3JCMV

Cryo-em structure of the spliceosomal u4/u6.u5 tri-snrnp
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
84
structure length
72
Chain Sequence
MVPPINCIFNFLQQQTPVTIWLFEQIGIRIKGKIVGFDEFMNVVIDEAVEIKEDVEKKILLKGDNITLITSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The 3.8 angstrom structure of the U4/U6.U5 tri-snRNP: Insights into spliceosome assembly and catalysis
pubmed doi rcsb
molecule tags Transcription
molecule keywords Pre-mRNA-splicing factor 8
total genus 7
structure length 72
sequence length 84
chains with identical sequence Y
ec nomenclature
pdb deposition date 2015-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3jcmV00
4M7AA 3QO3A 1M8VA 5I21A 1M5Q1 4XU0A 3SWNA 3JCMX 2YLBA 3RERA 2RB6A 4XU2A 1N9SA 4NOYA 1I81A 2VXFA 4PJOD 2DJZA 4M75B 5GAN6 2DXTA 2VC8A 4X9CA 3RESA 5LJ5h 2DZ9A 3SB2A 1HK9A 4F7UG 4M77F 3FIFA 1HXDA 4V2SA 3RIRA 5GAN5 2RD1A 4M78B 2DTOA 3BY7A 1BIBA 3L2ZA 3AHUA 3HFOA 4QVDA 3BW1A 4XTUA 3JB9G 3QUIA 2EJFA 5GANd 1BIAA 2EWNA 4HA8A 4M75C 4J6WA 5LJ3g 5LJ3h 2DXUA 4EMKC 4M7AE 3JCMe 4C8QE 2JN0A 3RKWA 3V8KA 4PJOB 2FB7A 4A53A 5LJ3e 1U1SA 5GAOq 1WPYA 4M75G 4NL3A 4M7AF 4M7DE 3QHSA 4M77A 4JUVA 1I5LA 2DTIA 4EMKB 3EFSA 4M75F 5GANh 4M7AG 5GMKm 4M7AD 4J6YA 4PJOC 1MGQA 4X9DA 2EJGA 4M7DC 4M78F 1Y96A 5GANj 3PGGA 4M77E 4HT8A 2DKGA 4M7DA 4PJOA 4A54A 5GANe 4F7UA 1KQ2A 4XTVA 2ZGWA 3V7RA 5GAOm 4M78E 4HT9A 4WF2A 5GAMg 4C8QA 2YLCA 4C92G 3JCMV 4XQ3A 1WNLA 2DZCA 5GAMf 5GMKh 5LJ3d 5LJ3j 4M77G 4NL2A 3JCMh 4MMLA 5GAMe 5GAN7 4M7AB 1WQ7A 1I8FA 3JB9H 1TH7A 1U1TA 3JCMf 2E41A 3FJPA 2E1HA 2YHTA 4JRIA 3JCMd 1LNXA 4C92F 2E65A 5GAN2 5LJ5g 2RA2A 4M7DB 1WQWA 4Y91A 5LJ5f 3JCMW 4M77D 1KQ1A 5CAIA 4C8QB 4M78G 4N0AA 5DY9A 3VU3C 5GMKj 3RUXA 5GAOp 5GAN4 2RM4A 4M75D 4F7UB 5GMKe 3INZA 1YCYA 2CGHA 3M4GA 4N0AC 2VXEA 1JRIA 1Y96B 4XU1A 4C92C 3V8JA 3RKYA 3JCMc 4XTWA 5LJ3f 3V7SA 4C92D 5GANf 4J6XA 1X01A 2DTHA 4RCBA 4C8QC 5GAMj 5GAMd 5GANg 3JB9I 4EMKA 5GAOn 3HSBA 2K57A 5GMKl 4M77B 3L1AA 4PJOG 3RKXA 4C92B 4M75E 5LJ5e 4M7DF 4JRKA 3JB9J 4M7AC 4OP0A 4C8QG 2EAYA 2QTXA 1H641 3JB9F 2HNIA 4JLIA 4C8QF 3BDUA 4PNOA 3BFMA 4M7DG 1N9RA 3V8LA 2FYKA 4PJOE 4M78D 4F7UF 4M7DD 4PJOF 3SWNC 3V7CA 4M78C 4M78A 4DQ2A 2DVEA 4C92A 1LJOA 2Y90A 4XU3A 4C8QD 4EMHA 4RCCA 4F7UE 5GAN3 3JB9D 3QSUA 4M75A 2EJ9A 4J5YA 1B34A 3JCMQ 4QVCA 4MMKA 3EFRA 5GAOl 1LOJA 3SWNB 1D3BA 4EMGA 5LJ5j 4XTYA 2E10A 1D3BB 2E64A 4XTZA 3JCMb 1JBMA 5GAMh 4XTXA 1B34B 3HFNA 4M77C 4C92E 5GAOr 3GIBA 1I4K1 3FB9A 5GAN8 2I2LA 3JCMP 3JCMg 2DEQA 3JCMJ 5GMKi 5LJ5d
chains in the Genus database with same CATH superfamily
2KEAA 3RBBB 3VRZA 4XU2A 4JRPA 4V2SA 1UE9A 2R5MA 3CEYA 4E6RA 4YTLA 1AZEA 3OBWA 3HFOA 1VQNT 1X43A 2LMJA 3JCMe 4PLLA 1X27A 4A53A 3SEMA 4FW2A 3VS1A 3EHRA 3FDRA 2HKQB 1V76A 4Z8AA 3ASKA 5KYXB 4M7DA 1YITT 3N5BB 2ZCFB 4HT9A 3KBGA 4J9DA 1F1BB 1QP3A 1VQ7Q 1VQPA 2DILA 3CCQT 1I07A 2ZPIB 3QYHB 5I22A 4M7DB 2NWMA 2OTLT 3X24B 1K76A 3JCMW 4RG8A 1WXBA 1PKSA 3RUXA 2RH2A 5GMKe 4OGEA 2RPNA 1Y71A 1VQLT 2A7YA 4A4FA 3JB9I 4BDZA 5LL6S 2MAMA 3MO8A 3RKXA 1JU5C 1ZQ1A 1NE8A 2J6OA 2O88A 1H641 2ENMA 4PNOA 4D8DA 4A4KA 2H3EB 4D6WA 3QDFA 2D0NA 4F04B 4F7UE 1E6GA 4KGZB 1WHMA 1Z9ZA 2SRCA 3QWXX 1M90C 4MDXA 3MKDA 5HK3A 3GIBA 3G7ZA 1X2KA 5KE2A 3C95A 2LP5A 5I21A 2FG0A 1FMVA 1HXDA 2DERA 2RD1A 1NJIU 2QA4T 1VQ9T 3JB9G 4IUQA 2P0PA 3HP9A 4KGXB 5LJ3h 1JB0E 5DLQE 1YHQA 1VQKT 4GLMA 1Q81C 2VWFA 4FM4B 1I5LA 3UA7A 1W6XA 4FYYB 3A98A 2EYQA 4E7JA 1VQOT 3PGGA 2DKGA 2EVRA 1MMDA 2OAWA 3M0RA 2RQRA 3M59A 5GAMf 1ZSGA 1Y57A 3CXCA 1EIFA 1VQ7A 2DL8A 5HCKA 2F2VA 3QG1A 3JCMf 3EGUA 4AFZC 1QCOA 2CDTA 4L6V5 2FO0A 1VQ4Q 5FRNA 5LJ5f 1GFDA 1MNDA 1Q82U 3R6NA 3I56A 2HQEA 3ZL7C 2VB6A 2HBWA 1SF9A 1VQ8A 3QZ5B 1WXUA 2O9VA 2K57A 1UJYA 3EGDB 1E7OA 2CP7A 4AG1C 4M7DF 5CK9A 3CC7A 1MUZA 2LDMA 4C8QF 1TS9A 2JOYA 2O2OA 2LC4A 3CMEA 3V7CA 1AEYA 2L0AA 4OMOA 2EJ9A 2FZCB 4QVCA 3L2QA 4BI4A 4GY5A 4XTZA 3OYIA 2E6NA 2B8AA 4ATOA 2A0FB 4B6MA 3JCMP 3QYGB 1M2OA 2VXFA 1IZ6A 1MNEA 1FX7A 1M3AA 2WSCE 2CSQA 4DOVA 3PTAA 5KYYB 5IT9E 4A4EA 4ZGJB 1UGVA 5AYFA 4C0ZA 1K73R 4J6WA 4L59A 3RKWA 4PJOB 2EYYA 2RO0A 4M75G 4M7AF 3OYEA 2D8HA 1OQKA 1OU9A 2KYBA 4PJOA 2JTMA 1WXTA 3M54A 5KYNA 3V7RA 4M78E 1FMKA 1VA7A 2IPOB 2IVWA 1UFFA 1QLYA 2E41A 5GAN2 3CMAA 4HVWA 3UA6A 3QKJA 2K3XA 4AFSC 4IKFA 5CKDA 1QVGA 1D09B 1TUGB 4M78G 5DY9A 2XMFA 4J9HA 3OYLA 2K3YA 4E7LA 1Q86U 3EG9B 3CCLA 5GAMd 3M0QA 3OSSC 4IURA 2DETA 1HD3A 4JZ4A 3J81E 4BE0A 2K5FA 4JZ3A 2HNIA 3CCJA 3BFMA 5I2SA 5IAYA 4BI3A 1RAEB 3L42A 1UB4A 4PJOE 2DA9A 5GAN3 3G71Q 3QSUA 4RTYA 2JM8A 3CCQA 4MMKA 2BUDA 3RMQA 3ULRB 1RUWA 1BB9A 2ROTA 2I2LA 2CH4A 1UHCA 2CREA 1EFNA 5HKCA 2LT1A 1NPRA 3G4ST 3KFVA 1TG0A 2PUOB 3UWNA 1G83A 2ZPEB 2RQVA 3LH5A 3G6EQ 3OW2S 3CCMQ 2BE7D 1KK7A 4J9IA 2RJCA 3VYHB 3V8KA 2O4XB 1QCFA 2XDDA 4NL3A 5A2QE 5KYWB 4EMKB 2DYBA 3ZEHA 1KQSA 3FRNA 2DVJA 3I9QA 4M78F 1Y96A 7AT1B 4MZTA 1VQPQ 2EYXA 2GFAA 2RK1A 5KYYA 4F7UA 3URGA 4BE1A 2HMAA 3EG2A 4ZTJA 2LQWA 4OB1B 4OF1A 4WF2A 2CUDA 1VQ6Q 3EFOA 1Z9QA 2JXBA 4M77G 1YJ9A 1UJ0A 1S72Q 4BDYA 2FL7A 1WQWA 1VYTA 1UEBA 4Z89A 3EG0A 4FCYA 3CCUQ 1VQ5Q 2KSSA 4RTTA 2RQUA 2MI6A 3SFMA 1JRIA 4A63B 3V7SA 1VQKA 2VKNA 2CP2A 1HYOA 1AVZC 3OB9A 2ZPHB 1K8AC 2GGRA 3DB3A 2NUZA 4CRIA 3MHXA 4MZMA 5LJ5e 2K5IA 4IUTA 2EAYA 4HKEA 3P8DA 4FIBA 4LUEA 3MP8A 4M78D 1YN8A 1VUBA 1M1GA 2K4YA 1YWOA 1Q82R 1D0YA 2LCCA 4C92A 3VS4A 2ESWA 4CC7A 3X26B 3JCMQ 3SWNB 5LJ5j 2QDYB 5ECAA 3OYFA 2EBPA 1YHQT 2CYZB 2CZ6B 3HHTB 3OSVA 3CCET 4KGVB 1OYXA 1W2BA 3CCEA 2G6FX 4M75B 3OYDA 2VC8A 5D7UA 1HK9A 3ZBDA 3M57A 2NYSA 3I5SA 2J7IA 8AT1B 1VQ4A 4HVUA 2DFUA 1W2BP 3MEAA 4ESRA 5CQXA 3H41A 3CMAT 2XKOC 3CCRQ 1Q95G 4FSSA 4J9GA 2FB7A 2CT4A 1WPYA 1JQQA 4LXCA 3S3MA 3QHSA 3TCJA 1TXQA 2A28A 1NEGA 4J6YA 1N8RU 2HAXA 4KH0B 2HCKA 1EZZB 2RK2A 4XTVA 3AT1B 2DE0X 3A8LB 2YLCA 5EC7A 3CC4T 2E3HA 3KXTA 3JCMh 1M27C 4MDWA 2XDPA 4N4IA 5IHNA 2GCXA 4IUUA 1XJWB 5FU6B 2BE9B 1Q7YU 4M77D 2C06A 4E7KA 4C8QB 3GPLA 6AT1B 4N0AA 4DEXA 2YRDA 2HKNA 3EAEA 2AT1B 1D0ZA 5GJVB 3GP8A 3CCMT 3FJ5A 2KDSA 3I55T 4J7IA 4PJOG 1IO6A 1RI0A 4M75E 2O9SA 2X35A 3O5ZA 1HSQA 3E1SA 4DBQA 3LWHA 1S1NA 2OTJT 1WDXA 4OMLA 2NUPA 2ZAEA 4QQDA 1VQPT 4CI0C 2QEXQ 4VUBA 1KFZA 3CC7Q 1Q81R 2RQTA 5CKBA 1M1KR 2YWWA 2QGFB 2KMTA 3VS6A 3UDCA 1MV0B 3CPWA 2ZPGB 1VQMQ 1OV3A 3JCMJ 1AZGB 2QA4Q 2DL3A 3VS2A 2KI7A 4LDVA 2JS0A 4AMCA 3OYKA 3CCSQ 2QTVA 2KBTA 1QMCA 2OJ2A 4XTUA 3HRSA 1RAFB 2LVMA 2EJFA 4ME7A 2F69A 2EYZA 2QQAA 4C8QE 2JN0A 2LCSA 4LE9A 3C0CA 3PIPA 1ZBJA 1Y7XA 1K1ZA 1ZUYA 1YIJA 1K4US 4LD6A 5KYWA 4HT8A 3OA6A 5FWBA 4DEYA 2KROA 5GANe 3REBB 2CP5A 1LCKA 5I2MA 1ZUKA 3JAME 2CKKA 2M16A 4NL2A 4MMLA 2AK5A 2FPFA 4OB3B 2X4XA 1QVPA 2JTFA 4DBRA 3G4SA 3A8OB 4BY6B 8ATCB 1JXMA 1NLOC 2QA4A 3TSWA 1XNIA 4FU6A 3LYIA 3VU3C 2DPPB 2EQUA 2RM4A 3QIIA 2DXCA 1YCYA 3V8JA 3CMAQ 4XTWA 5LJ3f 2GF7A 1JO8A 2BTTA 1VQOA 1ABOA 2LX9A 2FVUA 2DLPA 5KE3A 1YJWQ 1K8AR 2P0QA 2F5TX 2D6FA 2O01E 4FYXB 4ZN1A 1YIJT 4OVAA 5FU7B 1VQOQ 1Y0MA 1VQ8Q 3H6ZA 4OMQA 1QQJA 2DRMA 3CCVQ 4Y28E 2H3JA 4C5HA 1VQ6A 2MCNA 1RAIB 2HBPA 1CKAA 1QVGP 2RN8A 1M2VB 2V8JA 4R55A 4C0DB 3NTHA 2EKHA 1TU0B 2QEXA 3JCMg 2KVQG 4BE2A 5GMKi 5LJ5d 4M7AA 3QO3A 2LNHB 4DA4A 1UGRB 2DXTA 4PL6A 3VS7A 4J7FA 4PFOA 1QKXA 2DTOA 2E5QA 5IXBA 5GJWB 1WJSA 1VOMA 3NMZC 2EQMA 1EX4A 4RTUA 5GAOq 1MMNA 1M3BA 4JUVA 1UHFA 2PVGB 4QQ6A 2J6FA 3QWYA 3L2VA 2HZYA 1G3YA 2DL5A 1WFWA 1IHWA 1O9SA 3C4SA 2M0YA 4C92G 1WNLA 2LZ6B 2DL4A 4AG2C 2J06A 4D8KA 1KC8R 3OS0A 2Y4YA 4RUGA 3MPUB 3RNJA 1Q7YR 4MZPA 2CGHA 2DXBA 3MCAB 2JW4A 5GANf 1M1KC 2KXCA 5FW9A 3BDLA 3QDRB 1WZOA 1Q86C 2DIQA 2XD0A 3LLRA 3CMET 1D1AA 2L3PA 2E6ZA 3LGFA 2R57A 4JLIA 3G71T 2KYMA 2L89A 4BY6C 1PKTA 1VIEA 1FMWA 1QW1A 4XK8E 3NTKA 1OU8A 1IRXA 2IG0A 2M1HA 3EG9A 2MWOA 4JJDA 2YXYA 5FRMA 2FPEA 2MWPA 1D3BB 2OX7A 2HQHA 2QAZA 2YUOA 4FT2A 2FHDA 3VUBA 2GNCA 2RI2A 1M8VA 3SD4A 1OULA 5FU7C 3L2RA 1QKWA 4JLGA 1X6OA 2AZSA 5GAN6 4NS5A 2DZ9A 3JV3A 2YUQA 3SB2A 3FIFA 2MMPA 3RIRA 2RF0A 2RHUA 1RABB 1TOVA 3PMIA 1VQ9A 3BW1A 3X28B 2DL7A 1SHGA 2KK4A 1QWFA 3EGXB 2DXUA 4M7AE 2L3RA 3OS2A 3CD6A 4M77A 4C0DC 1GRIA 2X4WA 3CCRA 2JMCA 1IHVA 2DIGA 2COYA 4Z02A 4HCZA 3NPFA 3M56A 5CKFA 1AWWA 2XI9A 3PT9A 2BZ8A 4J8OA 3CCLT 3HRTA 1I1JA 2X4JA 1TUDA 1WHLA 1Q82C 4RTVA 3JCMd 1QCNA 3VV0A 1KHIA 2PU9B 3LGLA 4GLKA 4RG2A 1X75C 1A0NB 2A36A 1OPLA 2COWA 2KGTA 1PSFA 4XAXB 5GAN4 1NBEB 3INZA 2VXEA 4C92D 1M30A 2JZ2A 5GAMj 1NJIR 1VQNQ 1KJWA 4IUVA 2P4RA 1YI2T 3VS0A 3M0UA 2HSEB 2V8KA 3JB9J 2QQRA 1MMGA 3X25B 1RLPC 2RJFA 3GNFB 1PD0A 2KNBB 2Z0WA 3M0TA 4M7DG 1VQNA 2QQSA 4LNPA 1T0HA 2Y90A 3OYGA 1T3SA 3ZFJA 1YITQ 1M8MA 1XQHA 2XDBA 1IGUA 4OB0B 1G8XA 2KAFA 4HXJA 4XTXA 3PVQA 4LUDA 4PLIA 5GAOr 4HCBA 1SEMA 3QBYA 2LCLA 1JJ2P 1BKBA 2HQXA 4XU0A 3SWNA 4HVVA 2K5LA 2AHJB 4NOYA 2FEIA 2DJZA 3F70A 3UPUA 3H8ZA 2RHIA 3DB4A 3UATA 3BY7A 3MEWA 1NG2A 3ER0A 2L5QA 4Y92A 1SRLA 2EWNA 5KYUA 4EMKC 3CCSA 2QGGA 3OYNA 1N8RC 4AT1B 1YP5A 3CD6Q 2E12A 4OMPA 2QXFA 3BE3A 5CO7A 1G3SA 3TREA 3CPWP 2K2VA 2F1LA 3MP1A 3TSZA 3HRUA 4KBMB 2ZGWA 3VUZA 2EGEA 5GAMg 2YRCA 3L2UA 4RTXA 5GAMe 2D1XA 1OOTA 1AT1B 4J83A 5AT1B 4EIKA 3M55A 1Y07A 2MF2A 4Y91A 1VQ7T 1OEBA 1QWEA 2JTEA 1KHCA 1NZ9A 3I55Q 1BCOA 3CC2A 2XG8D 1Y96B 2D0QB 1NJIC 3G6ET 3QZ9B 2ECZA 4JS4A 4B9XA 1QVGS 1PSEA 4J9CA 1O75A 1B07A 4C92B 2EFIA 2F2WA 4KULA 4E2FB 4OP0A 2QEXT 2QTXA 1BI1A 4E7SA 1GXIE 3BDUA 1N9RA 3V8LA 1IREB 2DF6A 3QJYA 2RI5A 3SWNC 5KCOA 2HDAA 2RQWA 3VJPA 1LJOA 3OQ5A 1U5SA 4N4GA 1IGQA 2X51A 2WSEE 5J26A 3CCLQ 1OZ3A 5IHIA 2JUFA 3CXCP 1YBYA 4OMMA 2RNAA 1BK2A 4PJJA 4BI8B 3DLLA 4LDXA 4CC2A 5HK0A 1W2BS 1WGSA 1BBZA 2DO3A 1GL5A 2YLBA 2KQWA 1VQ4T 1I81A 1X6GA 1N5ZA 2EIFA 5GAN5 2X4YA 1V29B 3EHQA 2CP6A 1I5OB 1WLPB 3PVLA 3DLMA 4JRQA 1RL2A 3J7AF 2A08A 2J05A 4PFZA 4R0KA 1AWJA 3CCRT 1UUEA 3FLGA 5GANh 1QVFS 3MEVA 1MGQA 1AOJA 1M9SA 1N6AA 1ABQA 2PNIA 2Y4XA 2AKLA 3CC2Q 2L3SA 3M9QA 1VYVA 2DM1A 5LJ3j 1M90U 5FU6C 3EFOB 1I8FA 1TH7A 2RHZA 3QJ6A 3META 2YHTA 1UTIA 4E47A 1U06A 2M51A 4IIMA 2YUNA 2A37A 4JJBA 4JJNK 2NLUA 2OTLQ 2XICA 3RKYA 3JCMc 1ARKA 2LX7A 4OMNA 3J80E 1AWOA 2DBMA 2W10A 3EGXA 5GMKl 1PRMC 1MMAA 3L1AA 5L8RE 1K9MC 5M9OA 1H3ZA 1PC0A 3GBQA 1KD1R 2FYKA 2WACA 2O31A 2KR3A 4F7UF 1UDLA 4M78A 3UT1A 1TTHB 3P8BB 3H0IA 5IHKA 1PCXA 1PNJA 3EFRA 1X6BA 1D3BA 3CBPA 4F16A 5DLOA 5FROA 9ATCB 3OBYA 4Z88A 1B34B 3MJXA 1YWPA 3OS1A 3QXEB 2PVDB 4OGCA 5J39A 1WJQA 1M5Q1 2QI2A 3JCMX 3OYBA 1UG1A 3UF4A 1Q86R 4PJLA 4X9CA 1X2QA 4OMFB 5DM7R 4C5GA 4IIOA 1BIBA 3S3NA 2DAQA 2JM9A 3PMTA 5LJ3g 5IN1A 3U23A 1G5VA 3CCST 3E9FA 2HL5C 2V26A 2PQWA 1VQ9Q 5LJ3e 2MYSA 1G2BA 2P0KA 1TUCA 4C0GA 4IUPA 4ELYC 2QG9B 3RMSA 2DRKA 1NM7A 4FSXA 3GOXA 3CCUA 1VQ5A 5CIUA 2YRVA 3C94A 5I11A 3GF5A 1S72T 2NUTB 4LDUA 2AZVA 4X34A 2NUTA 1GBQA 5FWCA 2E1HA 5A0GA 4A4HA 4FYVB 1WX6A 5GMKj 1M90R 4M75D 1K0XA 1FXXA 3HTRA 3M0PA 1LPLA 3HKSA 4C5EA 2F5KA 1FWZA 1SKUB 2GTOA 1PM3A 3OYMA 1ZA2B 3JB9F 3M53A 2FZGB 4QQGA 5EG2A 3EG1A 4WTOB 1AD5A 2E70A 4JDSA 4TVRA 1SSFA 2QQBA 3JSCA 4PJOF 1W1FA 5C6SA 5CQYA 4RCCA 1WYXA 3EGDA 2DYIA 4AFUC 1WHJA 1B34A 1DJ7B 1RLQC 1OI1A 2H8HA 1G3TA 2L3QA 3L2WA 3S6WA 4LD9K 3HFNA 2E4HA 2K2MA 5GAN8 4JPBW 3RERA 3H0HA 1YJNQ 3I5RA 3CPWS 3WXMB 4F17A 4ZN3A 3G71A 3AHUA 3L2ZA 2DD5A 1CKBA 4HA8A 4LDWA 2XU8A 1ZX6A 2CP0A 1WHKA 2EYWA 1RI9A 2DTIA 3FC3A 4M7AD 3LW5E 4FT4A 4A54A 2X9HA 4QKUA 3PFSA 3MP6A 3OYAA 3H9NA 1K0SA 2R5AA 4C8QA 2JVVA 3RDVA 2DD4A 3CCMA 4A4GA 1OX8A 4II1A 1R0CB 2EQKA 3NFCA 1J3TA 4UC4A 1M4ZA 4M7AB 1H92A 3JB9H 3OMGA 3I55A 4GBQA 2GBQA 2M9UA 5LJ5g 2HSPA 4QT7A 1M2VA 1R77A 2ATCB 2DNUA 1BI3A 1OZ2A 4M7DC 4XU1A 2X3WD 4JS5A 2HEQA 3CQTA 1P92A 4B9WA 2G3RA 2CZ7B 4E7ZA 3HSBA 2JS2A 2XHCA 2C0OA 2VGMA 3EH1A 2OAUA 1RAHB 2EGCA 1T0JA 2CS7A 4EDUA 5KYUB 4PFPA 1MHNA 2W0ZA 1AWXA 3M58A 1K9MU 1W4SA 4M7DD 3M0SA 5J3BA 2FZKB 1IB8A 1VQ6T 4LDYA 3OYJA 1PG5B 1VQMT 1KSWA 2KE9A 3E2UA 2E10A 2EQIA 4F14A 1S72A 1YCSB 2BIVA 5A0LA 2DEQA 1QVFP 2CZ0B 1UECA 3NTIA 1B7TA 2YUPA 4F7UG 4M77F 2J6KA 1KQSP 2MIOA 4QVDA 1E6HA 2K6DA 5GANd 1QVFA 5A0DA 5HY6A 3R6OA 3OYHA 3FEOA 5KYXA 1U1SA 1ACMB 2CZ1B 2PUKB 4J9BA 4M7DE 2P84A 2KT8A 5FLXE 1VQLA 4X9DA 1XTDA 1MV3A 2EQJA 2RHYA 3OYCA 2RJDA 1VQMA 1KC8C 2BKDN 1GCQC 1C0MA 2ABLA 2LRQA 2YDLA 2P4TA 4XQ3A 1YHQQ 1UGPB 3M5AA 2M0OA 1SHFA 2LJ1A 1BU1A 5KH6A 1GCPA 1PRLC 1YJNT 1ZHIA 2GFUA 1GBRA 2B86A 3IQLA 2FRWA 2MPXC 4ZGEB 4F7UB 3M4GA 4BACA 4RTWA 1YNZA 1SRMA 2SEMA 2QQ9A 2CH4W 3VRYA 5GANg 3CCUT 1VQ5T 2DJQA 4EMKA 1ZSZC 2NUPB 3A1PA 2OTJQ 4M77B 4HCKA 2F2XA 4PKCC 1D1BA 4M7AC 2VV5A 3CCVA 1NYFA 1VQKQ 1XOVA 4ZGDB 1C6VX 2QK0A 1D1CA 1X69A 3OW2A 4M78C 4DQ2A 1K9MR 2RHXA 4XU3A 4O6JA 1GFCA 5GAOl 1NEBA 1WHGA 2LQNA 3CC7T 1KG1A 2RI3A 5GAMh 4ZTFA 2EKOA 3I35A 4C92E 3FB9A 1VIFA 1KIKA 4Q5WA 3REAB 3VYGA 3X20B 4PJOD 2X3XD 5LJ5h 2LNVA 4ANJA 1GCQA 4ZNXA 4X1VA 3T9NA 1K73C 2D9TA 1YI2Q 2KRSA 2VVKA 2OTJA 3HPWA 1N8RR 1WIEA 2ED1A 4M75F 4M7AG 2RMOA 2LQ8A 4PJNA 1YIJQ 2FPDA 1I0CA 2I0NA 3CCJQ 4PJOC 1TWBA 4M77E 3CC4A 3E9GA 1VQ8T 5CR2A 1KQ2A 2M02A 3OMCA 5GAOm 1KC8U 1C1AA 3VS3A 2DZCA 1NYGA 3HL8A 4QVZA 2JNGA 1RAAB 1H3HA 3FJPA 4CC4B 1LNXA 2WSFE 1KQ1A 5CAIA 5L23A 2YSQA 1FYNA 2ROLA 2VYTA 5GAOp 2KXDA 1YFNA 4DOWA 2OI3A 4FYWB 4WCIA 4C92C 2JMAA 1YJWT 3Q1JA 2O4XA 5CVIA 2DTHA 1V1CA 2DX1A 5GAOn 3OYYA 1YI2A 2EGAA 2EW3A 3CBMA 2R58A 3CD6T 2HD0A 1OPKA 1UGQB 2KRNA 3PE0A 4C8QG 1OX9A 4BD3A 2DMOA 3CXCS 4KRTA 3VKIA 2V1QA 3GNGA 5KCHA 3CC2T 1G3WA 1PD1A 2LTOA 5IXFA 2DVEA 3TEEA 3JB9D 2E3IA 1PWTA 3NHNA 2ZZDA 2MOXA 3JCMb 3PIOA 1ZSZB 4M77C 3G4SQ 3O8VA 5CCAA 4J9EA 1U3OA 2VGNA 3E19A 4KUDK 1T3LA 3PNWC 3JRZA 5IH2A 4N4HA 3RESA 2ZPFB 4P5NA 4M78B 3WVDB 2KT1A 3QUIA 3RR6A 2QASA 2PVOB 2AKKA 1IXDA 1WA7A 4L5GA 4C0FA 2VASA 4QW2A 1PHTA 3M4YA 1K8AU 1SSHA 3OW2P 3CCVT 1ZLMA 2DBKA 4CC3A 1R8OB 2CT3A 4BB7A 2COZA 1NLPC 1JJ2S 4RMOA 2ZPBB 2L2PA 1WI7A 2QYZA 5LJ3d 2JJ9A 3A5ZB 1YJ9Q 1W70A 2K7AA 2GQVA 1RADB 3I56Q 3OY9A 2JT4A 4PK4A 2ED0A 3KUFA 1BYMA 3CCEQ 3GLXA 3EH2A 2AIRB 1BI0A 2D8JA 4EMGA 1ZBXA 2QDLA 1ZA1B 1X01A 1HJDA 2HL3A 2IIMA 3C12A 1JJ2A 2XK0A 4RKUE 2E5KA 1SG5A 2DK3A 4E7HA 4FW1A 1M1FA 1QP2A 3NGPA 3A8GB 5D6YA 3CCJT 4RTZA 2V1RA 4OB2B 2C0TA 1R0BG 2K9GA 1CSKA 4KH1B 1Q7YC 3OS5A 2LJ3A 3D7SB 3CPFA 1B3QA 4J9FA 4C8QD 1KD1U 3G1JA 2KY9A 2FRYA 4J5YA 1ZSZA 1M3CA 1LOJA 1UGSB 1YJNA 2BZYA 2DEUA 2RJEA 3CCQQ 1SPKA 1AHJB 2KRMA 1NPPA 4C5IA 1JEGA 2XIDA 2CP3A 2MK5A 3TVTA 2GQIA 2RB6A 1N9SA 3SDZA 1WJRA 1M1KU 3TU4K 1Q81U 3S3OA 1U8RA 1BIAA 4M75C 1VQLQ 3EG3A 2BZXA 3CMEQ 4E7IA 4DBHA 3MEUA 4O5VA 2CSIA 1BCMA 3EFSA 3VS5A 5GMKm 4FL6A 4ELZC 1K9AA 2EJGA 4R56A 5GANj 1N27A 3JCMV 5GMKh 1K73U 3THKA 3G6EA 2V8IA 3H0FA 3ME9A 3P8HA 5GAN7 2K3BA 1WQ7A 1U1TA 2LJ0A 4BUGA 4JRIA 1KQSS 4C92F 2E65A 2RA2A 2GTJA 1H8KA 2LT4A 2PZ1A 2VUBA 5C0MA 1ZUUA 4PJMA 4KT0E 2LQKA 4M4ZA 4N0AC 1YJWA 1D0XA 1VYUA 5D6XA 1JXOA 4J6XA 4RCBA 4C8QC 2A3LA 3TQ7P 1KD1C 3LWIA 4DBFA 5D6WA 3A8MB 2EPDA 1BI2A 2OTLA 4JRKA 3SHWA 1RAGB 3A8HB 4HCCA 5CKHA 3WVEB 4EPCA 4K11A 4JJCA 4KUIA 1RACB 2C0IA 4EMHA 4M75A 4AFQC 1YITA 2YT6A 2PTKA 4ORZA 2L8DA 1TSFA 1YJ9T 5CKEA 4XTYA 1WHHA 2E64A 2K79A 3I56T 1JBMA 3DKMA 3CC4Q 4LN2A 1LVKA 3CBOA 3LX7A 3LH0A 1I4K1 3QPHA 2CUBA
chains in the Genus database with same CATH topology
3CCET 1BKBA 1OYXA 1W2BA 2HQXA 4XU0A 3CCEA 3SWNA 2CZ0B 2K5LA 3NTIA 4XU2A 2AHJB 4NOYA 4JRPA 2DJZA 3F70A 4M75B 3OYDA 2VC8A 3UPUA 4V2SA 2R5MA 3CEYA 1HK9A 2RHIA 3H8ZA 4M77F 4YTLA 3ZBDA 3M57A 3OBWA 4F7UG 3DB4A 3BY7A 3MEWA 3ER0A 2L5QA 3HFOA 4QVDA 4BE2A 1VQ4A 1VQNT 5GANd 1QVFA 3MEAA 2EWNA 5CQXA 5A0DA 5HY6A 3CMAT 2XKOC 3R6OA 4EMKC 3CCSA 3JCMe 4PLLA 3OYNA 3OYHA 1N8RC 3FEOA 2FB7A 4A53A 1U1SA 2CZ1B 1WPYA 2PUKB 2E12A 4M7DE 3S3MA 3QHSA 3TCJA 3FDRA 2QXFA 5CO7A 5FLXE 1G3SA 3TREA 1VQLA 2K2VA 4J6YA 4X9DA 5A0LA 1N8RU 2DEQA 2HAXA 1XTDA 3ASKA 3MP1A 3HRUA 4M7DA 2EQJA 2RHYA 3OYCA 2RJDA 4KBMB 2RK2A 4XTVA 2ZGWA 1YITT 1VQMA 1KC8C 2BKDN 3N5BB 2ZCFB 3VUZA 4HT9A 3A8LB 2LRQA 5GAMg 3KBGA 2YLCA 2P4TA 4XQ3A 3L2UA 3CC4T 3KXTA 1UGPB 1QP3A 3JCMh 3M5AA 5GAMe 4MDWA 2M0OA 2XDPA 3CCQT 4N4IA 1VQPA 5KH6A 2ZPIB 4J83A 1YJNT 3QYHB 1ZHIA 2GCXA 4M7DB 3M55A 2GFUA 1Y07A 2MF2A 4IUUA 2OTLT 5FU6B 3X24B 4Y91A 3JCMW 1VQ7T 1Q7YU 4M77D 4RG8A 2C06A 4E7KA 4C8QB 3GPLA 1KHCA 1NZ9A 4N0AA 3RUXA 4ZGEB 2RH2A 4F7UB 5GMKe 3EAEA 3M4GA 4BACA 3CC2A 2XG8D 1Y96B 2D0QB 4OGEA 1Y71A 1NJIC 3G6ET 1VQLT 3QZ9B 3GP8A 3CCJT 3CCMT 2QQ9A 5GANg 2A7YA 4B9XA 3CCUT 4A4FA 4JS4A 1PSEA 4EMKA 3JB9I 4BDZA 1QVGS 2KDSA 5LL6S 2MAMA 3MO8A 1O75A 4M77B 3I55T 4J7IA 4PJOG 3RKXA 1RI0A 4M75E 4C92B 4PKCC 2EFIA 2X35A 1ZQ1A 1NE8A 3E1SA 4M7AC 4KULA 2VV5A 3LWHA 4OP0A 3CCVA 1XOVA 4ZGDB 1H641 2QTXA 2QEXT 1BI1A 2OTJT 1GXIE 3BDUA 4PNOA 4QQDA 1VQPT 4A4KA 1N9RA 3V8LA 1IREB 3QJYA 3OW2A 4D6WA 2RI5A 3SWNC 4M78C 5KCOA 4CI0C 4DQ2A 4VUBA 3VJPA 1LJOA 2RHXA 3OQ5A 4N4GA 4XU3A 4F7UE 4O6JA 2WSEE 5J26A 1OZ3A 5CKBA 2KMTA 5GAOl 2JUFA 3UDCA 1YBYA 3CPWA 1M90C 3CC7T 1KG1A 2RI3A 5GAMh 4ZTFA 4MDXA 2EKOA 4BI8B 2ZPGB 4C92E 5HK3A 3GIBA 3DLLA 3G7ZA 5KE2A 3FB9A 4LDXA 1VIFA 3JCMJ 5HK0A 3C95A 1W2BS 1WGSA 5I21A 2DO3A 2YLBA 2KQWA 1VQ4T 4Q5WA 3VYGA 1I81A 3X20B 4PJOD 4LDVA 5LJ5h 4HCCA 2LNVA 3OYKA 3JB9F 1HXDA 3T9NA 2EIFA 5GAN5 2RD1A 2X4YA 1NJIU 2QA4T 1K73C 1VQ9T 4XTUA 2D9TA 2LVMA 3HRSA 1V29B 2EJFA 2F69A 4ME7A 3JB9G 4IUQA 2QQAA 2P0PA 3HP9A 5LJ3h 1JB0E 4JRQA 3DLMA 1RL2A 5DLQE 4C8QE 2JN0A 1YHQA 1VQKT 3J7AF 2OTJA 1Q81C 3HPWA 3PIPA 4FM4B 1I5LA 3CCRT 1Y7XA 3FLGA 4M75F 5GANh 1QVFS 4M7AG 1YIJA 2LQ8A 2EYQA 3MEVA 4PJOC 1MGQA 4LD6A 1M9SA 1N6AA 4E7JA 1VQOT 4HT8A 3PGGA 4M77E 3E9GA 3OA6A 1VQ8T 2DKGA 5CR2A 3CC4A 5GANe 1KQ2A 2Y4XA 3OMCA 5GAOm 1KC8U 5I2MA 3M9QA 3M59A 2CKKA 3JAME 2DZCA 5GAMf 1M90U 5LJ3j 5FU6C 2M16A 4NL2A 3HL8A 3CXCA 4MMLA 4QVZA 2JNGA 1EIFA 4OB3B 1VQ7A 2X4XA 1QVPA 1I8FA 1TH7A 2RHZA 3QJ6A 3QG1A 3META 3JCMf 3FJPA 2YHTA 4E47A 2JTFA 1LNXA 4L6V5 3G4SA 3A8OB 5FRNA 4BY6B 2WSFE 5LJ5f 1KQ1A 5CAIA 2QA4A 4JJNK 1Q82U 1XNIA 4FU6A 3LYIA 2OTLA 2VYTA 2NLUA 3VU3C 2DPPB 5GAOp 2EQUA 2RM4A 3QIIA 4DOWA 2DXCA 2XICA 1YCYA 3I56A 4C92C 2HQEA 3V8JA 3RKYA 1YJWT 3Q1JA 2O4XA 4XTWA 2GF7A 5LJ3f 3JCMc 1VQ8A 5CVIA 2DTHA 3J80E 1VQOA 3QZ5B 2LX9A 5GAOn 2FVUA 2K57A 3OYYA 5GMKl 1YI2A 3CBMA 2R58A 3L1AA 3CD6T 2HD0A 5KE3A 1UGQB 2P0QA 5L8RE 1K9MC 5CK9A 5M9OA 3CC7A 2F5TX 2D6FA 4M7DF 2O01E 1H3ZA 4C8QG 4ZN1A 1YIJT 4OVAA 2LDMA 5FU7B 4C8QF 4BD3A 2JOYA 3CXCS 2FYKA 2WACA 3H6ZA 3GNGA 3VKIA 4F7UF 2LC4A 5KCHA 3CMEA 3V7CA 3CC2T 1G3WA 4M78A 2LTOA 4Y28E 2DVEA 2H3JA 3UT1A 3TEEA 3P8BB 3JB9D 4C5HA 1VQ6A 2EJ9A 2HBPA 4QVCA 3EFRA 2ZZDA 4BI4A 3L2QA 1D3BA 3CBPA 4GY5A 5DLOA 3JCMb 5FROA 4XTZA 3OYIA 3PIOA 3OBYA 2V8JA 1B34B 4M77C 4R55A 4C0DB 2E6NA 3NTHA 2B8AA 3O8VA 4ATOA 5CCAA 2QEXA 3JCMP 3OS1A 3JCMg 2KVQG 3E19A 2VGNA 2PVDB 3QXEB 4OGCA 5GMKi 5LJ5d 3QYGB 4KUDK 3QO3A 5J39A 4M7AA 1WJQA 1M5Q1 2QI2A 3JCMX 3PNWC 3OYBA 4DA4A 3JRZA 4N4HA 1UGRB 1IZ6A 2VXFA 1FX7A 2DXTA 2WSCE 4PL6A 4J7FA 4X9CA 3RESA 2ZPFB 4P5NA 4OMFB 5DM7R 4C5GA 4DOVA 4M78B 2DTOA 3WVDB 1BIBA 3PTAA 5IT9E 4A4EA 4ZGJB 3S3NA 3QUIA 5AYFA 2DAQA 4C0ZA 3PMTA 2E5QA 5LJ3g 5IN1A 4J6WA 1WJSA 4L59A 1G5VA 3CCST 3E9FA 2PVOB 2EQMA 4L5GA 3RKWA 2PQWA 4PJOB 4C0FA 5LJ3e 2RO0A 2P0KA 5GAOq 4M75G 4M7AF 3OYEA 4C0GA 4IUPA 4ELYC 4JUVA 3RMSA 4QW2A 2PVGB 3M4YA 1K8AU 4QQ6A 3CCVT 4FSXA 3GOXA 3CCUA 1VQ5A 3L2VA 5CIUA 4PJOA 2YRVA 2JTMA 3C94A 1R8OB 3M54A 1G3YA 4BB7A 3GF5A 3V7RA 4M78E 1JJ2S 1O9SA 3C4SA 4RMOA 4C92G 1S72T 2ZPBB 1WNLA 5LJ3d 3A5ZB 4LDUA 4X34A 2IVWA 3QPHA 2GQVA 2E41A 2E1HA 3OY9A 3OS0A 5GAN2 3CMAA 5A0GA 4A4HA 3KUFA 3QKJA 2K3XA 2Y4YA 1BYMA 4IKFA 5CKDA 3GLXA 1QVGA 4M78G 5DY9A 4MZPA 1BI0A 5GMKj 3OYLA 2K3YA 4E7LA 1Q86U 4M75D 4EMGA 2CGHA 1ZBXA 2DXBA 1FXXA 3MCAB 5GANf 1M1KC 3CCLA 1X01A 5GAMd 3BDLA 3C12A 1JJ2A 2XK0A 3OSSC 4IURA 3QDRB 3HKSA 1Q86C 4RKUE 2DIQA 4C5EA 2F5KA 2XD0A 2DK3A 1FWZA 3J81E 4BE0A 4E7HA 3LLRA 3CMET 2K5FA 1M1FA 1QP2A 3OYMA 2E6ZA 3A8GB 2HNIA 2R57A 3LGFA 3M53A 4JLIA 4QQGA 5D6YA 3G71T 5EG2A 3CCJA 2L89A 3BFMA 4BY6C 2E70A 1VIEA 5I2SA 4OB2B 4JDSA 4TVRA 1SSFA 2QQBA 3JSCA 4PJOF 5C6SA 5IAYA 1Q7YC 3OS5A 5CQYA 4BI3A 1QW1A 3CPFA 3L42A 1UB4A 4XK8E 4C8QD 5GAN3 4PJOE 1KD1U 3NTKA 2KY9A 2IG0A 2M1HA 4RCCA 3QSUA 4J5YA 2MWOA 1B34A 1DJ7B 5FRMA 2MWPA 3CCQA 4MMKA 1OI1A 2BUDA 1LOJA 3RMQA 1D3BB 1G3TA 1UGSB 1YJNA 3L2WA 3S6WA 4LD9K 3HFNA 4FT2A 2FHDA 3VUBA 2RJEA 5GAN8 2I2LA 1AHJB 2RI2A 1NPPA 4C5IA 2XIDA 5HKCA 1M8VA 3RERA 2LT1A 3SD4A 1NPRA 2RB6A 3CPWS 1N9SA 5FU7C 3WXMB 3L2RA 3G4ST 4JLGA 1X6OA 5GAN6 4NS5A 3SDZA 2DZ9A 3SB2A 4ZN3A 3G71A 3FIFA 2PUOB 2MMPA 3RIRA 3UWNA 1WJRA 2RHUA 3AHUA 3L2ZA 1M1KU 3PMIA 1VQ5T 2DD5A 1VQ9A 3BW1A 3TU4K 3X28B 1Q81U 3S3OA 2ZPEB 1U8RA 1BIAA 2KK4A 4HA8A 4M75C 3OW2S 4LDWA 2XU8A 2DXUA 4M7AE 4E7IA 2RJCA 2L3RA 3VYHB 3V8KA 2O4XB 3MEUA 2XDDA 3OS2A 3CD6A 4NL3A 4O5VA 5A2QE 4M77A 4C0DC 2DTIA 4EMKB 2X4WA 3EFSA 3CCRA 5GMKm 3FC3A 4M7AD 4FL6A 2DIGA 3LW5E 3ZEHA 4ELZC 3FRNA 1KQSA 2EJGA 4HCZA 4FT4A 4M78F 4Z02A 3M56A 1Y96A 4R56A 4MZTA 5GANj 5CKFA 2GFAA 2RK1A 4A54A 4F7UA 1N27A 3PFSA 3MP6A 3OYAA 3URGA 4BE1A 2R5AA 4ZTJA 4WF2A 4OB1B 4OF1A 4C8QA 2JVVA 2XI9A 2DD4A 3PT9A 3JCMV 4A4GA 4J8OA 4II1A 5GMKh 3G6EA 3CCMA 1K73U 3CCLT 2EQKA 3NFCA 4M77G 3HRTA 2V8IA 3P8HA 3ME9A 4UC4A 1M4ZA 4M7AB 1WQ7A 5GAN7 1YJ9A 3JB9H 3OMGA 1U1TA 3I55A 4BUGA 1Q82C 4JRIA 3JCMd 2M9UA 4C92F 1KQSS 2E65A 4BDYA 5LJ5g 2RA2A 3VV0A 2FL7A 1WQWA 2LT4A 1KHIA 1UEBA 2PU9B 3LGLA 4GLKA 2VUBA 5C0MA 4RG2A 1X75C 1BI3A 1PSFA 2KSSA 4XAXB 5GAN4 1OZ2A 2MI6A 4M7DC 3INZA 4KT0E 2LQKA 4N0AC 4XU1A 2VXEA 1JRIA 3SFMA 4JS5A 5D6XA 1YJWA 4C92D 3V7SA 1P92A 4J6XA 4RCBA 2G3RA 2JZ2A 4B9WA 2A3LA 4C8QC 2CZ7B 5GAMj 1KD1C 1VQKA 3HSBA 3OB9A 3LWIA 2ZPHB 4IUVA 1K8AC 1YI2T 3DB3A 5D6WA 4CRIA 3MHXA 3A8MB 2XHCA 4MZMA 5LJ5e 2VGMA 2V8KA 1BI2A 2K5IA 3QBYA 2OAUA 2QQRA 3A8HB 4IUTA 4JRKA 3X25B 2RJFA 3JB9J 2EAYA 3GNFB 5CKHA 4HKEA 2CS7A 3P8DA 3WVEB 4EPCA 4EDUA 4FIBA 1MHNA 3M58A 4M7DG 3MP8A 1K9MU 1VQNA 2QQSA 4M78D 1W4SA 4M7DD 4KUIA 1VUBA 5J3BA 1M1GA 2K4YA 2LCCA 4C92A 2Y90A 4EMHA 1VQ6T 3OYGA 4LDYA 3OYJA 4M75A 3ZFJA 3X26B 1VQMT 1YITA 3JCMQ 1XQHA 2L8DA 3SWNB 1YJ9T 5CKEA 2XDBA 5LJ5j 4XTYA 2QDYB 2E10A 2E64A 4OB0B 3I56T 2KAFA 1JBMA 3DKMA 4XTXA 1S72A 3OYFA 1YHQT 4PLIA 2CYZB 5GAOr 3CBOA 2CZ6B 2BIVA 3LX7A 3LH0A 1I4K1 4HCBA 3HHTB 2X4JA 3OSVA 2LCLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M7A A;  3QO3 A;  1M8V A;  5I21 A;  1M5Q 1;  4XU0 A;  3SWN A;  3JCM X;  2YLB A;  3RER A;  2RB6 A;  4XU2 A;  1N9S A;  4NOY A;  1I81 A;  2VXF A;  4PJO D;  2DJZ A;  4M75 B;  5GAN 6;  2DXT A;  2VC8 A;  4X9C A;  3RES A;  5LJ5 h;  2DZ9 A;  3SB2 A;  1HK9 A;  4F7U G;  4M77 F;  3FIF A;  1HXD A;  4V2S A;  3RIR A;  5GAN 5;  2RD1 A;  4M78 B;  2DTO A;  3BY7 A;  1BIB A;  3L2Z A;  3AHU A;  3HFO A;  4QVD A;  3BW1 A;  4XTU A;  3JB9 G;  3QUI A;  2EJF A;  5GAN d;  1BIA A;  2EWN A;  4HA8 A;  4M75 C;  4J6W A;  5LJ3 g;  5LJ3 h;  2DXU A;  4EMK C;  4M7A E;  3JCM e;  4C8Q E;  2JN0 A;  3RKW A;  3V8K A;  4PJO B;  2FB7 A;  4A53 A;  5LJ3 e;  1U1S A;  5GAO q;  1WPY A;  4M75 G;  4NL3 A;  4M7A F;  4M7D E;  3QHS A;  4M77 A;  4JUV A;  1I5L A;  2DTI A;  4EMK B;  3EFS A;  4M75 F;  5GAN h;  4M7A G;  5GMK m;  4M7A D;  4J6Y A;  4PJO C;  1MGQ A;  4X9D A;  2EJG A;  4M7D C;  4M78 F;  1Y96 A;  5GAN j;  3PGG A;  4M77 E;  4HT8 A;  2DKG A;  4M7D A;  4PJO A;  4A54 A;  5GAN e;  4F7U A;  1KQ2 A;  4XTV A;  2ZGW A;  3V7R A;  5GAO m;  4M78 E;  4HT9 A;  4WF2 A;  5GAM g;  4C8Q A;  2YLC A;  4C92 G;  3JCM V;  4XQ3 A;  1WNL A;  2DZC A;  5GAM f;  5GMK h;  5LJ3 d;  5LJ3 j;  4M77 G;  4NL2 A;  3JCM h;  4MML A;  5GAM e;  5GAN 7;  4M7A B;  1WQ7 A;  1I8F A;  3JB9 H;  1TH7 A;  1U1T A;  3JCM f;  2E41 A;  3FJP A;  2E1H A;  2YHT A;  4JRI A;  3JCM d;  1LNX A;  4C92 F;  2E65 A;  5GAN 2;  5LJ5 g;  2RA2 A;  4M7D B;  1WQW A;  4Y91 A;  5LJ5 f;  3JCM W;  4M77 D;  1KQ1 A;  5CAI A;  4C8Q B;  4M78 G;  4N0A A;  5DY9 A;  3VU3 C;  5GMK j;  3RUX A;  5GAO p;  5GAN 4;  2RM4 A;  4M75 D;  4F7U B;  5GMK e;  3INZ A;  1YCY A;  2CGH A;  3M4G A;  4N0A C;  2VXE A;  1JRI A;  1Y96 B;  4XU1 A;  4C92 C;  3V8J A;  3RKY A;  3JCM c;  4XTW A;  5LJ3 f;  3V7S A;  4C92 D;  5GAN f;  4J6X A;  1X01 A;  2DTH A;  4RCB A;  4C8Q C;  5GAM j;  5GAM d;  5GAN g;  3JB9 I;  4EMK A;  5GAO n;  3HSB A;  2K57 A;  5GMK l;  4M77 B;  3L1A A;  4PJO G;  3RKX A;  4C92 B;  4M75 E;  5LJ5 e;  4M7D F;  4JRK A;  3JB9 J;  4M7A C;  4OP0 A;  4C8Q G;  2EAY A;  2QTX A;  1H64 1;  3JB9 F;  2HNI A;  4JLI A;  4C8Q F;  3BDU A;  4PNO A;  3BFM A;  4M7D G;  1N9R A;  3V8L A;  2FYK A;  4PJO E;  4M78 D;  4F7U F;  4M7D D;  4PJO F;  3SWN C;  3V7C A;  4M78 C;  4M78 A;  4DQ2 A;  2DVE A;  4C92 A;  1LJO A;  2Y90 A;  4XU3 A;  4C8Q D;  4EMH A;  4RCC A;  4F7U E;  5GAN 3;  3JB9 D;  3QSU A;  4M75 A;  2EJ9 A;  4J5Y A;  1B34 A;  3JCM Q;  4QVC A;  4MMK A;  3EFR A;  5GAO l;  1LOJ A;  3SWN B;  1D3B A;  4EMG A;  5LJ5 j;  4XTY A;  2E10 A;  1D3B B;  2E64 A;  4XTZ A;  3JCM b;  1JBM A;  5GAM h;  4XTX A;  1B34 B;  3HFN A;  4M77 C;  4C92 E;  5GAO r;  3GIB A;  1I4K 1;  3FB9 A;  5GAN 8;  2I2L A;  3JCM P;  3JCM g;  2DEQ A;  3JCM J;  5GMK i;  5LJ5 d; 
#chains in the Genus database with same CATH topology
 2KEA A;  3RBB B;  3VRZ A;  4XU2 A;  4JRP A;  4V2S A;  1UE9 A;  2R5M A;  3CEY A;  4E6R A;  4YTL A;  1AZE A;  3OBW A;  3HFO A;  1VQN T;  1X43 A;  2LMJ A;  3JCM e;  4PLL A;  1X27 A;  4A53 A;  3SEM A;  4FW2 A;  3VS1 A;  3EHR A;  3FDR A;  2HKQ B;  1V76 A;  4Z8A A;  3ASK A;  5KYX B;  4M7D A;  1YIT T;  3N5B B;  2ZCF B;  4HT9 A;  3KBG A;  4J9D A;  1F1B B;  1QP3 A;  1VQ7 Q;  1VQP A;  2DIL A;  3CCQ T;  1I07 A;  2ZPI B;  3QYH B;  5I22 A;  4M7D B;  2NWM A;  2OTL T;  3X24 B;  1K76 A;  3JCM W;  4RG8 A;  1WXB A;  1PKS A;  3RUX A;  2RH2 A;  5GMK e;  4OGE A;  2RPN A;  1Y71 A;  1VQL T;  2A7Y A;  4A4F A;  3JB9 I;  4BDZ A;  5LL6 S;  2MAM A;  3MO8 A;  3RKX A;  1JU5 C;  1ZQ1 A;  1NE8 A;  2J6O A;  2O88 A;  1H64 1;  2ENM A;  4PNO A;  4D8D A;  4A4K A;  2H3E B;  4D6W A;  3QDF A;  2D0N A;  4F04 B;  4F7U E;  1E6G A;  4KGZ B;  1WHM A;  1Z9Z A;  2SRC A;  3QWX X;  1M90 C;  4MDX A;  3MKD A;  5HK3 A;  3GIB A;  3G7Z A;  1X2K A;  5KE2 A;  3C95 A;  2LP5 A;  5I21 A;  2FG0 A;  1FMV A;  1HXD A;  2DER A;  2RD1 A;  1NJI U;  2QA4 T;  1VQ9 T;  3JB9 G;  4IUQ A;  2P0P A;  3HP9 A;  4KGX B;  5LJ3 h;  1JB0 E;  5DLQ E;  1YHQ A;  1VQK T;  4GLM A;  1Q81 C;  2VWF A;  4FM4 B;  1I5L A;  3UA7 A;  1W6X A;  4FYY B;  3A98 A;  2EYQ A;  4E7J A;  1VQO T;  3PGG A;  2DKG A;  2EVR A;  1MMD A;  2OAW A;  3M0R A;  2RQR A;  3M59 A;  5GAM f;  1ZSG A;  1Y57 A;  3CXC A;  1EIF A;  1VQ7 A;  2DL8 A;  5HCK A;  2F2V A;  3QG1 A;  3JCM f;  3EGU A;  4AFZ C;  1QCO A;  2CDT A;  4L6V 5;  2FO0 A;  1VQ4 Q;  5FRN A;  5LJ5 f;  1GFD A;  1MND A;  1Q82 U;  3R6N A;  3I56 A;  2HQE A;  3ZL7 C;  2VB6 A;  2HBW A;  1SF9 A;  1VQ8 A;  3QZ5 B;  1WXU A;  2O9V A;  2K57 A;  1UJY A;  3EGD B;  1E7O A;  2CP7 A;  4AG1 C;  4M7D F;  5CK9 A;  3CC7 A;  1MUZ A;  2LDM A;  4C8Q F;  1TS9 A;  2JOY A;  2O2O A;  2LC4 A;  3CME A;  3V7C A;  1AEY A;  2L0A A;  4OMO A;  2EJ9 A;  2FZC B;  4QVC A;  3L2Q A;  4BI4 A;  4GY5 A;  4XTZ A;  3OYI A;  2E6N A;  2B8A A;  4ATO A;  2A0F B;  4B6M A;  3JCM P;  3QYG B;  1M2O A;  2VXF A;  1IZ6 A;  1MNE A;  1FX7 A;  1M3A A;  2WSC E;  2CSQ A;  4DOV A;  3PTA A;  5KYY B;  5IT9 E;  4A4E A;  4ZGJ B;  1UGV A;  5AYF A;  4C0Z A;  1K73 R;  4J6W A;  4L59 A;  3RKW A;  4PJO B;  2EYY A;  2RO0 A;  4M75 G;  4M7A F;  3OYE A;  2D8H A;  1OQK A;  1OU9 A;  2KYB A;  4PJO A;  2JTM A;  1WXT A;  3M54 A;  5KYN A;  3V7R A;  4M78 E;  1FMK A;  1VA7 A;  2IPO B;  2IVW A;  1UFF A;  1QLY A;  2E41 A;  5GAN 2;  3CMA A;  4HVW A;  3UA6 A;  3QKJ A;  2K3X A;  4AFS C;  4IKF A;  5CKD A;  1QVG A;  1D09 B;  1TUG B;  4M78 G;  5DY9 A;  2XMF A;  4J9H A;  3OYL A;  2K3Y A;  4E7L A;  1Q86 U;  3EG9 B;  3CCL A;  5GAM d;  3M0Q A;  3OSS C;  4IUR A;  2DET A;  1HD3 A;  4JZ4 A;  3J81 E;  4BE0 A;  2K5F A;  4JZ3 A;  2HNI A;  3CCJ A;  3BFM A;  5I2S A;  5IAY A;  4BI3 A;  1RAE B;  3L42 A;  1UB4 A;  4PJO E;  2DA9 A;  5GAN 3;  3G71 Q;  3QSU A;  4RTY A;  2JM8 A;  3CCQ A;  4MMK A;  2BUD A;  3RMQ A;  3ULR B;  1RUW A;  1BB9 A;  2ROT A;  2I2L A;  2CH4 A;  1UHC A;  2CRE A;  1EFN A;  5HKC A;  2LT1 A;  1NPR A;  3G4S T;  3KFV A;  1TG0 A;  2PUO B;  3UWN A;  1G83 A;  2ZPE B;  2RQV A;  3LH5 A;  3G6E Q;  3OW2 S;  3CCM Q;  2BE7 D;  1KK7 A;  4J9I A;  2RJC A;  3VYH B;  3V8K A;  2O4X B;  1QCF A;  2XDD A;  4NL3 A;  5A2Q E;  5KYW B;  4EMK B;  2DYB A;  3ZEH A;  1KQS A;  3FRN A;  2DVJ A;  3I9Q A;  4M78 F;  1Y96 A;  7AT1 B;  4MZT A;  1VQP Q;  2EYX A;  2GFA A;  2RK1 A;  5KYY A;  4F7U A;  3URG A;  4BE1 A;  2HMA A;  3EG2 A;  4ZTJ A;  2LQW A;  4OB1 B;  4OF1 A;  4WF2 A;  2CUD A;  1VQ6 Q;  3EFO A;  1Z9Q A;  2JXB A;  4M77 G;  1YJ9 A;  1UJ0 A;  1S72 Q;  4BDY A;  2FL7 A;  1WQW A;  1VYT A;  1UEB A;  4Z89 A;  3EG0 A;  4FCY A;  3CCU Q;  1VQ5 Q;  2KSS A;  4RTT A;  2RQU A;  2MI6 A;  3SFM A;  1JRI A;  4A63 B;  3V7S A;  1VQK A;  2VKN A;  2CP2 A;  1HYO A;  1AVZ C;  3OB9 A;  2ZPH B;  1K8A C;  2GGR A;  3DB3 A;  2NUZ A;  4CRI A;  3MHX A;  4MZM A;  5LJ5 e;  2K5I A;  4IUT A;  2EAY A;  4HKE A;  3P8D A;  4FIB A;  4LUE A;  3MP8 A;  4M78 D;  1YN8 A;  1VUB A;  1M1G A;  2K4Y A;  1YWO A;  1Q82 R;  1D0Y A;  2LCC A;  4C92 A;  3VS4 A;  2ESW A;  4CC7 A;  3X26 B;  3JCM Q;  3SWN B;  5LJ5 j;  2QDY B;  5ECA A;  3OYF A;  2EBP A;  1YHQ T;  2CYZ B;  2CZ6 B;  3HHT B;  3OSV A;  3CCE T;  4KGV B;  1OYX A;  1W2B A;  3CCE A;  2G6F X;  4M75 B;  3OYD A;  2VC8 A;  5D7U A;  1HK9 A;  3ZBD A;  3M57 A;  2NYS A;  3I5S A;  2J7I A;  8AT1 B;  1VQ4 A;  4HVU A;  2DFU A;  1W2B P;  3MEA A;  4ESR A;  5CQX A;  3H41 A;  3CMA T;  2XKO C;  3CCR Q;  1Q95 G;  4FSS A;  4J9G A;  2FB7 A;  2CT4 A;  1WPY A;  1JQQ A;  4LXC A;  3S3M A;  3QHS A;  3TCJ A;  1TXQ A;  2A28 A;  1NEG A;  4J6Y A;  1N8R U;  2HAX A;  4KH0 B;  2HCK A;  1EZZ B;  2RK2 A;  4XTV A;  3AT1 B;  2DE0 X;  3A8L B;  2YLC A;  5EC7 A;  3CC4 T;  2E3H A;  3KXT A;  3JCM h;  1M27 C;  4MDW A;  2XDP A;  4N4I A;  5IHN A;  2GCX A;  4IUU A;  1XJW B;  5FU6 B;  2BE9 B;  1Q7Y U;  4M77 D;  2C06 A;  4E7K A;  4C8Q B;  3GPL A;  6AT1 B;  4N0A A;  4DEX A;  2YRD A;  2HKN A;  3EAE A;  2AT1 B;  1D0Z A;  5GJV B;  3GP8 A;  3CCM T;  3FJ5 A;  2KDS A;  3I55 T;  4J7I A;  4PJO G;  1IO6 A;  1RI0 A;  4M75 E;  2O9S A;  2X35 A;  3O5Z A;  1HSQ A;  3E1S A;  4DBQ A;  3LWH A;  1S1N A;  2OTJ T;  1WDX A;  4OML A;  2NUP A;  2ZAE A;  4QQD A;  1VQP T;  4CI0 C;  2QEX Q;  4VUB A;  1KFZ A;  3CC7 Q;  1Q81 R;  2RQT A;  5CKB A;  1M1K R;  2YWW A;  2QGF B;  2KMT A;  3VS6 A;  3UDC A;  1MV0 B;  3CPW A;  2ZPG B;  1VQM Q;  1OV3 A;  3JCM J;  1AZG B;  2QA4 Q;  2DL3 A;  3VS2 A;  2KI7 A;  4LDV A;  2JS0 A;  4AMC A;  3OYK A;  3CCS Q;  2QTV A;  2KBT A;  1QMC A;  2OJ2 A;  4XTU A;  3HRS A;  1RAF B;  2LVM A;  2EJF A;  4ME7 A;  2F69 A;  2EYZ A;  2QQA A;  4C8Q E;  2JN0 A;  2LCS A;  4LE9 A;  3C0C A;  3PIP A;  1ZBJ A;  1Y7X A;  1K1Z A;  1ZUY A;  1YIJ A;  1K4U S;  4LD6 A;  5KYW A;  4HT8 A;  3OA6 A;  5FWB A;  4DEY A;  2KRO A;  5GAN e;  3REB B;  2CP5 A;  1LCK A;  5I2M A;  1ZUK A;  3JAM E;  2CKK A;  2M16 A;  4NL2 A;  4MML A;  2AK5 A;  2FPF A;  4OB3 B;  2X4X A;  1QVP A;  2JTF A;  4DBR A;  3G4S A;  3A8O B;  4BY6 B;  8ATC B;  1JXM A;  1NLO C;  2QA4 A;  3TSW A;  1XNI A;  4FU6 A;  3LYI A;  3VU3 C;  2DPP B;  2EQU A;  2RM4 A;  3QII A;  2DXC A;  1YCY A;  3V8J A;  3CMA Q;  4XTW A;  5LJ3 f;  2GF7 A;  1JO8 A;  2BTT A;  1VQO A;  1ABO A;  2LX9 A;  2FVU A;  2DLP A;  5KE3 A;  1YJW Q;  1K8A R;  2P0Q A;  2F5T X;  2D6F A;  2O01 E;  4FYX B;  4ZN1 A;  1YIJ T;  4OVA A;  5FU7 B;  1VQO Q;  1Y0M A;  1VQ8 Q;  3H6Z A;  4OMQ A;  1QQJ A;  2DRM A;  3CCV Q;  4Y28 E;  2H3J A;  4C5H A;  1VQ6 A;  2MCN A;  1RAI B;  2HBP A;  1CKA A;  1QVG P;  2RN8 A;  1M2V B;  2V8J A;  4R55 A;  4C0D B;  3NTH A;  2EKH A;  1TU0 B;  2QEX A;  3JCM g;  2KVQ G;  4BE2 A;  5GMK i;  5LJ5 d;  4M7A A;  3QO3 A;  2LNH B;  4DA4 A;  1UGR B;  2DXT A;  4PL6 A;  3VS7 A;  4J7F A;  4PFO A;  1QKX A;  2DTO A;  2E5Q A;  5IXB A;  5GJW B;  1WJS A;  1VOM A;  3NMZ C;  2EQM A;  1EX4 A;  4RTU A;  5GAO q;  1MMN A;  1M3B A;  4JUV A;  1UHF A;  2PVG B;  4QQ6 A;  2J6F A;  3QWY A;  3L2V A;  2HZY A;  1G3Y A;  2DL5 A;  1WFW A;  1IHW A;  1O9S A;  3C4S A;  2M0Y A;  4C92 G;  1WNL A;  2LZ6 B;  2DL4 A;  4AG2 C;  2J06 A;  4D8K A;  1KC8 R;  3OS0 A;  2Y4Y A;  4RUG A;  3MPU B;  3RNJ A;  1Q7Y R;  4MZP A;  2CGH A;  2DXB A;  3MCA B;  2JW4 A;  5GAN f;  1M1K C;  2KXC A;  5FW9 A;  3BDL A;  3QDR B;  1WZO A;  1Q86 C;  2DIQ A;  2XD0 A;  3LLR A;  3CME T;  1D1A A;  2L3P A;  2E6Z A;  3LGF A;  2R57 A;  4JLI A;  3G71 T;  2KYM A;  2L89 A;  4BY6 C;  1PKT A;  1VIE A;  1FMW A;  1QW1 A;  4XK8 E;  3NTK A;  1OU8 A;  1IRX A;  2IG0 A;  2M1H A;  3EG9 A;  2MWO A;  4JJD A;  2YXY A;  5FRM A;  2FPE A;  2MWP A;  1D3B B;  2OX7 A;  2HQH A;  2QAZ A;  2YUO A;  4FT2 A;  2FHD A;  3VUB A;  2GNC A;  2RI2 A;  1M8V A;  3SD4 A;  1OUL A;  5FU7 C;  3L2R A;  1QKW A;  4JLG A;  1X6O A;  2AZS A;  5GAN 6;  4NS5 A;  2DZ9 A;  3JV3 A;  2YUQ A;  3SB2 A;  3FIF A;  2MMP A;  3RIR A;  2RF0 A;  2RHU A;  1RAB B;  1TOV A;  3PMI A;  1VQ9 A;  3BW1 A;  3X28 B;  2DL7 A;  1SHG A;  2KK4 A;  1QWF A;  3EGX B;  2DXU A;  4M7A E;  2L3R A;  3OS2 A;  3CD6 A;  4M77 A;  4C0D C;  1GRI A;  2X4W A;  3CCR A;  2JMC A;  1IHV A;  2DIG A;  2COY A;  4Z02 A;  4HCZ A;  3NPF A;  3M56 A;  5CKF A;  1AWW A;  2XI9 A;  3PT9 A;  2BZ8 A;  4J8O A;  3CCL T;  3HRT A;  1I1J A;  2X4J A;  1TUD A;  1WHL A;  1Q82 C;  4RTV A;  3JCM d;  1QCN A;  3VV0 A;  1KHI A;  2PU9 B;  3LGL A;  4GLK A;  4RG2 A;  1X75 C;  1A0N B;  2A36 A;  1OPL A;  2COW A;  2KGT A;  1PSF A;  4XAX B;  5GAN 4;  1NBE B;  3INZ A;  2VXE A;  4C92 D;  1M30 A;  2JZ2 A;  5GAM j;  1NJI R;  1VQN Q;  1KJW A;  4IUV A;  2P4R A;  1YI2 T;  3VS0 A;  3M0U A;  2HSE B;  2V8K A;  3JB9 J;  2QQR A;  1MMG A;  3X25 B;  1RLP C;  2RJF A;  3GNF B;  1PD0 A;  2KNB B;  2Z0W A;  3M0T A;  4M7D G;  1VQN A;  2QQS A;  4LNP A;  1T0H A;  2Y90 A;  3OYG A;  1T3S A;  3ZFJ A;  1YIT Q;  1M8M A;  1XQH A;  2XDB A;  1IGU A;  4OB0 B;  1G8X A;  2KAF A;  4HXJ A;  4XTX A;  3PVQ A;  4LUD A;  4PLI A;  5GAO r;  4HCB A;  1SEM A;  3QBY A;  2LCL A;  1JJ2 P;  1BKB A;  2HQX A;  4XU0 A;  3SWN A;  4HVV A;  2K5L A;  2AHJ B;  4NOY A;  2FEI A;  2DJZ A;  3F70 A;  3UPU A;  3H8Z A;  2RHI A;  3DB4 A;  3UAT A;  3BY7 A;  3MEW A;  1NG2 A;  3ER0 A;  2L5Q A;  4Y92 A;  1SRL A;  2EWN A;  5KYU A;  4EMK C;  3CCS A;  2QGG A;  3OYN A;  1N8R C;  4AT1 B;  1YP5 A;  3CD6 Q;  2E12 A;  4OMP A;  2QXF A;  3BE3 A;  5CO7 A;  1G3S A;  3TRE A;  3CPW P;  2K2V A;  2F1L A;  3MP1 A;  3TSZ A;  3HRU A;  4KBM B;  2ZGW A;  3VUZ A;  2EGE A;  5GAM g;  2YRC A;  3L2U A;  4RTX A;  5GAM e;  2D1X A;  1OOT A;  1AT1 B;  4J83 A;  5AT1 B;  4EIK A;  3M55 A;  1Y07 A;  2MF2 A;  4Y91 A;  1VQ7 T;  1OEB A;  1QWE A;  2JTE A;  1KHC A;  1NZ9 A;  3I55 Q;  1BCO A;  3CC2 A;  2XG8 D;  1Y96 B;  2D0Q B;  1NJI C;  3G6E T;  3QZ9 B;  2ECZ A;  4JS4 A;  4B9X A;  1QVG S;  1PSE A;  4J9C A;  1O75 A;  1B07 A;  4C92 B;  2EFI A;  2F2W A;  4KUL A;  4E2F B;  4OP0 A;  2QEX T;  2QTX A;  1BI1 A;  4E7S A;  1GXI E;  3BDU A;  1N9R A;  3V8L A;  1IRE B;  2DF6 A;  3QJY A;  2RI5 A;  3SWN C;  5KCO A;  2HDA A;  2RQW A;  3VJP A;  1LJO A;  3OQ5 A;  1U5S A;  4N4G A;  1IGQ A;  2X51 A;  2WSE E;  5J26 A;  3CCL Q;  1OZ3 A;  5IHI A;  2JUF A;  3CXC P;  1YBY A;  4OMM A;  2RNA A;  1BK2 A;  4PJJ A;  4BI8 B;  3DLL A;  4LDX A;  4CC2 A;  5HK0 A;  1W2B S;  1WGS A;  1BBZ A;  2DO3 A;  1GL5 A;  2YLB A;  2KQW A;  1VQ4 T;  1I81 A;  1X6G A;  1N5Z A;  2EIF A;  5GAN 5;  2X4Y A;  1V29 B;  3EHQ A;  2CP6 A;  1I5O B;  1WLP B;  3PVL A;  3DLM A;  4JRQ A;  1RL2 A;  3J7A F;  2A08 A;  2J05 A;  4PFZ A;  4R0K A;  1AWJ A;  3CCR T;  1UUE A;  3FLG A;  5GAN h;  1QVF S;  3MEV A;  1MGQ A;  1AOJ A;  1M9S A;  1N6A A;  1ABQ A;  2PNI A;  2Y4X A;  2AKL A;  3CC2 Q;  2L3S A;  3M9Q A;  1VYV A;  2DM1 A;  5LJ3 j;  1M90 U;  5FU6 C;  3EFO B;  1I8F A;  1TH7 A;  2RHZ A;  3QJ6 A;  3MET A;  2YHT A;  1UTI A;  4E47 A;  1U06 A;  2M51 A;  4IIM A;  2YUN A;  2A37 A;  4JJB A;  4JJN K;  2NLU A;  2OTL Q;  2XIC A;  3RKY A;  3JCM c;  1ARK A;  2LX7 A;  4OMN A;  3J80 E;  1AWO A;  2DBM A;  2W10 A;  3EGX A;  5GMK l;  1PRM C;  1MMA A;  3L1A A;  5L8R E;  1K9M C;  5M9O A;  1H3Z A;  1PC0 A;  3GBQ A;  1KD1 R;  2FYK A;  2WAC A;  2O31 A;  2KR3 A;  4F7U F;  1UDL A;  4M78 A;  3UT1 A;  1TTH B;  3P8B B;  3H0I A;  5IHK A;  1PCX A;  1PNJ A;  3EFR A;  1X6B A;  1D3B A;  3CBP A;  4F16 A;  5DLO A;  5FRO A;  9ATC B;  3OBY A;  4Z88 A;  1B34 B;  3MJX A;  1YWP A;  3OS1 A;  3QXE B;  2PVD B;  4OGC A;  5J39 A;  1WJQ A;  1M5Q 1;  2QI2 A;  3JCM X;  3OYB A;  1UG1 A;  3UF4 A;  1Q86 R;  4PJL A;  4X9C A;  1X2Q A;  4OMF B;  5DM7 R;  4C5G A;  4IIO A;  1BIB A;  3S3N A;  2DAQ A;  2JM9 A;  3PMT A;  5LJ3 g;  5IN1 A;  3U23 A;  1G5V A;  3CCS T;  3E9F A;  2HL5 C;  2V26 A;  2PQW A;  1VQ9 Q;  5LJ3 e;  2MYS A;  1G2B A;  2P0K A;  1TUC A;  4C0G A;  4IUP A;  4ELY C;  2QG9 B;  3RMS A;  2DRK A;  1NM7 A;  4FSX A;  3GOX A;  3CCU A;  1VQ5 A;  5CIU A;  2YRV A;  3C94 A;  5I11 A;  3GF5 A;  1S72 T;  2NUT B;  4LDU A;  2AZV A;  4X34 A;  2NUT A;  1GBQ A;  5FWC A;  2E1H A;  5A0G A;  4A4H A;  4FYV B;  1WX6 A;  5GMK j;  1M90 R;  4M75 D;  1K0X A;  1FXX A;  3HTR A;  3M0P A;  1LPL A;  3HKS A;  4C5E A;  2F5K A;  1FWZ A;  1SKU B;  2GTO A;  1PM3 A;  3OYM A;  1ZA2 B;  3JB9 F;  3M53 A;  2FZG B;  4QQG A;  5EG2 A;  3EG1 A;  4WTO B;  1AD5 A;  2E70 A;  4JDS A;  4TVR A;  1SSF A;  2QQB A;  3JSC A;  4PJO F;  1W1F A;  5C6S A;  5CQY A;  4RCC A;  1WYX A;  3EGD A;  2DYI A;  4AFU C;  1WHJ A;  1B34 A;  1DJ7 B;  1RLQ C;  1OI1 A;  2H8H A;  1G3T A;  2L3Q A;  3L2W A;  3S6W A;  4LD9 K;  3HFN A;  2E4H A;  2K2M A;  5GAN 8;  4JPB W;  3RER A;  3H0H A;  1YJN Q;  3I5R A;  3CPW S;  3WXM B;  4F17 A;  4ZN3 A;  3G71 A;  3AHU A;  3L2Z A;  2DD5 A;  1CKB A;  4HA8 A;  4LDW A;  2XU8 A;  1ZX6 A;  2CP0 A;  1WHK A;  2EYW A;  1RI9 A;  2DTI A;  3FC3 A;  4M7A D;  3LW5 E;  4FT4 A;  4A54 A;  2X9H A;  4QKU A;  3PFS A;  3MP6 A;  3OYA A;  3H9N A;  1K0S A;  2R5A A;  4C8Q A;  2JVV A;  3RDV A;  2DD4 A;  3CCM A;  4A4G A;  1OX8 A;  4II1 A;  1R0C B;  2EQK A;  3NFC A;  1J3T A;  4UC4 A;  1M4Z A;  4M7A B;  1H92 A;  3JB9 H;  3OMG A;  3I55 A;  4GBQ A;  2GBQ A;  2M9U A;  5LJ5 g;  2HSP A;  4QT7 A;  1M2V A;  1R77 A;  2ATC B;  2DNU A;  1BI3 A;  1OZ2 A;  4M7D C;  4XU1 A;  2X3W D;  4JS5 A;  2HEQ A;  3CQT A;  1P92 A;  4B9W A;  2G3R A;  2CZ7 B;  4E7Z A;  3HSB A;  2JS2 A;  2XHC A;  2C0O A;  2VGM A;  3EH1 A;  2OAU A;  1RAH B;  2EGC A;  1T0J A;  2CS7 A;  4EDU A;  5KYU B;  4PFP A;  1MHN A;  2W0Z A;  1AWX A;  3M58 A;  1K9M U;  1W4S A;  4M7D D;  3M0S A;  5J3B A;  2FZK B;  1IB8 A;  1VQ6 T;  4LDY A;  3OYJ A;  1PG5 B;  1VQM T;  1KSW A;  2KE9 A;  3E2U A;  2E10 A;  2EQI A;  4F14 A;  1S72 A;  1YCS B;  2BIV A;  5A0L A;  2DEQ A;  1QVF P;  2CZ0 B;  1UEC A;  3NTI A;  1B7T A;  2YUP A;  4F7U G;  4M77 F;  2J6K A;  1KQS P;  2MIO A;  4QVD A;  1E6H A;  2K6D A;  5GAN d;  1QVF A;  5A0D A;  5HY6 A;  3R6O A;  3OYH A;  3FEO A;  5KYX A;  1U1S A;  1ACM B;  2CZ1 B;  2PUK B;  4J9B A;  4M7D E;  2P84 A;  2KT8 A;  5FLX E;  1VQL A;  4X9D A;  1XTD A;  1MV3 A;  2EQJ A;  2RHY A;  3OYC A;  2RJD A;  1VQM A;  1KC8 C;  2BKD N;  1GCQ C;  1C0M A;  2ABL A;  2LRQ A;  2YDL A;  2P4T A;  4XQ3 A;  1YHQ Q;  1UGP B;  3M5A A;  2M0O A;  1SHF A;  2LJ1 A;  1BU1 A;  5KH6 A;  1GCP A;  1PRL C;  1YJN T;  1ZHI A;  2GFU A;  1GBR A;  2B86 A;  3IQL A;  2FRW A;  2MPX C;  4ZGE B;  4F7U B;  3M4G A;  4BAC A;  4RTW A;  1YNZ A;  1SRM A;  2SEM A;  2QQ9 A;  2CH4 W;  3VRY A;  5GAN g;  3CCU T;  1VQ5 T;  2DJQ A;  4EMK A;  1ZSZ C;  2NUP B;  3A1P A;  2OTJ Q;  4M77 B;  4HCK A;  2F2X A;  4PKC C;  1D1B A;  4M7A C;  2VV5 A;  3CCV A;  1NYF A;  1VQK Q;  1XOV A;  4ZGD B;  1C6V X;  2QK0 A;  1D1C A;  1X69 A;  3OW2 A;  4M78 C;  4DQ2 A;  1K9M R;  2RHX A;  4XU3 A;  4O6J A;  1GFC A;  5GAO l;  1NEB A;  1WHG A;  2LQN A;  3CC7 T;  1KG1 A;  2RI3 A;  5GAM h;  4ZTF A;  2EKO A;  3I35 A;  4C92 E;  3FB9 A;  1VIF A;  1KIK A;  4Q5W A;  3REA B;  3VYG A;  3X20 B;  4PJO D;  2X3X D;  5LJ5 h;  2LNV A;  4ANJ A;  1GCQ A;  4ZNX A;  4X1V A;  3T9N A;  1K73 C;  2D9T A;  1YI2 Q;  2KRS A;  2VVK A;  2OTJ A;  3HPW A;  1N8R R;  1WIE A;  2ED1 A;  4M75 F;  4M7A G;  2RMO A;  2LQ8 A;  4PJN A;  1YIJ Q;  2FPD A;  1I0C A;  2I0N A;  3CCJ Q;  4PJO C;  1TWB A;  4M77 E;  3CC4 A;  3E9G A;  1VQ8 T;  5CR2 A;  1KQ2 A;  2M02 A;  3OMC A;  5GAO m;  1KC8 U;  1C1A A;  3VS3 A;  2DZC A;  1NYG A;  3HL8 A;  4QVZ A;  2JNG A;  1RAA B;  1H3H A;  3FJP A;  4CC4 B;  1LNX A;  2WSF E;  1KQ1 A;  5CAI A;  5L23 A;  2YSQ A;  1FYN A;  2ROL A;  2VYT A;  5GAO p;  2KXD A;  1YFN A;  4DOW A;  2OI3 A;  4FYW B;  4WCI A;  4C92 C;  2JMA A;  1YJW T;  3Q1J A;  2O4X A;  5CVI A;  2DTH A;  1V1C A;  2DX1 A;  5GAO n;  3OYY A;  1YI2 A;  2EGA A;  2EW3 A;  3CBM A;  2R58 A;  3CD6 T;  2HD0 A;  1OPK A;  1UGQ B;  2KRN A;  3PE0 A;  4C8Q G;  1OX9 A;  4BD3 A;  2DMO A;  3CXC S;  4KRT A;  3VKI A;  2V1Q A;  3GNG A;  5KCH A;  3CC2 T;  1G3W A;  1PD1 A;  2LTO A;  5IXF A;  2DVE A;  3TEE A;  3JB9 D;  2E3I A;  1PWT A;  3NHN A;  2ZZD A;  2MOX A;  3JCM b;  3PIO A;  1ZSZ B;  4M77 C;  3G4S Q;  3O8V A;  5CCA A;  4J9E A;  1U3O A;  2VGN A;  3E19 A;  4KUD K;  1T3L A;  3PNW C;  3JRZ A;  5IH2 A;  4N4H A;  3RES A;  2ZPF B;  4P5N A;  4M78 B;  3WVD B;  2KT1 A;  3QUI A;  3RR6 A;  2QAS A;  2PVO B;  2AKK A;  1IXD A;  1WA7 A;  4L5G A;  4C0F A;  2VAS A;  4QW2 A;  1PHT A;  3M4Y A;  1K8A U;  1SSH A;  3OW2 P;  3CCV T;  1ZLM A;  2DBK A;  4CC3 A;  1R8O B;  2CT3 A;  4BB7 A;  2COZ A;  1NLP C;  1JJ2 S;  4RMO A;  2ZPB B;  2L2P A;  1WI7 A;  2QYZ A;  5LJ3 d;  2JJ9 A;  3A5Z B;  1YJ9 Q;  1W70 A;  2K7A A;  2GQV A;  1RAD B;  3I56 Q;  3OY9 A;  2JT4 A;  4PK4 A;  2ED0 A;  3KUF A;  1BYM A;  3CCE Q;  3GLX A;  3EH2 A;  2AIR B;  1BI0 A;  2D8J A;  4EMG A;  1ZBX A;  2QDL A;  1ZA1 B;  1X01 A;  1HJD A;  2HL3 A;  2IIM A;  3C12 A;  1JJ2 A;  2XK0 A;  4RKU E;  2E5K A;  1SG5 A;  2DK3 A;  4E7H A;  4FW1 A;  1M1F A;  1QP2 A;  3NGP A;  3A8G B;  5D6Y A;  3CCJ T;  4RTZ A;  2V1R A;  4OB2 B;  2C0T A;  1R0B G;  2K9G A;  1CSK A;  4KH1 B;  1Q7Y C;  3OS5 A;  2LJ3 A;  3D7S B;  3CPF A;  1B3Q A;  4J9F A;  4C8Q D;  1KD1 U;  3G1J A;  2KY9 A;  2FRY A;  4J5Y A;  1ZSZ A;  1M3C A;  1LOJ A;  1UGS B;  1YJN A;  2BZY A;  2DEU A;  2RJE A;  3CCQ Q;  1SPK A;  1AHJ B;  2KRM A;  1NPP A;  4C5I A;  1JEG A;  2XID A;  2CP3 A;  2MK5 A;  3TVT A;  2GQI A;  2RB6 A;  1N9S A;  3SDZ A;  1WJR A;  1M1K U;  3TU4 K;  1Q81 U;  3S3O A;  1U8R A;  1BIA A;  4M75 C;  1VQL Q;  3EG3 A;  2BZX A;  3CME Q;  4E7I A;  4DBH A;  3MEU A;  4O5V A;  2CSI A;  1BCM A;  3EFS A;  3VS5 A;  5GMK m;  4FL6 A;  4ELZ C;  1K9A A;  2EJG A;  4R56 A;  5GAN j;  1N27 A;  3JCM V;  5GMK h;  1K73 U;  3THK A;  3G6E A;  2V8I A;  3H0F A;  3ME9 A;  3P8H A;  5GAN 7;  2K3B A;  1WQ7 A;  1U1T A;  2LJ0 A;  4BUG A;  4JRI A;  1KQS S;  4C92 F;  2E65 A;  2RA2 A;  2GTJ A;  1H8K A;  2LT4 A;  2PZ1 A;  2VUB A;  5C0M A;  1ZUU A;  4PJM A;  4KT0 E;  2LQK A;  4M4Z A;  4N0A C;  1YJW A;  1D0X A;  1VYU A;  5D6X A;  1JXO A;  4J6X A;  4RCB A;  4C8Q C;  2A3L A;  3TQ7 P;  1KD1 C;  3LWI A;  4DBF A;  5D6W A;  3A8M B;  2EPD A;  1BI2 A;  2OTL A;  4JRK A;  3SHW A;  1RAG B;  3A8H B;  4HCC A;  5CKH A;  3WVE B;  4EPC A;  4K11 A;  4JJC A;  4KUI A;  1RAC B;  2C0I A;  4EMH A;  4M75 A;  4AFQ C;  1YIT A;  2YT6 A;  2PTK A;  4ORZ A;  2L8D A;  1TSF A;  1YJ9 T;  5CKE A;  4XTY A;  1WHH A;  2E64 A;  2K79 A;  3I56 T;  1JBM A;  3DKM A;  3CC4 Q;  4LN2 A;  1LVK A;  3CBO A;  3LX7 A;  3LH0 A;  1I4K 1;  3QPH A;  2CUB A; 
#chains in the Genus database with same CATH homology
 3CCE T;  1BKB A;  1OYX A;  1W2B A;  2HQX A;  4XU0 A;  3CCE A;  3SWN A;  2CZ0 B;  2K5L A;  3NTI A;  4XU2 A;  2AHJ B;  4NOY A;  4JRP A;  2DJZ A;  3F70 A;  4M75 B;  3OYD A;  2VC8 A;  3UPU A;  4V2S A;  2R5M A;  3CEY A;  1HK9 A;  2RHI A;  3H8Z A;  4M77 F;  4YTL A;  3ZBD A;  3M57 A;  3OBW A;  4F7U G;  3DB4 A;  3BY7 A;  3MEW A;  3ER0 A;  2L5Q A;  3HFO A;  4QVD A;  4BE2 A;  1VQ4 A;  1VQN T;  5GAN d;  1QVF A;  3MEA A;  2EWN A;  5CQX A;  5A0D A;  5HY6 A;  3CMA T;  2XKO C;  3R6O A;  4EMK C;  3CCS A;  3JCM e;  4PLL A;  3OYN A;  3OYH A;  1N8R C;  3FEO A;  2FB7 A;  4A53 A;  1U1S A;  2CZ1 B;  1WPY A;  2PUK B;  2E12 A;  4M7D E;  3S3M A;  3QHS A;  3TCJ A;  3FDR A;  2QXF A;  5CO7 A;  5FLX E;  1G3S A;  3TRE A;  1VQL A;  2K2V A;  4J6Y A;  4X9D A;  5A0L A;  1N8R U;  2DEQ A;  2HAX A;  1XTD A;  3ASK A;  3MP1 A;  3HRU A;  4M7D A;  2EQJ A;  2RHY A;  3OYC A;  2RJD A;  4KBM B;  2RK2 A;  4XTV A;  2ZGW A;  1YIT T;  1VQM A;  1KC8 C;  2BKD N;  3N5B B;  2ZCF B;  3VUZ A;  4HT9 A;  3A8L B;  2LRQ A;  5GAM g;  3KBG A;  2YLC A;  2P4T A;  4XQ3 A;  3L2U A;  3CC4 T;  3KXT A;  1UGP B;  1QP3 A;  3JCM h;  3M5A A;  5GAM e;  4MDW A;  2M0O A;  2XDP A;  3CCQ T;  4N4I A;  1VQP A;  5KH6 A;  2ZPI B;  4J83 A;  1YJN T;  3QYH B;  1ZHI A;  2GCX A;  4M7D B;  3M55 A;  2GFU A;  1Y07 A;  2MF2 A;  4IUU A;  2OTL T;  5FU6 B;  3X24 B;  4Y91 A;  3JCM W;  1VQ7 T;  1Q7Y U;  4M77 D;  4RG8 A;  2C06 A;  4E7K A;  4C8Q B;  3GPL A;  1KHC A;  1NZ9 A;  4N0A A;  3RUX A;  4ZGE B;  2RH2 A;  4F7U B;  5GMK e;  3EAE A;  3M4G A;  4BAC A;  3CC2 A;  2XG8 D;  1Y96 B;  2D0Q B;  4OGE A;  1Y71 A;  1NJI C;  3G6E T;  1VQL T;  3QZ9 B;  3GP8 A;  3CCJ T;  3CCM T;  2QQ9 A;  5GAN g;  2A7Y A;  4B9X A;  3CCU T;  4A4F A;  4JS4 A;  1PSE A;  4EMK A;  3JB9 I;  4BDZ A;  1QVG S;  2KDS A;  5LL6 S;  2MAM A;  3MO8 A;  1O75 A;  4M77 B;  3I55 T;  4J7I A;  4PJO G;  3RKX A;  1RI0 A;  4M75 E;  4C92 B;  4PKC C;  2EFI A;  2X35 A;  1ZQ1 A;  1NE8 A;  3E1S A;  4M7A C;  4KUL A;  2VV5 A;  3LWH A;  4OP0 A;  3CCV A;  1XOV A;  4ZGD B;  1H64 1;  2QTX A;  2QEX T;  1BI1 A;  2OTJ T;  1GXI E;  3BDU A;  4PNO A;  4QQD A;  1VQP T;  4A4K A;  1N9R A;  3V8L A;  1IRE B;  3QJY A;  3OW2 A;  4D6W A;  2RI5 A;  3SWN C;  4M78 C;  5KCO A;  4CI0 C;  4DQ2 A;  4VUB A;  3VJP A;  1LJO A;  2RHX A;  3OQ5 A;  4N4G A;  4XU3 A;  4F7U E;  4O6J A;  2WSE E;  5J26 A;  1OZ3 A;  5CKB A;  2KMT A;  5GAO l;  2JUF A;  3UDC A;  1YBY A;  3CPW A;  1M90 C;  3CC7 T;  1KG1 A;  2RI3 A;  5GAM h;  4ZTF A;  4MDX A;  2EKO A;  4BI8 B;  2ZPG B;  4C92 E;  5HK3 A;  3GIB A;  3DLL A;  3G7Z A;  5KE2 A;  3FB9 A;  4LDX A;  1VIF A;  3JCM J;  5HK0 A;  3C95 A;  1W2B S;  1WGS A;  5I21 A;  2DO3 A;  2YLB A;  2KQW A;  1VQ4 T;  4Q5W A;  3VYG A;  1I81 A;  3X20 B;  4PJO D;  4LDV A;  5LJ5 h;  4HCC A;  2LNV A;  3OYK A;  3JB9 F;  1HXD A;  3T9N A;  2EIF A;  5GAN 5;  2RD1 A;  2X4Y A;  1NJI U;  2QA4 T;  1K73 C;  1VQ9 T;  4XTU A;  2D9T A;  2LVM A;  3HRS A;  1V29 B;  2EJF A;  2F69 A;  4ME7 A;  3JB9 G;  4IUQ A;  2QQA A;  2P0P A;  3HP9 A;  5LJ3 h;  1JB0 E;  4JRQ A;  3DLM A;  1RL2 A;  5DLQ E;  4C8Q E;  2JN0 A;  1YHQ A;  1VQK T;  3J7A F;  2OTJ A;  1Q81 C;  3HPW A;  3PIP A;  4FM4 B;  1I5L A;  3CCR T;  1Y7X A;  3FLG A;  4M75 F;  5GAN h;  1QVF S;  4M7A G;  1YIJ A;  2LQ8 A;  2EYQ A;  3MEV A;  4PJO C;  1MGQ A;  4LD6 A;  1M9S A;  1N6A A;  4E7J A;  1VQO T;  4HT8 A;  3PGG A;  4M77 E;  3E9G A;  3OA6 A;  1VQ8 T;  2DKG A;  5CR2 A;  3CC4 A;  5GAN e;  1KQ2 A;  2Y4X A;  3OMC A;  5GAO m;  1KC8 U;  5I2M A;  3M9Q A;  3M59 A;  2CKK A;  3JAM E;  2DZC A;  5GAM f;  1M90 U;  5LJ3 j;  5FU6 C;  2M16 A;  4NL2 A;  3HL8 A;  3CXC A;  4MML A;  4QVZ A;  2JNG A;  1EIF A;  4OB3 B;  1VQ7 A;  2X4X A;  1QVP A;  1I8F A;  1TH7 A;  2RHZ A;  3QJ6 A;  3QG1 A;  3MET A;  3JCM f;  3FJP A;  2YHT A;  4E47 A;  2JTF A;  1LNX A;  4L6V 5;  3G4S A;  3A8O B;  5FRN A;  4BY6 B;  2WSF E;  5LJ5 f;  1KQ1 A;  5CAI A;  2QA4 A;  4JJN K;  1Q82 U;  1XNI A;  4FU6 A;  3LYI A;  2OTL A;  2VYT A;  2NLU A;  3VU3 C;  2DPP B;  5GAO p;  2EQU A;  2RM4 A;  3QII A;  4DOW A;  2DXC A;  2XIC A;  1YCY A;  3I56 A;  4C92 C;  2HQE A;  3V8J A;  3RKY A;  1YJW T;  3Q1J A;  2O4X A;  4XTW A;  2GF7 A;  5LJ3 f;  3JCM c;  1VQ8 A;  5CVI A;  2DTH A;  3J80 E;  1VQO A;  3QZ5 B;  2LX9 A;  5GAO n;  2FVU A;  2K57 A;  3OYY A;  5GMK l;  1YI2 A;  3CBM A;  2R58 A;  3L1A A;  3CD6 T;  2HD0 A;  5KE3 A;  1UGQ B;  2P0Q A;  5L8R E;  1K9M C;  5CK9 A;  5M9O A;  3CC7 A;  2F5T X;  2D6F A;  4M7D F;  2O01 E;  1H3Z A;  4C8Q G;  4ZN1 A;  1YIJ T;  4OVA A;  2LDM A;  5FU7 B;  4C8Q F;  4BD3 A;  2JOY A;  3CXC S;  2FYK A;  2WAC A;  3H6Z A;  3GNG A;  3VKI A;  4F7U F;  2LC4 A;  5KCH A;  3CME A;  3V7C A;  3CC2 T;  1G3W A;  4M78 A;  2LTO A;  4Y28 E;  2DVE A;  2H3J A;  3UT1 A;  3TEE A;  3P8B B;  3JB9 D;  4C5H A;  1VQ6 A;  2EJ9 A;  2HBP A;  4QVC A;  3EFR A;  2ZZD A;  4BI4 A;  3L2Q A;  1D3B A;  3CBP A;  4GY5 A;  5DLO A;  3JCM b;  5FRO A;  4XTZ A;  3OYI A;  3PIO A;  3OBY A;  2V8J A;  1B34 B;  4M77 C;  4R55 A;  4C0D B;  2E6N A;  3NTH A;  2B8A A;  3O8V A;  4ATO A;  5CCA A;  2QEX A;  3JCM P;  3OS1 A;  3JCM g;  2KVQ G;  3E19 A;  2VGN A;  2PVD B;  3QXE B;  4OGC A;  5GMK i;  5LJ5 d;  3QYG B;  4KUD K;  3QO3 A;  5J39 A;  4M7A A;  1WJQ A;  1M5Q 1;  2QI2 A;  3JCM X;  3PNW C;  3OYB A;  4DA4 A;  3JRZ A;  4N4H A;  1UGR B;  1IZ6 A;  2VXF A;  1FX7 A;  2DXT A;  2WSC E;  4PL6 A;  4J7F A;  4X9C A;  3RES A;  2ZPF B;  4P5N A;  4OMF B;  5DM7 R;  4C5G A;  4DOV A;  4M78 B;  2DTO A;  3WVD B;  1BIB A;  3PTA A;  5IT9 E;  4A4E A;  4ZGJ B;  3S3N A;  3QUI A;  5AYF A;  2DAQ A;  4C0Z A;  3PMT A;  2E5Q A;  5LJ3 g;  5IN1 A;  4J6W A;  1WJS A;  4L59 A;  1G5V A;  3CCS T;  3E9F A;  2PVO B;  2EQM A;  4L5G A;  3RKW A;  2PQW A;  4PJO B;  4C0F A;  5LJ3 e;  2RO0 A;  2P0K A;  5GAO q;  4M75 G;  4M7A F;  3OYE A;  4C0G A;  4IUP A;  4ELY C;  4JUV A;  3RMS A;  4QW2 A;  2PVG B;  3M4Y A;  1K8A U;  4QQ6 A;  3CCV T;  4FSX A;  3GOX A;  3CCU A;  1VQ5 A;  3L2V A;  5CIU A;  4PJO A;  2YRV A;  2JTM A;  3C94 A;  1R8O B;  3M54 A;  1G3Y A;  4BB7 A;  3GF5 A;  3V7R A;  4M78 E;  1JJ2 S;  1O9S A;  3C4S A;  4RMO A;  4C92 G;  1S72 T;  2ZPB B;  1WNL A;  5LJ3 d;  3A5Z B;  4LDU A;  4X34 A;  2IVW A;  3QPH A;  2GQV A;  2E41 A;  2E1H A;  3OY9 A;  3OS0 A;  5GAN 2;  3CMA A;  5A0G A;  4A4H A;  3KUF A;  3QKJ A;  2K3X A;  2Y4Y A;  1BYM A;  4IKF A;  5CKD A;  3GLX A;  1QVG A;  4M78 G;  5DY9 A;  4MZP A;  1BI0 A;  5GMK j;  3OYL A;  2K3Y A;  4E7L A;  1Q86 U;  4M75 D;  4EMG A;  2CGH A;  1ZBX A;  2DXB A;  1FXX A;  3MCA B;  5GAN f;  1M1K C;  3CCL A;  1X01 A;  5GAM d;  3BDL A;  3C12 A;  1JJ2 A;  2XK0 A;  3OSS C;  4IUR A;  3QDR B;  3HKS A;  1Q86 C;  4RKU E;  2DIQ A;  4C5E A;  2F5K A;  2XD0 A;  2DK3 A;  1FWZ A;  3J81 E;  4BE0 A;  4E7H A;  3LLR A;  3CME T;  2K5F A;  1M1F A;  1QP2 A;  3OYM A;  2E6Z A;  3A8G B;  2HNI A;  2R57 A;  3LGF A;  3M53 A;  4JLI A;  4QQG A;  5D6Y A;  3G71 T;  5EG2 A;  3CCJ A;  2L89 A;  3BFM A;  4BY6 C;  2E70 A;  1VIE A;  5I2S A;  4OB2 B;  4JDS A;  4TVR A;  1SSF A;  2QQB A;  3JSC A;  4PJO F;  5C6S A;  5IAY A;  1Q7Y C;  3OS5 A;  5CQY A;  4BI3 A;  1QW1 A;  3CPF A;  3L42 A;  1UB4 A;  4XK8 E;  4C8Q D;  5GAN 3;  4PJO E;  1KD1 U;  3NTK A;  2KY9 A;  2IG0 A;  2M1H A;  4RCC A;  3QSU A;  4J5Y A;  2MWO A;  1B34 A;  1DJ7 B;  5FRM A;  2MWP A;  3CCQ A;  4MMK A;  1OI1 A;  2BUD A;  1LOJ A;  3RMQ A;  1D3B B;  1G3T A;  1UGS B;  1YJN A;  3L2W A;  3S6W A;  4LD9 K;  3HFN A;  4FT2 A;  2FHD A;  3VUB A;  2RJE A;  5GAN 8;  2I2L A;  1AHJ B;  2RI2 A;  1NPP A;  4C5I A;  2XID A;  5HKC A;  1M8V A;  3RER A;  2LT1 A;  3SD4 A;  1NPR A;  2RB6 A;  3CPW S;  1N9S A;  5FU7 C;  3WXM B;  3L2R A;  3G4S T;  4JLG A;  1X6O A;  5GAN 6;  4NS5 A;  3SDZ A;  2DZ9 A;  3SB2 A;  4ZN3 A;  3G71 A;  3FIF A;  2PUO B;  2MMP A;  3RIR A;  3UWN A;  1WJR A;  2RHU A;  3AHU A;  3L2Z A;  1M1K U;  3PMI A;  1VQ5 T;  2DD5 A;  1VQ9 A;  3BW1 A;  3TU4 K;  3X28 B;  1Q81 U;  3S3O A;  2ZPE B;  1U8R A;  1BIA A;  2KK4 A;  4HA8 A;  4M75 C;  3OW2 S;  4LDW A;  2XU8 A;  2DXU A;  4M7A E;  4E7I A;  2RJC A;  2L3R A;  3VYH B;  3V8K A;  2O4X B;  3MEU A;  2XDD A;  3OS2 A;  3CD6 A;  4NL3 A;  4O5V A;  5A2Q E;  4M77 A;  4C0D C;  2DTI A;  4EMK B;  2X4W A;  3EFS A;  3CCR A;  5GMK m;  3FC3 A;  4M7A D;  4FL6 A;  2DIG A;  3LW5 E;  3ZEH A;  4ELZ C;  3FRN A;  1KQS A;  2EJG A;  4HCZ A;  4FT4 A;  4M78 F;  4Z02 A;  3M56 A;  1Y96 A;  4R56 A;  4MZT A;  5GAN j;  5CKF A;  2GFA A;  2RK1 A;  4A54 A;  4F7U A;  1N27 A;  3PFS A;  3MP6 A;  3OYA A;  3URG A;  4BE1 A;  2R5A A;  4ZTJ A;  4WF2 A;  4OB1 B;  4OF1 A;  4C8Q A;  2JVV A;  2XI9 A;  2DD4 A;  3PT9 A;  3JCM V;  4A4G A;  4J8O A;  4II1 A;  5GMK h;  3G6E A;  3CCM A;  1K73 U;  3CCL T;  2EQK A;  3NFC A;  4M77 G;  3HRT A;  2V8I A;  3P8H A;  3ME9 A;  4UC4 A;  1M4Z A;  4M7A B;  1WQ7 A;  5GAN 7;  1YJ9 A;  3JB9 H;  3OMG A;  1U1T A;  3I55 A;  4BUG A;  1Q82 C;  4JRI A;  3JCM d;  2M9U A;  4C92 F;  1KQS S;  2E65 A;  4BDY A;  5LJ5 g;  2RA2 A;  3VV0 A;  2FL7 A;  1WQW A;  2LT4 A;  1KHI A;  1UEB A;  2PU9 B;  3LGL A;  4GLK A;  2VUB A;  5C0M A;  4RG2 A;  1X75 C;  1BI3 A;  1PSF A;  2KSS A;  4XAX B;  5GAN 4;  1OZ2 A;  2MI6 A;  4M7D C;  3INZ A;  4KT0 E;  2LQK A;  4N0A C;  4XU1 A;  2VXE A;  1JRI A;  3SFM A;  4JS5 A;  5D6X A;  1YJW A;  4C92 D;  3V7S A;  1P92 A;  4J6X A;  4RCB A;  2G3R A;  2JZ2 A;  4B9W A;  2A3L A;  4C8Q C;  2CZ7 B;  5GAM j;  1KD1 C;  1VQK A;  3HSB A;  3OB9 A;  3LWI A;  2ZPH B;  4IUV A;  1K8A C;  1YI2 T;  3DB3 A;  5D6W A;  4CRI A;  3MHX A;  3A8M B;  2XHC A;  4MZM A;  5LJ5 e;  2VGM A;  2V8K A;  1BI2 A;  2K5I A;  3QBY A;  2OAU A;  2QQR A;  3A8H B;  4IUT A;  4JRK A;  3X25 B;  2RJF A;  3JB9 J;  2EAY A;  3GNF B;  5CKH A;  4HKE A;  2CS7 A;  3P8D A;  3WVE B;  4EPC A;  4EDU A;  4FIB A;  1MHN A;  3M58 A;  4M7D G;  3MP8 A;  1K9M U;  1VQN A;  2QQS A;  4M78 D;  1W4S A;  4M7D D;  4KUI A;  1VUB A;  5J3B A;  1M1G A;  2K4Y A;  2LCC A;  4C92 A;  2Y90 A;  4EMH A;  1VQ6 T;  3OYG A;  4LDY A;  3OYJ A;  4M75 A;  3ZFJ A;  3X26 B;  1VQM T;  1YIT A;  3JCM Q;  1XQH A;  2L8D A;  3SWN B;  1YJ9 T;  5CKE A;  2XDB A;  5LJ5 j;  4XTY A;  2QDY B;  2E10 A;  2E64 A;  4OB0 B;  3I56 T;  2KAF A;  1JBM A;  3DKM A;  4XTX A;  1S72 A;  3OYF A;  1YHQ T;  4PLI A;  2CYZ B;  5GAO r;  3CBO A;  2CZ6 B;  2BIV A;  3LX7 A;  3LH0 A;  1I4K 1;  4HCB A;  3HHT B;  2X4J A;  3OSV A;  2LCL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...