JCM d;  3SWN A;  4C92 C;  4M77 E;  3BDU A;  5GAN 8;  4C92 G;  3BY7 A;  5GAO q;  4J6Y A;  3HFN A;  2DTI A;  5LJ3 g;  3AHU A;  4J6X A;  5GAO r;  5GAM f;  3L1A A;  4NL2 A;  5GAO n;  5GAO l;  2EJF A;  4M78 G;  2VC8 A;  5GAN 5;  4M7A D;  3HSB A;  4PJO C;  2Y90 A;  5GAN g;  3SWN B;  4C8Q D;  5GAN 3;  4F7U G;  5I21 A;  3JB9 H;  4XTV A;  1HXD A;  4J6W A;  4XQ3 A;  4C92 D;  4F7U F;  5GMK e;  5LJ3 j;  2E41 A;  4M75 D;  3JCM Q;  3JCM c;  3QUI A;  5GAM d;  3RIR A;  3JCM h;  4M7A C;  5GAN j;  4M78 D;  4JRI A;  1LNX A;  2RB6 A;  4XU2 A;  4C8Q C;  2DJZ A;  4M7A G;  2DTO A;  1I5L A;  1B34 A;  4DQ2 A;  3JCM X;  2ZGW A;  4M7A F;  2E1H A;  1D3B B;  4M75 C;  5GAN 7;  4C8Q F;  1I81 A;  1YCY A;  2E65 A;  4Y91 A;  4F7U B;  4C8Q A;  4M75 G;  2DVE A;  4EMH A;  1JBM A;  4N0A A;  3JCM P;  4C92 F;  4M78 C;  4V2S A;  4M75 F;  5LJ5 f;  4C92 A;  4M7D G;  4PJO D;  3FIF A;  5GAM g;  4NOY A;  4XTX A;  5LJ3 h;  4WF2 A;  2EWN A;  1B34 B;  2YLC A;  1I4K 1;  4JRK A;  4M78 F;  3V8J A;  3JB9 G;  1BIA A;  3JCM e;  3QO3 A;  4M7A B;  2DXT A;  4M78 A;  5GAM h;  4OP0 A;  3FJP A;  1WPY A;  1D3B A;  4C8Q B;  5GAN h;  5GAN 6;  2DKG A;  4F7U E;  3JCM J;  3M4G A; 
#chains in the Genus database with same CATH topology
 2YLB A;  3JB9 J;  1JJ2 S;  4JJN K;  1VQ7 A;  1K73 C;  4EMK C;  2E10 A;  4XU3 A;  4ZNX A;  4M7A E;  1W6X A;  1WJQ A;  1M90 C;  4DOV A;  1YJW T;  1NZ9 A;  2DL3 A;  1S72 A;  4CC3 A;  2EQI A;  2Y4X A;  2E5Q A;  4O6J A;  2XID A;  2AZS A;  3SB2 A;  2YSQ A;  3JV3 A;  1ZSZ C;  2L3Q A;  3RUX A;  1VQL Q;  4FT2 A;  1R8O B;  1BCM A;  1VQN T;  2FB7 A;  3QDF A;  4J9D A;  2LQW A;  2X35 A;  3LWI A;  3G6E T;  3SEM A;  5LJ5 e;  1KHI A;  1OV3 A;  2QAZ A;  1O75 A;  2QQS A;  2HQX A;  5GAN 2;  4LDV A;  3FC3 A;  4ZGD B;  2KT1 A;  4F04 B;  2JS2 A;  2M02 A;  2HQH A;  2ROL A;  1AHJ B;  1UHF A;  2KGT A;  3GNG A;  5L23 A;  1NM7 A;  2VC8 A;  2DD5 A;  3EAE A;  1GBQ A;  1PD0 A;  2WAC A;  1AWJ A;  1UHC A;  1RLP C;  3PVL A;  3JCM Q;  3KXT A;  2DIL A;  3HPW A;  3DB4 A;  2RHZ A;  2X3X D;  4M78 D;  1LNX A;  4CC7 A;  3REA B;  3CCL A;  2VWF A;  1OPL A;  4LDY A;  3M0U A;  8AT1 B;  2GFU A;  4C0Z A;  1PCX A;  4CC4 B;  3FIF A;  5LJ3 h;  4QKU A;  2CZ6 B;  1UJ0 A;  5J3B A;  1BI1 A;  3CPW A;  3CC2 T;  1R0B G;  3X24 B;  4J9C A;  5GAN h;  2KNB B;  2LT1 A;  4JS5 A;  1Q86 U;  2OTJ Q;  4F7U A;  3L2V A;  4BE2 A;  2IPO B;  4M75 B;  3EGU A;  3CC7 T;  3MJX A;  3JB9 D;  3LH0 A;  3I35 A;  3CC4 A;  5GAO p;  1M3C A;  2DEQ A;  2J05 A;  3JAM E;  1M90 R;  4FW2 A;  8ATC B;  2MK5 A;  4M77 D;  1LJO A;  4AFU C;  1MND A;  1Y7X A;  2FZK B;  2Y4Y A;  3QWX X;  4M7D F;  1D0Z A;  2EKO A;  2RQR A;  1SRM A;  1TUG B;  2BIV A;  1Q86 C;  3JB9 I;  4QVC A;  1Y96 B;  1QW1 A;  2GCX A;  2DEU A;  4HCC A;  2E3I A;  3REB B;  2KR3 A;  2D8J A;  2WSE E;  4AFQ C;  2RF0 A;  3A8G B;  4ZN1 A;  1QVG A;  3OYI A;  3VS7 A;  2K4Y A;  1PWT A;  1UEC A;  3CCU A;  3CMA T;  3VS0 A;  5GMK m;  1Q82 U;  1PNJ A;  2XI9 A;  2EW3 A;  3CPW P;  2H3J A;  2ZCF B;  4BE0 A;  4OB1 B;  1VQ4 Q;  1N8R R;  3G7Z A;  3PTA A;  4C8Q D;  4J7F A;  1TG0 A;  4KBM B;  3EGX A;  1UGR B;  3CCE Q;  1AVZ C;  3THK A;  1Q82 C;  2KE9 A;  2DTO A;  3L2R A;  1PC0 A;  2CSI A;  3BDL A;  5J39 A;  3FEO A;  1B34 A;  4E7S A;  3OYG A;  5IHI A;  2E1H A;  1YJ9 A;  2EYZ A;  3UDC A;  3HRU A;  1JBM A;  3H9N A;  4JJD A;  2C0O A;  2FPD A;  1FXX A;  5EC7 A;  1G5V A;  2QQ9 A;  4AT1 B;  2JOY A;  1ZLM A;  3VUB A;  3G71 A;  1BKB A;  5IXB A;  1IZ6 A;  1QCF A;  1XNI A;  4RTV A;  6AT1 B;  5GAO m;  2GQV A;  4ZN3 A;  3RMS A;  5KE2 A;  1XJW B;  5CO7 A;  1OI1 A;  2OTL A;  2VV5 A;  2XDP A;  4M75 E;  2PVO B;  2CZ1 B;  1Q81 U;  2JMA A;  2AHJ B;  1NJI R;  2I2L A;  1Q86 R;  2A28 A;  1VYU A;  3CCV A;  4FCY A;  2M51 A;  3MCA B;  1QWE A;  4C0D B;  5KE3 A;  2RQW A;  1YJW Q;  4AG2 C;  2DD4 A;  3V8K A;  2PZ1 A;  1VQ7 T;  2A7Y A;  2RM4 A;  1PG5 B;  4OB0 B;  3CCR A;  1RI9 A;  2LVM A;  3P8H A;  2DIG A;  5LJ3 d;  5HCK A;  1S72 T;  3OYC A;  1WZO A;  1NYG A;  5GAN d;  1HD3 A;  2FPE A;  4BE1 A;  1KD1 U;  2XMF A;  4PJM A;  2VGN A;  4N4I A;  1K76 A;  5FW9 A;  4M4Z A;  3JCM d;  3QZ5 B;  4FT4 A;  3NMZ C;  2K79 A;  4FU6 A;  4A4F A;  3G6E Q;  5KCO A;  2C06 A;  3QXE B;  4Y28 E;  2PNI A;  1PM3 A;  4L59 A;  1D09 B;  4C5G A;  2BZ8 A;  2LDM A;  4F7U F;  2HCK A;  2ESW A;  1Z9Z A;  3A8H B;  1KD1 C;  2RNA A;  2O4X A;  4DBQ A;  3FLG A;  1BK2 A;  3E1S A;  2QA4 A;  1G3Y A;  4E7I A;  5KYX B;  4C92 F;  1OZ3 A;  2KRS A;  2LC4 A;  2YXY A;  2B86 A;  4HCZ A;  3TQ7 P;  1M30 A;  4PJO C;  1HYO A;  1TOV A;  3VJP A;  1FX7 A;  1ZA1 B;  3RKW A;  3OW2 A;  2QXF A;  5KYU A;  2RHI A;  2DRM A;  3V7C A;  1E7O A;  1OEB A;  4J9I A;  4ZTJ A;  3CCL T;  3CC2 Q;  3JCM V;  3M5A A;  2RD1 A;  3X20 B;  3NPF A;  4X34 A;  1YJN Q;  5HK3 A;  1BI0 A;  3CC7 Q;  1VQN A;  1T0H A;  4JZ3 A;  2CUB A;  2VXE A;  4M7D B;  3UPU A;  1QKX A;  3UWN A;  2E12 A;  7AT1 B;  1KC8 U;  2HL5 C;  4RTU A;  1VQK A;  2H3E B;  1X43 A;  4DEX A;  2C0I A;  3CC4 T;  2O31 A;  2BUD A;  1W2B A;  3QBY A;  2DPP B;  3NTK A;  1OPK A;  1EZZ B;  2XD0 A;  2HZY A;  2K2V A;  3QSU A;  3BW1 A;  3SWN A;  3URG A;  4KH0 B;  4JRQ A;  1YP5 A;  2DTI A;  4JRP A;  1RLQ C;  4BD3 A;  1M27 C;  3AT1 B;  3GF5 A;  4LDX A;  2RK2 A;  2ED1 A;  3BE3 A;  3VRY A;  3CMA Q;  2KRO A;  1HXD A;  4CRI A;  1GFC A;  1NG2 A;  3EHR A;  3X25 B;  2P84 A;  1K8A R;  2RB6 A;  3SD4 A;  5KCH A;  1KD1 R;  4JJC A;  2AZV A;  3CCU T;  4X1V A;  1LVK A;  2X3W D;  2HDA A;  3CCS Q;  2L5Q A;  1KIK A;  2VGM A;  1R0C B;  3A8M B;  1I4K 1;  3SHW A;  2DO3 A;  5GAM h;  1G8X A;  3FJP A;  1W70 A;  5GAN 6;  2DKG A;  3KFV A;  5GAM j;  1I07 A;  4XTZ A;  3VV0 A;  1X75 C;  2GFA A;  1K0X A;  2CRE A;  1ABO A;  2EGE A;  1G2B A;  2K3Y A;  1W2B P;  3CCJ A;  1Y07 A;  4A53 A;  2K2M A;  1D1C A;  1JQQ A;  3LX7 A;  1Y71 A;  1ABQ A;  2CGH A;  2KK4 A;  1UE9 A;  1FYN A;  2ZPH B;  1H8K A;  4E7J A;  1X6B A;  4RUG A;  2M16 A;  1PHT A;  3FDR A;  1MNE A;  4IUP A;  3G71 T;  3E9G A;  4D8K A;  4PNO A;  3N5B B;  4BI8 B;  2DYB A;  4XAX B;  4EMK A;  1YCS B;  2LX9 A;  3MET A;  4E2F B;  2OTL T;  4E7Z A;  2EJ9 A;  2ED0 A;  4M7D E;  1GBR A;  3FB9 A;  4Z89 A;  2KBT A;  2F2W A;  2LNV A;  2VKN A;  1XQH A;  2CUD A;  2E3H A;  1KG1 A;  1VQP A;  1AD5 A;  1QWF A;  1NLO C;  2OI3 A;  4IUR A;  1M8V A;  1X6O A;  1VQ7 Q;  4D8D A;  2XKO C;  3CCV T;  1GRI A;  3ZFJ A;  1X27 A;  2RHY A;  1KQS S;  3AHU A;  2F5K A;  1WLP B;  3NTH A;  1KK7 A;  1KFZ A;  3HHT B;  3EG9 A;  1S72 Q;  1UTI A;  4TVR A;  1IHW A;  5GMK e;  2BE9 B;  1BBZ A;  3CCR T;  3MP6 A;  1YIT A;  2EGA A;  1VIF A;  1JJ2 A;  3RDV A;  5A2Q E;  4DQ2 A;  4L5G A;  1YBY A;  2L89 A;  4C0D C;  4F7U B;  5CKD A;  1X6G A;  2DLP A;  2YRC A;  3OMG A;  4PJO D;  4D6W A;  5GAM g;  2VAS A;  4M78 F;  2RI2 A;  3JCM e;  3QO3 A;  4BI4 A;  2FZG B;  2VUB A;  4C92 B;  2RJC A;  5CR2 A;  2HNI A;  5GAN 4;  1WXB A;  3CXC S;  3C4S A;  4ESR A;  3LH5 A;  4LUE A;  1MMA A;  1K9M U;  2EBP A;  2LCL A;  2D6F A;  3CME A;  3DLM A;  3WVE B;  1P92 A;  2GGR A;  3JB9 F;  1IB8 A;  2WSF E;  1RAA B;  5AT1 B;  2L8D A;  4M77 F;  4N4H A;  1E6H A;  1WHM A;  2DBM A;  3R6N A;  3RER A;  3MP1 A;  2OJ2 A;  2K5I A;  2QQR A;  1HK9 A;  1K9M C;  4X9C A;  1QVF S;  1JJ2 P;  1LOJ A;  3M56 A;  1WFW A;  2NUT A;  3M0T A;  4GLK A;  4ZTF A;  2R57 A;  5CK9 A;  2X4X A;  2CP3 A;  4ELY C;  3EGX B;  3OYD A;  2ABL A;  2D8H A;  2PUO B;  2QGF B;  1QVF P;  5L8R E;  1VQO T;  5HY6 A;  3I56 T;  2BE7 D;  3M55 A;  1N8R U;  4Z8A A;  1T3S A;  3M53 A;  3QJ6 A;  4EDU A;  3L2Q A;  3PIO A;  3M0P A;  5GAN 3;  3UA6 A;  3CCM A;  1VQK T;  3RBB B;  4ME7 A;  2O88 A;  4NS5 A;  1UGS B;  3VS6 A;  4DOW A;  1ZBJ A;  3ZBD A;  3QUI A;  1EX4 A;  4JJB A;  5LL6 S;  4C5H A;  3CBO A;  5IXF A;  1I5L A;  3HTR A;  4BB7 A;  4C8Q F;  1JB0 E;  1VQM A;  2K5L A;  4EMH A;  1VQ9 T;  2DXB A;  1N8R C;  2QQB A;  4BDZ A;  2LP5 A;  2MF2 A;  1PSE A;  3VS2 A;  2EGC A;  1WHH A;  3HL8 A;  3DLL A;  1M4Z A;  4F7U E;  1G83 A;  2DXC A;  2JTM A;  3CCU Q;  4IIM A;  4PJO G;  2Z0W A;  4FYY B;  2RH2 A;  3EFO B;  4FSX A;  1IRX A;  4NL3 A;  2HKN A;  5GMK l;  1N5Z A;  1U1S A;  2LMJ A;  4LNP A;  3VU3 C;  4C92 E;  1KQ2 A;  1SKU B;  2V1R A;  4Z88 A;  4IUT A;  1YN8 A;  4FIB A;  1NJI U;  1AEY A;  1TU0 B;  3OQ5 A;  5GMK j;  3GLX A;  1SF9 A;  3CBP A;  2DK3 A;  1YJ9 Q;  5I2M A;  2EAY A;  5DY9 A;  2CZ7 B;  3LLR A;  1K9M R;  4XTW A;  4KGV B;  3RES A;  3BFM A;  1JXM A;  1NEB A;  3CCJ T;  5FU7 B;  4BAC A;  3OYL A;  4RCB A;  4PFO A;  3DKM A;  1I1J A;  1NJI C;  3MEA A;  2BTT A;  4LE9 A;  3G71 Q;  2RA2 A;  2YUN A;  4OB3 B;  3GBQ A;  2CP2 A;  3OBW A;  1RAD B;  2O2O A;  3TU4 K;  3OY9 A;  4HVW A;  5GAM f;  5GAO l;  4R55 A;  2OTL Q;  1RL2 A;  1H3Z A;  4HKE A;  4MDX A;  3SDZ A;  2XDB A;  2ZPB B;  4M7A C;  1BU1 A;  2K5F A;  4JRI A;  3CCV Q;  1WHG A;  3ZEH A;  3EGD A;  1NE8 A;  4OMP A;  1U8R A;  1VQP T;  4FYX B;  4OMO A;  4Y92 A;  1BI2 A;  4KUD K;  1N6A A;  4LD9 K;  2CP0 A;  1M1F A;  4E7K A;  4PJN A;  4QT7 A;  3NGP A;  5FU6 B;  4E6R A;  4JRK A;  3CCR Q;  3PIP A;  1NEG A;  3M4G A;  3PFS A;  3JCM b;  3G4S A;  5AYF A;  3WXM B;  1M5Q 1;  1RAG B;  3H6Z A;  3OYE A;  2HSE B;  2DIQ A;  4M78 B;  4AMC A;  1YIT T;  3V7R A;  3I55 Q;  3IQL A;  2RJF A;  3VS3 A;  4A4H A;  1XOV A;  3M54 A;  1KJW A;  1SEM A;  1PSF A;  2JJ9 A;  1WXT A;  5C0M A;  5FRN A;  2X4Y A;  2QDY B;  2MYS A;  2K6D A;  3WVD B;  1UJY A;  2FEI A;  5LJ5 j;  1M2O A;  3OSS C;  1T3L A;  2RQT A;  2VXF A;  4X9D A;  1M3A A;  2EPD A;  4PJO A;  2JMC A;  2QA4 Q;  4ZGJ B;  2LX7 A;  4GBQ A;  2FG0 A;  2DTH A;  4M77 B;  1JRI A;  3JCM g;  4LDW A;  2BKD N;  1K0S A;  2YUO A;  1U1T A;  4OML A;  2O9V A;  3PNW C;  2JN0 A;  3CME T;  2KYM A;  2KAF A;  5GMK i;  4C92 C;  2JM9 A;  2DF6 A;  1ZX6 A;  2ZAE A;  1A0N B;  2RMO A;  2ZZD A;  2MWO A;  4OF1 A;  2JS0 A;  5FWC A;  3ULR B;  2QDL A;  3LW5 E;  1ZUY A;  3L2U A;  5FRO A;  1PKS A;  1GCP A;  1C0M A;  1G3W A;  2A0F B;  2NUZ A;  2RN8 A;  3MPU B;  4PFZ A;  1K8A U;  1VQN Q;  1QP3 A;  4DA4 A;  1WDX A;  2PVD B;  2J6F A;  4VUB A;  2ZPF B;  4HVU A;  2ZGW A;  1VQ4 A;  2HL3 A;  1VYV A;  4JS4 A;  4Y91 A;  5IHK A;  1AZG B;  3H0I A;  2G3R A;  2YRV A;  1Q7Y U;  1VIE A;  1VQK Q;  4NOY A;  3FJ5 A;  1K1Z A;  3V8J A;  3J81 E;  1OX8 A;  2DXT A;  1D3B A;  4C8Q B;  4E7H A;  3U23 A;  3CCM T;  4ELZ C;  2DYI A;  1SRL A;  1H3H A;  2XU8 A;  3CCQ T;  1K8A C;  4B6M A;  3FRN A;  1MGQ A;  1WYX A;  1X01 A;  3DB3 A;  4RCC A;  2JZ2 A;  1V1C A;  1CKB A;  4HT8 A;  4A63 B;  1Q7Y C;  1YWP A;  5A0D A;  2KRM A;  3KBG A;  1Y96 A;  2RI3 A;  5LJ5 g;  1VQM T;  1MMD A;  4M78 E;  1GCQ A;  1OU8 A;  2HQE A;  1M2V A;  1JXO A;  1ZUU A;  3EFR A;  1TUD A;  1ZQ1 A;  4CC2 A;  4HCK A;  1GFD A;  2NUP A;  2LQK A;  1FMK A;  1PKT A;  3NHN A;  2C0T A;  2LZ6 B;  2PVG B;  1ZSZ B;  3LYI A;  2FZC B;  4GLM A;  4MMK A;  3QYH B;  1AWW A;  3EG9 B;  4E47 A;  1VQO A;  2RI5 A;  4M77 E;  5KYW A;  3I56 A;  4QVZ A;  4FSS A;  2RQU A;  3QG1 A;  5CKF A;  3TRE A;  2A3L A;  4RG2 A;  1M1G A;  2V8K A;  3CCJ Q;  4M7A D;  2HSP A;  3UA7 A;  5CVI A;  2RO0 A;  4J9F A;  2LQ8 A;  2YUP A;  2K3X A;  2E5K A;  4OB2 B;  3RIR A;  2VVK A;  5KH6 A;  1NYF A;  1OX9 A;  2FL7 A;  3JCM X;  1YWO A;  2PQW A;  5KYY A;  4M75 C;  4RTW A;  1VA7 A;  1VQ9 A;  1NLP C;  2QTV A;  1Y57 A;  1YHQ A;  4B9X A;  1SHG A;  4M7D G;  2LCC A;  2MMP A;  1M3B A;  2E6N A;  1VYT A;  4Q5W A;  1M1K U;  1MUZ A;  1BIA A;  3VS1 A;  3GOX A;  3UT1 A;  1QLY A;  1ZBX A;  4KGZ B;  3PGG A;  2DL8 A;  1EIF A;  1VQP Q;  5DLO A;  2LRQ A;  4AFS C;  2L3R A;  4PJO F;  1E6G A;  3OA6 A;  4C8Q E;  3V8L A;  2E6Z A;  3MEU A;  1GCQ C;  1OQK A;  1Q7Y R;  3H41 A;  3OBY A;  3JCM f;  2GNC A;  1B07 A;  1M9S A;  2NYS A;  1M1K C;  3EH1 A;  2RQV A;  4HA8 A;  2VYT A;  4MDW A;  4JZ4 A;  4PLL A;  3LWH A;  4HXJ A;  3TSZ A;  3G4S T;  3RKY A;  1KQS A;  3M57 A;  4Z02 A;  1CSK A;  4KT0 E;  4DEY A;  2QAS A;  1U3O A;  4A54 A;  5DLQ E;  1VQ5 A;  2YWW A;  4A4E A;  2SRC A;  1RI0 A;  2NLU A;  1WNL A;  2JTF A;  1EFN A;  3F70 A;  1T0J A;  4PK4 A;  1RAC B;  1OOT A;  2M1H A;  4IIO A;  2ZPG B;  1QCN A;  2XG8 D;  2HMA A;  2GTJ A;  2EVR A;  4WCI A;  4N4G A;  2E41 A;  1I0C A;  4HCB A;  2R5M A;  3EG1 A;  4XU2 A;  4M7A G;  2CS7 A;  3CXC A;  3MEW A;  1JO8 A;  1WXU A;  1I81 A;  2QYZ A;  4F16 A;  5LJ5 f;  5IHN A;  2JNG A;  4DBF A;  2YLC A;  4OP0 A;  2MOX A;  3S6W A;  2DXU A;  1UEB A;  2EJG A;  1KQS P;  3PVQ A;  4PLI A;  3X28 B;  3GIB A;  3CCS A;  2B8A A;  5LJ3 e;  5I22 A;  1KHC A;  1VQ4 T;  1HSQ A;  4JPB W;  1ACM B;  5GAN e;  3HKS A;  1QVF A;  1M1K R;  3CCM Q;  4M7D A;  2FPF A;  2CH4 W;  4IKF A;  1IHV A;  4OGE A;  4A4K A;  4JUV A;  2P0Q A;  4EPC A;  1RUW A;  3RNJ A;  2FVU A;  1H64 1;  3LGL A;  3VS5 A;  3QPH A;  3RR6 A;  2QTX A;  1JU5 C;  2I0N A;  4J5Y A;  1YI2 A;  2F1L A;  1UDL A;  4EIK A;  1MV3 A;  4MML A;  1VQM Q;  1UUE A;  1SPK A;  4P5N A;  3PT9 A;  2LNH B;  4OMQ A;  1H92 A;  2FYK A;  2CP5 A;  1G3S A;  3CXC P;  3I9Q A;  2KXC A;  3EHQ A;  1XTD A;  1LCK A;  3L2W A;  3UF4 A;  4L6V 5;  2DBK A;  1MMG A;  4C92 G;  3R6O A;  3E2U A;  3CCL Q;  3OS0 A;  4J6Y A;  2DL4 A;  2LQN A;  5CIU A;  1Q95 G;  3CD6 A;  5IT9 E;  2ENM A;  2RJD A;  2KY9 A;  1UGQ B;  2FRW A;  3QKJ A;  2FO0 A;  4LXC A;  4XTV A;  2QEX A;  4M75 D;  1AOJ A;  4QQD A;  2D0Q B;  2K9G A;  5GAM d;  1M8M A;  3M0Q A;  5KYN A;  1ZUK A;  4MZP A;  2L2P A;  1WHJ A;  2O01 E;  1G3T A;  4ATO A;  1U5S A;  2BZY A;  2R5A A;  3CQT A;  2DM1 A;  3CC4 Q;  4LUD A;  1BB9 A;  2AK5 A;  4V2S A;  1YFN A;  3OS2 A;  4C5I A;  3MO8 A;  4WF2 A;  2EWN A;  1B34 B;  5CQX A;  5GJV B;  1SSH A;  2GF7 A;  3CCQ A;  2PU9 B;  2LJ3 A;  4LDU A;  3VS4 A;  3OS5 A;  4EMG A;  2ZPI B;  4OMF B;  4II1 A;  1TH7 A;  2LTO A;  2ZPE B;  4YTL A;  3JSC A;  4M7A A;  3M0S A;  3VRZ A;  2EQJ A;  3M0R A;  4M7D C;  1N9S A;  1WGS A;  3QHS A;  1NBE B;  1AWO A;  5M9O A;  2KSS A;  3RMQ A;  1WQ7 A;  1MHN A;  1YHQ T;  4PJO B;  2CSQ A;  4KRT A;  2XIC A;  4KUL A;  1VQ8 A;  3O5Z A;  1BIB A;  2V8I A;  2DZC A;  1FMV A;  4XTY A;  2COY A;  4PFP A;  1I8F A;  3HP9 A;  3RKX A;  4BI3 A;  2HEQ A;  2IG0 A;  1WHK A;  1YIJ A;  4F14 A;  4QVD A;  4C0G A;  1FMW A;  4PJJ A;  2DMO A;  1ARK A;  2AT1 B;  4J9E A;  1IGU A;  2A36 A;  2K57 A;  4BY6 B;  1VQ6 A;  3MEV A;  2K3B A;  3A5Z B;  3OYK A;  4KH1 B;  4CI0 C;  1TWB A;  2EQM A;  5GMK h;  4ORZ A;  4N0A C;  3G4S Q;  3QYG B;  1D1B A;  1BCO A;  1MV0 B;  2AKL A;  3S3O A;  1QVP A;  2DL5 A;  1PRM C;  5GAO q;  2XK0 A;  2J6K A;  2KRN A;  5GAO n;  1F1B B;  2EJF A;  2HAX A;  4ANJ A;  5I21 A;  5LJ3 j;  4OGC A;  2A37 A;  2FRY A;  2EYQ A;  3JCM c;  1YJN T;  2X9H A;  1VQ5 T;  1PD1 A;  2KI7 A;  3JCM h;  1RAE B;  5GAN j;  1VQL A;  2MAM A;  2EYX A;  2DAQ A;  3I5R A;  3EG2 A;  1K73 R;  4KGX B;  1D3B B;  1WIE A;  1YCY A;  4M75 G;  4PL6 A;  1TTH B;  4C92 A;  4C0F A;  2O4X B;  3QZ9 B;  1UFF A;  1C6V X;  1QCO A;  1OU9 A;  1DJ7 B;  2OX7 A;  4FW1 A;  2PTK A;  2CKK A;  4RTX A;  1M2V B;  2LT4 A;  3L2Z A;  3ZL7 C;  1CKA A;  1QP2 A;  3OYH A;  4AG1 C;  3CPW S;  2DVJ A;  5CCA A;  3OYY A;  3VKI A;  5KYU B;  2DER A;  4LN2 A;  1RAI B;  4C5E A;  1ZHI A;  2NUP B;  2FHD A;  2F69 A;  1W4S A;  1O9S A;  3NTI A;  1N27 A;  1SHF A;  2CH4 A;  2QI2 A;  1K4U S;  4PJO E;  1WJR A;  1BI3 A;  2JXB A;  1OZ2 A;  1RAH B;  3CCS T;  5KYW B;  4FM4 B;  1WJS A;  3PMT A;  2AIR B;  3VYH B;  1D1A A;  4PJL A;  2OTJ A;  5LJ5 h;  4J7I A;  4PKC C;  5FLX E;  2F5T X;  2AKK A;  1RAB B;  1OUL A;  1AZE A;  2RJE A;  3M58 A;  2X4J A;  3GNF B;  5LJ3 g;  4RG8 A;  1WHL A;  2D9T A;  2JT4 A;  5GAO r;  3VUZ A;  3C0C A;  4M78 G;  3P8D A;  1YI2 T;  5GAN g;  3SWN B;  1U06 A;  5KYY B;  1QVG S;  3JB9 H;  2L3P A;  2DL7 A;  1WA7 A;  2V1Q A;  4XQ3 A;  2MIO A;  1NPR A;  1Z9Q A;  3A1P A;  1ZA2 B;  2OAW A;  3CBM A;  3OMC A;  2P4T A;  4XK8 E;  5DM7 R;  4M7A F;  2HBW A;  1AWX A;  5GAN 7;  4MZM A;  1QVG P;  2G6F X;  2DVE A;  2DRK A;  3JCM P;  4QW2 A;  4GY5 A;  2LJ0 A;  1IGQ A;  4XTX A;  5I2S A;  3ER0 A;  3EFO A;  3JB9 G;  3Q1J A;  5D6Y A;  2KVQ G;  3M4Y A;  1SSF A;  3UAT A;  3G1J A;  2X4W A;  1MMN A;  3CD6 T;  4RTZ A;  1IO6 A;  4KUI A;  1PRL C;  4M77 G;  1X69 A;  5CAI A;  2QEX T;  4M7D D;  2CZ0 B;  4FYW B;  1QQJ A;  4RMO A;  3C94 A;  1VQO Q;  2XDD A;  2EFI A;  2EQK A;  2JVV A;  5D7U A;  3I56 Q;  1KSW A;  3MP8 A;  2DA9 A;  2MI6 A;  2R58 A;  3SFM A;  5GAM e;  4M75 A;  3H0F A;  2CDT A;  4AFZ C;  3CCE A;  1Q81 C;  1B7T A;  2JW4 A;  3OYM A;  4K11 A;  3A8L B;  3MHX A;  2NWM A;  3OYA A;  3CPF A;  3M9Q A;  4MZT A;  2YRD A;  3I55 A;  2O9S A;  3O8V A;  2HKQ B;  1VQ9 Q;  2E64 A;  4UC4 A;  1YHQ Q;  2KQW A;  1GXI E;  3EH2 A;  1V29 B;  3TEE A;  2VB6 A;  1ZSG A;  4J9H A;  1J3T A;  3VYG A;  2WSC E;  4IUU A;  3PMI A;  3NFC A;  1Q82 R;  4BDY A;  3QDR B;  4WTO B;  4EMK B;  5C6S A;  4C8Q G;  1VQ8 T;  2J06 A;  2IVW A;  4FYV B;  5GAN 8;  3BY7 A;  4RTT A;  1FWZ A;  3HFN A;  1VOM A;  2CT4 A;  2IIM A;  4J6X A;  4LD6 A;  2Y90 A;  1WX6 A;  1SG5 A;  4JLG A;  1QKW A;  1YIJ T;  2KT8 A;  2CYZ B;  4J6W A;  1TXQ A;  1V76 A;  5GJW B;  1VQ6 T;  2M0O A;  2D1X A;  1YJW A;  4QQ6 A;  5IAY A;  1K9A A;  2RPN A;  2E65 A;  2H8H A;  3HRT A;  1VUB A;  2DX1 A;  4FL6 A;  3S3M A;  2COZ A;  2RHU A;  2GBQ A;  1HJD A;  2L0A A;  3A98 A;  3J80 E;  2V8J A;  3P8B B;  9ATC B;  3KUF A;  4M78 A;  2LCS A;  4R56 A;  1VQ5 Q;  4HVV A;  2CP7 A;  1QMC A;  1WPY A;  4BY6 C;  1RAF B;  3E9F A;  3JCM J;  3OB9 A;  1UGV A;  2DZ9 A;  5LJ5 d;  2E70 A;  1BYM A;  2YUQ A;  3G6E A;  3LGF A;  1VQL T;  2ATC B;  2GTO A;  2W10 A;  1S1N A;  2XHC A;  1UB4 A;  4JLI A;  4J9B A;  5I11 A;  1Y0M A;  2QK0 A;  1Q81 R;  2KMT A;  2ECZ A;  2P0P A;  4HT9 A;  3INZ A;  1TUC A;  2CT3 A;  3C12 A;  5FU7 C;  1WQW A;  2A08 A;  2EYW A;  1W1F A;  4A4G A;  2OAU A;  3I5S A;  4DBR A;  5HK0 A;  3OW2 S;  4M77 A;  5LJ3 f;  1KC8 C;  1X2K A;  2M9U A;  5GAN f;  3GPL A;  4BUG A;  3L42 A;  5FRM A;  3QII A;  3V7S A;  5IN1 A;  4XU1 A;  5HKC A;  2KXD A;  3OW2 P;  4OMM A;  2COW A;  3ME9 A;  5ECA A;  3CEY A;  1YIT Q;  2ROT A;  3BDU A;  2F2V A;  3X26 B;  2MWP A;  3J7A F;  2YT6 A;  2NUT B;  3CC2 A;  2HD0 A;  3L1A A;  3GP8 A;  4NL2 A;  2X51 A;  5GAN 5;  1YJN A;  1GL5 A;  1W2B S;  4C92 D;  2J7I A;  1LPL A;  3CC7 A;  2MCN A;  5FU6 C;  2EQU A;  2BZX A;  1TSF A;  2YDL A;  2DJZ A;  3H0H A;  2OTJ T;  2DNU A;  3EG3 A;  2EIF A;  2KYB A;  1YI2 Q;  3JRZ A;  4C8Q A;  3OSV A;  5J26 A;  2DET A;  5A0G A;  2P4R A;  4M78 C;  2K7A A;  4M75 F;  1YJ9 T;  2RK1 A;  3A8O B;  1NPP A;  2SEM A;  3OYF A;  1D0X A;  4M7A B;  2PUK B;  2F2X A;  3CME Q;  3S3N A;  5KYX A;  3HFO A;  2D0N A;  5D6W A;  2W0Z A;  2RHX A;  2P0K A;  4B9W A;  3OYJ A;  4XTU A;  2DE0 X;  4RTY A;  5CKB A;  5CKH A;  5EG2 A;  5D6X A;  4IUV A;  3ASK A;  3CMA A;  3HRS A;  1I5O B;  3CD6 Q;  4O5V A;  1UGP B;  1D0Y A;  3EG0 A;  4R0K A;  3SWN C;  3D7S B;  4JDS A;  2QEX Q;  1X2Q A;  1IXD A;  4M77 C;  2QQA A;  2CP6 A;  2HBP A;  1C1A A;  1OYX A;  3QWY A;  1IRE B;  1AT1 B;  3H8Z A;  4J83 A;  1KC8 R;  1ZSZ A;  3TVT A;  3JCM W;  4XU0 A;  3M59 A;  1KQ1 A;  2MPX C;  2JM8 A;  2YHT A;  1B3Q A;  3EFS A;  4J9G A;  4DBH A;  2LJ1 A;  3TCJ A;  4F17 A;  3CCQ Q;  3CCE T;  2DJQ A;  5FWB A;  3E19 A;  1JEG A;  1N9R A;  1WI7 A;  2QG9 B;  4ZGE B;  2KDS A;  3OYN A;  2DFU A;  1YNZ A;  3PE0 A;  3I55 T;  2M0Y A;  5CQY A;  3HSB A;  3OS1 A;  2L3S A;  4RKU E;  4F7U G;  2E4H A;  3C95 A;  1TS9 A;  2V26 A;  1R77 A;  3OYB A;  4OVA A;  4J8O A;  1VQ8 Q;  5CKE A;  3MKD A;  4C8Q C;  4QQG A;  1K73 U;  1UG1 A;  2EYY A;  2J6O A;  1M90 U;  3TSW A;  2QGG A;  2KEA A;  4N0A A;  4OMN A;  5A0L A;  3T9N A;  3QJY A;  5IH2 A;  2QA4 T;  1YIJ Q;  3EGD B;  2JUF A;  4IUQ A;  2JTE A;  2GQI A;  1VQ6 Q;  2EKH A;  4E7L A; 
#chains in the Genus database with same CATH homology
 3CCM T;  4ELZ C;  5GAM j;  2YLB A;  3JB9 J;  4XTZ A;  3VV0 A;  1JJ2 S;  2XU8 A;  3CCQ T;  4JJN K;  1K8A C;  1X75 C;  1VQ7 A;  1K73 C;  2GFA A;  3FRN A;  1MGQ A;  1DJ7 B;  4EMK C;  2E10 A;  1X01 A;  3DB3 A;  4XU3 A;  4RCC A;  4M7A E;  2JZ2 A;  1WJQ A;  2CKK A;  1M90 C;  4DOV A;  4HT8 A;  1YJW T;  2K3Y A;  2LT4 A;  3L2Z A;  3CCJ A;  1Y07 A;  1NZ9 A;  4A53 A;  1Q7Y C;  5A0D A;  1QP2 A;  3KBG A;  1S72 A;  3OYH A;  1Y96 A;  3CPW S;  2RI3 A;  3LX7 A;  1Y71 A;  5LJ5 g;  5CCA A;  3OYY A;  3VKI A;  1VQM T;  2Y4X A;  2CGH A;  2E5Q A;  2KK4 A;  4M78 E;  4O6J A;  2XID A;  4C5E A;  3SB2 A;  2ZPH B;  2HQE A;  1ZHI A;  2FHD A;  2F69 A;  4E7J A;  1W4S A;  1O9S A;  3RUX A;  3EFR A;  2M16 A;  3NTI A;  4FT2 A;  1N27 A;  3FDR A;  1R8O B;  4IUP A;  1VQN T;  3G71 T;  2FB7 A;  2QI2 A;  3E9G A;  4PJO E;  1ZQ1 A;  1WJR A;  4PNO A;  1BI3 A;  2X35 A;  3LWI A;  3N5B B;  4BI8 B;  1OZ2 A;  3G6E T;  2LQK A;  4XAX B;  5LJ5 e;  4EMK A;  3CCS T;  1KHI A;  4FM4 B;  2LX9 A;  3MET A;  1WJS A;  2OTL T;  1O75 A;  2QQS A;  2EJ9 A;  3PMT A;  2HQX A;  4M7D E;  2PVG B;  3FB9 A;  3LYI A;  4MMK A;  2LNV A;  3VYH B;  5GAN 2;  3QYH B;  1XQH A;  4LDV A;  3FC3 A;  5LJ5 h;  2OTJ A;  4ZGD B;  4J7I A;  1VQP A;  1KG1 A;  4E47 A;  4IUR A;  4PKC C;  5FLX E;  1M8V A;  1X6O A;  2F5T X;  1VQO A;  2RI5 A;  4M77 E;  3I56 A;  1AHJ B;  2XKO C;  4QVZ A;  3CCV T;  2RJE A;  3M58 A;  2X4J A;  3GNF B;  3ZFJ A;  2RHY A;  3QG1 A;  4RG8 A;  2F5K A;  2A3L A;  2D9T A;  1M1G A;  3GNG A;  3NTH A;  4RG2 A;  3TRE A;  3VUZ A;  3CPW A;  5GAO r;  3CC2 T;  3HHT B;  2V8K A;  4M78 G;  3P8D A;  1YI2 T;  2VC8 A;  4M7A D;  2DD5 A;  5GAN g;  3EAE A;  3SWN B;  5CVI A;  2RO0 A;  1QVG S;  3JB9 H;  2WAC A;  4TVR A;  2LQ8 A;  4XQ3 A;  5GMK e;  1NPR A;  3AHU A;  2K3X A;  3JCM Q;  3KXT A;  3CCR T;  4OB2 B;  3MP6 A;  3HPW A;  3RIR A;  3DB4 A;  2RHZ A;  1YIT A;  4M78 D;  5KH6 A;  1LNX A;  1VIF A;  1JJ2 A;  3CBM A;  3OMC A;  2P4T A;  3CCL A;  4XK8 E;  5A2Q E;  2FL7 A;  5DM7 R;  3JCM X;  4DQ2 A;  2PQW A;  4L5G A;  4M7A F;  1YBY A;  4LDY A;  4M75 C;  5GAN 7;  4MZM A;  1VQ9 A;  2GFU A;  4C0Z A;  2L89 A;  4C0D C;  4F7U B;  2DVE A;  5CKD A;  3JCM P;  4QW2 A;  4GY5 A;  1YHQ A;  4B9X A;  4M7D G;  3OMG A;  4PJO D;  2LCC A;  2MMP A;  4D6W A;  3FIF A;  5GAM g;  2E6N A;  4XTX A;  2CZ6 B;  5J3B A;  5LJ3 h;  1BI1 A;  3ER0 A;  4Q5W A;  4M78 F;  5I2S A;  3JB9 G;  3Q1J A;  1M1K U;  1BIA A;  2RI2 A;  5D6Y A;  2KVQ G;  3M4Y A;  1SSF A;  3QO3 A;  3X24 B;  3JCM e;  4BI4 A;  3GOX A;  5GAN h;  4JS5 A;  2LT1 A;  3UT1 A;  1Q86 U;  2VUB A;  1ZBX A;  2X4W A;  3CD6 T;  4KUI A;  4F7U A;  3PGG A;  4M77 G;  4C92 B;  3L2V A;  4BE2 A;  5CAI A;  2QEX T;  4M7D D;  1EIF A;  2CZ0 B;  2RJC A;  4M75 B;  2LRQ A;  5DLO A;  2HNI A;  5CR2 A;  3CC7 T;  5GAN 4;  4RMO A;  3CXC S;  2L3R A;  3C4S A;  4PJO F;  3C94 A;  3JB9 D;  3LH0 A;  2EFI A;  2XDD A;  3CC4 A;  2EQK A;  5GAO p;  2DEQ A;  3JAM E;  3OA6 A;  2JVV A;  4C8Q E;  3MP8 A;  3V8L A;  2E6Z A;  3MEU A;  4M77 D;  2MI6 A;  2R58 A;  3SFM A;  1K9M U;  5GAM e;  1LJO A;  3OBY A;  3JCM f;  1Y7X A;  2LCL A;  4M75 A;  2Y4Y A;  1Q81 C;  3CCE A;  1M9S A;  2D6F A;  4M7D F;  1M1K C;  3OYM A;  3CME A;  3DLM A;  2EKO A;  3WVE B;  1P92 A;  3JB9 F;  4HA8 A;  2BIV A;  3A8L B;  3MHX A;  2WSF E;  3JB9 I;  2VYT A;  4MDW A;  4QVC A;  1Q86 C;  1Y96 B;  1QW1 A;  2L8D A;  4PLL A;  3OYA A;  3LWH A;  4M77 F;  3CPF A;  3M9Q A;  2GCX A;  4MZT A;  4N4H A;  4HCC A;  3I55 A;  3O8V A;  3G4S T;  3RKY A;  1KQS A;  3MP1 A;  3RER A;  3M57 A;  4Z02 A;  4KT0 E;  2E64 A;  2K5I A;  2QQR A;  4UC4 A;  1HK9 A;  1K9M C;  2WSE E;  2KQW A;  4X9C A;  4A54 A;  1GXI E;  1V29 B;  5DLQ E;  1VQ5 A;  1QVF S;  3A8G B;  3TEE A;  4A4E A;  4ZN1 A;  1QVG A;  3OYI A;  1LOJ A;  2K4Y A;  3VYG A;  3M56 A;  1RI0 A;  2NLU A;  3CCU A;  1WNL A;  2WSC E;  4IUU A;  2JTF A;  3NFC A;  3PMI A;  4GLK A;  5GMK m;  4ZTF A;  2R57 A;  5CK9 A;  2X4X A;  4BDY A;  3QDR B;  1Q82 U;  3F70 A;  4EMK B;  2XI9 A;  4ELY C;  5C6S A;  4C8Q G;  1VQ8 T;  3OYD A;  2IVW A;  5GAN 8;  2PUO B;  2H3J A;  3BY7 A;  5L8R E;  2M1H A;  2ZCF B;  1FWZ A;  3HFN A;  4OB1 B;  5HY6 A;  4BE0 A;  1VQO T;  2ZPG B;  4J6X A;  4LD6 A;  3I56 T;  2XG8 D;  3M55 A;  1N8R U;  3G7Z A;  3M53 A;  3PTA A;  2Y90 A;  3QJ6 A;  4C8Q D;  4J7F A;  4EDU A;  4JLG A;  4KBM B;  3PIO A;  3L2Q A;  5GAN 3;  3CCM A;  1VQK T;  1YIJ T;  4ME7 A;  1KQS S;  2CYZ B;  4NS5 A;  1UGR B;  4J6W A;  4N4G A;  2E41 A;  1UGS B;  4DOW A;  3ZBD A;  3QUI A;  1Q82 C;  1VQ6 T;  4HCB A;  2M0O A;  5LL6 S;  4C5H A;  3CBO A;  2R5M A;  4XU2 A;  4M7A G;  2DTO A;  2CS7 A;  3L2R A;  1YJW A;  4QQ6 A;  1I5L A;  3BDL A;  5J39 A;  5IAY A;  3CXC A;  3FEO A;  1B34 A;  3OYG A;  3MEW A;  2E1H A;  4BB7 A;  1YJ9 A;  4C8Q F;  1I81 A;  2E65 A;  3HRT A;  3UDC A;  3HRU A;  1JB0 E;  1VQM A;  1VUB A;  2K5L A;  1JBM A;  4EMH A;  4FL6 A;  3S3M A;  5LJ5 f;  1VQ9 T;  2DXB A;  1FXX A;  2JNG A;  1N8R C;  2RHU A;  2QQB A;  1G5V A;  2YLC A;  3J80 E;  2V8J A;  3P8B B;  4BDZ A;  2QQ9 A;  4R56 A;  3KUF A;  4M78 A;  5LJ3 g;  4OP0 A;  2MF2 A;  1PSE A;  1WPY A;  2JOY A;  3HL8 A;  3E9F A;  4BY6 C;  1M4Z A;  3OB9 A;  3S6W A;  3VUB A;  4F7U E;  3DLL A;  3JCM J;  2DXU A;  3G71 A;  2DXC A;  1BKB A;  2DZ9 A;  2JTM A;  5LJ5 d;  1UEB A;  2EJG A;  1IZ6 A;  5GAO m;  1XNI A;  4PJO G;  2RH2 A;  2E70 A;  2GQV A;  4FSX A;  4PLI A;  4NL3 A;  1BYM A;  3X28 B;  3G6E A;  3LGF A;  3GIB A;  1VQL T;  4ZN3 A;  3RMS A;  5KE2 A;  3CCS A;  5GMK l;  2B8A A;  5CO7 A;  1U1S A;  5LJ3 e;  1OI1 A;  2OTL A;  2VV5 A;  2XDP A;  1KHC A;  2XHC A;  3VU3 C;  1UB4 A;  4C92 E;  1VQ4 T;  1KQ2 A;  4JLI A;  4M75 E;  2PVO B;  5GAN e;  2CZ1 B;  3HKS A;  1QVF A;  1Q81 U;  2AHJ B;  4IUT A;  2KMT A;  4M7D A;  4FIB A;  2P0P A;  4HT9 A;  3INZ A;  1NJI U;  4IKF A;  4OGE A;  2I2L A;  4A4K A;  4JUV A;  2P0Q A;  4EPC A;  3C12 A;  5FU7 C;  1WQW A;  3CCV A;  2FVU A;  1H64 1;  3LGL A;  3MCA B;  3QPH A;  4A4G A;  3OQ5 A;  2QTX A;  2OAU A;  5HK0 A;  5GMK j;  3GLX A;  4J5Y A;  4C0D B;  5KE3 A;  4M77 A;  3OW2 S;  5LJ3 f;  3CBP A;  5CKF A;  1YI2 A;  1KC8 C;  2DD4 A;  2DK3 A;  3V8K A;  5I2M A;  1VQ7 T;  2M9U A;  2EAY A;  4MML A;  5GAN f;  2A7Y A;  2RM4 A;  2CZ7 B;  5DY9 A;  3GPL A;  4BUG A;  4OB0 B;  3LLR A;  3L42 A;  5FRM A;  3CCR A;  4XTW A;  4P5N A;  3QII A;  3CMA T;  2LVM A;  5IN1 A;  3PT9 A;  4XU1 A;  3RES A;  3BFM A;  3V7S A;  5HKC A;  3P8H A;  2DIG A;  2FYK A;  5LJ3 d;  5FU7 B;  3CCJ T;  4BAC A;  3OYL A;  1G3S A;  4RCB A;  1S72 T;  3OYC A;  3DKM A;  1NJI C;  3MEA A;  5GAN d;  4BE1 A;  1KD1 U;  3ME9 A;  1XTD A;  2RA2 A;  3CEY A;  2VGN A;  4N4I A;  4OB3 B;  3L2W A;  3JCM d;  3OBW A;  3QZ5 B;  4L6V 5;  3BDU A;  4FT4 A;  3X26 B;  4C92 G;  3R6O A;  2MWP A;  4FU6 A;  4A4F A;  3TU4 K;  3J7A F;  3OS0 A;  4J6Y A;  3OY9 A;  3CC2 A;  5KCO A;  5GAM f;  2C06 A;  2HD0 A;  3L1A A;  3GP8 A;  4NL2 A;  5GAO l;  4R55 A;  3QXE B;  5GAN 5;  4Y28 E;  1RL2 A;  5CIU A;  3CD6 A;  5IT9 E;  4HKE A;  1YJN A;  1H3Z A;  2RJD A;  2KY9 A;  4L59 A;  1UGQ B;  4MDX A;  4C5G A;  3QKJ A;  4XTV A;  2QEX A;  1W2B S;  2LDM A;  3SDZ A;  4C92 D;  4F7U F;  3CC7 A;  4M75 D;  5FU6 C;  4QQD A;  2D0Q B;  2EQU A;  5GAM d;  2XDB A;  2ZPB B;  4M7A C;  2K5F A;  3A8H B;  4JRI A;  1KD1 C;  2DJZ A;  3ZEH A;  2OTJ T;  1NE8 A;  2EIF A;  4MZP A;  1U8R A;  2O4X A;  1VQP T;  2O01 E;  1G3T A;  3FLG A;  3E1S A;  2QA4 A;  4ATO A;  1G3Y A;  2R5A A;  3JRZ A;  4E7I A;  4C8Q A;  3OSV A;  1BI2 A;  5J26 A;  1N6A A;  4KUD K;  4LD9 K;  5A0G A;  4C92 F;  4PJO B;  1OZ3 A;  4M78 C;  4V2S A;  4M75 F;  2LC4 A;  1M1F A;  2RK1 A;  1YJ9 T;  3OS2 A;  4E7K A;  3A8O B;  4C5I A;  1NPP A;  3MO8 A;  4WF2 A;  2EWN A;  1B34 B;  5CQX A;  5FU6 B;  4JRK A;  3OYF A;  2GF7 A;  4M7A B;  2PUK B;  3PIP A;  4HCZ A;  3CCQ A;  3S3N A;  2PU9 B;  3M4G A;  3PFS A;  3JCM b;  3HFO A;  3G4S A;  4PJO C;  5AYF A;  3WXM B;  1M5Q 1;  4LDU A;  3H6Z A;  3OYE A;  3OS5 A;  5D6W A;  2RHX A;  2P0K A;  3VJP A;  4EMG A;  1FX7 A;  4B9W A;  2ZPI B;  3RKW A;  3OYJ A;  3OW2 A;  4XTU A;  2QXF A;  2DIQ A;  4M78 B;  4OMF B;  2RHI A;  1TH7 A;  4II1 A;  1YIT T;  5CKB A;  2LTO A;  2ZPE B;  3V7R A;  3V7C A;  4YTL A;  3JSC A;  5CKH A;  5EG2 A;  4M7A A;  2RJF A;  3CCL T;  4ZTJ A;  5D6X A;  2EQJ A;  3JCM V;  4M7D C;  3M5A A;  1N9S A;  1WGS A;  3ASK A;  1XOV A;  2RD1 A;  4IUV A;  3M54 A;  3QHS A;  3X20 B;  4A4H A;  1PSF A;  3HRS A;  3CMA A;  5M9O A;  2KSS A;  3RMQ A;  4X34 A;  1WQ7 A;  1MHN A;  4O5V A;  1UGP B;  1YHQ T;  5C0M A;  2XIC A;  4KUL A;  3SWN C;  5HK3 A;  4JDS A;  5FRN A;  1VQ8 A;  1BI0 A;  2X4Y A;  4M77 C;  2QDY B;  2QQA A;  1BIB A;  1VQN A;  2V8I A;  2DZC A;  3WVD B;  5LJ5 j;  2HBP A;  1OYX A;  1IRE B;  4XTY A;  3H8Z A;  3OSS C;  2VXE A;  1I8F A;  4M7D B;  3HP9 A;  3UPU A;  4J83 A;  3UWN A;  2VXF A;  4X9D A;  2E12 A;  3RKX A;  4BI3 A;  1KC8 U;  4PJO A;  2IG0 A;  4ZGJ B;  3JCM W;  1VQK A;  1YIJ A;  4XU0 A;  3M59 A;  4QVD A;  1KQ1 A;  4C0G A;  3CC4 T;  2BUD A;  2DTH A;  2K57 A;  4M77 B;  4BY6 B;  1JRI A;  1VQ6 A;  2YHT A;  4LDW A;  3JCM g;  1W2B A;  2BKD N;  3MEV A;  3EFS A;  1U1T A;  3QBY A;  2DPP B;  3TCJ A;  3NTK A;  3A5Z B;  3CCE T;  3OYK A;  4CI0 C;  2EQM A;  2JN0 A;  3PNW C;  5GMK h;  3CME T;  2XD0 A;  2K2V A;  4N0A C;  2KAF A;  3BW1 A;  3E19 A;  1N9R A;  3QYG B;  5GMK i;  3QSU A;  3SWN A;  4C92 C;  3S3O A;  3URG A;  1QVP A;  5GAO q;  4JRQ A;  2XK0 A;  2KDS A;  4ZGE B;  3OYN A;  2DTI A;  2ZZD A;  2MWO A;  4OF1 A;  4JRP A;  4BD3 A;  5GAO n;  3I55 T;  2EJF A;  3GF5 A;  4LDX A;  2RK2 A;  5CQY A;  3HSB A;  3OS1 A;  3LW5 E;  4RKU E;  3L2U A;  2HAX A;  5FRO A;  4F7U G;  5I21 A;  3C95 A;  1HXD A;  5LJ3 j;  1G3W A;  4OGC A;  4CRI A;  2EYQ A;  3JCM c;  3OYB A;  4OVA A;  3X25 B;  4J8O A;  1YJN T;  1VQ5 T;  3JCM h;  5GAN j;  1VQL A;  5CKE A;  2MAM A;  1K8A U;  1QP3 A;  2RB6 A;  2DAQ A;  4QQG A;  3SD4 A;  4C8Q C;  2PVD B;  5KCH A;  4DA4 A;  1K73 U;  4VUB A;  3CCU T;  2ZPF B;  2ZGW A;  1VQ4 A;  1D3B B;  1M90 U;  4JS4 A;  1YCY A;  4Y91 A;  4M75 G;  4PL6 A;  2G3R A;  2YRV A;  4N0A A;  1Q7Y U;  5A0L A;  1VIE A;  2L5Q A;  2VGM A;  3T9N A;  3QJY A;  4C92 A;  2QA4 T;  3A8M B;  4NOY A;  2JUF A;  4IUQ A;  1I4K 1;  4C0F A;  2O4X B;  3QZ9 B;  3V8J A;  2DO3 A;  3J81 E;  2DXT A;  5GAM h;  3FJP A;  1D3B A;  4C8Q B;  5GAN 6;  2DKG A;  4E7H A;  4E7L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...