3JCMQ

Cryo-em structure of the spliceosomal u4/u6.u5 tri-snrnp
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
90
structure length
89
Chain Sequence
b'ELEEFEFKHGPMSLINDAMVTRTPVIISLRNNHKIIARVKAFDRHCNMVLENVKELWTEKKKNVINRERFISKLFLRGDSVIVVLKTPV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pre-mRNA-splicing factor 8
molecule tags Transcription
publication title The 3.8 angstrom structure of the U4/U6.U5 tri-snRNP: Insights into spliceosome assembly and catalysis
pubmed doi rcsb
total genus 11
structure length 89
sequence length 90
chains with identical sequence U
ec nomenclature
pdb deposition date 2015-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3jcmQ00
3BDUA 4A54A 3EFRA 4A53A 4JRKA 4MMKA 5GANg 5GAOp 3BW1A 1LOJA 3JB9D 3BFMA 3RERA 4M77A 2RA2A 4J6YA 4XTYA 3FIFA 2VXEA 3INZA 5LJ3h 2E65A 4M7AF 4M77C 3QHSA 2E10A 1MGQA 4XTUA 4XU3A 4C92A 5GMKe 1U1TA 5LJ5g 4PJOF 4C8QB 2DJZA 1N9RA 4F7UF 4M77F 4HT8A 3JCMf 5GMKj 4C92C 1WQWA 5GAOl 3RESA 4JLIA 2EJ9A 4M75B 3RKWA 4PJOA 4F7UA 4EMKC 3JB9I 1Y96A 1M8VA 3JCMW 4RCBA 3SWNB 5GANh 2K57A 5GAN4 4PJOG 3QO3A 1D3BB 4X9CA 5GAN3 2YHTA 4F7UB 4RCCA 1H641 1B34A 1WQ7A 4C8QC 5GANe 5GAN6 2EWNA 4NL3A 4X9DA 4HT9A 4M75F 2RB6A 3QSUA 2DZCA 4M78E 1WNLA 3HFOA 5GMKi 4M7DB 1JBMA 3JCMh 3SWNC 3JB9H 5DY9A 1I4K1 3AHUA 4XU1A 5GMKh 5GAOq 4DQ2A 3EFSA 3FJPA 2DVEA 4PJOE 1M5Q1 2DXUA 4M7AG 2JN0A 2DTHA 3BY7A 5LJ3f 4M7AA 5GAMh 2DTOA 4M7AE 2DZ9A 5LJ5h 4M7DF 1X01A 5GANj 3L1AA 3M4GA 4XU0A 3JCMJ 2DKGA 5LJ3j 4XTWA 1D3BA 5GANd 3V8KA 3JCMd 4F7UE 4XU2A 1BIAA 3SB2A 4C8QG 3JB9F 4C8QF 3JCMX 4QVDA 5GAOr 4C8QD 4J6XA 4PJOC 1YCYA 4M78F 4EMKA 2DEQA 3JCMQ 1TH7A 4C92F 3VU3C 4C92G 4J6WA 5CAIA 5LJ5e 5GAOn 3JCMP 1KQ2A 3V7RA 4M77E 5GAMe 1KQ1A 1WPYA 2E1HA 4M7DD 2EAYA 3V7CA 2DXTA 4F7UG 3JB9J 3PGGA 4M78A 4XQ3A 5GAMj 3JB9G 4M75D 3JCMe 5GMKm 4XTVA 1JRIA 4N0AA 4EMGA 3RKYA 3JCMg 5GAN8 4M7AC 4C92E 2HNIA 2I2LA 4N0AC 5LJ3d 4QVCA 5GMKl 5GAN2 5GAN7 1B34B 4M7DG 3V7SA 4EMKB 4PNOA 3JCMb 2VXFA 4C8QE 5GAMg 4NL2A 2E64A 2QTXA 2YLBA 4OP0A 3V8LA 5GAN5 5LJ5d 2FB7A 1HK9A 1BIBA 1N9SA 1I81A 2RM4A 1LNXA 3L2ZA 4J5YA 4M78C 2CGHA 5GAMd 4PJOD 4PJOB 3RIRA 4M77B 2YLCA 2ZGWA 4M7AD 3FB9A 3RKXA 5LJ3g 1LJOA 4M75G 4M77G 4M7DC 5GAMf 2RD1A 4M75A 3QUIA 4M77D 4HA8A 2EJGA 4NOYA 3V8JA 2E41A 4XTZA 5I21A 3JCMc 1U1SA 2FYKA 4M75C 5LJ3e 3HSBA 4M78B 4C92D 4C92B 1I5LA 2DTIA 4WF2A 4EMHA 4M7DE 1Y96B 4C8QA 4JRIA 2EJFA 4MMLA 1HXDA 4M78G 2VC8A 2Y90A 4V2SA 4M75E 5GAOm 4XTXA 3GIBA 4JUVA 1I8FA 4M7DA 3JCMV 3SWNA 4M7AB 5LJ5j 5LJ5f 4M78D 3RUXA 3HFNA 5GANf 4Y91A
chains in the Genus database with same CATH superfamily
2CSIA 3CC2A 2K79A 3QDFA 1D0YA 1M90C 1AZGB 3QYGB 1B7TA 2A0FB 2MF2A 2DJZA 4OMLA 1VQ4T 3REAB 4OMOA 2EFIA 3H9NA 3WXMB 2KEAA 2FZGB 4ZN3A 4MZTA 3QO3A 1SKUB 2GFUA 1VQNQ 1UGSB 4NL3A 2HBPA 1M2OA 3MEUA 3EFOA 1OQKA 2LQWA 2V1RA 3CCJT 2FO0A 2KR3A 4Z8AA 4PJOE 4X1VA 2V8IA 2LNHB 3MP8A 1YNZA 2LMJA 3MKDA 2FZCB 1TUCA 2ECZA 3CCVA 2L3RA 1QVFS 3ME9A 3RDVA 2CS7A 4M7AC 4OF1A 3G71T 3MHXA 2OJ2A 1BBZA 1JXMA 3THKA 4PFOA 1VQMQ 1NJIR 1N6AA 1Y0MA 3RKYA 5AT1B 5GAN8 3VS2A 5FU7B 2ZAEA 2VXFA 1F1BB 4OP0A 1WA7A 1ACMB 1WHLA 2L0AA 2QEXT 3HL8A 4OMPA 1YITT 4PJOD 1YWOA 3KFVA 2Z0WA 2GF7A 1MMDA 3KBGA 2F2WA 3I9QA 1VQOT 4M7DE 1FWZA 2HDAA 4C0ZA 2EJFA 3MEVA 2X4YA 2IPOB 1VQOA 1VQ8A 1VYTA 1SHGA 2R5AA 3BDUA 4FW1A 2W10A 4JRKA 4LN2A 1TU0B 4A53A 5GANg 3OW2A 3G1JA 1VQ6A 3E9FA 3FIFA 1S72Q 4E7HA 2L8DA 5GMKj 1WJSA 3CMEQ 2KAFA 5GAOl 3M59A 1WJQA 4J7FA 3VUZA 4RCCA 2HAXA 2L5QA 4ANJA 4A4HA 1WNLA 3TU4K 1IO6A 4AG1C 3FJPA 3O5ZA 1RAEB 2DTOA 1OZ2A 2K9GA 1K8AR 3QZ9B 1WFWA 1K9MR 2RHXA 1BI1A 1ZSZA 2CP3A 2DD5A 3BE3A 2LQ8A 2XI9A 4P5NA 2C0IA 2DYIA 1YWPA 2XDDA 2RQUA 5CAIA 3M0QA 1FMVA 2V8KA 4FU6A 1EZZB 2EQJA 4JJNK 1Q86U 5KE3A 2X4JA 2CUBA 3C95A 4M7DG 1QW1A 5GAN2 2F1LA 1XOVA 1HK9A 2MMPA 2L89A 3RKXA 5HY6A 5CVIA 2EBPA 1LPLA 3QJ6A 3V8JA 3CCRQ 3QKJA 3JCMc 5FWCA 3X20B 2RHIA 3EFOB 2ROLA 4C8QA 1BCMA 2DFUA 2JNGA 3G4SA 3CCUQ 2KVQG 1VQ9T 3EHRA 4BACA 1BU1A 3CMAT 4KGXB 4E7LA 4A54A 1K1ZA 2BZ8A 1K4US 1QP2A 2EGCA 2L3SA 1WHGA 2JXBA 1KQSA 2EKOA 1V76A 3TVTA 1WX6A 1G3SA 2B8AA 4PFZA 5D6WA 4C92C 3CCSA 3REBB 1KJWA 1OX9A 3JB9I 1TG0A 2BE9B 3SWNB 1SRMA 4DOVA 1D3BB 1UDLA 5I11A 1TUDA 3SHWA 1VQMA 3A8OB 2NUZA 4M78E 3H8ZA 1WGSA 1IB8A 3OYFA 1X2QA 4BE0A 5C6SA 4PL6A 1M30A 4QT7A 4KULA 2YSQA 1ZUYA 2DIQA 5D6XA 5CQYA 2CT4A 2O9VA 4J6XA 1W6XA 1XTDA 2DVJA 3L2UA 2LVMA 3VU3C 3G6EA 3VS6A 3URGA 2DL7A 3V7CA 4KUIA 3OBWA 5GAMj 2AKLA 4YTLA 4M75D 2AHJB 2OAWA 4AMCA 3EGXA 4A4EA 2E12A 1YJ9A 1HYOA 2F2VA 4B9XA 1YIJQ 1XQHA 4ZGJB 1VQPQ 5HKCA 4PJNA 4CRIA 4L5GA 1Y7XA 3RIRA 3X26B 5FWBA 1NEGA 1WHKA 4LE9A 4E7ZA 1YITA 1R0BG 3KXTA 1QWEA 1RI9A 2A37A 1JEGA 1U06A 1H3ZA 4Q5WA 1ZUUA 5GAOm 1W2BS 1I8FA 2E5KA 2EYQA 2EVRA 4IIMA 1YJWT 3VV0A 1YN8A 2GQVA 3BFMA 5HK0A 4M77A 4XTYA 3GP8A 4A4KA 3PMTA 8AT1B 4CI0C 1TS9A 1VQMT 4PJOF 2EQMA 1UHCA 4OMFB 4DBHA 2CP2A 1FXXA 5A0LA 1MNDA 3MCAB 4Y92A 3ZFJA 3A1PA 3CBMA 1YI2A 2OTJQ 2QEXQ 1WQ7A 3PIOA 3CCQQ 3NTIA 4X9DA 2XK0A 2DL3A 5L8RE 1WZOA 1CKAA 5GMKi 4R0KA 3CCST 3SEMA 3H0IA 3MO8A 3MPUB 3VKIA 3C0CA 3OW2P 3AHUA 4UC4A 3GNGA 2E5QA 6AT1B 1KFZA 5J39A 5A2QE 2JMCA 1TUGB 2ZZDA 3OS5A 4CC2A 3S3OA 2M0OA 2YUQA 2A3LA 3NTHA 1M27C 1N5ZA 2FVUA 5FU6B 3JCMX 1UUEA 1E6HA 2A7YA 2JVVA 1G5VA 3JCMQ 4C92F 3JCMP 1KQSP 5LJ5e 1KK7A 2GCXA 3AT1B 1UGVA 2HQXA 3G4SQ 4M78A 4XQ3A 4ZTJA 3QZ5B 2HD0A 3PMIA 1N8RU 1O9SA 2H3EB 2VUBA 4EMKB 1OU9A 4B9WA 5EC7A 3OYBA 2D8JA 1UHFA 4M78C 1RI0A 1LNXA 2JW4A 2RK1A 2DBMA 4LD9K 1QQJA 1H8KA 3OYJA 3S6WA 3FB9A 4E7IA 4WCIA 4EPCA 2NUPB 2RPNA 2MWPA 5D6YA 2RNAA 4XTZA 1WJRA 2JTFA 3ZEHA 4O6JA 4J8OA 4WF2A 2R5MA 1Y96B 5KYUB 1PRMC 2KK4A 3QPHA 1M90U 2QQBA 2W0ZA 4N4HA 2M16A 3SWNA 4C5GA 2P4RA 1M3AA 1C0MA 3ZL7C 2VXEA 1H3HA 3VS3A 3CD6Q 3RMQA 4M75B 1YJWQ 2ZPHB 4F7UA 1JJ2P 1VQ5T 1K0SA 1H641 1RLQC 5GANe 5A0DA 1NJIC 1N27A 2RB6A 3QSUA 1GRIA 4IIOA 2RHYA 3JCMh 3CPWP 1YIJA 1WXTA 3EG9A 3LH5A 1T0HA 1VOMA 3M4GA 1SRLA 5LJ3j 4J9IA 4JJBA 2WSEE 4RUGA 5KYUA 4C8QG 3CMAQ 1UGRB 3P8HA 2EGAA 1KC8U 3EG0A 2DEQA 3LLRA 5GAOn 2LJ3A 4MZPA 4B6MA 2P0KA 4A63B 3CC7A 2RO0A 4LDUA 3V7SA 4OB2B 2F5KA 1N8RC 4NL2A 2QTXA 2YLBA 1YJ9T 4RTTA 1T3SA 2MAMA 2RM4A 4KT0E 2BIVA 1UJYA 2XKOC 5FU6C 2K2MA 1OZ3A 5IN1A 4D8DA 2JM8A 4M7DC 2RJCA 2X51A 4OVAA 1U1SA 1KD1U 2JOYA 2QASA 1VIFA 1VQ7Q 2KBTA 5CKHA 5IT9E 4M7DA 2J6OA 2YRDA 5IXBA 3T9NA 4C0DB 3RUXA 2AZVA 1KC8R 3VS1A 3L2VA 3HRUA 2BZYA 5DLQE 1XNIA 3OYEA 1AWXA 1JO8A 1J3TA 1VQ4Q 2CUDA 2OTLT 1WHHA 2E10A 1RAAB 2I0NA 2QI2A 1N9RA 4LD6A 4HXJA 4F04B 3RESA 4F14A 1YIJT 1UGPB 1T0JA 1A0NB 2FPDA 4J7IA 2GFAA 2XG8D 4PLIA 2MYSA 2VASA 3A8HB 2KGTA 1M3CA 4HVUA 2HQHA 3SWNC 5GMKh 2KY9A 2EPDA 2DVEA 4WTOB 4M7AG 4LDVA 4J9EA 2V26A 4HVWA 2FL7A 5CR2A 3TREA 3I35A 2COYA 1UB4A 2F69A 1X75C 4BY6C 3V8KA 3I56A 1QKXA 2DXCA 2VKNA 3FRNA 2QXFA 3QXEB 2LJ1A 1YCYA 3QWXX 2ZPEB 3L2QA 2RI2A 2ZPGB 4HKEA 4XK8E 2BZXA 2D6FA 2SRCA 3OYGA 4QVZA 1TTHB 3JCMe 1AZEA 1JRIA 2CT3A 3HPWA 3M9QA 2X9HA 3OYAA 3M0SA 5LJ3d 1WHMA 1JQQA 5GAMg 5GAN5 4C0GA 3UATA 4AFZC 1N9SA 3CBOA 2YRCA 2DRKA 2QG9B 1PSEA 1I5OB 1YITQ 3NMZC 3I5RA 4RG2A 2O9SA 3DKMA 1AT1B 1QVGP 1HD3A 1UJ0A 1YJ9Q 4OB1B 3CCMT 4M75C 1V1CA 2CZ7B 4IUPA 1VQ6T 4M78G 2X3XD 2KROA 2E70A 4FYWB 3EG9B 2VGNA 3UA6A 3P8DA 1Q7YR 1YJNQ 5LJ5j 1ZSZC 2JTMA 2PTKA 2MI6A 2X3WD 3P8BB 1ZQ1A 4J6YA 1VQ8Q 3M54A 3WVDB 2DK3A 3INZA 3PT9A 2E65A 4M77C 5GMKe 2GTJA 1D0ZA 3S3NA 5CIUA 1VQ4A 3OQ5A 4X9CA 2YRVA 1H92A 1K73R 5KCOA 1D0XA 4MDWA 4BUGA 3HFOA 2DPPB 2JMAA 2L3PA 4E7SA 4FYXB 3M5AA 4F17A 3OSVA 3VYHB 2O01E 3D7SB 5D7UA 1OI1A 1X27A 2LC4A 2RF0A 1UECA 3UA7A 3VYGA 5LJ5h 3EGXB 4E7JA 1GFDA 1XJWB 2DE0X 3CCEA 1WXBA 2DX1A 4F7UE 4LDXA 1EX4A 1NYGA 2DJQA 2EYXA 1OOTA 2B86A 2LDMA 3ASKA 4N4IA 4C8QD 3CPWS 3SFMA 1QVGS 4C92G 4AT1B 1KQ2A 2M9UA 3QWYA 3A8GB 1KSWA 4RTUA 2MPXC 4EIKA 2D0QB 3UDCA 2SEMA 1SG5A 5IXFA 1K73C 3CC7Q 1Z9ZA 2I2LA 1VQ5Q 2XICA 1PWTA 5FROA 2HKNA 4ME7A 4ATOA 3LGLA 3L2ZA 1NLPC 4LDWA 1VQKQ 3CCQA 2D1XA 3M58A 2C0TA 3MEWA 3I5SA 3KUFA 1E6GA 2VVKA 1UTIA 3CBPA 2E41A 4M78B 4C92D 1KIKA 4LUDA 1QVGA 3CCLA 4FW2A 4KH1B 1GBQA 2CDTA 3CPWA 2QGGA 2KYMA 4C5EA 4TVRA 5LJ5f 3CC2Q 2K3XA 4MMKA 3OBYA 2HZYA 3A8LB 2CZ0B 5CK9A 1D1BA 1WDXA 1U1TA 3UF4A 1NYFA 3RKWA 1Y96A 2DIGA 5I22A 5GANh 4HCZA 3C4SA 1PD1A 2CH4A 5DLOA 1PM3A 2LCSA 4E2FB 1GCPA 3HKSA 2RN8A 1G3TA 2FHDA 2LNVA 2GGRA 3CCLQ 3E19A 2GNCA 2DXUA 4C5IA 3G71A 3I56Q 5GANd 2RH2A 2EIFA 4RTXA 4AFQC 2O31A 1QVFA 1E7OA 4XU2A 2C0OA 3RBBB 2BE7D 4BE2A 1EIFA 2RI3A 2BUDA 4AG2C 3EGDB 4M77E 5FRMA 1NPRA 1HJDA 2KXCA 3CCET 4MDXA 1M1GA 1RACB 4M4ZA 1SEMA 4EMGA 3A98A 1Y07A 4BY6B 1M2VA 1BCOA 2OI3A 2RK2A 1IHVA 1M90R 1OEBA 3V8LA 2LZ6B 2AKKA 2COZA 4J5YA 1I81A 1VQLA 1RUWA 3CC7T 5FLXE 2DD4A 2RD1A 2RQTA 4DBQA 3CCJQ 1RAFB 3TEEA 1ZSGA 1X43A 1QP3A 2RHZA 1KC8C 2M1HA 4CC3A 3Q1JA 4OMQA 3CXCA 2OTLA 3OYYA 4PLLA 4OGCA 4OGEA 3M56A 2M02A 3X25B 3CC4Q 2CKKA 1IGQA 5GJWB 2CZ6B 1GXIE 2FEIA 2QDYB 2YXYA 1MGQA 1PKSA 4C8QB 1AVZC 5CKEA 3TCJA 2LX7A 1W70A 4KGVB 2J6FA 3QBYA 7AT1B 2LQNA 3JCMW 3J80E 2DO3A 2KE9A 1RLPC 2NUTB 3EGUA 5AYFA 2XIDA 2RJDA 4BI3A 2VWFA 2FPFA 4DA4A 2R58A 2JN0A 2DTHA 3JV3A 3OSSC 4DBRA 1SPKA 4ZGDB 3CCVT 2K3YA 2MOXA 3J7AF 1K9AA 1C1AA 1ZBXA 4ZNXA 2HQEA 2P84A 4C0FA 4QVDA 4FM4B 4J6WA 4J83A 3V7RA 4JZ3A 1IHWA 2X35A 1S1NA 2V8JA 1PRLC 2JTEA 1QKWA 1SHFA 5CKBA 4HVVA 1QCFA 2VV5A 3RMSA 1K0XA 1BKBA 2ZPFB 3M4YA 1YBYA 1S72A 2HNIA 1VA7A 1B34B 4RG8A 3CCMA 4F16A 1WHJA 1B07A 3PE0A 3PVQA 2E64A 2GQIA 2FB7A 3S3MA 5GAMd 1UGQB 2YLCA 2P4TA 4KUDK 3M0TA 2DLPA 4M77G 5GAMf 3GPLA 2MCNA 2YDLA 3G6EQ 4E7KA 1JJ2S 1KG1A 3META 4HA8A 4NOYA 2HEQA 3HSBA 3EG1A 1ARKA 1I5LA 2DTIA 2NUTA 2E4HA 4AFSC 1VQLT 2K2VA 1HXDA 2PNIA 5J3BA 1MV0B 2VC8A 3MP6A 2Y4YA 4XTXA 3VRYA 2CP0A 1YJWA 2C06A 1OPLA 1R77A 1VYUA 1WXUA 4JRPA 4QQ6A 1G83A 1K8AC 5GAOp 3BW1A 3L2WA 3CD6T 1WYXA 4MZMA 1IREB 1P92A 1NJIU 1YCSB 2RQWA 5A0GA 3I55Q 3CCJA 4NS5A 2JS2A 1JU5C 1R8OB 1MMNA 2G6FX 2YHTA 4JJCA 1B34A 2M51A 2DL8A 4HT9A 2DEUA 4E47A 2XU8A 3CC4A 3G7ZA 2QAZA 4PJJA 5C0MA 2D9TA 5FRNA 3BDLA 4DQ2A 3GOXA 3EFSA 1LCKA 1M1KC 2K5LA 1LVKA 2R57A 2A28A 2DYBA 1TWBA 4JPBW 3EG3A 1M3BA 1BIAA 1VQ9Q 2XMFA 1KQSS 1W4SA 4FYYB 5IHNA 1IXDA 1DJ7B 4M78F 2E6NA 3CCVQ 2J05A 2EQKA 4M7DD 4ELYC 4OB0B 2LJ0A 2EKHA 4C0DC 2H3JA 3UPUA 3X24B 1IZ6A 4Z89A 1Q82C 1VQ7A 1ZBJA 1Q95G 3OYCA 3ZBDA 4PKCC 4RTWA 1K73U 4LUEA 2HKQB 1AWWA 1PD0A 3F70A 4DEYA 1NM7A 1VIEA 2EGEA 2YUOA 4A4GA 2LTOA 2GTOA 2P0QA 4EMHA 1X69A 3CMAA 3NGPA 2KSSA 4MMLA 2Y90A 5FU7C 4KH0B 1R0CB 3CEYA 3GIBA 1FMWA 3NTKA 3VRZA 4OMNA 2ZPBB 1FX7A 4FSXA 1LOJA 2CP6A 3OMGA 2J06A 4JRQA 2RA2A 1SF9A 3OY9A 5KYWA 2QK0A 4M77F 3JCMf 2EYZA 4HCBA 2VYTA 4XAXB 1QVPA 2ESWA 1JJ2A 5GAN4 2DXBA 1M2VB 2EWNA 2KDSA 3GBQA 4PJLA 4DBFA 3OYDA 3O8VA 3I55T 3HRTA 1Q82U 3JB9H 3MJXA 5IH2A 5GAOq 1GBRA 1V29B 5GAMh 3LWHA 3M0RA 4AFUC 2FG0A 1CKBA 5LL6S 3CC4T 2WSCE 1G3WA 4RKUE 1TSFA 2CP5A 4K11A 4CC7A 2AT1B 1T3LA 1M9SA 1KQ1A 2DBKA 2DRMA 2EAYA 4F7UG 3IQLA 1Q81R 2LRQA 2BKDN 4J9DA 2DILA 2YWWA 1RAGB 3CCSQ 3FEOA 1W1FA 3HRSA 4C92E 2ATCB 4QW2A 3M55A 3M57A 4PFPA 1BYMA 2RJEA 4R56A 2FZKB 2A08A 4KBMB 4R55A 2JT4A 2DL5A 2QTVA 4ZN1A 1LJOA 4M75A 2J7IA 1IRXA 3EGDA 4M77D 1UEBA 1BB9A 1TOVA 2KMTA 1VUBA 1JXOA 1YP5A 4JRIA 4GY5A 1AHJB 3QDRB 3PFSA 2ABLA 4L59A 1BK2A 3CCUA 2XDBA 1NLOC 1CSKA 3M53A 1QMCA 5I2MA 1PC0A 1GFCA 2K5FA 2BTTA 1VQ8T 3X28B 2IVWA 3U23A 3JB9D 1YI2Q 2OTJA 3SD4A 5LJ3h 4ORZA 2ROTA 3G4ST 1KHCA 4XTUA 4XU3A 3M0UA 4RTZA 4F7UF 1VQNA 1I1JA 3GLXA 2KT1A 1VQNT 4PJOG 3VUBA 2KYBA 4C8QC 4GLKA 2DZCA 3DLLA 4KGZB 2VGMA 2XHCA 1B3QA 3JAME 1I0CA 3QG1A 4XU1A 1K8AU 1M5Q1 9ATCB 3VJPA 3BY7A 4FT2A 3VS4A 3L2RA 2DZ9A 1X01A 3JCMJ 4XU0A 3HP9A 4RTYA 1NG2A 2HSEB 2EYYA 2QYZA 1OPKA 1Y57A 5CQXA 1U3OA 3G71Q 4L6V5 2PUOB 2AZSA 2DL4A 1TH7A 2O4XA 1Q86R 1WPYA 2RMOA 2JUFA 3OYNA 1PNJA 2RQRA 2J6KA 4XTVA 1ABQA 2NWMA 3TQ7P 2QGFB 5GMKl 1VQKT 4LXCA 1G8XA 1PSFA 1MMGA 2K4YA 1Q86C 2ZGWA 2YUPA 4M7AD 1MV3A 1EFNA 2QQSA 3DB4A 2E3IA 1VQOQ 1IGUA 1W2BP 1SSHA 2CH4W 2OTJT 3E2UA 5KYYA 2NLUA 1NE8A 3M0PA 3CCQT 1I07A 1OU8A 4M75E 3CC2T 2DERA 2L3QA 3JCMV 5DM7R 3LX7A 2LQKA 4BE1A 5GANf 4Y91A 2QA4T 4KRTA 1UE9A 3N5BB 2O88A 3LW5E 3CMET 1NEBA 3CXCP 4DEXA 2JJ9A 3QHSA 3QIIA 1QLYA 4C92A 4J9GA 4JLIA 1PKTA 2O4XB 5GAN6 3R6NA 4O5VA 3I56T 2PU9B 4M7DB 3OA6A 4J9HA 4ELZC 4DOWA 1NZ9A 4D8KA 4QQDA 1YI2T 1RADB 2NUPA 2OAUA 1BI2A 2PZ1A 4M7DF 3L1AA 2H8HA 1QCOA 2DKGA 2MK5A 3H0FA 3JCMd 3CCEQ 3SB2A 1PHTA 5GAOr 4EMKA 3CCRA 2G3RA 5KH6A 2DXTA 2Y4XA 2K7AA 1M8MA 4JLGA 1ABOA 2MIOA 4RMOA 1AD5A 3JCMg 3OYHA 2FPEA 2QEXA 2ZPIB 4N0AC 5CKDA 3OYMA 3JCMb 1KHIA 3UT1A 4FIBA 4C8QE 5HCKA 1WIEA 5LJ5d 3TSZA 2HCKA 1WLPB 3EAEA 1AEYA 2ED1A 3GNFB 2RJFA 1YHQA 1UG1A 1ZA1B 2CSQA 2FYKA 2QA4A 2KXDA 5KCHA 3CCUT 3UWNA 2MWOA 3FLGA 2AIRB 1TXQA 3CPFA 1OX8A 2JZ2A 4V2SA 2KQWA 4JUVA 1BI0A 4GBQA 2KI7A 2LCCA 5IAYA 5IHIA 3RERA 4ESRA 4M7AF 1Q7YC 3ER0A 5LJ5g 2RI5A 2ENMA 1HSQA 1NPPA 3PVLA 4HT8A 1WQWA 3CD6A 5KYXA 3HHTB 2X4XA 3CCMQ 2RQVA 1K9MU 5GJVB 1VQ6Q 3EH1A 3CMEA 2XDPA 1OULA 2OX7A 5IHKA 1OV3A 3JRZA 3FDRA 3H41A 1VYVA 4GLMA 2FRYA 1G2BA 1RAHB 3H0HA 1JBMA 1UFFA 3OMCA 5DY9A 1VQ5A 1MNEA 5CCAA 5KYWB 1K76A 2AK5A 4M7AA 4CC4B 4M7AE 2M0YA 2D0NA 2QQAA 3ULRB 2EQIA 4Y28E 1ZX6A 4PK4A 1PG5B 3C94A 1QCNA 4BDYA 4C8QF 2WACA 1RAIB 3EHQA 4J9FA 4PJOC 3FC3A 1X6BA 3RNJA 1ZSZB 3OYLA 5M9OA 1QWFA 1WI7A 2CYZB 2E1HA 2K3BA 3PIPA 2OTLQ 1VQ7T 1VQKA 1U5SA 1MHNA 1ZHIA 2KRMA 1YHQT 4PJMA 3OW2S 4N4GA 3G6ET 2HL3A 4X34A 3PTAA 1JB0E 1VQPT 2CGHA 4LDYA 3SDZA 1VQLQ 2LCLA 2KRSA 4QQGA 3LYIA 2EJGA 1OYXA 3E9GA 5L23A 4Z88A 3E1SA 2EW3A 2EYWA 1GL5A 2CZ1B 2L2PA 1U8RA 4BB7A 2O2OA 4JS5A 2HMAA 3OYIA 2V1QA 4C5HA 4EDUA 4FL6A 4IUUA 3A8MB 1GCQC 3OS2A 3OB9A 1YFNA 2LT4A 3HTRA 1QVFP 1Q81U 1Q82R 3LGFA 3CQTA 4RTVA 4BI8B 3R6OA 4IUVA 3NPFA 2YT6A 1ZA2B 2COWA 4II1A 1D09B 4EMKC 1BI3A 2ED0A 2ZCFB 2K57A 3VS5A 3DB3A 5GAN3 4F7UB 1MUZA 1M4ZA 2DETA 1D1CA 4A4FA 3H6ZA 2PVGB 1Y71A 1MMAA 3EH2A 2D8HA 2PVDB 3LH0A 3QYHB 4OMMA 2P0PA 1M1KR 4IKFA 4IUQA 1D3BA 2JM9A 2CREA 2X4WA 4JJDA 3JB9F 2QDLA 3EG2A 1YJNT 5ECAA 2A36A 4E6RA 3J81E 1GCQA 2QA4Q 3L42A 2IIMA 1RABB 3MP1A 2K6DA 4JDSA 2NYSA 1S72T 4IURA 1M1KU 4HCCA 4N0AA 2RHUA 5FW9A 3NHNA 4QVCA 2E6ZA 4PNOA 1AWOA 5KE2A 4ZTFA 2HBWA 2XD0A 2LP5A 4D6WA 3CXCS 1BIBA 5I2SA 4PJOB 3GF5A 4FSSA 3LWIA 5LJ3g 1YHQQ 1VQ9A 2PUKB 1X6GA 5CKFA 2DM1A 1D1AA 2DMOA 2CP7A 2F2XA 3QUIA 1X2KA 3CCLT 5LJ3e 3WVEB 1ZUKA 3VS7A 4LNPA 8ATCB 1KD1R 5HK3A 4ZGEB 3NFCA 1RL2A 2E3HA 1ZLMA 2WSFE 2YUNA 4VUBA 4M7AB 4M78D 3HFNA 4HCKA 3EFRA 4IUTA 4J9CA 2KT8A 2VB6A 3MEAA 1NBEB 2DNUA 2DA9A 2GBQA 4BDZA 1KD1C 3DLMA 5EG2A 2EJ9A 4PJOA 2QQ9A 1M8VA 3PNWC 3QJYA 4RCBA 2HSPA 2FRWA 5KYNA 4M75F 1Q7YU 4JS4A 2LT1A 1Q81C 2EQUA 3OS1A 4FT4A 1I4K1 1O75A 3JSCA 1SSFA 3CCRT 4QKUA 1C6VX 1G3YA 5LJ3f 1W2BA 2PQWA 3OS0A 4FYVB 5GANj 2DAQA 3C12A 1N8RR 4XTWA 4BD3A 3RR6A 3I55A 2K5IA 4BI4A 3VS0A 4Z02A 1FYNA 4J9BA 4JZ4A 5GAMe 2KRNA 3JB9J 3PGGA 3JB9G 1AOJA 2QQRA 5GMKm 1YJNA 2HL5C 4OB3B 2JS0A 3TSWA 5GAN7 2KNBB 3FJ5A 2PVOB 3A5ZB 2DF6A 4M77B 4FCYA 1M1FA 4M75G 1K9MC 1VQPA 2F5TX 1Z9QA 1FMKA 5KYYB 5J26A 5I21A 1X6OA 5KYXB 4C92B 1PCXA 1AWJA 5CO7A 3OYKA 2LX9A 2IG0A
chains in the Genus database with same CATH topology
4C5GA 3CC2A 2QA4T 3N5BB 2QDYB 3LW5E 1M90C 2VXEA 3CMET 3QYGB 3QHSA 1MGQA 3QIIA 4C92A 2MF2A 4C8QB 2DJZA 1VQ4T 5CKEA 3TCJA 4JLIA 4M75B 3RMQA 2ZPHB 2EFIA 3WXMB 4F7UA 3QBYA 1VQ5T 3JCMW 3J80E 4ZN3A 2O4XB 4MZTA 2DO3A 3QO3A 5AYFA 2XIDA 2RJDA 1H641 4BI3A 2GFUA 5GANe 5A0DA 5GAN6 1UGSB 1N27A 4NL3A 1NJIC 2RB6A 2HBPA 3QSUA 3MEUA 4O5VA 3I56T 2PU9B 2RHYA 4M7DB 3OA6A 3JCMh 3CCJT 1YIJA 4ELZC 4DOWA 4DA4A 1NZ9A 4QQDA 4PJOE 2R58A 2JN0A 2DTHA 2V8IA 1YI2T 3OSSC 2OAUA 3MP8A 4ZGDB 1BI2A 4M7DF 3CCVT 2K3YA 3L1AA 3M4GA 2DKGA 5LJ3j 3J7AF 3JCMd 2WSEE 3SB2A 4C8QG 1UGRB 3CCVA 3P8HA 1ZBXA 4QVDA 2HQEA 4C0FA 5GAOr 2L3RA 1KC8U 1QVFS 4FM4B 3ME9A 2CS7A 4EMKA 2G3RA 3CCRA 2DEQA 4M7AC 3LLRA 4OF1A 4J6WA 5GAOn 3G71T 4J83A 3V7RA 3MHXA 5KH6A 4MZPA 2X35A 2DXTA 2Y4XA 2V8JA 2P0KA 4JLGA 3CC7A 5CKBA 1N6AA 2VV5A 3RMSA 3RKYA 4RMOA 2RO0A 3JCMg 1BKBA 5GAN8 3OYHA 2ZPFB 3M4YA 2QEXA 1YBYA 2ZPIB 1S72A 2HNIA 4LDUA 4N0AC 5CKDA 5FU7B 1B34B 4RG8A 3V7SA 3JCMb 3OYMA 3CCMA 2VXFA 1KHIA 2F5KA 4OB2B 4FIBA 3UT1A 4C8QE 4NL2A 2E64A 2QTXA 2YLBA 4OP0A 2QEXT 1YJ9T 5LJ5d 3HL8A 2FB7A 2MAMA 3S3MA 5GAMd 2RM4A 1UGQB 1YITT 4PJOD 4KT0E 2BIVA 2XKOC 3EAEA 2YLCA 2P4TA 5FU6C 4KUDK 1OZ3A 5IN1A 4M77G 4M7DC 3GNFB 2RJFA 5GAMf 3GPLA 1YHQA 2GF7A 2RJCA 4E7KA 4OVAA 1JJ2S 1KG1A 3META 4HA8A 4NOYA 3KBGA 3HSBA 1U1SA 2FYKA 2QA4A 5KCHA 1KD1U 2JOYA 3CCUT 3UWNA 2MWOA 1VQOT 1I5LA 2DTIA 3FLGA 4M7DE 1FWZA 1VQLT 4C0ZA 2EJFA 2K2VA 3CPFA 3MEVA 1HXDA 2X4YA 5J3BA 2JZ2A 2VC8A 2Y4YA 1VIFA 3MP6A 1VQOA 4V2SA 1VQ8A 2KQWA 4XTXA 5CKHA 1YJWA 4JUVA 1BI0A 5IT9E 4M7DA 2C06A 3T9NA 4C0DB 4JRPA 3RUXA 2R5AA 3BDUA 4QQ6A 3L2VA 2LCCA 3HRUA 4A53A 4JRKA 5DLQE 1XNIA 5GANg 5GAOp 1K8AC 3BW1A 3OW2A 3OYEA 5IAYA 1VQ6A 3RERA 3L2WA 3E9FA 3FIFA 3CD6T 4M7AF 2OTLT 2E10A 1Q7YC 3ER0A 4MZMA 2QI2A 5LJ5g 4E7HA 2RI5A 1IREB 1N9RA 1P92A 2L8DA 4LD6A 1NPPA 5GMKj 1WJSA 1WQWA 1NJIU 2KAFA 4HT8A 3CD6A 5GAOl 3M59A 1WJQA 3HHTB 3RESA 5A0GA 2X4XA 3CCJA 4J7FA 4NS5A 1YIJT 1UGPB 1K9MU 1R8OB 3VUZA 2YHTA 4RCCA 3CMEA 1B34A 4J7IA 2GFAA 2XDPA 2XG8D 4PLIA 2HAXA 4HT9A 2L5QA 4A4HA 3JRZA 3FDRA 1WNLA 4E47A 2XU8A 3A8HB 3CC4A 3TU4K 1JBMA 3G7ZA 5C0MA 3OMCA 3SWNC 2D9TA 5DY9A 5FRNA 5GMKh 3BDLA 4DQ2A 1VQ5A 3GOXA 2KY9A 3EFSA 3FJPA 2DVEA 4M7AG 4LDVA 5CCAA 1M1KC 2K5LA 4M7AA 2DTOA 1OZ2A 4M7AE 2FL7A 5CR2A 3TREA 2QQAA 1UB4A 2R57A 3QZ9B 2F69A 4Y28E 1X75C 4BY6C 3V8KA 3C94A 2RHXA 2DXCA 3I56A 4BDYA 1BIAA 1BI1A 2DD5A 4C8QF 2WACA 1KQSS 3FRNA 1W4SA 2LQ8A 2QXFA 4PJOC 2XI9A 3QXEB 4P5NA 1YCYA 1DJ7B 2ZPEB 4M78F 3L2QA 2E6NA 3FC3A 2RI2A 2XDDA 5CAIA 3OYLA 5M9OA 2ZPGB 4HKEA 2CYZB 2EQKA 4XK8E 2E1HA 4M7DD 2D6FA 2V8KA 4FU6A 3PIPA 2EQJA 4ELYC 4JJNK 3OYGA 4OB0B 4QVZA 1Q86U 1VQ7T 3JCMe 4C0DC 5KE3A 1VQKA 2X4JA 2H3JA 1JRIA 1MHNA 1ZHIA 3HPWA 3UPUA 3X24B 3C95A 3M9QA 1YHQT 3OYAA 1IZ6A 4M7DG 5LJ3d 1QW1A 5GAN2 3OW2S 1Q82C 1VQ7A 4N4GA 3OYCA 3ZBDA 4PKCC 3G6ET 4X34A 5GAMg 3PTAA 5GAN5 4C0GA 1XOVA 1K73U 2MMPA 1HK9A 1JB0E 1N9SA 2L89A 1VQPT 3CBOA 2CGHA 4LDYA 3SDZA 2LCLA 1PSEA 3RKXA 4QQGA 3LYIA 5HY6A 4RG2A 3F70A 5CVIA 3DKMA 3QJ6A 2EJGA 3V8JA 1VIEA 1OYXA 3QKJA 4M75C 4OB1B 3JCMc 3CCMT 3X20B 4A4GA 2RHIA 2LTOA 1M8VA 3E9GA 2P0QA 2CZ7B 4IUPA 4EMHA 1VQ6T 3E1SA 4C8QA 3CMAA 2KSSA 4MMLA 2CZ1B 2JNGA 4M78G 2Y90A 5FU7C 4BB7A 3G4SA 1U8RA 2E70A 4JS5A 2KVQG 2VGNA 1VQ9T 3CEYA 3GIBA 3NTKA 4BACA 3CMAT 3P8DA 3OYIA 5LJ5j 2JTMA 4C5HA 4E7LA 4A54A 4EDUA 2ZPBB 4FL6A 4IUUA 1FX7A 3A8MB 2MI6A 1LOJA 4FSXA 3OS2A 3OB9A 3P8BB 2LT4A 3OMGA 4JRQA 2RA2A 1ZQ1A 4J6YA 1QP2A 3M54A 3WVDB 2DK3A 3INZA 3LGFA 3PT9A 2E65A 3OY9A 4M77C 1Q81U 2EKOA 1KQSA 5GMKe 1G3SA 4BI8B 2B8AA 4M77F 3JCMf 3S3NA 5D6WA 4C92C 3R6OA 3CCSA 4IUVA 4HCBA 4II1A 2VYTA 4XAXB 5CIUA 4EMKC 3JB9I 1QVPA 1BI3A 2ZCFB 1VQ4A 3SWNB 1JJ2A 2K57A 4DOVA 5GAN4 3OQ5A 1D3BB 3DB3A 4X9CA 5GAN3 2YRVA 4F7UB 2DXBA 5KCOA 2EWNA 4MDWA 1M4ZA 1VQMA 2KDSA 3A8OB 4BUGA 4A4FA 4M78E 3HFOA 3H8ZA 2DPPB 1WGSA 3H6ZA 2PVGB 1Y71A 3OYDA 3O8VA 3I55T 3OYFA 3HRTA 1Q82U 4BE0A 3JB9H 2PVDB 3M5AA 5GAOq 3LH0A 5C6SA 3OSVA 3QYHB 3VYHB 2O01E 1V29B 2P0PA 1OI1A 5GAMh 4IKFA 2LC4A 4PL6A 3LWHA 3VYGA 5LJ5h 4E7JA 3CCEA 4IUQA 1D3BA 4LDXA 2X4WA 4F7UE 5LL6S 3CC4T 4KULA 2WSCE 2DIQA 2LDMA 3JB9F 5D6XA 1G3WA 3ASKA 4RKUE 5CQYA 1YJNT 4N4IA 4C8QD 4J6XA 3J81E 3CPWS 3SFMA 1XTDA 3L2UA 1QVGS 3L42A 2LVMA 3VU3C 4C92G 3G6EA 1M9SA 3MP1A 3URGA 1KQ2A 1KQ1A 2EAYA 2M9UA 3V7CA 4JDSA 4F7UG 4KUIA 3OBWA 5GAMj 2LRQA 2BKDN 1S72T 4YTLA 3A8GB 4M75D 2AHJB 4IURA 4A4EA 2D0QB 3UDCA 3FEOA 1M1KU 4HCCA 4N0AA 1K73C 2E12A 2RHUA 3HRSA 1YJ9A 4C92E 2I2LA 2XICA 4QVCA 4B9XA 1XQHA 2E6ZA 4PNOA 4ME7A 4QW2A 3M55A 5FROA 4ZGJB 4ATOA 5HKCA 5KE2A 3M57A 3LGLA 4ZTFA 2XD0A 4D6WA 1BYMA 3CXCS 2RJEA 1BIBA 3L2ZA 4R56A 4LDWA 4CRIA 5I2SA 4L5GA 3CCQA 1Y7XA 3GF5A 3M58A 3RIRA 3X26B 4PJOB 4KBMB 3MEWA 3KUFA 4R55A 3LWIA 5LJ3g 1VQ9A 2PUKB 4ZN1A 1LJOA 1YITA 5CKFA 4M75A 3KXTA 3QUIA 4M77D 3CBPA 3CCLT 2E41A 1UEBA 5LJ3e 4M78B 4C92D 2KMTA 1VUBA 1H3ZA 4JRIA 3WVEB 1QVGA 4GY5A 4Q5WA 1AHJB 3CCLA 3QDRB 4ZGEB 3PFSA 3NFCA 5HK3A 4L59A 3CPWA 1RL2A 5GAOm 3CCUA 4C5EA 2XDBA 1W2BS 4TVRA 1I8FA 3M53A 5I2MA 2WSFE 4VUBA 4M7AB 5LJ5f 4M78D 2K5FA 3HFNA 1VQ8T 2EYQA 3X28B 2IVWA 2K3XA 3EFRA 4IUTA 4MMKA 3OBYA 1YJWT 3A8LB 3VV0A 3JB9D 2OTJA 2GQVA 3BFMA 5HK0A 4M77A 2CZ0B 5CK9A 4XTYA 3SD4A 3GP8A 4A4KA 5LJ3h 3PMTA 3G4ST 3MEAA 1KHCA 4XTUA 4XU3A 4CI0C 1VQMT 1U1TA 4PJOF 2EQMA 4OMFB 4F7UF 1VQNA 4BDZA 1KD1C 1FXXA 5A0LA 3DLMA 5EG2A 2EJ9A 3RKWA 3GLXA 1N8RC 4PJOA 2QQ9A 3MCAB 1Y96A 3ZFJA 2DIGA 3PNWC 3QJYA 1VQNT 4RCBA 5GANh 3CBMA 4HCZA 3C4SA 4PJOG 1YI2A 5DLOA 3VUBA 1WQ7A 3PIOA 4C8QC 4GLKA 3NTIA 4X9DA 2XK0A 4M75F 2DZCA 5L8RE 3DLLA 1Q7YU 2VGMA 4JS4A 2LT1A 3HKSA 2XHCA 5GMKi 3CCST 1Q81C 2EQUA 1G3TA 2FHDA 3JAME 3MO8A 2LNVA 3VKIA 4FT4A 3OS1A 1I4K1 1O75A 3AHUA 3QG1A 4XU1A 3JSCA 3GNGA 2E5QA 3E19A 4UC4A 1SSFA 1K8AU 3CCRT 1M5Q1 2DXUA 4C5IA 3VJPA 1G3YA 3BY7A 4FT2A 5LJ3f 3L2RA 5J39A 5A2QE 3G71A 1W2BA 2PQWA 2DZ9A 3OS0A 1X01A 2DAQA 5GANj 3JCMJ 4XU0A 3HP9A 3C12A 4XTWA 5GANd 2ZZDA 3OS5A 4BD3A 2RH2A 2EIFA 2M0OA 3S3OA 1QVFA 2A3LA 4XU2A 3I55A 3NTHA 2K5IA 4BI4A 5CQXA 3JCMX 2FVUA 5FU6B 4Z02A 2A7YA 4L6V5 2JVVA 2PUOB 4BE2A 1G5VA 3JCMQ 1TH7A 1EIFA 2O4XA 4C92F 2RI3A 3JCMP 5LJ5e 1GXIE 2BUDA 5FRMA 2GCXA 4M77E 5GAMe 1NPRA 1WPYA 2JUFA 2HQXA 3JB9J 3PGGA 4M78A 1M1GA 4XQ3A 4ZTJA 3CCET 4MDXA 3OYNA 3JB9G 2QQRA 5GMKm 4XTVA 4EMGA 1YJNA 1Y07A 3QZ5B 2HD0A 3PMIA 1N8RU 4OB3B 5GMKl 5GAN7 4BY6B 1O9SA 2RK2A 4EMKB 2VUBA 1VQKT 4B9WA 1PSFA 3V8LA 3OYBA 2PVOB 1VQLA 1RI0A 4J5YA 1LNXA 1I81A 4M78C 2RK1A 2K4YA 4LD9K 3A5ZB 1Q86C 4M77B 3CC7T 2ZGWA 3OYJA 3S6WA 1M1FA 3FB9A 4E7IA 5FLXE 4M7AD 2QQSA 3DB4A 4M75G 1K9MC 1VQPA 2F5TX 2DD4A 2RD1A 4EPCA 2MWPA 5D6YA 5J26A 5I21A 4XTZA 3TEEA 1X6OA 1WJRA 1QP3A 2RHZA 2JTFA 3ZEHA 1KC8C 2M1HA 4O6JA 4J8OA 4WF2A 4C92B 2OTJT 2R5MA 1Y96B 3Q1JA 2KK4A 2NLUA 1NE8A 3QPHA 3CXCA 3CCQT 2OTLA 1M90U 3OYYA 2QQBA 4M75E 4PLLA 3CC2T 4OGCA 4OGEA 3M56A 5CO7A 3X25B 4N4HA 2M16A 3OYKA 3JCMV 2LX9A 3SWNA 2CKKA 5DM7R 2IG0A 3LX7A 2LQKA 4BE1A 5GANf 2CZ6B 4Y91A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BDU A;  4A54 A;  3EFR A;  4A53 A;  4JRK A;  4MMK A;  5GAN g;  5GAO p;  3BW1 A;  1LOJ A;  3JB9 D;  3BFM A;  3RER A;  4M77 A;  2RA2 A;  4J6Y A;  4XTY A;  3FIF A;  2VXE A;  3INZ A;  5LJ3 h;  2E65 A;  4M7A F;  4M77 C;  3QHS A;  2E10 A;  1MGQ A;  4XTU A;  4XU3 A;  4C92 A;  5GMK e;  1U1T A;  5LJ5 g;  4PJO F;  4C8Q B;  2DJZ A;  1N9R A;  4F7U F;  4M77 F;  4HT8 A;  3JCM f;  5GMK j;  4C92 C;  1WQW A;  5GAO l;  3RES A;  4JLI A;  2EJ9 A;  4M75 B;  3RKW A;  4PJO A;  4F7U A;  4EMK C;  3JB9 I;  1Y96 A;  1M8V A;  3JCM W;  4RCB A;  3SWN B;  5GAN h;  2K57 A;  5GAN 4;  4PJO G;  3QO3 A;  1D3B B;  4X9C A;  5GAN 3;  2YHT A;  4F7U B;  4RCC A;  1H64 1;  1B34 A;  1WQ7 A;  4C8Q C;  5GAN e;  5GAN 6;  2EWN A;  4NL3 A;  4X9D A;  4HT9 A;  4M75 F;  2RB6 A;  3QSU A;  2DZC A;  4M78 E;  1WNL A;  3HFO A;  5GMK i;  4M7D B;  1JBM A;  3JCM h;  3SWN C;  3JB9 H;  5DY9 A;  1I4K 1;  3AHU A;  4XU1 A;  5GMK h;  5GAO q;  4DQ2 A;  3EFS A;  3FJP A;  2DVE A;  4PJO E;  1M5Q 1;  2DXU A;  4M7A G;  2JN0 A;  2DTH A;  3BY7 A;  5LJ3 f;  4M7A A;  5GAM h;  2DTO A;  4M7A E;  2DZ9 A;  5LJ5 h;  4M7D F;  1X01 A;  5GAN j;  3L1A A;  3M4G A;  4XU0 A;  3JCM J;  2DKG A;  5LJ3 j;  4XTW A;  1D3B A;  5GAN d;  3V8K A;  3JCM d;  4F7U E;  4XU2 A;  1BIA A;  3SB2 A;  4C8Q G;  3JB9 F;  4C8Q F;  3JCM X;  4QVD A;  5GAO r;  4C8Q D;  4J6X A;  4PJO C;  1YCY A;  4M78 F;  4EMK A;  2DEQ A;  3JCM Q;  1TH7 A;  4C92 F;  3VU3 C;  4C92 G;  4J6W A;  5CAI A;  5LJ5 e;  5GAO n;  3JCM P;  1KQ2 A;  3V7R A;  4M77 E;  5GAM e;  1KQ1 A;  1WPY A;  2E1H A;  4M7D D;  2EAY A;  3V7C A;  2DXT A;  4F7U G;  3JB9 J;  3PGG A;  4M78 A;  4XQ3 A;  5GAM j;  3JB9 G;  4M75 D;  3JCM e;  5GMK m;  4XTV A;  1JRI A;  4N0A A;  4EMG A;  3RKY A;  3JCM g;  5GAN 8;  4M7A C;  4C92 E;  2HNI A;  2I2L A;  4N0A C;  5LJ3 d;  4QVC A;  5GMK l;  5GAN 2;  5GAN 7;  1B34 B;  4M7D G;  3V7S A;  4EMK B;  4PNO A;  3JCM b;  2VXF A;  4C8Q E;  5GAM g;  4NL2 A;  2E64 A;  2QTX A;  2YLB A;  4OP0 A;  3V8L A;  5GAN 5;  5LJ5 d;  2FB7 A;  1HK9 A;  1BIB A;  1N9S A;  1I81 A;  2RM4 A;  1LNX A;  3L2Z A;  4J5Y A;  4M78 C;  2CGH A;  5GAM d;  4PJO D;  4PJO B;  3RIR A;  4M77 B;  2YLC A;  2ZGW A;  4M7A D;  3FB9 A;  3RKX A;  5LJ3 g;  1LJO A;  4M75 G;  4M77 G;  4M7D C;  5GAM f;  2RD1 A;  4M75 A;  3QUI A;  4M77 D;  4HA8 A;  2EJG A;  4NOY A;  3V8J A;  2E41 A;  4XTZ A;  5I21 A;  3JCM c;  1U1S A;  2FYK A;  4M75 C;  5LJ3 e;  3HSB A;  4M78 B;  4C92 D;  4C92 B;  1I5L A;  2DTI A;  4WF2 A;  4EMH A;  4M7D E;  1Y96 B;  4C8Q A;  4JRI A;  2EJF A;  4MML A;  1HXD A;  4M78 G;  2VC8 A;  2Y90 A;  4V2S A;  4M75 E;  5GAO m;  4XTX A;  3GIB A;  4JUV A;  1I8F A;  4M7D A;  3JCM V;  3SWN A;  4M7A B;  5LJ5 j;  5LJ5 f;  4M78 D;  3RUX A;  3HFN A;  5GAN f;  4Y91 A; 
#chains in the Genus database with same CATH topology
 2CSI A;  3CC2 A;  2K79 A;  3QDF A;  1D0Y A;  1M90 C;  1AZG B;  3QYG B;  1B7T A;  2A0F B;  2MF2 A;  2DJZ A;  4OML A;  1VQ4 T;  3REA B;  4OMO A;  2EFI A;  3H9N A;  3WXM B;  2KEA A;  2FZG B;  4ZN3 A;  4MZT A;  3QO3 A;  1SKU B;  2GFU A;  1VQN Q;  1UGS B;  4NL3 A;  2HBP A;  1M2O A;  3MEU A;  3EFO A;  1OQK A;  2LQW A;  2V1R A;  3CCJ T;  2FO0 A;  2KR3 A;  4Z8A A;  4PJO E;  4X1V A;  2V8I A;  2LNH B;  3MP8 A;  1YNZ A;  2LMJ A;  3MKD A;  2FZC B;  1TUC A;  2ECZ A;  3CCV A;  2L3R A;  1QVF S;  3ME9 A;  3RDV A;  2CS7 A;  4M7A C;  4OF1 A;  3G71 T;  3MHX A;  2OJ2 A;  1BBZ A;  1JXM A;  3THK A;  4PFO A;  1VQM Q;  1NJI R;  1N6A A;  1Y0M A;  3RKY A;  5AT1 B;  5GAN 8;  3VS2 A;  5FU7 B;  2ZAE A;  2VXF A;  1F1B B;  4OP0 A;  1WA7 A;  1ACM B;  1WHL A;  2L0A A;  2QEX T;  3HL8 A;  4OMP A;  1YIT T;  4PJO D;  1YWO A;  3KFV A;  2Z0W A;  2GF7 A;  1MMD A;  3KBG A;  2F2W A;  3I9Q A;  1VQO T;  4M7D E;  1FWZ A;  2HDA A;  4C0Z A;  2EJF A;  3MEV A;  2X4Y A;  2IPO B;  1VQO A;  1VQ8 A;  1VYT A;  1SHG A;  2R5A A;  3BDU A;  4FW1 A;  2W10 A;  4JRK A;  4LN2 A;  1TU0 B;  4A53 A;  5GAN g;  3OW2 A;  3G1J A;  1VQ6 A;  3E9F A;  3FIF A;  1S72 Q;  4E7H A;  2L8D A;  5GMK j;  1WJS A;  3CME Q;  2KAF A;  5GAO l;  3M59 A;  1WJQ A;  4J7F A;  3VUZ A;  4RCC A;  2HAX A;  2L5Q A;  4ANJ A;  4A4H A;  1WNL A;  3TU4 K;  1IO6 A;  4AG1 C;  3FJP A;  3O5Z A;  1RAE B;  2DTO A;  1OZ2 A;  2K9G A;  1K8A R;  3QZ9 B;  1WFW A;  1K9M R;  2RHX A;  1BI1 A;  1ZSZ A;  2CP3 A;  2DD5 A;  3BE3 A;  2LQ8 A;  2XI9 A;  4P5N A;  2C0I A;  2DYI A;  1YWP A;  2XDD A;  2RQU A;  5CAI A;  3M0Q A;  1FMV A;  2V8K A;  4FU6 A;  1EZZ B;  2EQJ A;  4JJN K;  1Q86 U;  5KE3 A;  2X4J A;  2CUB A;  3C95 A;  4M7D G;  1QW1 A;  5GAN 2;  2F1L A;  1XOV A;  1HK9 A;  2MMP A;  2L89 A;  3RKX A;  5HY6 A;  5CVI A;  2EBP A;  1LPL A;  3QJ6 A;  3V8J A;  3CCR Q;  3QKJ A;  3JCM c;  5FWC A;  3X20 B;  2RHI A;  3EFO B;  2ROL A;  4C8Q A;  1BCM A;  2DFU A;  2JNG A;  3G4S A;  3CCU Q;  2KVQ G;  1VQ9 T;  3EHR A;  4BAC A;  1BU1 A;  3CMA T;  4KGX B;  4E7L A;  4A54 A;  1K1Z A;  2BZ8 A;  1K4U S;  1QP2 A;  2EGC A;  2L3S A;  1WHG A;  2JXB A;  1KQS A;  2EKO A;  1V76 A;  3TVT A;  1WX6 A;  1G3S A;  2B8A A;  4PFZ A;  5D6W A;  4C92 C;  3CCS A;  3REB B;  1KJW A;  1OX9 A;  3JB9 I;  1TG0 A;  2BE9 B;  3SWN B;  1SRM A;  4DOV A;  1D3B B;  1UDL A;  5I11 A;  1TUD A;  3SHW A;  1VQM A;  3A8O B;  2NUZ A;  4M78 E;  3H8Z A;  1WGS A;  1IB8 A;  3OYF A;  1X2Q A;  4BE0 A;  5C6S A;  4PL6 A;  1M30 A;  4QT7 A;  4KUL A;  2YSQ A;  1ZUY A;  2DIQ A;  5D6X A;  5CQY A;  2CT4 A;  2O9V A;  4J6X A;  1W6X A;  1XTD A;  2DVJ A;  3L2U A;  2LVM A;  3VU3 C;  3G6E A;  3VS6 A;  3URG A;  2DL7 A;  3V7C A;  4KUI A;  3OBW A;  5GAM j;  2AKL A;  4YTL A;  4M75 D;  2AHJ B;  2OAW A;  4AMC A;  3EGX A;  4A4E A;  2E12 A;  1YJ9 A;  1HYO A;  2F2V A;  4B9X A;  1YIJ Q;  1XQH A;  4ZGJ B;  1VQP Q;  5HKC A;  4PJN A;  4CRI A;  4L5G A;  1Y7X A;  3RIR A;  3X26 B;  5FWB A;  1NEG A;  1WHK A;  4LE9 A;  4E7Z A;  1YIT A;  1R0B G;  3KXT A;  1QWE A;  1RI9 A;  2A37 A;  1JEG A;  1U06 A;  1H3Z A;  4Q5W A;  1ZUU A;  5GAO m;  1W2B S;  1I8F A;  2E5K A;  2EYQ A;  2EVR A;  4IIM A;  1YJW T;  3VV0 A;  1YN8 A;  2GQV A;  3BFM A;  5HK0 A;  4M77 A;  4XTY A;  3GP8 A;  4A4K A;  3PMT A;  8AT1 B;  4CI0 C;  1TS9 A;  1VQM T;  4PJO F;  2EQM A;  1UHC A;  4OMF B;  4DBH A;  2CP2 A;  1FXX A;  5A0L A;  1MND A;  3MCA B;  4Y92 A;  3ZFJ A;  3A1P A;  3CBM A;  1YI2 A;  2OTJ Q;  2QEX Q;  1WQ7 A;  3PIO A;  3CCQ Q;  3NTI A;  4X9D A;  2XK0 A;  2DL3 A;  5L8R E;  1WZO A;  1CKA A;  5GMK i;  4R0K A;  3CCS T;  3SEM A;  3H0I A;  3MO8 A;  3MPU B;  3VKI A;  3C0C A;  3OW2 P;  3AHU A;  4UC4 A;  3GNG A;  2E5Q A;  6AT1 B;  1KFZ A;  5J39 A;  5A2Q E;  2JMC A;  1TUG B;  2ZZD A;  3OS5 A;  4CC2 A;  3S3O A;  2M0O A;  2YUQ A;  2A3L A;  3NTH A;  1M27 C;  1N5Z A;  2FVU A;  5FU6 B;  3JCM X;  1UUE A;  1E6H A;  2A7Y A;  2JVV A;  1G5V A;  3JCM Q;  4C92 F;  3JCM P;  1KQS P;  5LJ5 e;  1KK7 A;  2GCX A;  3AT1 B;  1UGV A;  2HQX A;  3G4S Q;  4M78 A;  4XQ3 A;  4ZTJ A;  3QZ5 B;  2HD0 A;  3PMI A;  1N8R U;  1O9S A;  2H3E B;  2VUB A;  4EMK B;  1OU9 A;  4B9W A;  5EC7 A;  3OYB A;  2D8J A;  1UHF A;  4M78 C;  1RI0 A;  1LNX A;  2JW4 A;  2RK1 A;  2DBM A;  4LD9 K;  1QQJ A;  1H8K A;  3OYJ A;  3S6W A;  3FB9 A;  4E7I A;  4WCI A;  4EPC A;  2NUP B;  2RPN A;  2MWP A;  5D6Y A;  2RNA A;  4XTZ A;  1WJR A;  2JTF A;  3ZEH A;  4O6J A;  4J8O A;  4WF2 A;  2R5M A;  1Y96 B;  5KYU B;  1PRM C;  2KK4 A;  3QPH A;  1M90 U;  2QQB A;  2W0Z A;  4N4H A;  2M16 A;  3SWN A;  4C5G A;  2P4R A;  1M3A A;  1C0M A;  3ZL7 C;  2VXE A;  1H3H A;  3VS3 A;  3CD6 Q;  3RMQ A;  4M75 B;  1YJW Q;  2ZPH B;  4F7U A;  1JJ2 P;  1VQ5 T;  1K0S A;  1H64 1;  1RLQ C;  5GAN e;  5A0D A;  1NJI C;  1N27 A;  2RB6 A;  3QSU A;  1GRI A;  4IIO A;  2RHY A;  3JCM h;  3CPW P;  1YIJ A;  1WXT A;  3EG9 A;  3LH5 A;  1T0H A;  1VOM A;  3M4G A;  1SRL A;  5LJ3 j;  4J9I A;  4JJB A;  2WSE E;  4RUG A;  5KYU A;  4C8Q G;  3CMA Q;  1UGR B;  3P8H A;  2EGA A;  1KC8 U;  3EG0 A;  2DEQ A;  3LLR A;  5GAO n;  2LJ3 A;  4MZP A;  4B6M A;  2P0K A;  4A63 B;  3CC7 A;  2RO0 A;  4LDU A;  3V7S A;  4OB2 B;  2F5K A;  1N8R C;  4NL2 A;  2QTX A;  2YLB A;  1YJ9 T;  4RTT A;  1T3S A;  2MAM A;  2RM4 A;  4KT0 E;  2BIV A;  1UJY A;  2XKO C;  5FU6 C;  2K2M A;  1OZ3 A;  5IN1 A;  4D8D A;  2JM8 A;  4M7D C;  2RJC A;  2X51 A;  4OVA A;  1U1S A;  1KD1 U;  2JOY A;  2QAS A;  1VIF A;  1VQ7 Q;  2KBT A;  5CKH A;  5IT9 E;  4M7D A;  2J6O A;  2YRD A;  5IXB A;  3T9N A;  4C0D B;  3RUX A;  2AZV A;  1KC8 R;  3VS1 A;  3L2V A;  3HRU A;  2BZY A;  5DLQ E;  1XNI A;  3OYE A;  1AWX A;  1JO8 A;  1J3T A;  1VQ4 Q;  2CUD A;  2OTL T;  1WHH A;  2E10 A;  1RAA B;  2I0N A;  2QI2 A;  1N9R A;  4LD6 A;  4HXJ A;  4F04 B;  3RES A;  4F14 A;  1YIJ T;  1UGP B;  1T0J A;  1A0N B;  2FPD A;  4J7I A;  2GFA A;  2XG8 D;  4PLI A;  2MYS A;  2VAS A;  3A8H B;  2KGT A;  1M3C A;  4HVU A;  2HQH A;  3SWN C;  5GMK h;  2KY9 A;  2EPD A;  2DVE A;  4WTO B;  4M7A G;  4LDV A;  4J9E A;  2V26 A;  4HVW A;  2FL7 A;  5CR2 A;  3TRE A;  3I35 A;  2COY A;  1UB4 A;  2F69 A;  1X75 C;  4BY6 C;  3V8K A;  3I56 A;  1QKX A;  2DXC A;  2VKN A;  3FRN A;  2QXF A;  3QXE B;  2LJ1 A;  1YCY A;  3QWX X;  2ZPE B;  3L2Q A;  2RI2 A;  2ZPG B;  4HKE A;  4XK8 E;  2BZX A;  2D6F A;  2SRC A;  3OYG A;  4QVZ A;  1TTH B;  3JCM e;  1AZE A;  1JRI A;  2CT3 A;  3HPW A;  3M9Q A;  2X9H A;  3OYA A;  3M0S A;  5LJ3 d;  1WHM A;  1JQQ A;  5GAM g;  5GAN 5;  4C0G A;  3UAT A;  4AFZ C;  1N9S A;  3CBO A;  2YRC A;  2DRK A;  2QG9 B;  1PSE A;  1I5O B;  1YIT Q;  3NMZ C;  3I5R A;  4RG2 A;  2O9S A;  3DKM A;  1AT1 B;  1QVG P;  1HD3 A;  1UJ0 A;  1YJ9 Q;  4OB1 B;  3CCM T;  4M75 C;  1V1C A;  2CZ7 B;  4IUP A;  1VQ6 T;  4M78 G;  2X3X D;  2KRO A;  2E70 A;  4FYW B;  3EG9 B;  2VGN A;  3UA6 A;  3P8D A;  1Q7Y R;  1YJN Q;  5LJ5 j;  1ZSZ C;  2JTM A;  2PTK A;  2MI6 A;  2X3W D;  3P8B B;  1ZQ1 A;  4J6Y A;  1VQ8 Q;  3M54 A;  3WVD B;  2DK3 A;  3INZ A;  3PT9 A;  2E65 A;  4M77 C;  5GMK e;  2GTJ A;  1D0Z A;  3S3N A;  5CIU A;  1VQ4 A;  3OQ5 A;  4X9C A;  2YRV A;  1H92 A;  1K73 R;  5KCO A;  1D0X A;  4MDW A;  4BUG A;  3HFO A;  2DPP B;  2JMA A;  2L3P A;  4E7S A;  4FYX B;  3M5A A;  4F17 A;  3OSV A;  3VYH B;  2O01 E;  3D7S B;  5D7U A;  1OI1 A;  1X27 A;  2LC4 A;  2RF0 A;  1UEC A;  3UA7 A;  3VYG A;  5LJ5 h;  3EGX B;  4E7J A;  1GFD A;  1XJW B;  2DE0 X;  3CCE A;  1WXB A;  2DX1 A;  4F7U E;  4LDX A;  1EX4 A;  1NYG A;  2DJQ A;  2EYX A;  1OOT A;  2B86 A;  2LDM A;  3ASK A;  4N4I A;  4C8Q D;  3CPW S;  3SFM A;  1QVG S;  4C92 G;  4AT1 B;  1KQ2 A;  2M9U A;  3QWY A;  3A8G B;  1KSW A;  4RTU A;  2MPX C;  4EIK A;  2D0Q B;  3UDC A;  2SEM A;  1SG5 A;  5IXF A;  1K73 C;  3CC7 Q;  1Z9Z A;  2I2L A;  1VQ5 Q;  2XIC A;  1PWT A;  5FRO A;  2HKN A;  4ME7 A;  4ATO A;  3LGL A;  3L2Z A;  1NLP C;  4LDW A;  1VQK Q;  3CCQ A;  2D1X A;  3M58 A;  2C0T A;  3MEW A;  3I5S A;  3KUF A;  1E6G A;  2VVK A;  1UTI A;  3CBP A;  2E41 A;  4M78 B;  4C92 D;  1KIK A;  4LUD A;  1QVG A;  3CCL A;  4FW2 A;  4KH1 B;  1GBQ A;  2CDT A;  3CPW A;  2QGG A;  2KYM A;  4C5E A;  4TVR A;  5LJ5 f;  3CC2 Q;  2K3X A;  4MMK A;  3OBY A;  2HZY A;  3A8L B;  2CZ0 B;  5CK9 A;  1D1B A;  1WDX A;  1U1T A;  3UF4 A;  1NYF A;  3RKW A;  1Y96 A;  2DIG A;  5I22 A;  5GAN h;  4HCZ A;  3C4S A;  1PD1 A;  2CH4 A;  5DLO A;  1PM3 A;  2LCS A;  4E2F B;  1GCP A;  3HKS A;  2RN8 A;  1G3T A;  2FHD A;  2LNV A;  2GGR A;  3CCL Q;  3E19 A;  2GNC A;  2DXU A;  4C5I A;  3G71 A;  3I56 Q;  5GAN d;  2RH2 A;  2EIF A;  4RTX A;  4AFQ C;  2O31 A;  1QVF A;  1E7O A;  4XU2 A;  2C0O A;  3RBB B;  2BE7 D;  4BE2 A;  1EIF A;  2RI3 A;  2BUD A;  4AG2 C;  3EGD B;  4M77 E;  5FRM A;  1NPR A;  1HJD A;  2KXC A;  3CCE T;  4MDX A;  1M1G A;  1RAC B;  4M4Z A;  1SEM A;  4EMG A;  3A98 A;  1Y07 A;  4BY6 B;  1M2V A;  1BCO A;  2OI3 A;  2RK2 A;  1IHV A;  1M90 R;  1OEB A;  3V8L A;  2LZ6 B;  2AKK A;  2COZ A;  4J5Y A;  1I81 A;  1VQL A;  1RUW A;  3CC7 T;  5FLX E;  2DD4 A;  2RD1 A;  2RQT A;  4DBQ A;  3CCJ Q;  1RAF B;  3TEE A;  1ZSG A;  1X43 A;  1QP3 A;  2RHZ A;  1KC8 C;  2M1H A;  4CC3 A;  3Q1J A;  4OMQ A;  3CXC A;  2OTL A;  3OYY A;  4PLL A;  4OGC A;  4OGE A;  3M56 A;  2M02 A;  3X25 B;  3CC4 Q;  2CKK A;  1IGQ A;  5GJW B;  2CZ6 B;  1GXI E;  2FEI A;  2QDY B;  2YXY A;  1MGQ A;  1PKS A;  4C8Q B;  1AVZ C;  5CKE A;  3TCJ A;  2LX7 A;  1W70 A;  4KGV B;  2J6F A;  3QBY A;  7AT1 B;  2LQN A;  3JCM W;  3J80 E;  2DO3 A;  2KE9 A;  1RLP C;  2NUT B;  3EGU A;  5AYF A;  2XID A;  2RJD A;  4BI3 A;  2VWF A;  2FPF A;  4DA4 A;  2R58 A;  2JN0 A;  2DTH A;  3JV3 A;  3OSS C;  4DBR A;  1SPK A;  4ZGD B;  3CCV T;  2K3Y A;  2MOX A;  3J7A F;  1K9A A;  1C1A A;  1ZBX A;  4ZNX A;  2HQE A;  2P84 A;  4C0F A;  4QVD A;  4FM4 B;  4J6W A;  4J83 A;  3V7R A;  4JZ3 A;  1IHW A;  2X35 A;  1S1N A;  2V8J A;  1PRL C;  2JTE A;  1QKW A;  1SHF A;  5CKB A;  4HVV A;  1QCF A;  2VV5 A;  3RMS A;  1K0X A;  1BKB A;  2ZPF B;  3M4Y A;  1YBY A;  1S72 A;  2HNI A;  1VA7 A;  1B34 B;  4RG8 A;  3CCM A;  4F16 A;  1WHJ A;  1B07 A;  3PE0 A;  3PVQ A;  2E64 A;  2GQI A;  2FB7 A;  3S3M A;  5GAM d;  1UGQ B;  2YLC A;  2P4T A;  4KUD K;  3M0T A;  2DLP A;  4M77 G;  5GAM f;  3GPL A;  2MCN A;  2YDL A;  3G6E Q;  4E7K A;  1JJ2 S;  1KG1 A;  3MET A;  4HA8 A;  4NOY A;  2HEQ A;  3HSB A;  3EG1 A;  1ARK A;  1I5L A;  2DTI A;  2NUT A;  2E4H A;  4AFS C;  1VQL T;  2K2V A;  1HXD A;  2PNI A;  5J3B A;  1MV0 B;  2VC8 A;  3MP6 A;  2Y4Y A;  4XTX A;  3VRY A;  2CP0 A;  1YJW A;  2C06 A;  1OPL A;  1R77 A;  1VYU A;  1WXU A;  4JRP A;  4QQ6 A;  1G83 A;  1K8A C;  5GAO p;  3BW1 A;  3L2W A;  3CD6 T;  1WYX A;  4MZM A;  1IRE B;  1P92 A;  1NJI U;  1YCS B;  2RQW A;  5A0G A;  3I55 Q;  3CCJ A;  4NS5 A;  2JS2 A;  1JU5 C;  1R8O B;  1MMN A;  2G6F X;  2YHT A;  4JJC A;  1B34 A;  2M51 A;  2DL8 A;  4HT9 A;  2DEU A;  4E47 A;  2XU8 A;  3CC4 A;  3G7Z A;  2QAZ A;  4PJJ A;  5C0M A;  2D9T A;  5FRN A;  3BDL A;  4DQ2 A;  3GOX A;  3EFS A;  1LCK A;  1M1K C;  2K5L A;  1LVK A;  2R57 A;  2A28 A;  2DYB A;  1TWB A;  4JPB W;  3EG3 A;  1M3B A;  1BIA A;  1VQ9 Q;  2XMF A;  1KQS S;  1W4S A;  4FYY B;  5IHN A;  1IXD A;  1DJ7 B;  4M78 F;  2E6N A;  3CCV Q;  2J05 A;  2EQK A;  4M7D D;  4ELY C;  4OB0 B;  2LJ0 A;  2EKH A;  4C0D C;  2H3J A;  3UPU A;  3X24 B;  1IZ6 A;  4Z89 A;  1Q82 C;  1VQ7 A;  1ZBJ A;  1Q95 G;  3OYC A;  3ZBD A;  4PKC C;  4RTW A;  1K73 U;  4LUE A;  2HKQ B;  1AWW A;  1PD0 A;  3F70 A;  4DEY A;  1NM7 A;  1VIE A;  2EGE A;  2YUO A;  4A4G A;  2LTO A;  2GTO A;  2P0Q A;  4EMH A;  1X69 A;  3CMA A;  3NGP A;  2KSS A;  4MML A;  2Y90 A;  5FU7 C;  4KH0 B;  1R0C B;  3CEY A;  3GIB A;  1FMW A;  3NTK A;  3VRZ A;  4OMN A;  2ZPB B;  1FX7 A;  4FSX A;  1LOJ A;  2CP6 A;  3OMG A;  2J06 A;  4JRQ A;  2RA2 A;  1SF9 A;  3OY9 A;  5KYW A;  2QK0 A;  4M77 F;  3JCM f;  2EYZ A;  4HCB A;  2VYT A;  4XAX B;  1QVP A;  2ESW A;  1JJ2 A;  5GAN 4;  2DXB A;  1M2V B;  2EWN A;  2KDS A;  3GBQ A;  4PJL A;  4DBF A;  3OYD A;  3O8V A;  3I55 T;  3HRT A;  1Q82 U;  3JB9 H;  3MJX A;  5IH2 A;  5GAO q;  1GBR A;  1V29 B;  5GAM h;  3LWH A;  3M0R A;  4AFU C;  2FG0 A;  1CKB A;  5LL6 S;  3CC4 T;  2WSC E;  1G3W A;  4RKU E;  1TSF A;  2CP5 A;  4K11 A;  4CC7 A;  2AT1 B;  1T3L A;  1M9S A;  1KQ1 A;  2DBK A;  2DRM A;  2EAY A;  4F7U G;  3IQL A;  1Q81 R;  2LRQ A;  2BKD N;  4J9D A;  2DIL A;  2YWW A;  1RAG B;  3CCS Q;  3FEO A;  1W1F A;  3HRS A;  4C92 E;  2ATC B;  4QW2 A;  3M55 A;  3M57 A;  4PFP A;  1BYM A;  2RJE A;  4R56 A;  2FZK B;  2A08 A;  4KBM B;  4R55 A;  2JT4 A;  2DL5 A;  2QTV A;  4ZN1 A;  1LJO A;  4M75 A;  2J7I A;  1IRX A;  3EGD A;  4M77 D;  1UEB A;  1BB9 A;  1TOV A;  2KMT A;  1VUB A;  1JXO A;  1YP5 A;  4JRI A;  4GY5 A;  1AHJ B;  3QDR B;  3PFS A;  2ABL A;  4L59 A;  1BK2 A;  3CCU A;  2XDB A;  1NLO C;  1CSK A;  3M53 A;  1QMC A;  5I2M A;  1PC0 A;  1GFC A;  2K5F A;  2BTT A;  1VQ8 T;  3X28 B;  2IVW A;  3U23 A;  3JB9 D;  1YI2 Q;  2OTJ A;  3SD4 A;  5LJ3 h;  4ORZ A;  2ROT A;  3G4S T;  1KHC A;  4XTU A;  4XU3 A;  3M0U A;  4RTZ A;  4F7U F;  1VQN A;  1I1J A;  3GLX A;  2KT1 A;  1VQN T;  4PJO G;  3VUB A;  2KYB A;  4C8Q C;  4GLK A;  2DZC A;  3DLL A;  4KGZ B;  2VGM A;  2XHC A;  1B3Q A;  3JAM E;  1I0C A;  3QG1 A;  4XU1 A;  1K8A U;  1M5Q 1;  9ATC B;  3VJP A;  3BY7 A;  4FT2 A;  3VS4 A;  3L2R A;  2DZ9 A;  1X01 A;  3JCM J;  4XU0 A;  3HP9 A;  4RTY A;  1NG2 A;  2HSE B;  2EYY A;  2QYZ A;  1OPK A;  1Y57 A;  5CQX A;  1U3O A;  3G71 Q;  4L6V 5;  2PUO B;  2AZS A;  2DL4 A;  1TH7 A;  2O4X A;  1Q86 R;  1WPY A;  2RMO A;  2JUF A;  3OYN A;  1PNJ A;  2RQR A;  2J6K A;  4XTV A;  1ABQ A;  2NWM A;  3TQ7 P;  2QGF B;  5GMK l;  1VQK T;  4LXC A;  1G8X A;  1PSF A;  1MMG A;  2K4Y A;  1Q86 C;  2ZGW A;  2YUP A;  4M7A D;  1MV3 A;  1EFN A;  2QQS A;  3DB4 A;  2E3I A;  1VQO Q;  1IGU A;  1W2B P;  1SSH A;  2CH4 W;  2OTJ T;  3E2U A;  5KYY A;  2NLU A;  1NE8 A;  3M0P A;  3CCQ T;  1I07 A;  1OU8 A;  4M75 E;  3CC2 T;  2DER A;  2L3Q A;  3JCM V;  5DM7 R;  3LX7 A;  2LQK A;  4BE1 A;  5GAN f;  4Y91 A;  2QA4 T;  4KRT A;  1UE9 A;  3N5B B;  2O88 A;  3LW5 E;  3CME T;  1NEB A;  3CXC P;  4DEX A;  2JJ9 A;  3QHS A;  3QII A;  1QLY A;  4C92 A;  4J9G A;  4JLI A;  1PKT A;  2O4X B;  5GAN 6;  3R6N A;  4O5V A;  3I56 T;  2PU9 B;  4M7D B;  3OA6 A;  4J9H A;  4ELZ C;  4DOW A;  1NZ9 A;  4D8K A;  4QQD A;  1YI2 T;  1RAD B;  2NUP A;  2OAU A;  1BI2 A;  2PZ1 A;  4M7D F;  3L1A A;  2H8H A;  1QCO A;  2DKG A;  2MK5 A;  3H0F A;  3JCM d;  3CCE Q;  3SB2 A;  1PHT A;  5GAO r;  4EMK A;  3CCR A;  2G3R A;  5KH6 A;  2DXT A;  2Y4X A;  2K7A A;  1M8M A;  4JLG A;  1ABO A;  2MIO A;  4RMO A;  1AD5 A;  3JCM g;  3OYH A;  2FPE A;  2QEX A;  2ZPI B;  4N0A C;  5CKD A;  3OYM A;  3JCM b;  1KHI A;  3UT1 A;  4FIB A;  4C8Q E;  5HCK A;  1WIE A;  5LJ5 d;  3TSZ A;  2HCK A;  1WLP B;  3EAE A;  1AEY A;  2ED1 A;  3GNF B;  2RJF A;  1YHQ A;  1UG1 A;  1ZA1 B;  2CSQ A;  2FYK A;  2QA4 A;  2KXD A;  5KCH A;  3CCU T;  3UWN A;  2MWO A;  3FLG A;  2AIR B;  1TXQ A;  3CPF A;  1OX8 A;  2JZ2 A;  4V2S A;  2KQW A;  4JUV A;  1BI0 A;  4GBQ A;  2KI7 A;  2LCC A;  5IAY A;  5IHI A;  3RER A;  4ESR A;  4M7A F;  1Q7Y C;  3ER0 A;  5LJ5 g;  2RI5 A;  2ENM A;  1HSQ A;  1NPP A;  3PVL A;  4HT8 A;  1WQW A;  3CD6 A;  5KYX A;  3HHT B;  2X4X A;  3CCM Q;  2RQV A;  1K9M U;  5GJV B;  1VQ6 Q;  3EH1 A;  3CME A;  2XDP A;  1OUL A;  2OX7 A;  5IHK A;  1OV3 A;  3JRZ A;  3FDR A;  3H41 A;  1VYV A;  4GLM A;  2FRY A;  1G2B A;  1RAH B;  3H0H A;  1JBM A;  1UFF A;  3OMC A;  5DY9 A;  1VQ5 A;  1MNE A;  5CCA A;  5KYW B;  1K76 A;  2AK5 A;  4M7A A;  4CC4 B;  4M7A E;  2M0Y A;  2D0N A;  2QQA A;  3ULR B;  2EQI A;  4Y28 E;  1ZX6 A;  4PK4 A;  1PG5 B;  3C94 A;  1QCN A;  4BDY A;  4C8Q F;  2WAC A;  1RAI B;  3EHQ A;  4J9F A;  4PJO C;  3FC3 A;  1X6B A;  3RNJ A;  1ZSZ B;  3OYL A;  5M9O A;  1QWF A;  1WI7 A;  2CYZ B;  2E1H A;  2K3B A;  3PIP A;  2OTL Q;  1VQ7 T;  1VQK A;  1U5S A;  1MHN A;  1ZHI A;  2KRM A;  1YHQ T;  4PJM A;  3OW2 S;  4N4G A;  3G6E T;  2HL3 A;  4X34 A;  3PTA A;  1JB0 E;  1VQP T;  2CGH A;  4LDY A;  3SDZ A;  1VQL Q;  2LCL A;  2KRS A;  4QQG A;  3LYI A;  2EJG A;  1OYX A;  3E9G A;  5L23 A;  4Z88 A;  3E1S A;  2EW3 A;  2EYW A;  1GL5 A;  2CZ1 B;  2L2P A;  1U8R A;  4BB7 A;  2O2O A;  4JS5 A;  2HMA A;  3OYI A;  2V1Q A;  4C5H A;  4EDU A;  4FL6 A;  4IUU A;  3A8M B;  1GCQ C;  3OS2 A;  3OB9 A;  1YFN A;  2LT4 A;  3HTR A;  1QVF P;  1Q81 U;  1Q82 R;  3LGF A;  3CQT A;  4RTV A;  4BI8 B;  3R6O A;  4IUV A;  3NPF A;  2YT6 A;  1ZA2 B;  2COW A;  4II1 A;  1D09 B;  4EMK C;  1BI3 A;  2ED0 A;  2ZCF B;  2K57 A;  3VS5 A;  3DB3 A;  5GAN 3;  4F7U B;  1MUZ A;  1M4Z A;  2DET A;  1D1C A;  4A4F A;  3H6Z A;  2PVG B;  1Y71 A;  1MMA A;  3EH2 A;  2D8H A;  2PVD B;  3LH0 A;  3QYH B;  4OMM A;  2P0P A;  1M1K R;  4IKF A;  4IUQ A;  1D3B A;  2JM9 A;  2CRE A;  2X4W A;  4JJD A;  3JB9 F;  2QDL A;  3EG2 A;  1YJN T;  5ECA A;  2A36 A;  4E6R A;  3J81 E;  1GCQ A;  2QA4 Q;  3L42 A;  2IIM A;  1RAB B;  3MP1 A;  2K6D A;  4JDS A;  2NYS A;  1S72 T;  4IUR A;  1M1K U;  4HCC A;  4N0A A;  2RHU A;  5FW9 A;  3NHN A;  4QVC A;  2E6Z A;  4PNO A;  1AWO A;  5KE2 A;  4ZTF A;  2HBW A;  2XD0 A;  2LP5 A;  4D6W A;  3CXC S;  1BIB A;  5I2S A;  4PJO B;  3GF5 A;  4FSS A;  3LWI A;  5LJ3 g;  1YHQ Q;  1VQ9 A;  2PUK B;  1X6G A;  5CKF A;  2DM1 A;  1D1A A;  2DMO A;  2CP7 A;  2F2X A;  3QUI A;  1X2K A;  3CCL T;  5LJ3 e;  3WVE B;  1ZUK A;  3VS7 A;  4LNP A;  8ATC B;  1KD1 R;  5HK3 A;  4ZGE B;  3NFC A;  1RL2 A;  2E3H A;  1ZLM A;  2WSF E;  2YUN A;  4VUB A;  4M7A B;  4M78 D;  3HFN A;  4HCK A;  3EFR A;  4IUT A;  4J9C A;  2KT8 A;  2VB6 A;  3MEA A;  1NBE B;  2DNU A;  2DA9 A;  2GBQ A;  4BDZ A;  1KD1 C;  3DLM A;  5EG2 A;  2EJ9 A;  4PJO A;  2QQ9 A;  1M8V A;  3PNW C;  3QJY A;  4RCB A;  2HSP A;  2FRW A;  5KYN A;  4M75 F;  1Q7Y U;  4JS4 A;  2LT1 A;  1Q81 C;  2EQU A;  3OS1 A;  4FT4 A;  1I4K 1;  1O75 A;  3JSC A;  1SSF A;  3CCR T;  4QKU A;  1C6V X;  1G3Y A;  5LJ3 f;  1W2B A;  2PQW A;  3OS0 A;  4FYV B;  5GAN j;  2DAQ A;  3C12 A;  1N8R R;  4XTW A;  4BD3 A;  3RR6 A;  3I55 A;  2K5I A;  4BI4 A;  3VS0 A;  4Z02 A;  1FYN A;  4J9B A;  4JZ4 A;  5GAM e;  2KRN A;  3JB9 J;  3PGG A;  3JB9 G;  1AOJ A;  2QQR A;  5GMK m;  1YJN A;  2HL5 C;  4OB3 B;  2JS0 A;  3TSW A;  5GAN 7;  2KNB B;  3FJ5 A;  2PVO B;  3A5Z B;  2DF6 A;  4M77 B;  4FCY A;  1M1F A;  4M75 G;  1K9M C;  1VQP A;  2F5T X;  1Z9Q A;  1FMK A;  5KYY B;  5J26 A;  5I21 A;  1X6O A;  5KYX B;  4C92 B;  1PCX A;  1AWJ A;  5CO7 A;  3OYK A;  2LX9 A;  2IG0 A; 
#chains in the Genus database with same CATH homology
 4C5G A;  3CC2 A;  2QA4 T;  3N5B B;  2QDY B;  3LW5 E;  1M90 C;  2VXE A;  3CME T;  3QYG B;  3QHS A;  1MGQ A;  3QII A;  4C92 A;  2MF2 A;  4C8Q B;  2DJZ A;  1VQ4 T;  5CKE A;  3TCJ A;  4JLI A;  4M75 B;  3RMQ A;  2ZPH B;  2EFI A;  3WXM B;  4F7U A;  3QBY A;  1VQ5 T;  3JCM W;  3J80 E;  4ZN3 A;  2O4X B;  4MZT A;  2DO3 A;  3QO3 A;  5AYF A;  2XID A;  2RJD A;  1H64 1;  4BI3 A;  2GFU A;  5GAN e;  5A0D A;  5GAN 6;  1UGS B;  1N27 A;  4NL3 A;  1NJI C;  2RB6 A;  2HBP A;  3QSU A;  3MEU A;  4O5V A;  3I56 T;  2PU9 B;  2RHY A;  4M7D B;  3OA6 A;  3JCM h;  3CCJ T;  1YIJ A;  4ELZ C;  4DOW A;  4DA4 A;  1NZ9 A;  4QQD A;  4PJO E;  2R58 A;  2JN0 A;  2DTH A;  2V8I A;  1YI2 T;  3OSS C;  2OAU A;  3MP8 A;  4ZGD B;  1BI2 A;  4M7D F;  3CCV T;  2K3Y A;  3L1A A;  3M4G A;  2DKG A;  5LJ3 j;  3J7A F;  3JCM d;  2WSE E;  3SB2 A;  4C8Q G;  1UGR B;  3CCV A;  3P8H A;  1ZBX A;  4QVD A;  2HQE A;  4C0F A;  5GAO r;  2L3R A;  1KC8 U;  1QVF S;  4FM4 B;  3ME9 A;  2CS7 A;  4EMK A;  2G3R A;  3CCR A;  2DEQ A;  4M7A C;  3LLR A;  4OF1 A;  4J6W A;  5GAO n;  3G71 T;  4J83 A;  3V7R A;  3MHX A;  5KH6 A;  4MZP A;  2X35 A;  2DXT A;  2Y4X A;  2V8J A;  2P0K A;  4JLG A;  3CC7 A;  5CKB A;  1N6A A;  2VV5 A;  3RMS A;  3RKY A;  4RMO A;  2RO0 A;  3JCM g;  1BKB A;  5GAN 8;  3OYH A;  2ZPF B;  3M4Y A;  2QEX A;  1YBY A;  2ZPI B;  1S72 A;  2HNI A;  4LDU A;  4N0A C;  5CKD A;  5FU7 B;  1B34 B;  4RG8 A;  3V7S A;  3JCM b;  3OYM A;  3CCM A;  2VXF A;  1KHI A;  2F5K A;  4OB2 B;  4FIB A;  3UT1 A;  4C8Q E;  4NL2 A;  2E64 A;  2QTX A;  2YLB A;  4OP0 A;  2QEX T;  1YJ9 T;  5LJ5 d;  3HL8 A;  2FB7 A;  2MAM A;  3S3M A;  5GAM d;  2RM4 A;  1UGQ B;  1YIT T;  4PJO D;  4KT0 E;  2BIV A;  2XKO C;  3EAE A;  2YLC A;  2P4T A;  5FU6 C;  4KUD K;  1OZ3 A;  5IN1 A;  4M77 G;  4M7D C;  3GNF B;  2RJF A;  5GAM f;  3GPL A;  1YHQ A;  2GF7 A;  2RJC A;  4E7K A;  4OVA A;  1JJ2 S;  1KG1 A;  3MET A;  4HA8 A;  4NOY A;  3KBG A;  3HSB A;  1U1S A;  2FYK A;  2QA4 A;  5KCH A;  1KD1 U;  2JOY A;  3CCU T;  3UWN A;  2MWO A;  1VQO T;  1I5L A;  2DTI A;  3FLG A;  4M7D E;  1FWZ A;  1VQL T;  4C0Z A;  2EJF A;  2K2V A;  3CPF A;  3MEV A;  1HXD A;  2X4Y A;  5J3B A;  2JZ2 A;  2VC8 A;  2Y4Y A;  1VIF A;  3MP6 A;  1VQO A;  4V2S A;  1VQ8 A;  2KQW A;  4XTX A;  5CKH A;  1YJW A;  4JUV A;  1BI0 A;  5IT9 E;  4M7D A;  2C06 A;  3T9N A;  4C0D B;  4JRP A;  3RUX A;  2R5A A;  3BDU A;  4QQ6 A;  3L2V A;  2LCC A;  3HRU A;  4A53 A;  4JRK A;  5DLQ E;  1XNI A;  5GAN g;  5GAO p;  1K8A C;  3BW1 A;  3OW2 A;  3OYE A;  5IAY A;  1VQ6 A;  3RER A;  3L2W A;  3E9F A;  3FIF A;  3CD6 T;  4M7A F;  2OTL T;  2E10 A;  1Q7Y C;  3ER0 A;  4MZM A;  2QI2 A;  5LJ5 g;  4E7H A;  2RI5 A;  1IRE B;  1N9R A;  1P92 A;  2L8D A;  4LD6 A;  1NPP A;  5GMK j;  1WJS A;  1WQW A;  1NJI U;  2KAF A;  4HT8 A;  3CD6 A;  5GAO l;  3M59 A;  1WJQ A;  3HHT B;  3RES A;  5A0G A;  2X4X A;  3CCJ A;  4J7F A;  4NS5 A;  1YIJ T;  1UGP B;  1K9M U;  1R8O B;  3VUZ A;  2YHT A;  4RCC A;  3CME A;  1B34 A;  4J7I A;  2GFA A;  2XDP A;  2XG8 D;  4PLI A;  2HAX A;  4HT9 A;  2L5Q A;  4A4H A;  3JRZ A;  3FDR A;  1WNL A;  4E47 A;  2XU8 A;  3A8H B;  3CC4 A;  3TU4 K;  1JBM A;  3G7Z A;  5C0M A;  3OMC A;  3SWN C;  2D9T A;  5DY9 A;  5FRN A;  5GMK h;  3BDL A;  4DQ2 A;  1VQ5 A;  3GOX A;  2KY9 A;  3EFS A;  3FJP A;  2DVE A;  4M7A G;  4LDV A;  5CCA A;  1M1K C;  2K5L A;  4M7A A;  2DTO A;  1OZ2 A;  4M7A E;  2FL7 A;  5CR2 A;  3TRE A;  2QQA A;  1UB4 A;  2R57 A;  3QZ9 B;  2F69 A;  4Y28 E;  1X75 C;  4BY6 C;  3V8K A;  3C94 A;  2RHX A;  2DXC A;  3I56 A;  4BDY A;  1BIA A;  1BI1 A;  2DD5 A;  4C8Q F;  2WAC A;  1KQS S;  3FRN A;  1W4S A;  2LQ8 A;  2QXF A;  4PJO C;  2XI9 A;  3QXE B;  4P5N A;  1YCY A;  1DJ7 B;  2ZPE B;  4M78 F;  3L2Q A;  2E6N A;  3FC3 A;  2RI2 A;  2XDD A;  5CAI A;  3OYL A;  5M9O A;  2ZPG B;  4HKE A;  2CYZ B;  2EQK A;  4XK8 E;  2E1H A;  4M7D D;  2D6F A;  2V8K A;  4FU6 A;  3PIP A;  2EQJ A;  4ELY C;  4JJN K;  3OYG A;  4OB0 B;  4QVZ A;  1Q86 U;  1VQ7 T;  3JCM e;  4C0D C;  5KE3 A;  1VQK A;  2X4J A;  2H3J A;  1JRI A;  1MHN A;  1ZHI A;  3HPW A;  3UPU A;  3X24 B;  3C95 A;  3M9Q A;  1YHQ T;  3OYA A;  1IZ6 A;  4M7D G;  5LJ3 d;  1QW1 A;  5GAN 2;  3OW2 S;  1Q82 C;  1VQ7 A;  4N4G A;  3OYC A;  3ZBD A;  4PKC C;  3G6E T;  4X34 A;  5GAM g;  3PTA A;  5GAN 5;  4C0G A;  1XOV A;  1K73 U;  2MMP A;  1HK9 A;  1JB0 E;  1N9S A;  2L89 A;  1VQP T;  3CBO A;  2CGH A;  4LDY A;  3SDZ A;  2LCL A;  1PSE A;  3RKX A;  4QQG A;  3LYI A;  5HY6 A;  4RG2 A;  3F70 A;  5CVI A;  3DKM A;  3QJ6 A;  2EJG A;  3V8J A;  1VIE A;  1OYX A;  3QKJ A;  4M75 C;  4OB1 B;  3JCM c;  3CCM T;  3X20 B;  4A4G A;  2RHI A;  2LTO A;  1M8V A;  3E9G A;  2P0Q A;  2CZ7 B;  4IUP A;  4EMH A;  1VQ6 T;  3E1S A;  4C8Q A;  3CMA A;  2KSS A;  4MML A;  2CZ1 B;  2JNG A;  4M78 G;  2Y90 A;  5FU7 C;  4BB7 A;  3G4S A;  1U8R A;  2E70 A;  4JS5 A;  2KVQ G;  2VGN A;  1VQ9 T;  3CEY A;  3GIB A;  3NTK A;  4BAC A;  3CMA T;  3P8D A;  3OYI A;  5LJ5 j;  2JTM A;  4C5H A;  4E7L A;  4A54 A;  4EDU A;  2ZPB B;  4FL6 A;  4IUU A;  1FX7 A;  3A8M B;  2MI6 A;  1LOJ A;  4FSX A;  3OS2 A;  3OB9 A;  3P8B B;  2LT4 A;  3OMG A;  4JRQ A;  2RA2 A;  1ZQ1 A;  4J6Y A;  1QP2 A;  3M54 A;  3WVD B;  2DK3 A;  3INZ A;  3LGF A;  3PT9 A;  2E65 A;  3OY9 A;  4M77 C;  1Q81 U;  2EKO A;  1KQS A;  5GMK e;  1G3S A;  4BI8 B;  2B8A A;  4M77 F;  3JCM f;  3S3N A;  5D6W A;  4C92 C;  3R6O A;  3CCS A;  4IUV A;  4HCB A;  4II1 A;  2VYT A;  4XAX B;  5CIU A;  4EMK C;  3JB9 I;  1QVP A;  1BI3 A;  2ZCF B;  1VQ4 A;  3SWN B;  1JJ2 A;  2K57 A;  4DOV A;  5GAN 4;  3OQ5 A;  1D3B B;  3DB3 A;  4X9C A;  5GAN 3;  2YRV A;  4F7U B;  2DXB A;  5KCO A;  2EWN A;  4MDW A;  1M4Z A;  1VQM A;  2KDS A;  3A8O B;  4BUG A;  4A4F A;  4M78 E;  3HFO A;  3H8Z A;  2DPP B;  1WGS A;  3H6Z A;  2PVG B;  1Y71 A;  3OYD A;  3O8V A;  3I55 T;  3OYF A;  3HRT A;  1Q82 U;  4BE0 A;  3JB9 H;  2PVD B;  3M5A A;  5GAO q;  3LH0 A;  5C6S A;  3OSV A;  3QYH B;  3VYH B;  2O01 E;  1V29 B;  2P0P A;  1OI1 A;  5GAM h;  4IKF A;  2LC4 A;  4PL6 A;  3LWH A;  3VYG A;  5LJ5 h;  4E7J A;  3CCE A;  4IUQ A;  1D3B A;  4LDX A;  2X4W A;  4F7U E;  5LL6 S;  3CC4 T;  4KUL A;  2WSC E;  2DIQ A;  2LDM A;  3JB9 F;  5D6X A;  1G3W A;  3ASK A;  4RKU E;  5CQY A;  1YJN T;  4N4I A;  4C8Q D;  4J6X A;  3J81 E;  3CPW S;  3SFM A;  1XTD A;  3L2U A;  1QVG S;  3L42 A;  2LVM A;  3VU3 C;  4C92 G;  3G6E A;  1M9S A;  3MP1 A;  3URG A;  1KQ2 A;  1KQ1 A;  2EAY A;  2M9U A;  3V7C A;  4JDS A;  4F7U G;  4KUI A;  3OBW A;  5GAM j;  2LRQ A;  2BKD N;  1S72 T;  4YTL A;  3A8G B;  4M75 D;  2AHJ B;  4IUR A;  4A4E A;  2D0Q B;  3UDC A;  3FEO A;  1M1K U;  4HCC A;  4N0A A;  1K73 C;  2E12 A;  2RHU A;  3HRS A;  1YJ9 A;  4C92 E;  2I2L A;  2XIC A;  4QVC A;  4B9X A;  1XQH A;  2E6Z A;  4PNO A;  4ME7 A;  4QW2 A;  3M55 A;  5FRO A;  4ZGJ B;  4ATO A;  5HKC A;  5KE2 A;  3M57 A;  3LGL A;  4ZTF A;  2XD0 A;  4D6W A;  1BYM A;  3CXC S;  2RJE A;  1BIB A;  3L2Z A;  4R56 A;  4LDW A;  4CRI A;  5I2S A;  4L5G A;  3CCQ A;  1Y7X A;  3GF5 A;  3M58 A;  3RIR A;  3X26 B;  4PJO B;  4KBM B;  3MEW A;  3KUF A;  4R55 A;  3LWI A;  5LJ3 g;  1VQ9 A;  2PUK B;  4ZN1 A;  1LJO A;  1YIT A;  5CKF A;  4M75 A;  3KXT A;  3QUI A;  4M77 D;  3CBP A;  3CCL T;  2E41 A;  1UEB A;  5LJ3 e;  4M78 B;  4C92 D;  2KMT A;  1VUB A;  1H3Z A;  4JRI A;  3WVE B;  1QVG A;  4GY5 A;  4Q5W A;  1AHJ B;  3CCL A;  3QDR B;  4ZGE B;  3PFS A;  3NFC A;  5HK3 A;  4L59 A;  3CPW A;  1RL2 A;  5GAO m;  3CCU A;  4C5E A;  2XDB A;  1W2B S;  4TVR A;  1I8F A;  3M53 A;  5I2M A;  2WSF E;  4VUB A;  4M7A B;  5LJ5 f;  4M78 D;  2K5F A;  3HFN A;  1VQ8 T;  2EYQ A;  3X28 B;  2IVW A;  2K3X A;  3EFR A;  4IUT A;  4MMK A;  3OBY A;  1YJW T;  3A8L B;  3VV0 A;  3JB9 D;  2OTJ A;  2GQV A;  3BFM A;  5HK0 A;  4M77 A;  2CZ0 B;  5CK9 A;  4XTY A;  3SD4 A;  3GP8 A;  4A4K A;  5LJ3 h;  3PMT A;  3G4S T;  3MEA A;  1KHC A;  4XTU A;  4XU3 A;  4CI0 C;  1VQM T;  1U1T A;  4PJO F;  2EQM A;  4OMF B;  4F7U F;  1VQN A;  4BDZ A;  1KD1 C;  1FXX A;  5A0L A;  3DLM A;  5EG2 A;  2EJ9 A;  3RKW A;  3GLX A;  1N8R C;  4PJO A;  2QQ9 A;  3MCA B;  1Y96 A;  3ZFJ A;  2DIG A;  3PNW C;  3QJY A;  1VQN T;  4RCB A;  5GAN h;  3CBM A;  4HCZ A;  3C4S A;  4PJO G;  1YI2 A;  5DLO A;  3VUB A;  1WQ7 A;  3PIO A;  4C8Q C;  4GLK A;  3NTI A;  4X9D A;  2XK0 A;  4M75 F;  2DZC A;  5L8R E;  3DLL A;  1Q7Y U;  2VGM A;  4JS4 A;  2LT1 A;  3HKS A;  2XHC A;  5GMK i;  3CCS T;  1Q81 C;  2EQU A;  1G3T A;  2FHD A;  3JAM E;  3MO8 A;  2LNV A;  3VKI A;  4FT4 A;  3OS1 A;  1I4K 1;  1O75 A;  3AHU A;  3QG1 A;  4XU1 A;  3JSC A;  3GNG A;  2E5Q A;  3E19 A;  4UC4 A;  1SSF A;  1K8A U;  3CCR T;  1M5Q 1;  2DXU A;  4C5I A;  3VJP A;  1G3Y A;  3BY7 A;  4FT2 A;  5LJ3 f;  3L2R A;  5J39 A;  5A2Q E;  3G71 A;  1W2B A;  2PQW A;  2DZ9 A;  3OS0 A;  1X01 A;  2DAQ A;  5GAN j;  3JCM J;  4XU0 A;  3HP9 A;  3C12 A;  4XTW A;  5GAN d;  2ZZD A;  3OS5 A;  4BD3 A;  2RH2 A;  2EIF A;  2M0O A;  3S3O A;  1QVF A;  2A3L A;  4XU2 A;  3I55 A;  3NTH A;  2K5I A;  4BI4 A;  5CQX A;  3JCM X;  2FVU A;  5FU6 B;  4Z02 A;  2A7Y A;  4L6V 5;  2JVV A;  2PUO B;  4BE2 A;  1G5V A;  3JCM Q;  1TH7 A;  1EIF A;  2O4X A;  4C92 F;  2RI3 A;  3JCM P;  5LJ5 e;  1GXI E;  2BUD A;  5FRM A;  2GCX A;  4M77 E;  5GAM e;  1NPR A;  1WPY A;  2JUF A;  2HQX A;  3JB9 J;  3PGG A;  4M78 A;  1M1G A;  4XQ3 A;  4ZTJ A;  3CCE T;  4MDX A;  3OYN A;  3JB9 G;  2QQR A;  5GMK m;  4XTV A;  4EMG A;  1YJN A;  1Y07 A;  3QZ5 B;  2HD0 A;  3PMI A;  1N8R U;  4OB3 B;  5GMK l;  5GAN 7;  4BY6 B;  1O9S A;  2RK2 A;  4EMK B;  2VUB A;  1VQK T;  4B9W A;  1PSF A;  3V8L A;  3OYB A;  2PVO B;  1VQL A;  1RI0 A;  4J5Y A;  1LNX A;  1I81 A;  4M78 C;  2RK1 A;  2K4Y A;  4LD9 K;  3A5Z B;  1Q86 C;  4M77 B;  3CC7 T;  2ZGW A;  3OYJ A;  3S6W A;  1M1F A;  3FB9 A;  4E7I A;  5FLX E;  4M7A D;  2QQS A;  3DB4 A;  4M75 G;  1K9M C;  1VQP A;  2F5T X;  2DD4 A;  2RD1 A;  4EPC A;  2MWP A;  5D6Y A;  5J26 A;  5I21 A;  4XTZ A;  3TEE A;  1X6O A;  1WJR A;  1QP3 A;  2RHZ A;  2JTF A;  3ZEH A;  1KC8 C;  2M1H A;  4O6J A;  4J8O A;  4WF2 A;  4C92 B;  2OTJ T;  2R5M A;  1Y96 B;  3Q1J A;  2KK4 A;  2NLU A;  1NE8 A;  3QPH A;  3CXC A;  3CCQ T;  2OTL A;  1M90 U;  3OYY A;  2QQB A;  4M75 E;  4PLL A;  3CC2 T;  4OGC A;  4OGE A;  3M56 A;  5CO7 A;  3X25 B;  4N4H A;  2M16 A;  3OYK A;  3JCM V;  2LX9 A;  3SWN A;  2CKK A;  5DM7 R;  2IG0 A;  3LX7 A;  2LQK A;  4BE1 A;  5GAN f;  2CZ6 B;  4Y91 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...