3JCMV

Cryo-em structure of the spliceosomal u4/u6.u5 tri-snrnp
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
84
structure length
72
Chain Sequence
MVPPINCIFNFLQQQTPVTIWLFEQIGIRIKGKIVGFDEFMNVVIDEAVEIKEDVEKKILLKGDNITLITSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pre-mRNA-splicing factor 8
publication title The 3.8 angstrom structure of the U4/U6.U5 tri-snRNP: Insights into spliceosome assembly and catalysis
pubmed doi rcsb
molecule tags Transcription
total genus 7
structure length 72
sequence length 84
chains with identical sequence Y
ec nomenclature
pdb deposition date 2015-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3jcmV00
5GAMh 5LJ3e 4M7AD 4PJOD 3FIFA 3AHUA 4PNOA 3QUIA 4M78G 2RD1A 4XQ3A 3SWNC 4MMLA 4NOYA 2YLBA 4PJOA 4C92B 5LJ5g 2DEQA 4C92F 1Y96A 2YLCA 3HFOA 4M77G 5GANg 4C8QE 4MMKA 4WF2A 1WNLA 3L1AA 4EMKB 2VXFA 1WPYA 4C92D 4J6XA 3INZA 2VC8A 4M75B 4C92A 5LJ5j 3QHSA 2EJGA 4OP0A 2CGHA 2EWNA 5GANe 1LJOA 1LOJA 4EMKA 5LJ5f 3RESA 4M78E 4EMGA 4M75D 3PGGA 3RUXA 2DTIA 4M78C 3V7CA 4M7AF 1WQ7A 1N9RA 4EMHA 5GAN5 4X9CA 2FB7A 4C92G 5GMKm 2DXUA 3JCMe 4M7DB 4M77E 4HT9A 4M7DF 3JCMV 4M77C 3JB9G 4X9DA 5LJ3j 2RA2A 3RKXA 3JCMW 1YCYA 5LJ5h 2RM4A 4M7AA 4J6YA 4F7UB 5GAMe 3JB9J 4XTZA 5LJ3f 4F7UF 4M7DD 2Y90A 3JB9I 2DVEA 4XU2A 5I21A 4HT8A 2EJ9A 4RCCA 4XU0A 3SWNB 3EFSA 1U1SA 3V7RA 4C8QC 3JB9H 4M7DA 3BW1A 5CAIA 4V2SA 1D3BB 4NL2A 4PJOG 3HFNA 5GAN2 4M7AG 5GAOp 4HA8A 3JCMg 1KQ2A 4M75F 2DKGA 5LJ3h 4F7UA 4C92E 3BFMA 5LJ5d 2YHTA 1I81A 4C92C 2E10A 4XTUA 5GAN8 4A53A 5GAN4 5GAOn 5GMKe 3QO3A 5GANj 1JBMA 4M7DG 3SWNA 1WQWA 3JCMP 1N9SA 1I4K1 2DTHA 5GAMg 4QVCA 5GAN7 1D3BA 5GANf 1KQ1A 4M75A 1HXDA 4F7UG 2DJZA 1MGQA 4N0AA 5GAOr 3RIRA 3V8LA 5LJ3d 5GAOl 2VXEA 1JRIA 4DQ2A 4M78B 4J5YA 1LNXA 3V8KA 4M78F 3JCMf 5GMKi 2E65A 1I8FA 4RCBA 3GIBA 4PJOE 4M7AE 1M8VA 2DZCA 4PJOC 2EAYA 5GAN6 3BDUA 5GANh 4M7AC 4M75G 3RKYA 1TH7A 5GAOq 4M77B 4M78D 4M77F 4M7DE 5GAMf 3JCMb 5GAN3 2HNIA 1HK9A 4XU1A 4M78A 2JN0A 4XU3A 3V8JA 4NL3A 4M77D 3VU3C 1Y96B 3BY7A 4F7UE 4C8QB 4XTYA 4C8QF 2DXTA 4M77A 2FYKA 5GANd 3JCMQ 5GMKj 4EMKC 4Y91A 3M4GA 4JRKA 4XTXA 1M5Q1 4C8QD 4JLIA 2QTXA 4XTWA 1H641 1U1TA 1B34B 4XTVA 2EJFA 3L2ZA 4JRIA 4M75E 3SB2A 3JCMd 4M75C 3JCMc 1BIAA 4C8QA 2RB6A 4N0AC 2E41A 3RERA 3JB9F 3HSBA 4J6WA 2ZGWA 4A54A 5GMKl 5GAMj 5GAMd 3QSUA 5GMKh 1BIBA 2E1HA 3JB9D 5LJ5e 2DZ9A 2E64A 1B34A 4QVDA 5DY9A 1I5LA 4C8QG 2DTOA 3FB9A 5LJ3g 3JCMJ 1X01A 4M7DC 3JCMh 3JCMX 5GAOm 4PJOB 4M7AB 4PJOF 2I2LA 3EFRA 3FJPA 3RKWA 4JUVA 3V7SA 2K57A
chains in the Genus database with same CATH superfamily
3CD6T 4PJOD 4MMLA 1VQ4Q 4JJNK 4PJOA 3Q1JA 1ZSZC 4C0ZA 2R5MA 5CK9A 2DRMA 1NPRA 5AT1B 1M1KR 1K8AC 2QG9B 5FW9A 2X3XD 4M75B 1WIEA 2XDBA 2FVUA 2KMTA 1UE9A 1FX7A 4D8DA 2KXDA 1ARKA 1LJOA 1RADB 3A98A 1G3WA 3MEAA 3EG3A 1M1KC 2DXUA 5A2QE 2LQ8A 2CYZB 3JCMW 1WXBA 5LJ5h 2JOYA 1KC8R 4IUTA 4M7DD 4F7UF 2MPXC 2NLUA 3I56A 3OSSC 2CH4W 2V8IA 4XU0A 4M7DA 4E2FB 5KYXA 4IUQA 2O9SA 1HJDA 2OI3A 4NL2A 5IXFA 3CD6A 2WSEE 2M0OA 1U5SA 3VS7A 1KC8C 5GAMg 2JTFA 1D3BA 4LDWA 1HD3A 3CBMA 3OB9A 4N0AA 5KYYB 2KYBA 3I56Q 4N4HA 3S6WA 4PJOE 2EAYA 4M75G 3CD6Q 3E2UA 4BACA 1ACMB 1CKBA 5I11A 4M77D 3L2UA 2EBPA 2ROLA 4M77A 3A8HB 3VKIA 2R58A 3QWXX 4N0AC 3UATA 2LC4A 3MP6A 2WSCE 5KYWB 1NM7A 1BI2A 4GLMA 3QKJA 5L23A 3CXCS 2QXFA 1I5LA 4OB3B 2LCLA 1Q7YR 2LJ1A 4J9CA 1AD5A 3JCMh 5GAOm 2C0TA 1BI3A 4HCKA 3CMAT 3EFRA 5D7UA 4JRPA 1WI7A 1QWFA 1VQPT 3VYHB 1G5VA 3A8GB 1ZA2B 4C92B 4X1VA 2DEQA 4E7SA 1M9SA 2GF7A 2LJ0A 5KYUB 1Q7YC 4ZNXA 1WNLA 2QQAA 1TUGB 1GL5A 2EJGA 1NBEB 2K9GA 3UPUA 3PGGA 2KRNA 2D8JA 2M0YA 3PVLA 3VRZA 4M77E 3I5RA 4KBMB 3MKDA 2RI2A 2AHJB 2Y90A 4DEXA 3JB9I 3CCQT 4A4FA 1U1SA 3I9QA 3CMAA 3LW5E 2IPOB 1VQPA 4VUBA 2VVKA 1KG1A 3J80E 3CPWS 3F70A 2RQUA 1BKBA 1RAIB 1C0MA 5GMKe 1VQ5A 1SKUB 2AIRB 4AMCA 1M2OA 1NEGA 2YUNA 4OGCA 1HXDA 4C5HA 2XDDA 3O8VA 2FHDA 4RCBA 2HEQA 2K7AA 2CUBA 3PMIA 3CMAQ 1VQPQ 2L3SA 3SD4A 1M3BA 4AFZC 1MUZA 2NUZA 1VQ5Q 3ZFJA 4C8QB 1NLOC 4LE9A 3PIOA 1K0SA 4D8KA 4KGXB 1XQHA 2JW4A 2X9HA 3CCQA 3QJYA 2HQXA 4C0DB 1BIAA 1AZGB 2LQWA 3JB9F 3A1PA 4OMPA 1YIJT 1T3SA 2JVVA 2QQBA 3CPFA 2X51A 3MP1A 2E64A 2DJQA 2V26A 3VS5A 3CCST 1AWXA 2RF0A 1W1FA 3CCQQ 3HP9A 4DOVA 4KGZB 4DBHA 2PNIA 4PNOA 2OTLT 4XQ3A 1Q82R 5LJ5g 3TQ7P 8ATCB 2XIDA 4EMKB 4PK4A 1H8KA 3OSVA 2OAWA 4PKCC 1MV0B 3H9NA 2CDTA 5LJ5j 3SEMA 1VQLT 2E5QA 2MMPA 1Q82C 2FRWA 3ASKA 2L89A 2RI5A 3M54A 3FRNA 3L2WA 1YIJA 1NJIU 1YITT 5L8RE 2DL8A 2SRCA 2EQJA 3NMZC 4M7AA 2JT4A 1YWOA 3E9GA 1IGQA 2EJ9A 3EFSA 3JB9H 1VQMA 2M16A 2KI7A 3KUFA 5GAN2 1ZSZB 2PVDB 2OTLA 2QI2A 1WHMA 5CKDA 5M9OA 5J39A 5DLOA 3QO3A 4LDUA 3CCEA 1I4K1 1YIJQ 4OB0B 1Y07A 2LX9A 2HSEB 1HYOA 1MGQA 3M5AA 2RJDA 3C12A 5CQYA 1TUDA 4M78F 1I8FA 1VQLA 3CCSQ 5DM7R 2IG0A 4M7AC 2A3LA 3SDZA 3OBYA 3HRSA 2OTLQ 2D0NA 2JTMA 1T3LA 2EQUA 1X69A 1YITA 2EYYA 2EQMA 3OYYA 2P84A 4DBQA 1N5ZA 2KE9A 2OTJA 3L2RA 1W2BA 4A63B 3JSCA 1B34B 3N5BB 3C94A 3UWNA 1VQLQ 2GNCA 2BZYA 4OMNA 3RERA 2ATCB 1XOVA 3C0CA 4RTUA 1M1KU 4Y28E 3QSUA 1Q81U 4HKEA 1WHHA 5KE2A 4LDXA 1YITQ 3OQ5A 2VYTA 5KCOA 4JRQA 2BE9B 2P0KA 1QLYA 1YNZA 2OTJQ 2JTEA 1O9SA 1UDLA 1EZZB 2DEUA 2VWFA 3FIFA 2EIFA 3HKSA 4NOYA 3I35A 1D0ZA 1G2BA 4FYWB 3L1AA 1ZUKA 4AFUC 1UJ0A 2FL7A 2GFAA 2EWNA 1C6VX 1ZBXA 4MZMA 2D1XA 2DPPB 1GFDA 2K2VA 3H0HA 1PKTA 4A4GA 1X43A 5CVIA 3MPUB 2RM4A 2HMAA 3A8LB 2AK5A 4AG1C 5FRMA 5HK0A 3TU4K 3U23A 1YBYA 3EG2A 7AT1B 4M7DG 3CMET 1I0CA 2MWPA 1K9AA 3VS1A 4XAXB 2DTHA 3CCRT 2E6ZA 3OYFA 3P8DA 2MAMA 2MOXA 5IHKA 3OMCA 2F5KA 1V29B 2YWWA 4IIMA 1ZSGA 1BK2A 3EG9A 2P4TA 4FYYB 1ZUYA 2LCSA 1PKSA 3JAME 2MIOA 2PU9B 1AOJA 2JN0A 1M90C 2QK0A 4ELYC 4XTYA 4F17A 1UG1A 2X4YA 3L2QA 4Y91A 1EX4A 2RJCA 3TSZA 3L2ZA 4BI3A 1RAHB 3OA6A 4F16A 3RBBB 3CMEA 2DXBA 1W2BS 4OVAA 3G71T 3CCRA 1UGQB 4L5GA 1UTIA 1XNIA 1KQSS 4J9FA 2LQKA 5GAMh 2D8HA 2LVMA 3M0SA 1RAFB 2COZA 2XDPA 4BI4A 2L3RA 1LPLA 1ZQ1A 1OYXA 2LJ3A 3CMEQ 4FT2A 1YJNT 5D6WA 3G6ET 4E7JA 4FIBA 1VQKA 1MNEA 3CCRQ 1WLPB 3MEWA 1AVZC 5GANe 1LOJA 1OI1A 2ZPFB 2KNBB 2C06A 1W4SA 2HDAA 3WVDB 1RI9A 2EW3A 3EHQA 1RLQC 4HT9A 4A4EA 3BE3A 2EQIA 3LYIA 1YCYA 3G71A 1GXIE 3RDVA 1I5OB 3E19A 1Y71A 4FT4A 1VQ6T 2J6KA 3CQTA 2QA4A 2DYIA 4F7UA 4C92E 9ATCB 1U06A 2K3YA 1QCOA 2EGCA 2LQNA 2CP7A 3QZ9B 1YJNA 3G6EA 3G71Q 3V8LA 1SEMA 3L42A 3A8MB 1GCQA 4FCYA 3GIBA 2DZCA 3BDUA 1H3HA 3CBPA 4ZGJB 2QA4Q 2EYQA 1OQKA 5GAN3 2JJ9A 3RR6A 2L5QA 3WVEB 3CCVA 2AZVA 4F14A 1YJNQ 3G6EQ 4HCBA 4OF1A 2QTXA 1NJIR 2KT8A 4QQGA 3PE0A 4KT0E 3M9QA 1RAEB 1ZX6A 2F1LA 1Y57A 4RMOA 2DL4A 1VQ7A 2ECZA 3JV3A 1KD1U 5AYFA 1BBZA 3FLGA 2MI6A 3CCVQ 4M7AB 1NJIC 2I2LA 3V7SA 3KXTA 3SWNC 3QUIA 3LWHA 1VQ6Q 2P0PA 2XMFA 1FMVA 2V8JA 5CQXA 4C92F 4C8QE 4C0FA 2CZ6B 4J6XA 2ZZDA 4JJDA 1PD0A 3OYBA 4PL6A 1UGRB 1R77A 1VQOA 4KULA 2CGHA 4RG8A 3I56T 4PLLA 2DILA 2B86A 2XI9A 4BE1A 4II1A 2NUPA 2KROA 2XICA 2ZPEB 3S3OA 2BKDN 2DETA 1PSEA 2DVEA 2YRDA 3G7ZA 4ZGDB 1Q81R 4QQ6A 4GLKA 4AT1B 2O88A 1VQOQ 3HFNA 4M7AG 1YJ9T 2KR3A 2A36A 2O4XA 1JJ2P 4HCZA 1RABB 4ORZA 5CO7A 5GAOr 2OX7A 3RIRA 1Q81C 3C95A 3UA6A 3NHNA 4PJOC 2XG8D 4E7ZA 1IHVA 1QVGA 1MNDA 4CRIA 2J7IA 2LTOA 3QYHB 2VB6A 4XU3A 3MO8A 3X28B 3VYGA 4FYVB 4C8QF 4J9BA 3OYHA 5FU6C 2PVGB 3META 4DBRA 2QDYB 2QTVA 3QDFA 4JRIA 1AT1B 3M53A 1QQJA 1YHQT 1YJ9A 5IHNA 5EG2A 4E7IA 1PD1A 5CR2A 1WHJA 5GAMj 3JB9D 3LWIA 2XD0A 2QYZA 3FB9A 4M7DC 2FO0A 1ZA1B 3KBGA 1E7OA 1KJWA 2NYSA 1VQNA 1A0NB 4CC7A 2QEXT 2K4YA 4K11A 2RD1A 1YJ9Q 1K4US 1JEGA 1I07A 3HFOA 2LT1A 5GANg 3LGFA 1G3TA 4PJJA 2VXFA 4LDYA 1B3QA 1SRLA 1VQ8T 3EH1A 1MHNA 1VQNQ 1YHQA 1N9RA 1GFCA 4M4ZA 4CC4B 3JCMe 1ZHIA 4M77C 1M90U 1OX9A 3EGDA 2QQ9A 1VUBA 2DK3A 1VQ5T 4LD6A 3T9NA 1E6HA 3EFOA 1NEBA 4LXCA 4XU2A 1KIKA 4RTYA 3UT1A 4MZPA 2BIVA 4DEYA 2QEXA 2DL7A 3H0FA 2H3EB 1YHQQ 5FRNA 4LNPA 1M2VA 4BDYA 4N4GA 5GAN7 2KY9A 3PVQA 1R0BG 2B8AA 1VYVA 2XHCA 1VQ8A 4DBFA 1QWEA 2O01E 2QAZA 1X2QA 3M0TA 4ATOA 4M78D 4BI8B 1BYMA 3OYJA 2ENMA 2QEXQ 1OZ2A 4M78A 3E1SA 2R5AA 2F2VA 2E3HA 3DB4A 1OOTA 3S3MA 2L8DA 4J83A 4XTXA 1VQ8Q 8AT1B 4FSSA 1D1CA 4RTTA 2FZKB 1YJWA 2HCKA 4Z02A 2DFUA 5GMKh 5CKFA 3HRUA 5DY9A 2KVQG 2GCXA 1ABOA 3FJ5A 3J7AF 2DLPA 2K5FA 2VGNA 1IHWA 3M57A 1U3OA 2RN8A 3PIPA 1R0CB 1Y0MA 5LJ3e 1UFFA 1FXXA 3OS5A 3NPFA 2CT4A 3REAB 2DYBA 2NUTB 5IAYA 3OYAA 3EGXB 4WF2A 3VS4A 1RL2A 3WXMB 4HVVA 2VC8A 1WXTA 1UB4A 4M78E 2BTTA 3V7CA 3QWYA 1VQMT 1WQ7A 1HSQA 2JS0A 3MCAB 1Q95G 1IREB 2AT1B 4X9DA 3G4ST 2K6DA 3REBB 3JB9J 3CCET 5KH6A 3OS2A 5HY6A 3SWNB 1G83A 1PG5B 1N27A 3OS1A 2GQIA 2CP2A 1JU5C 1PCXA 1KD1R 1KQ2A 4B6MA 2DMOA 2L3QA 1TWBA 4L6V5 3VS6A 1I81A 3QG1A 1ZLMA 4CC2A 4XTUA 3TVTA 5GAOn 4QVCA 4FSXA 3M58A 1MMNA 4F7UG 5A0DA 1RLPC 2J6FA 3V8KA 4J5YA 2E65A 3ULRB 1KD1C 1X6OA 1QVGP 2OTJT 4ME7A 2R57A 1TOVA 2CZ1B 2W10A 4CC3A 4JJBA 4XU1A 1OPKA 4RTVA 3MEVA 3VJPA 3G4SA 3UDCA 5GANd 1V1CA 2RQWA 4JRKA 2K79A 2H3JA 3A8OB 1JXOA 3E9FA 4O5VA 1FYNA 2DVJA 1K73U 2YRVA 1LCKA 2E5KA 3HSBA 4J6WA 1VQMQ 2ZPIB 4QVDA 4E6RA 1WHGA 1UECA 3G4SQ 4PJOB 2JMAA 3CCEQ 4HCCA 3OW2A 2RO0A 2MWOA 1WDXA 2D6FA 5FU6B 3GLXA 2YT6A 1QW1A 4AG2C 2FZCB 2O4XB 2ZPHB 3H6ZA 2DBKA 3CC4T 4RTZA 2LRQA 4FW1A 1MMGA 2E70A 4M75D 1NYFA 1KHCA 1BU1A 2CZ7B 4AFQC 4EDUA 4M7DB 2GFUA 1RAAB 3GOXA 5KYXB 2IVWA 2L3PA 2RNAA 4IUVA 1M4ZA 4IUPA 5IH2A 1YWPA 3BW1A 1D3BB 3CCLA 4PJOG 2FZGB 1S72T 1ZBJA 4A53A 1JBMA 1WQWA 1N9SA 3DLLA 1OPLA 3CC2T 5GANf 2HQEA 3CBOA 4J7FA 3OYGA 1WXUA 3SFMA 3CC4A 4HXJA 2E4HA 1XTDA 4Z89A 4M77B 1D1AA 4Y92A 5KYYA 5J3BA 1OZ3A 3ZEHA 3BY7A 4C5GA 3JRZA 1B07A 1RACB 5GMKj 3GNFB 1PRLC 4E7KA 2PUKB 1TS9A 3PT9A 3CC4Q 4M75E 1M90R 1JJ2A 3H41A 2EYWA 1S72A 5IT9E 1WFWA 1M1FA 1D09B 4C5EA 4R0KA 3OYEA 1CSKA 1RAGB 2CZ0B 5LJ3g 4EIKA 3CC2A 2E3IA 1D0YA 2J6OA 2HL5C 1VQKT 2KAFA 2X35A 3TSWA 5KYWA 1B7TA 3PMTA 1SG5A 3PFSA 1MMAA 1JXMA 4KUDK 5FWCA 4PFOA 5GJVB 2RHYA 2K3BA 3URGA 2MCNA 1QMCA 1S72Q 2CREA 3O5ZA 4M77G 2DF6A 1AWOA 2OAUA 1EIFA 2RQTA 4C92D 3INZA 3OY9A 5IN1A 3M55A 3CC2Q 3NTHA 4QW2A 4C92A 4JS4A 1H92A 5KYUA 2P4RA 1N6AA 4EMGA 1NLPC 3UF4A 1PWTA 4X9CA 2QA4T 3MEUA 2J06A 2RH2A 4J8OA 2RHIA 1BI0A 5GAMe 2JXBA 1IB8A 1P92A 2C0OA 4V2SA 1Q86U 4BD3A 4ZTFA 4M75F 4WCIA 3M56A 4C92C 1M3AA 3I55T 3CCUA 1SSFA 4A4KA 1RI0A 2E12A 2DAQA 1OEBA 3LX7A 4J9HA 1EFNA 3CCJT 3CCVT 2EKHA 1WZOA 1VQKQ 5GANh 5CIUA 2CP5A 2RK2A 1TG0A 3CCUQ 2BZXA 3OYMA 1YCSB 2A0FB 3OS0A 1KK7A 4FYXB 1VQ7T 1PNJA 4C8QD 4JLIA 4XTWA 2VGMA 4LUEA 4XTVA 2EJFA 2LNHB 1AHJB 3JCMd 4E7LA 4C8QA 2E41A 1VYUA 5GMKl 5FWBA 3I55A 2E1HA 2GTJA 3ZL7C 3HPWA 1SHGA 3OW2P 2ED1A 3GP8A 3CCJA 2K3XA 5CKHA 2JNGA 3AHUA 1VQOT 1D1BA 2DL3A 2A37A 6AT1B 3D7SB 4MZTA 2GQVA 3I55Q 1PRMC 1GCQC 1E6GA 3FEOA 2KRSA 4OB2B 1CKAA 2KEAA 3QHSA 2COWA 5DLQE 2CP3A 3M0UA 4EMKA 1LVKA 3CCJQ 4BE2A 2CP0A 2K2MA 2DTIA 3R6OA 2DD5A 2RHXA 2CT3A 1J3TA 2JM9A 1D0XA 1K73R 3VUBA 1NZ9A 2KQWA 5I21A 4RCCA 3V7RA 2AKKA 1VQ7Q 2PQWA 2DNUA 1FMKA 4CI0C 3VV0A 3X24B 1M30A 1K73C 2EPDA 2RHUA 1ZSZA 3CXCA 5CCAA 1NPPA 4IURA 2QGGA 5LJ3d 2HL3A 3M4YA 4DQ2A 5GMKi 3JCMf 1TH7A 1QCNA 2KDSA 2A08A 3JCMb 1WHLA 2F5TX 5I22A 3DLMA 1TXQA 2MK5A 1K9MR 1RUWA 4RG2A 1OULA 1PM3A 1N8RU 3EHRA 1VYTA 3SB2A 3OYCA 1OX8A 3QYGB 1VQNT 3TCJA 2HKNA 2HAXA 1UGPB 1K9MC 2M51A 3RNJA 2O31A 5LJ5e 1X75C 2DZ9A 4OMFB 1B34A 4GBQA 1TU0B 1O75A 3X26B 2NWMA 3S3NA 4JZ3A 4KH0B 2HD0A 3ER0A 1TTHB 3CPWA 3VRYA 2O9VA 2X3WD 4JPBW 2RQRA 2D9TA 2H8HA 2DD4A 4MMKA 4KH1B 2CSIA 3M0PA 4KUIA 4KGVB 2OJ2A 1WHKA 1MV3A 1VA7A 3VS0A 3OYIA 4OP0A 3RESA 2M1HA 4ZTJA 5ECAA 1YI2T 3ME9A 1FWZA 5C6SA 3KFVA 2P0QA 4MDWA 3RKXA 2YUQA 4RTWA 5LJ3f 2CSQA 2V1RA 2CP6A 1ABQA 4LDVA 4ZGEB 2DE0X 2LDMA 2ZAEA 2DKGA 5D6YA 3BFMA 4R55A 1QVFP 4B9WA 2GTOA 3EAEA 4JZ4A 5GANj 5HK3A 3EG9B 2LT4A 2BZ8A 2X4JA 1WJSA 1K0XA 1KQ1A 2DA9A 1AZEA 3BDLA 5GAOl 2YRCA 1JRIA 2AKLA 4LN2A 2EFIA 3OYNA 2RI3A 1M8VA 3HL8A 2RMOA 5A0GA 4M7DE 3HTRA 1YI2A 1U8RA 2FPEA 3GF5A 3V8JA 3VU3C 1C1AA 1YJWT 1MMDA 2HZYA 2PVOB 2BUDA 1BCMA 1IGUA 1W6XA 1H641 1X6GA 3VS2A 3JCMc 2K5IA 4LUDA 1FMWA 4BB7A 2EYZA 4P5NA 1OV3A 2F69A 1YI2Q 1Q86R 4OGEA 1X01A 4E7HA 1PC0A 3CC7T 4PJOF 2JMCA 5KE3A 1QVGS 2DM1A 3PNWC 1WGSA 2KXCA 1SPKA 2V8KA 4JJCA 3AT1B 2C0IA 2YLBA 3EH2A 1Q86C 5C0MA 3CCMT 2YLCA 1NYGA 3LGLA 1V76A 4ZN3A 3SHWA 4NS5A 1K1ZA 2CKKA 5LL6S 4EPCA 2X4WA 4FL6A 5I2SA 2G6FX 2RHZA 2QQSA 2XU8A 2A7YA 4ANJA 4WTOB 3QXEB 3QBYA 4M78C 1G3YA 5KCHA 1NG2A 1UJYA 5GAN5 4C92G 2LMJA 2YSQA 4M7DF 5FU7C 5CKEA 1QKXA 4F7UB 2CUDA 4XTZA 3M0RA 1YJWQ 4HT8A 2EGAA 2DIGA 1XJWB 1G3SA 4RTXA 3CC7A 4PJNA 3A5ZB 5CAIA 1SSHA 1AWWA 1Z9ZA 5GAOp 1BB9A 3X20B 5LJ3h 2JZ2A 1UHCA 1NE8A 4J9DA 5A0LA 3CXCP 3CCMA 2LCCA 2HSPA 3X25B 5HCKA 2CH4A 1LNXA 4PFPA 3CC7Q 5GAN6 2WSFE 2MF2A 3THKA 2LP5A 4BE0A 3P8HA 4M77F 2FEIA 1QCFA 2HNIA 4QQDA 1QKWA 1JB0E 3CCMQ 1WJRA 2DXTA 2FYKA 3JCMQ 1QP3A 3M4GA 2ED0A 4PJLA 3R6NA 1WA7A 1DJ7B 2DRKA 2ESWA 2RPNA 1VOMA 3FC3A 5GAMd 1KFZA 1W70A 2Y4YA 3EG0A 1M1GA 4C8QG 1X6BA 4C0GA 4BY6C 2RJEA 2COYA 3M0QA 2Y4XA 1KSWA 1VQ9T 2CS7A 3GNGA 1X2KA 1YFNA 3CPWP 2K5LA 3L2VA 3LH5A 3EG1A 4M7AD 2RJFA 1R8OB 2PZ1A 2DXCA 2HQHA 2M9UA 2HBPA 1Y96A 2KGTA 3UA7A 3CCSA 1IO6A 1WPYA 1KHIA 3GPLA 1S1NA 1IRXA 2XKOC 2E6NA 2NUPB 1YP5A 4JDSA 5D6XA 2FRYA 2V1QA 1N8RR 3CCLT 1WX6A 1M3CA 4RUGA 4J6YA 2LZ6B 3MHXA 2WACA 1SRMA 4J9IA 1VQ9A 1N8RC 2HBWA 2ABLA 3HHTB 1VIFA 2FPDA 4HA8A 3JCMg 3VS3A 2EKOA 2YHTA 3DB3A 1K8AU 3OYDA 5GAN4 3J81E 2GGRA 4O6JA 1K9MU 1IXDA 2KK4A 1BI1A 4PFZA 4M75A 4KRTA 5KYNA 1GBQA 4ESRA 1UHFA 2XK0A 3M59A 3ZBDA 4M7AE 1GRIA 1KQSA 5GAOq 2BE7D 1VQ9Q 5GAMf 1HK9A 4RKUE 4DOWA 4NL3A 2L0AA 3QZ5B 5HKCA 2DO3A 4BUGA 4M75C 1KC8U 4JLGA 2DERA 2RQVA 1F1BB 3TREA 5FROA 1TSFA 1BIBA 3CCLQ 1SHFA 2DTOA 5IHIA 3JCMJ 4PLIA 5EC7A 1WYXA 3FJPA 2EYXA 1BCOA 2AZSA 3RMSA 2ZPGB 2KRMA 2O2OA 3C4SA 2DL5A 3NTKA 2YXYA 4LD9K 4R56A 3NFCA 4FU6A 1QVPA 2LNVA 2J05A 1ZUUA 4QKUA 4HVWA 2QASA 5CKBA 3EGDB 4OMLA 2L2PA 3EFOB 2QQRA 3RUXA 4M7AF 4D6WA 3MJXA 2F2XA 1TUCA 1IZ6A 4PJMA 2I0NA 3JCMV 3JB9G 5LJ3j 3CCUT 3GBQA 4OB1B 3OYLA 4J9EA 3OW2S 1M2VB 3EGUA 4L59A 2KYMA 1Q7YU 5LJ5d 1G8XA 2E10A 2JUFA 1X27A 1AWJA 5GAN8 2ZPBB 4YTLA 3JCMP 3NGPA 1WJQA 1PSFA 4IUUA 2DJZA 4Z8AA 4TVRA 2W0ZA 2VXEA 4C5IA 2RK1A 4M78B 1AEYA 3OBWA 5I2MA 1OU9A 4F04B 3RKYA 2YUOA 5FU7B 3IQLA 4FW2A 3NTIA 2PTKA 2Z0WA 1M27C 1Y7XA 1QVFA 1YN8A 2YUPA 3HRTA 5J26A 3OYKA 1M5Q1 2YDLA 4J9GA 4QT7A 1M8MA 4QVZA 1UGSB 4E47A 2KBTA 1UEBA 2ZGWA 4A54A 4OMOA 2HKQB 4ELZC 2PUOB 2VV5A 5FLXE 4DA4A 2F2WA 1Z9QA 3JCMX 1H3ZA 4A4HA 4Z88A 2QGFB 2EVRA 3RKWA 2G3RA 4JUVA 4X34A 2K57A 2FG0A 4M78G 4OMMA 2ROTA 4IKFA 2GBQA 4HVUA 3H8ZA 1QP2A 1I1JA 2VUBA 4JS5A 1JJ2S 3I5SA 3QPHA 2NUTA 4MDXA 3EGXA 5LJ5f 2M02A 2QDLA 4Q5WA 5GJWB 3MP8A 1SF9A 2MYSA 4EMHA 2FB7A 5GMKm 3QDRB 1GBRA 4BY6B 3CEYA 2RA2A 1K76A 2SEMA 4C8QC 3LLRA 1GCPA 2JM8A 1VQ4T 4GY5A 2LX7A 2DX1A 1UUEA 1OU8A 3SWNA 4C0DC 1W2BP 4N4IA 2A28A 2EQKA 4UC4A 1Q82U 4XK8E 1UGVA 1VQ6A 2KT1A 1KQSP 2FPFA 2D0QB 3H0IA 3QIIA 1T0JA 5IXBA 1PHTA 3FDRA 3TEEA 3RMQA 2IIMA 1Y96B 4J7IA 4F7UE 2DIQA 3P8BB 2VKNA 2JS2A 4B9XA 1JO8A 3VUZA 2X4XA 4EMKC 2KSSA 1VIEA 3OMGA 1U1TA 1T0HA 3DKMA 1VQ4A 2VASA 2RB6A 1JQQA 4IIOA 1QVFS 3G1JA 4BDZA 2ZCFB 4ZN1A 3QJ6A 1K8AR 3PTAA 3LH0A 2EGEA 4OMQA 4FM4B 2DBMA 4AFSC
chains in the Genus database with same CATH topology
2MWOA 5GAMh 3CD6T 3PNWC 2LVMA 4PJOD 1WGSA 2V8KA 4MMLA 2D6FA 2YLBA 4JJNK 4PJOA 3Q1JA 2XDPA 1Q86C 5C0MA 5FU6B 2R5MA 4BI4A 2L3RA 2YLCA 1NPRA 3GLXA 4C0ZA 5CK9A 3CCMT 1QW1A 1ZQ1A 1OYXA 3LGLA 2O4XB 4FT2A 2ZPHB 1YJNT 5D6WA 3H6ZA 4ZN3A 4FIBA 3G6ET 4E7JA 4NS5A 1K8AC 1VQKA 2CKKA 5LL6S 4M75B 2XDBA 2FVUA 4EPCA 3CC4T 2KMTA 2LRQA 2X4WA 3MEWA 4FL6A 1FX7A 5GANe 5I2SA 1LJOA 1LOJA 2QQSA 2RHZA 1OI1A 2A7YA 2XU8A 2E70A 3QXEB 2ZPFB 3QBYA 4M75D 4M78C 1G3WA 1KHCA 3MEAA 1W4SA 2CZ7B 1G3YA 5KCHA 1M1KC 2C06A 5GAN5 4C92G 3WVDB 4EDUA 2DXUA 5A2QE 4M7DB 2GFUA 4HT9A 3GOXA 4M7DF 2LQ8A 4A4EA 2CYZB 5FU7C 2IVWA 3LYIA 3JCMW 1YCYA 5LJ5h 3G71A 5CKEA 2JOYA 4IUTA 4F7UB 4M7DD 4XTZA 4IUVA 4F7UF 1GXIE 4HT8A 2NLUA 3I56A 3OSSC 1M4ZA 2DIGA 1G3SA 2V8IA 4IUPA 4XU0A 3CC7A 4M7DA 3BW1A 1Y71A 3A5ZB 3E19A 4FT4A 4IUQA 5CAIA 1VQ6T 1D3BB 4NL2A 4PJOG 2QA4A 3CCLA 5GAOp 3CD6A 2WSEE 1S72T 2M0OA 3X20B 5LJ3h 4F7UA 4C92E 2JZ2A 4A53A 2K3YA 1NE8A 1JBMA 5A0LA 1WQWA 1N9SA 3CCMA 3DLLA 1KC8C 5GAMg 2JTFA 1D3BA 4LDWA 5GANf 3QZ9B 3CBMA 3CC2T 2LCCA 3OB9A 1YJNA 4N0AA 3G6EA 2HQEA 3CBOA 4J7FA 3V8LA 3X25B 3OYGA 3L42A 3A8MB 3SFMA 1LNXA 4N4HA 3CC4A 3GIBA 3S6WA 4PJOE 2DZCA 1XTDA 2EAYA 3BDUA 2WSFE 5GAN6 4M75G 2MF2A 3CBPA 4BE0A 4M77B 4ZGJB 3P8HA 4M77F 2EYQA 5GAN3 2HNIA 5J3BA 4BACA 1OZ3A 4QQDA 4M77D 3L2UA 2L5QA 3ZEHA 1JB0E 3BY7A 3WVEB 4C5GA 3CCVA 3JRZA 1WJRA 2DXTA 4M77A 2FYKA 3JCMQ 5GMKj 3GNFB 3A8HB 1QP3A 3M4GA 4E7KA 4HCBA 4OF1A 3VKIA 2R58A 2QTXA 2PUKB 3PT9A 1JJ2A 4M75E 4QQGA 1DJ7B 4KT0E 4N0AC 2LC4A 3MP6A 1S72A 5IT9E 3M9QA 2WSCE 3FC3A 1M1FA 5GAMd 4C5EA 3CXCS 1BI2A 4RMOA 3QKJA 1VQ7A 2QXFA 3OYEA 2Y4YA 2CZ0B 4OB3B 1M1GA 1I5LA 4C8QG 2LCLA 5LJ3g 1KD1U 3CC2A 5AYFA 3FLGA 2MI6A 4C0GA 3JCMh 4BY6C 5GAOm 1BI3A 4M7AB 2RJEA 1NJIC 2I2LA 3CMAT 3EFRA 1VQKT 2KAFA 2X35A 2Y4XA 4JRPA 1VQ9T 1VQPT 3V7SA 2CS7A 3GNGA 3PMTA 3PFSA 3VYHB 3KXTA 2K5LA 3L2VA 4KUDK 4M7AD 1G5VA 3SWNC 3QUIA 2RJFA 1R8OB 3LWHA 2DXCA 2RHYA 3A8GB 3URGA 2P0PA 4C92B 2DEQA 2V8JA 5CQXA 4C92F 2M9UA 2HBPA 1Y96A 1M9SA 2GF7A 4M77G 1Q7YC 4C8QE 1WNLA 2OAUA 2QQAA 1EIFA 4C0FA 3CCSA 1WPYA 2CZ6B 4C92D 4J6XA 3INZA 3OY9A 2ZZDA 5IN1A 1KHIA 3GPLA 3M55A 3OYBA 3NTHA 4PL6A 4QW2A 1UGRB 4C92A 4JS4A 2XKOC 2E6NA 2EJGA 1VQOA 4KULA 2CGHA 4RG8A 3I56T 1N6AA 4JDSA 4PLLA 4EMGA 3UPUA 3PGGA 5D6XA 2XI9A 4X9CA 3CCLT 4BE1A 2QA4T 3MEUA 4M77E 4KBMB 2RH2A 4J8OA 4II1A 2RHIA 2XICA 2RI2A 2AHJB 2ZPEB 3S3OA 2BKDN 1BI0A 4J6YA 5GAMe 1PSEA 2Y90A 3MHXA 2DVEA 3JB9I 3CCQT 3G7ZA 1P92A 2WACA 4A4FA 1U1SA 4V2SA 4ZGDB 3CMAA 3LW5E 4QQ6A 1Q86U 4GLKA 1VQPA 4VUBA 4BD3A 4ZTFA 3J80E 3CPWS 3HFNA 1VQ9A 3F70A 1YJ9T 1N8RC 4M7AG 4HA8A 3HHTB 1VIFA 4M75F 3JCMg 2EKOA 1BKBA 2YHTA 3DB3A 3M56A 4C92C 1K8AU 3OYDA 5GAN4 3I55T 3CCUA 5GMKe 3J81E 1VQ5A 4O6JA 1K9MU 2O4XA 1SSFA 2KK4A 1BI1A 4A4KA 4HCZA 5CO7A 4M75A 4OGCA 1HXDA 1RI0A 2E12A 4C5HA 5GAOr 2DAQA 3RIRA 2XDDA 3LX7A 3O8VA 1Q81C 2FHDA 2XK0A 3CCJT 3CCVT 3M59A 4RCBA 3C95A 3PMIA 3ZBDA 4M7AE 1KQSA 4PJOC 2XG8D 5GANh 5GAOq 1QVGA 5CIUA 3SD4A 4CRIA 2RK2A 5GAMf 1HK9A 2LTOA 3QYHB 4RKUE 4XU3A 3MO8A 4DOWA 4NL3A 3ZFJA 3X28B 3OYMA 3QZ5B 3VYGA 4C8QB 4C8QF 3OYHA 3OS0A 5FU6C 2PVGB 3PIOA 3META 1VQ7T 5HKCA 1XQHA 3CCQA 2QDYB 4C8QD 2DO3A 4JLIA 3QJYA 2VGMA 4XTWA 4XTVA 2EJFA 4BUGA 1AHJB 2HQXA 4JRIA 3JCMd 3M53A 4M75C 4C0DB 1BIAA 4JLGA 4C8QA 1YHQT 2E41A 4E7IA 5EG2A 1YJ9A 1KC8U 3JB9F 1QVGS 5CR2A 3TREA 5FROA 1YIJT 5GMKl 5GAMj 2JVVA 2QQBA 3I55A 1BIBA 2E1HA 3CPFA 3MP1A 3LWIA 3JB9D 2E64A 2XD0A 2DTOA 3FB9A 3JCMJ 3HPWA 4M7DC 4PLIA 3KBGA 3CCST 3GP8A 3FJPA 3CCJA 1VQNA 3HP9A 4DOVA 2QEXT 2K4YA 2K3XA 5CKHA 2JNGA 4PNOA 1VQOT 2RD1A 4XQ3A 3RMSA 2OTLT 2ZPGB 3AHUA 5LJ5g 3C4SA 3HFOA 3NTKA 2LT1A 4LD9K 4MZTA 2GQVA 2XIDA 1G3TA 3LGFA 4EMKB 5GANg 4R56A 3NFCA 2VXFA 3OSVA 4LDYA 4FU6A 3FEOA 4PKCC 1QVPA 2LNVA 4OB2B 1VQ8T 5LJ5j 3QHSA 1VQLT 5DLQE 1MHNA 2E5QA 2MMPA 5CKBA 1Q82C 4EMKA 4BE2A 2QQRA 2DTIA 3ASKA 3RUXA 4M7AF 1YHQA 2L89A 1N9RA 4D6WA 2RI5A 3M54A 3R6OA 3FRNA 3JCMe 3L2WA 1IZ6A 1ZHIA 2DD5A 2RHXA 1YIJA 3JCMV 4M77C 3JB9G 1YITT 5L8RE 5LJ3j 1NJIU 1M90U 4E7LA 2QQ9A 3VUBA 3CCUT 2EQJA 1VUBA 2DK3A 4M7AA 1VQ5T 4LD6A 4OB1B 3T9NA 1NZ9A 2KQWA 3E9GA 4XU2A 5I21A 3OYLA 2EJ9A 3UT1A 4RCCA 3OW2S 3EFSA 3V7RA 3JB9H 1VQMA 2M16A 3KUFA 2PQWA 4MZPA 4L59A 5GAN2 2BIVA 1Q7YU 4CI0C 2QEXA 5LJ5d 2PVDB 3VV0A 3X24B 2OTLA 2QI2A 5CKDA 5M9OA 2E10A 2JUFA 5J39A 5GAN8 2ZPBB 5DLOA 3QO3A 1K73C 4YTLA 5FRNA 4LDUA 3JCMP 3CCEA 1I4K1 4BDYA 1WJQA 1PSFA 2KY9A 4N4GA 4IUUA 1Y07A 2LX9A 4OB0B 2RHUA 5GAN7 3CXCA 5CCAA 2B8AA 1NPPA 2DJZA 1MGQA 3M5AA 2XHCA 4IURA 4TVRA 2RJDA 3C12A 5LJ3d 2VXEA 1VQ8A 3M4YA 5CQYA 2RK1A 4M78B 4C5IA 2O01E 4DQ2A 4M78F 3JCMf 3OBWA 5GMKi 1I8FA 5I2MA 1VQLA 5DM7R 2IG0A 4M7AC 2A3LA 3RKYA 4ATOA 1TH7A 3SDZA 2KDSA 3OBYA 4M78D 5FU7B 4BI8B 1BYMA 3OYJA 3JCMb 3HRSA 2F5TX 3NTIA 1OZ2A 4M78A 2JTMA 2R5AA 3DLMA 3E1SA 2EQUA 1YITA 2EQMA 3OYYA 4RG2A 1Y7XA 3DB4A 3S3MA 1QVFA 2OTJA 1N8RU 2L8DA 4J83A 3L2RA 3HRTA 4XTXA 5J26A 1M5Q1 3OYKA 1W2BA 3JSCA 1B34B 3N5BB 3C94A 3SB2A 3UWNA 3OYCA 3QYGB 3RERA 1XOVA 1VQNT 3TCJA 1M1KU 4QVZA 1UGSB 4Y28E 4E47A 1YJWA 2HAXA 1UEBA 2ZGWA 1UGPB 4A54A 3QSUA 4Z02A 1K9MC 4ELZC 5GMKh 1Q81U 5LJ5e 5CKFA 1X75C 2DZ9A 2PUOB 1B34A 2VV5A 3HRUA 4HKEA 4OMFB 5DY9A 5FLXE 5KE2A 4LDXA 1O75A 2KVQG 3X26B 4DA4A 3OQ5A 2VYTA 5KCOA 2GCXA 4JRQA 2P0KA 3JCMX 1H3ZA 3S3NA 4A4HA 3J7AF 2K5FA 2VGNA 3RKWA 1O9SA 2G3RA 4JUVA 3M57A 2K57A 4X34A 2HD0A 3ER0A 3PIPA 5LJ3e 3FIFA 2EIFA 4M78G 3HKSA 1FXXA 3CPWA 3OS5A 4NOYA 4IKFA 2D9TA 5IAYA 3OYAA 2DD4A 3H8ZA 1QP2A 4MMKA 3L1AA 4WF2A 1RL2A 3WXMB 2FL7A 2VUBA 4KUIA 2VC8A 4JS5A 1JJ2S 3QPHA 3OYIA 4OP0A 2GFAA 2EWNA 4MDXA 1ZBXA 4MZMA 1UB4A 3RESA 4M78E 2DPPB 4Q5WA 5LJ5f 3MP8A 3V7CA 1VQMT 1WQ7A 2K2VA 2M1HA 4EMHA 4ZTJA 2FB7A 5GMKm 1YI2T 3MCAB 3ME9A 3QDRB 4A4GA 1IREB 1FWZA 5CVIA 5C6SA 2P0QA 4X9DA 4BY6B 3CEYA 2RA2A 4MDWA 3RKXA 3G4ST 2RM4A 3A8LB 3JB9J 5LJ3f 3CCET 5KH6A 3OS2A 5HY6A 3SWNB 4C8QC 3LLRA 5FRMA 1N27A 4LDVA 4ZGEB 2LDMA 5HK0A 3OS1A 1VQ4T 4GY5A 3TU4K 1KQ2A 2DKGA 1YBYA 5D6YA 3BFMA 4L6V5 4R55A 1I81A 3QG1A 4B9WA 4XTUA 5GAOn 4M7DG 3CMET 3EAEA 5GANj 2MWPA 3SWNA 4C0DC 5HK3A 4XAXB 2DTHA 4N4IA 4QVCA 4FSXA 3M58A 2LT4A 3CCRT 2X4JA 2E6ZA 1WJSA 2EQKA 3OYFA 1KQ1A 4UC4A 4F7UG 1Q82U 3P8DA 2MAMA 3BDLA 4XK8E 1KG1A 5A0DA 1VQ6A 3OMCA 2F5KA 5GAOl 1V29B 1JRIA 3V8KA 4J5YA 2D0QB 2E65A 1KD1C 2EFIA 1X6OA 2OTJT 2P4TA 3QIIA 2RI3A 3OYNA 1M8VA 3HL8A 4ME7A 2R57A 3JAME 5A0GA 2CZ1B 4M7DE 2PU9B 3FDRA 4XU1A 3TEEA 3RMQA 1YI2A 1U8RA 3VJPA 2JN0A 3GF5A 3MEVA 3V8JA 3VU3C 1M90C 1Y96B 4ELYC 4J7IA 4F7UE 2DIQA 4XTYA 3P8BB 3G4SA 1YJWT 4B9XA 2PVOB 3UDCA 5GANd 2X4YA 3VUZA 3L2QA 2X4XA 2BUDA 4Y91A 2KSSA 4EMKC 4JRKA 3A8OB 2H3JA 2RJCA 1VIEA 3E9FA 1H641 4O5VA 3OMGA 1U1TA 3DKMA 3L2ZA 1K73U 2YRVA 4BI3A 3JCMc 2K5IA 1VQ4A 2RB6A 3HSBA 4J6WA 4BB7A 3OA6A 1QVFS 4P5NA 3CMEA 2DXBA 1W2BS 4OVAA 2F69A 2ZPIB 4OGEA 4QVDA 3G71T 4BDZA 2ZCFB 1X01A 4ZN1A 3CCRA 1UGQB 4E7HA 3QJ6A 4L5GA 4PJOB 3CC7T 4PJOF 3PTAA 1XNIA 5KE3A 1KQSS 3LH0A 2LQKA 4HCCA 4FM4B 3OW2A 2RO0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GAM h;  5LJ3 e;  4M7A D;  4PJO D;  3FIF A;  3AHU A;  4PNO A;  3QUI A;  4M78 G;  2RD1 A;  4XQ3 A;  3SWN C;  4MML A;  4NOY A;  2YLB A;  4PJO A;  4C92 B;  5LJ5 g;  2DEQ A;  4C92 F;  1Y96 A;  2YLC A;  3HFO A;  4M77 G;  5GAN g;  4C8Q E;  4MMK A;  4WF2 A;  1WNL A;  3L1A A;  4EMK B;  2VXF A;  1WPY A;  4C92 D;  4J6X A;  3INZ A;  2VC8 A;  4M75 B;  4C92 A;  5LJ5 j;  3QHS A;  2EJG A;  4OP0 A;  2CGH A;  2EWN A;  5GAN e;  1LJO A;  1LOJ A;  4EMK A;  5LJ5 f;  3RES A;  4M78 E;  4EMG A;  4M75 D;  3PGG A;  3RUX A;  2DTI A;  4M78 C;  3V7C A;  4M7A F;  1WQ7 A;  1N9R A;  4EMH A;  5GAN 5;  4X9C A;  2FB7 A;  4C92 G;  5GMK m;  2DXU A;  3JCM e;  4M7D B;  4M77 E;  4HT9 A;  4M7D F;  3JCM V;  4M77 C;  3JB9 G;  4X9D A;  5LJ3 j;  2RA2 A;  3RKX A;  3JCM W;  1YCY A;  5LJ5 h;  2RM4 A;  4M7A A;  4J6Y A;  4F7U B;  5GAM e;  3JB9 J;  4XTZ A;  5LJ3 f;  4F7U F;  4M7D D;  2Y90 A;  3JB9 I;  2DVE A;  4XU2 A;  5I21 A;  4HT8 A;  2EJ9 A;  4RCC A;  4XU0 A;  3SWN B;  3EFS A;  1U1S A;  3V7R A;  4C8Q C;  3JB9 H;  4M7D A;  3BW1 A;  5CAI A;  4V2S A;  1D3B B;  4NL2 A;  4PJO G;  3HFN A;  5GAN 2;  4M7A G;  5GAO p;  4HA8 A;  3JCM g;  1KQ2 A;  4M75 F;  2DKG A;  5LJ3 h;  4F7U A;  4C92 E;  3BFM A;  5LJ5 d;  2YHT A;  1I81 A;  4C92 C;  2E10 A;  4XTU A;  5GAN 8;  4A53 A;  5GAN 4;  5GAO n;  5GMK e;  3QO3 A;  5GAN j;  1JBM A;  4M7D G;  3SWN A;  1WQW A;  3JCM P;  1N9S A;  1I4K 1;  2DTH A;  5GAM g;  4QVC A;  5GAN 7;  1D3B A;  5GAN f;  1KQ1 A;  4M75 A;  1HXD A;  4F7U G;  2DJZ A;  1MGQ A;  4N0A A;  5GAO r;  3RIR A;  3V8L A;  5LJ3 d;  5GAO l;  2VXE A;  1JRI A;  4DQ2 A;  4M78 B;  4J5Y A;  1LNX A;  3V8K A;  4M78 F;  3JCM f;  5GMK i;  2E65 A;  1I8F A;  4RCB A;  3GIB A;  4PJO E;  4M7A E;  1M8V A;  2DZC A;  4PJO C;  2EAY A;  5GAN 6;  3BDU A;  5GAN h;  4M7A C;  4M75 G;  3RKY A;  1TH7 A;  5GAO q;  4M77 B;  4M78 D;  4M77 F;  4M7D E;  5GAM f;  3JCM b;  5GAN 3;  2HNI A;  1HK9 A;  4XU1 A;  4M78 A;  2JN0 A;  4XU3 A;  3V8J A;  4NL3 A;  4M77 D;  3VU3 C;  1Y96 B;  3BY7 A;  4F7U E;  4C8Q B;  4XTY A;  4C8Q F;  2DXT A;  4M77 A;  2FYK A;  5GAN d;  3JCM Q;  5GMK j;  4EMK C;  4Y91 A;  3M4G A;  4JRK A;  4XTX A;  1M5Q 1;  4C8Q D;  4JLI A;  2QTX A;  4XTW A;  1H64 1;  1U1T A;  1B34 B;  4XTV A;  2EJF A;  3L2Z A;  4JRI A;  4M75 E;  3SB2 A;  3JCM d;  4M75 C;  3JCM c;  1BIA A;  4C8Q A;  2RB6 A;  4N0A C;  2E41 A;  3RER A;  3JB9 F;  3HSB A;  4J6W A;  2ZGW A;  4A54 A;  5GMK l;  5GAM j;  5GAM d;  3QSU A;  5GMK h;  1BIB A;  2E1H A;  3JB9 D;  5LJ5 e;  2DZ9 A;  2E64 A;  1B34 A;  4QVD A;  5DY9 A;  1I5L A;  4C8Q G;  2DTO A;  3FB9 A;  5LJ3 g;  3JCM J;  1X01 A;  4M7D C;  3JCM h;  3JCM X;  5GAO m;  4PJO B;  4M7A B;  4PJO F;  2I2L A;  3EFR A;  3FJP A;  3RKW A;  4JUV A;  3V7S A;  2K57 A; 
#chains in the Genus database with same CATH topology
 3CD6 T;  4PJO D;  4MML A;  1VQ4 Q;  4JJN K;  4PJO A;  3Q1J A;  1ZSZ C;  4C0Z A;  2R5M A;  5CK9 A;  2DRM A;  1NPR A;  5AT1 B;  1M1K R;  1K8A C;  2QG9 B;  5FW9 A;  2X3X D;  4M75 B;  1WIE A;  2XDB A;  2FVU A;  2KMT A;  1UE9 A;  1FX7 A;  4D8D A;  2KXD A;  1ARK A;  1LJO A;  1RAD B;  3A98 A;  1G3W A;  3MEA A;  3EG3 A;  1M1K C;  2DXU A;  5A2Q E;  2LQ8 A;  2CYZ B;  3JCM W;  1WXB A;  5LJ5 h;  2JOY A;  1KC8 R;  4IUT A;  4M7D D;  4F7U F;  2MPX C;  2NLU A;  3I56 A;  3OSS C;  2CH4 W;  2V8I A;  4XU0 A;  4M7D A;  4E2F B;  5KYX A;  4IUQ A;  2O9S A;  1HJD A;  2OI3 A;  4NL2 A;  5IXF A;  3CD6 A;  2WSE E;  2M0O A;  1U5S A;  3VS7 A;  1KC8 C;  5GAM g;  2JTF A;  1D3B A;  4LDW A;  1HD3 A;  3CBM A;  3OB9 A;  4N0A A;  5KYY B;  2KYB A;  3I56 Q;  4N4H A;  3S6W A;  4PJO E;  2EAY A;  4M75 G;  3CD6 Q;  3E2U A;  4BAC A;  1ACM B;  1CKB A;  5I11 A;  4M77 D;  3L2U A;  2EBP A;  2ROL A;  4M77 A;  3A8H B;  3VKI A;  2R58 A;  3QWX X;  4N0A C;  3UAT A;  2LC4 A;  3MP6 A;  2WSC E;  5KYW B;  1NM7 A;  1BI2 A;  4GLM A;  3QKJ A;  5L23 A;  3CXC S;  2QXF A;  1I5L A;  4OB3 B;  2LCL A;  1Q7Y R;  2LJ1 A;  4J9C A;  1AD5 A;  3JCM h;  5GAO m;  2C0T A;  1BI3 A;  4HCK A;  3CMA T;  3EFR A;  5D7U A;  4JRP A;  1WI7 A;  1QWF A;  1VQP T;  3VYH B;  1G5V A;  3A8G B;  1ZA2 B;  4C92 B;  4X1V A;  2DEQ A;  4E7S A;  1M9S A;  2GF7 A;  2LJ0 A;  5KYU B;  1Q7Y C;  4ZNX A;  1WNL A;  2QQA A;  1TUG B;  1GL5 A;  2EJG A;  1NBE B;  2K9G A;  3UPU A;  3PGG A;  2KRN A;  2D8J A;  2M0Y A;  3PVL A;  3VRZ A;  4M77 E;  3I5R A;  4KBM B;  3MKD A;  2RI2 A;  2AHJ B;  2Y90 A;  4DEX A;  3JB9 I;  3CCQ T;  4A4F A;  1U1S A;  3I9Q A;  3CMA A;  3LW5 E;  2IPO B;  1VQP A;  4VUB A;  2VVK A;  1KG1 A;  3J80 E;  3CPW S;  3F70 A;  2RQU A;  1BKB A;  1RAI B;  1C0M A;  5GMK e;  1VQ5 A;  1SKU B;  2AIR B;  4AMC A;  1M2O A;  1NEG A;  2YUN A;  4OGC A;  1HXD A;  4C5H A;  2XDD A;  3O8V A;  2FHD A;  4RCB A;  2HEQ A;  2K7A A;  2CUB A;  3PMI A;  3CMA Q;  1VQP Q;  2L3S A;  3SD4 A;  1M3B A;  4AFZ C;  1MUZ A;  2NUZ A;  1VQ5 Q;  3ZFJ A;  4C8Q B;  1NLO C;  4LE9 A;  3PIO A;  1K0S A;  4D8K A;  4KGX B;  1XQH A;  2JW4 A;  2X9H A;  3CCQ A;  3QJY A;  2HQX A;  4C0D B;  1BIA A;  1AZG B;  2LQW A;  3JB9 F;  3A1P A;  4OMP A;  1YIJ T;  1T3S A;  2JVV A;  2QQB A;  3CPF A;  2X51 A;  3MP1 A;  2E64 A;  2DJQ A;  2V26 A;  3VS5 A;  3CCS T;  1AWX A;  2RF0 A;  1W1F A;  3CCQ Q;  3HP9 A;  4DOV A;  4KGZ B;  4DBH A;  2PNI A;  4PNO A;  2OTL T;  4XQ3 A;  1Q82 R;  5LJ5 g;  3TQ7 P;  8ATC B;  2XID A;  4EMK B;  4PK4 A;  1H8K A;  3OSV A;  2OAW A;  4PKC C;  1MV0 B;  3H9N A;  2CDT A;  5LJ5 j;  3SEM A;  1VQL T;  2E5Q A;  2MMP A;  1Q82 C;  2FRW A;  3ASK A;  2L89 A;  2RI5 A;  3M54 A;  3FRN A;  3L2W A;  1YIJ A;  1NJI U;  1YIT T;  5L8R E;  2DL8 A;  2SRC A;  2EQJ A;  3NMZ C;  4M7A A;  2JT4 A;  1YWO A;  3E9G A;  1IGQ A;  2EJ9 A;  3EFS A;  3JB9 H;  1VQM A;  2M16 A;  2KI7 A;  3KUF A;  5GAN 2;  1ZSZ B;  2PVD B;  2OTL A;  2QI2 A;  1WHM A;  5CKD A;  5M9O A;  5J39 A;  5DLO A;  3QO3 A;  4LDU A;  3CCE A;  1I4K 1;  1YIJ Q;  4OB0 B;  1Y07 A;  2LX9 A;  2HSE B;  1HYO A;  1MGQ A;  3M5A A;  2RJD A;  3C12 A;  5CQY A;  1TUD A;  4M78 F;  1I8F A;  1VQL A;  3CCS Q;  5DM7 R;  2IG0 A;  4M7A C;  2A3L A;  3SDZ A;  3OBY A;  3HRS A;  2OTL Q;  2D0N A;  2JTM A;  1T3L A;  2EQU A;  1X69 A;  1YIT A;  2EYY A;  2EQM A;  3OYY A;  2P84 A;  4DBQ A;  1N5Z A;  2KE9 A;  2OTJ A;  3L2R A;  1W2B A;  4A63 B;  3JSC A;  1B34 B;  3N5B B;  3C94 A;  3UWN A;  1VQL Q;  2GNC A;  2BZY A;  4OMN A;  3RER A;  2ATC B;  1XOV A;  3C0C A;  4RTU A;  1M1K U;  4Y28 E;  3QSU A;  1Q81 U;  4HKE A;  1WHH A;  5KE2 A;  4LDX A;  1YIT Q;  3OQ5 A;  2VYT A;  5KCO A;  4JRQ A;  2BE9 B;  2P0K A;  1QLY A;  1YNZ A;  2OTJ Q;  2JTE A;  1O9S A;  1UDL A;  1EZZ B;  2DEU A;  2VWF A;  3FIF A;  2EIF A;  3HKS A;  4NOY A;  3I35 A;  1D0Z A;  1G2B A;  4FYW B;  3L1A A;  1ZUK A;  4AFU C;  1UJ0 A;  2FL7 A;  2GFA A;  2EWN A;  1C6V X;  1ZBX A;  4MZM A;  2D1X A;  2DPP B;  1GFD A;  2K2V A;  3H0H A;  1PKT A;  4A4G A;  1X43 A;  5CVI A;  3MPU B;  2RM4 A;  2HMA A;  3A8L B;  2AK5 A;  4AG1 C;  5FRM A;  5HK0 A;  3TU4 K;  3U23 A;  1YBY A;  3EG2 A;  7AT1 B;  4M7D G;  3CME T;  1I0C A;  2MWP A;  1K9A A;  3VS1 A;  4XAX B;  2DTH A;  3CCR T;  2E6Z A;  3OYF A;  3P8D A;  2MAM A;  2MOX A;  5IHK A;  3OMC A;  2F5K A;  1V29 B;  2YWW A;  4IIM A;  1ZSG A;  1BK2 A;  3EG9 A;  2P4T A;  4FYY B;  1ZUY A;  2LCS A;  1PKS A;  3JAM E;  2MIO A;  2PU9 B;  1AOJ A;  2JN0 A;  1M90 C;  2QK0 A;  4ELY C;  4XTY A;  4F17 A;  1UG1 A;  2X4Y A;  3L2Q A;  4Y91 A;  1EX4 A;  2RJC A;  3TSZ A;  3L2Z A;  4BI3 A;  1RAH B;  3OA6 A;  4F16 A;  3RBB B;  3CME A;  2DXB A;  1W2B S;  4OVA A;  3G71 T;  3CCR A;  1UGQ B;  4L5G A;  1UTI A;  1XNI A;  1KQS S;  4J9F A;  2LQK A;  5GAM h;  2D8H A;  2LVM A;  3M0S A;  1RAF B;  2COZ A;  2XDP A;  4BI4 A;  2L3R A;  1LPL A;  1ZQ1 A;  1OYX A;  2LJ3 A;  3CME Q;  4FT2 A;  1YJN T;  5D6W A;  3G6E T;  4E7J A;  4FIB A;  1VQK A;  1MNE A;  3CCR Q;  1WLP B;  3MEW A;  1AVZ C;  5GAN e;  1LOJ A;  1OI1 A;  2ZPF B;  2KNB B;  2C06 A;  1W4S A;  2HDA A;  3WVD B;  1RI9 A;  2EW3 A;  3EHQ A;  1RLQ C;  4HT9 A;  4A4E A;  3BE3 A;  2EQI A;  3LYI A;  1YCY A;  3G71 A;  1GXI E;  3RDV A;  1I5O B;  3E19 A;  1Y71 A;  4FT4 A;  1VQ6 T;  2J6K A;  3CQT A;  2QA4 A;  2DYI A;  4F7U A;  4C92 E;  9ATC B;  1U06 A;  2K3Y A;  1QCO A;  2EGC A;  2LQN A;  2CP7 A;  3QZ9 B;  1YJN A;  3G6E A;  3G71 Q;  3V8L A;  1SEM A;  3L42 A;  3A8M B;  1GCQ A;  4FCY A;  3GIB A;  2DZC A;  3BDU A;  1H3H A;  3CBP A;  4ZGJ B;  2QA4 Q;  2EYQ A;  1OQK A;  5GAN 3;  2JJ9 A;  3RR6 A;  2L5Q A;  3WVE B;  3CCV A;  2AZV A;  4F14 A;  1YJN Q;  3G6E Q;  4HCB A;  4OF1 A;  2QTX A;  1NJI R;  2KT8 A;  4QQG A;  3PE0 A;  4KT0 E;  3M9Q A;  1RAE B;  1ZX6 A;  2F1L A;  1Y57 A;  4RMO A;  2DL4 A;  1VQ7 A;  2ECZ A;  3JV3 A;  1KD1 U;  5AYF A;  1BBZ A;  3FLG A;  2MI6 A;  3CCV Q;  4M7A B;  1NJI C;  2I2L A;  3V7S A;  3KXT A;  3SWN C;  3QUI A;  3LWH A;  1VQ6 Q;  2P0P A;  2XMF A;  1FMV A;  2V8J A;  5CQX A;  4C92 F;  4C8Q E;  4C0F A;  2CZ6 B;  4J6X A;  2ZZD A;  4JJD A;  1PD0 A;  3OYB A;  4PL6 A;  1UGR B;  1R77 A;  1VQO A;  4KUL A;  2CGH A;  4RG8 A;  3I56 T;  4PLL A;  2DIL A;  2B86 A;  2XI9 A;  4BE1 A;  4II1 A;  2NUP A;  2KRO A;  2XIC A;  2ZPE B;  3S3O A;  2BKD N;  2DET A;  1PSE A;  2DVE A;  2YRD A;  3G7Z A;  4ZGD B;  1Q81 R;  4QQ6 A;  4GLK A;  4AT1 B;  2O88 A;  1VQO Q;  3HFN A;  4M7A G;  1YJ9 T;  2KR3 A;  2A36 A;  2O4X A;  1JJ2 P;  4HCZ A;  1RAB B;  4ORZ A;  5CO7 A;  5GAO r;  2OX7 A;  3RIR A;  1Q81 C;  3C95 A;  3UA6 A;  3NHN A;  4PJO C;  2XG8 D;  4E7Z A;  1IHV A;  1QVG A;  1MND A;  4CRI A;  2J7I A;  2LTO A;  3QYH B;  2VB6 A;  4XU3 A;  3MO8 A;  3X28 B;  3VYG A;  4FYV B;  4C8Q F;  4J9B A;  3OYH A;  5FU6 C;  2PVG B;  3MET A;  4DBR A;  2QDY B;  2QTV A;  3QDF A;  4JRI A;  1AT1 B;  3M53 A;  1QQJ A;  1YHQ T;  1YJ9 A;  5IHN A;  5EG2 A;  4E7I A;  1PD1 A;  5CR2 A;  1WHJ A;  5GAM j;  3JB9 D;  3LWI A;  2XD0 A;  2QYZ A;  3FB9 A;  4M7D C;  2FO0 A;  1ZA1 B;  3KBG A;  1E7O A;  1KJW A;  2NYS A;  1VQN A;  1A0N B;  4CC7 A;  2QEX T;  2K4Y A;  4K11 A;  2RD1 A;  1YJ9 Q;  1K4U S;  1JEG A;  1I07 A;  3HFO A;  2LT1 A;  5GAN g;  3LGF A;  1G3T A;  4PJJ A;  2VXF A;  4LDY A;  1B3Q A;  1SRL A;  1VQ8 T;  3EH1 A;  1MHN A;  1VQN Q;  1YHQ A;  1N9R A;  1GFC A;  4M4Z A;  4CC4 B;  3JCM e;  1ZHI A;  4M77 C;  1M90 U;  1OX9 A;  3EGD A;  2QQ9 A;  1VUB A;  2DK3 A;  1VQ5 T;  4LD6 A;  3T9N A;  1E6H A;  3EFO A;  1NEB A;  4LXC A;  4XU2 A;  1KIK A;  4RTY A;  3UT1 A;  4MZP A;  2BIV A;  4DEY A;  2QEX A;  2DL7 A;  3H0F A;  2H3E B;  1YHQ Q;  5FRN A;  4LNP A;  1M2V A;  4BDY A;  4N4G A;  5GAN 7;  2KY9 A;  3PVQ A;  1R0B G;  2B8A A;  1VYV A;  2XHC A;  1VQ8 A;  4DBF A;  1QWE A;  2O01 E;  2QAZ A;  1X2Q A;  3M0T A;  4ATO A;  4M78 D;  4BI8 B;  1BYM A;  3OYJ A;  2ENM A;  2QEX Q;  1OZ2 A;  4M78 A;  3E1S A;  2R5A A;  2F2V A;  2E3H A;  3DB4 A;  1OOT A;  3S3M A;  2L8D A;  4J83 A;  4XTX A;  1VQ8 Q;  8AT1 B;  4FSS A;  1D1C A;  4RTT A;  2FZK B;  1YJW A;  2HCK A;  4Z02 A;  2DFU A;  5GMK h;  5CKF A;  3HRU A;  5DY9 A;  2KVQ G;  2GCX A;  1ABO A;  3FJ5 A;  3J7A F;  2DLP A;  2K5F A;  2VGN A;  1IHW A;  3M57 A;  1U3O A;  2RN8 A;  3PIP A;  1R0C B;  1Y0M A;  5LJ3 e;  1UFF A;  1FXX A;  3OS5 A;  3NPF A;  2CT4 A;  3REA B;  2DYB A;  2NUT B;  5IAY A;  3OYA A;  3EGX B;  4WF2 A;  3VS4 A;  1RL2 A;  3WXM B;  4HVV A;  2VC8 A;  1WXT A;  1UB4 A;  4M78 E;  2BTT A;  3V7C A;  3QWY A;  1VQM T;  1WQ7 A;  1HSQ A;  2JS0 A;  3MCA B;  1Q95 G;  1IRE B;  2AT1 B;  4X9D A;  3G4S T;  2K6D A;  3REB B;  3JB9 J;  3CCE T;  5KH6 A;  3OS2 A;  5HY6 A;  3SWN B;  1G83 A;  1PG5 B;  1N27 A;  3OS1 A;  2GQI A;  2CP2 A;  1JU5 C;  1PCX A;  1KD1 R;  1KQ2 A;  4B6M A;  2DMO A;  2L3Q A;  1TWB A;  4L6V 5;  3VS6 A;  1I81 A;  3QG1 A;  1ZLM A;  4CC2 A;  4XTU A;  3TVT A;  5GAO n;  4QVC A;  4FSX A;  3M58 A;  1MMN A;  4F7U G;  5A0D A;  1RLP C;  2J6F A;  3V8K A;  4J5Y A;  2E65 A;  3ULR B;  1KD1 C;  1X6O A;  1QVG P;  2OTJ T;  4ME7 A;  2R57 A;  1TOV A;  2CZ1 B;  2W10 A;  4CC3 A;  4JJB A;  4XU1 A;  1OPK A;  4RTV A;  3MEV A;  3VJP A;  3G4S A;  3UDC A;  5GAN d;  1V1C A;  2RQW A;  4JRK A;  2K79 A;  2H3J A;  3A8O B;  1JXO A;  3E9F A;  4O5V A;  1FYN A;  2DVJ A;  1K73 U;  2YRV A;  1LCK A;  2E5K A;  3HSB A;  4J6W A;  1VQM Q;  2ZPI B;  4QVD A;  4E6R A;  1WHG A;  1UEC A;  3G4S Q;  4PJO B;  2JMA A;  3CCE Q;  4HCC A;  3OW2 A;  2RO0 A;  2MWO A;  1WDX A;  2D6F A;  5FU6 B;  3GLX A;  2YT6 A;  1QW1 A;  4AG2 C;  2FZC B;  2O4X B;  2ZPH B;  3H6Z A;  2DBK A;  3CC4 T;  4RTZ A;  2LRQ A;  4FW1 A;  1MMG A;  2E70 A;  4M75 D;  1NYF A;  1KHC A;  1BU1 A;  2CZ7 B;  4AFQ C;  4EDU A;  4M7D B;  2GFU A;  1RAA B;  3GOX A;  5KYX B;  2IVW A;  2L3P A;  2RNA A;  4IUV A;  1M4Z A;  4IUP A;  5IH2 A;  1YWP A;  3BW1 A;  1D3B B;  3CCL A;  4PJO G;  2FZG B;  1S72 T;  1ZBJ A;  4A53 A;  1JBM A;  1WQW A;  1N9S A;  3DLL A;  1OPL A;  3CC2 T;  5GAN f;  2HQE A;  3CBO A;  4J7F A;  3OYG A;  1WXU A;  3SFM A;  3CC4 A;  4HXJ A;  2E4H A;  1XTD A;  4Z89 A;  4M77 B;  1D1A A;  4Y92 A;  5KYY A;  5J3B A;  1OZ3 A;  3ZEH A;  3BY7 A;  4C5G A;  3JRZ A;  1B07 A;  1RAC B;  5GMK j;  3GNF B;  1PRL C;  4E7K A;  2PUK B;  1TS9 A;  3PT9 A;  3CC4 Q;  4M75 E;  1M90 R;  1JJ2 A;  3H41 A;  2EYW A;  1S72 A;  5IT9 E;  1WFW A;  1M1F A;  1D09 B;  4C5E A;  4R0K A;  3OYE A;  1CSK A;  1RAG B;  2CZ0 B;  5LJ3 g;  4EIK A;  3CC2 A;  2E3I A;  1D0Y A;  2J6O A;  2HL5 C;  1VQK T;  2KAF A;  2X35 A;  3TSW A;  5KYW A;  1B7T A;  3PMT A;  1SG5 A;  3PFS A;  1MMA A;  1JXM A;  4KUD K;  5FWC A;  4PFO A;  5GJV B;  2RHY A;  2K3B A;  3URG A;  2MCN A;  1QMC A;  1S72 Q;  2CRE A;  3O5Z A;  4M77 G;  2DF6 A;  1AWO A;  2OAU A;  1EIF A;  2RQT A;  4C92 D;  3INZ A;  3OY9 A;  5IN1 A;  3M55 A;  3CC2 Q;  3NTH A;  4QW2 A;  4C92 A;  4JS4 A;  1H92 A;  5KYU A;  2P4R A;  1N6A A;  4EMG A;  1NLP C;  3UF4 A;  1PWT A;  4X9C A;  2QA4 T;  3MEU A;  2J06 A;  2RH2 A;  4J8O A;  2RHI A;  1BI0 A;  5GAM e;  2JXB A;  1IB8 A;  1P92 A;  2C0O A;  4V2S A;  1Q86 U;  4BD3 A;  4ZTF A;  4M75 F;  4WCI A;  3M56 A;  4C92 C;  1M3A A;  3I55 T;  3CCU A;  1SSF A;  4A4K A;  1RI0 A;  2E12 A;  2DAQ A;  1OEB A;  3LX7 A;  4J9H A;  1EFN A;  3CCJ T;  3CCV T;  2EKH A;  1WZO A;  1VQK Q;  5GAN h;  5CIU A;  2CP5 A;  2RK2 A;  1TG0 A;  3CCU Q;  2BZX A;  3OYM A;  1YCS B;  2A0F B;  3OS0 A;  1KK7 A;  4FYX B;  1VQ7 T;  1PNJ A;  4C8Q D;  4JLI A;  4XTW A;  2VGM A;  4LUE A;  4XTV A;  2EJF A;  2LNH B;  1AHJ B;  3JCM d;  4E7L A;  4C8Q A;  2E41 A;  1VYU A;  5GMK l;  5FWB A;  3I55 A;  2E1H A;  2GTJ A;  3ZL7 C;  3HPW A;  1SHG A;  3OW2 P;  2ED1 A;  3GP8 A;  3CCJ A;  2K3X A;  5CKH A;  2JNG A;  3AHU A;  1VQO T;  1D1B A;  2DL3 A;  2A37 A;  6AT1 B;  3D7S B;  4MZT A;  2GQV A;  3I55 Q;  1PRM C;  1GCQ C;  1E6G A;  3FEO A;  2KRS A;  4OB2 B;  1CKA A;  2KEA A;  3QHS A;  2COW A;  5DLQ E;  2CP3 A;  3M0U A;  4EMK A;  1LVK A;  3CCJ Q;  4BE2 A;  2CP0 A;  2K2M A;  2DTI A;  3R6O A;  2DD5 A;  2RHX A;  2CT3 A;  1J3T A;  2JM9 A;  1D0X A;  1K73 R;  3VUB A;  1NZ9 A;  2KQW A;  5I21 A;  4RCC A;  3V7R A;  2AKK A;  1VQ7 Q;  2PQW A;  2DNU A;  1FMK A;  4CI0 C;  3VV0 A;  3X24 B;  1M30 A;  1K73 C;  2EPD A;  2RHU A;  1ZSZ A;  3CXC A;  5CCA A;  1NPP A;  4IUR A;  2QGG A;  5LJ3 d;  2HL3 A;  3M4Y A;  4DQ2 A;  5GMK i;  3JCM f;  1TH7 A;  1QCN A;  2KDS A;  2A08 A;  3JCM b;  1WHL A;  2F5T X;  5I22 A;  3DLM A;  1TXQ A;  2MK5 A;  1K9M R;  1RUW A;  4RG2 A;  1OUL A;  1PM3 A;  1N8R U;  3EHR A;  1VYT A;  3SB2 A;  3OYC A;  1OX8 A;  3QYG B;  1VQN T;  3TCJ A;  2HKN A;  2HAX A;  1UGP B;  1K9M C;  2M51 A;  3RNJ A;  2O31 A;  5LJ5 e;  1X75 C;  2DZ9 A;  4OMF B;  1B34 A;  4GBQ A;  1TU0 B;  1O75 A;  3X26 B;  2NWM A;  3S3N A;  4JZ3 A;  4KH0 B;  2HD0 A;  3ER0 A;  1TTH B;  3CPW A;  3VRY A;  2O9V A;  2X3W D;  4JPB W;  2RQR A;  2D9T A;  2H8H A;  2DD4 A;  4MMK A;  4KH1 B;  2CSI A;  3M0P A;  4KUI A;  4KGV B;  2OJ2 A;  1WHK A;  1MV3 A;  1VA7 A;  3VS0 A;  3OYI A;  4OP0 A;  3RES A;  2M1H A;  4ZTJ A;  5ECA A;  1YI2 T;  3ME9 A;  1FWZ A;  5C6S A;  3KFV A;  2P0Q A;  4MDW A;  3RKX A;  2YUQ A;  4RTW A;  5LJ3 f;  2CSQ A;  2V1R A;  2CP6 A;  1ABQ A;  4LDV A;  4ZGE B;  2DE0 X;  2LDM A;  2ZAE A;  2DKG A;  5D6Y A;  3BFM A;  4R55 A;  1QVF P;  4B9W A;  2GTO A;  3EAE A;  4JZ4 A;  5GAN j;  5HK3 A;  3EG9 B;  2LT4 A;  2BZ8 A;  2X4J A;  1WJS A;  1K0X A;  1KQ1 A;  2DA9 A;  1AZE A;  3BDL A;  5GAO l;  2YRC A;  1JRI A;  2AKL A;  4LN2 A;  2EFI A;  3OYN A;  2RI3 A;  1M8V A;  3HL8 A;  2RMO A;  5A0G A;  4M7D E;  3HTR A;  1YI2 A;  1U8R A;  2FPE A;  3GF5 A;  3V8J A;  3VU3 C;  1C1A A;  1YJW T;  1MMD A;  2HZY A;  2PVO B;  2BUD A;  1BCM A;  1IGU A;  1W6X A;  1H64 1;  1X6G A;  3VS2 A;  3JCM c;  2K5I A;  4LUD A;  1FMW A;  4BB7 A;  2EYZ A;  4P5N A;  1OV3 A;  2F69 A;  1YI2 Q;  1Q86 R;  4OGE A;  1X01 A;  4E7H A;  1PC0 A;  3CC7 T;  4PJO F;  2JMC A;  5KE3 A;  1QVG S;  2DM1 A;  3PNW C;  1WGS A;  2KXC A;  1SPK A;  2V8K A;  4JJC A;  3AT1 B;  2C0I A;  2YLB A;  3EH2 A;  1Q86 C;  5C0M A;  3CCM T;  2YLC A;  1NYG A;  3LGL A;  1V76 A;  4ZN3 A;  3SHW A;  4NS5 A;  1K1Z A;  2CKK A;  5LL6 S;  4EPC A;  2X4W A;  4FL6 A;  5I2S A;  2G6F X;  2RHZ A;  2QQS A;  2XU8 A;  2A7Y A;  4ANJ A;  4WTO B;  3QXE B;  3QBY A;  4M78 C;  1G3Y A;  5KCH A;  1NG2 A;  1UJY A;  5GAN 5;  4C92 G;  2LMJ A;  2YSQ A;  4M7D F;  5FU7 C;  5CKE A;  1QKX A;  4F7U B;  2CUD A;  4XTZ A;  3M0R A;  1YJW Q;  4HT8 A;  2EGA A;  2DIG A;  1XJW B;  1G3S A;  4RTX A;  3CC7 A;  4PJN A;  3A5Z B;  5CAI A;  1SSH A;  1AWW A;  1Z9Z A;  5GAO p;  1BB9 A;  3X20 B;  5LJ3 h;  2JZ2 A;  1UHC A;  1NE8 A;  4J9D A;  5A0L A;  3CXC P;  3CCM A;  2LCC A;  2HSP A;  3X25 B;  5HCK A;  2CH4 A;  1LNX A;  4PFP A;  3CC7 Q;  5GAN 6;  2WSF E;  2MF2 A;  3THK A;  2LP5 A;  4BE0 A;  3P8H A;  4M77 F;  2FEI A;  1QCF A;  2HNI A;  4QQD A;  1QKW A;  1JB0 E;  3CCM Q;  1WJR A;  2DXT A;  2FYK A;  3JCM Q;  1QP3 A;  3M4G A;  2ED0 A;  4PJL A;  3R6N A;  1WA7 A;  1DJ7 B;  2DRK A;  2ESW A;  2RPN A;  1VOM A;  3FC3 A;  5GAM d;  1KFZ A;  1W70 A;  2Y4Y A;  3EG0 A;  1M1G A;  4C8Q G;  1X6B A;  4C0G A;  4BY6 C;  2RJE A;  2COY A;  3M0Q A;  2Y4X A;  1KSW A;  1VQ9 T;  2CS7 A;  3GNG A;  1X2K A;  1YFN A;  3CPW P;  2K5L A;  3L2V A;  3LH5 A;  3EG1 A;  4M7A D;  2RJF A;  1R8O B;  2PZ1 A;  2DXC A;  2HQH A;  2M9U A;  2HBP A;  1Y96 A;  2KGT A;  3UA7 A;  3CCS A;  1IO6 A;  1WPY A;  1KHI A;  3GPL A;  1S1N A;  1IRX A;  2XKO C;  2E6N A;  2NUP B;  1YP5 A;  4JDS A;  5D6X A;  2FRY A;  2V1Q A;  1N8R R;  3CCL T;  1WX6 A;  1M3C A;  4RUG A;  4J6Y A;  2LZ6 B;  3MHX A;  2WAC A;  1SRM A;  4J9I A;  1VQ9 A;  1N8R C;  2HBW A;  2ABL A;  3HHT B;  1VIF A;  2FPD A;  4HA8 A;  3JCM g;  3VS3 A;  2EKO A;  2YHT A;  3DB3 A;  1K8A U;  3OYD A;  5GAN 4;  3J81 E;  2GGR A;  4O6J A;  1K9M U;  1IXD A;  2KK4 A;  1BI1 A;  4PFZ A;  4M75 A;  4KRT A;  5KYN A;  1GBQ A;  4ESR A;  1UHF A;  2XK0 A;  3M59 A;  3ZBD A;  4M7A E;  1GRI A;  1KQS A;  5GAO q;  2BE7 D;  1VQ9 Q;  5GAM f;  1HK9 A;  4RKU E;  4DOW A;  4NL3 A;  2L0A A;  3QZ5 B;  5HKC A;  2DO3 A;  4BUG A;  4M75 C;  1KC8 U;  4JLG A;  2DER A;  2RQV A;  1F1B B;  3TRE A;  5FRO A;  1TSF A;  1BIB A;  3CCL Q;  1SHF A;  2DTO A;  5IHI A;  3JCM J;  4PLI A;  5EC7 A;  1WYX A;  3FJP A;  2EYX A;  1BCO A;  2AZS A;  3RMS A;  2ZPG B;  2KRM A;  2O2O A;  3C4S A;  2DL5 A;  3NTK A;  2YXY A;  4LD9 K;  4R56 A;  3NFC A;  4FU6 A;  1QVP A;  2LNV A;  2J05 A;  1ZUU A;  4QKU A;  4HVW A;  2QAS A;  5CKB A;  3EGD B;  4OML A;  2L2P A;  3EFO B;  2QQR A;  3RUX A;  4M7A F;  4D6W A;  3MJX A;  2F2X A;  1TUC A;  1IZ6 A;  4PJM A;  2I0N A;  3JCM V;  3JB9 G;  5LJ3 j;  3CCU T;  3GBQ A;  4OB1 B;  3OYL A;  4J9E A;  3OW2 S;  1M2V B;  3EGU A;  4L59 A;  2KYM A;  1Q7Y U;  5LJ5 d;  1G8X A;  2E10 A;  2JUF A;  1X27 A;  1AWJ A;  5GAN 8;  2ZPB B;  4YTL A;  3JCM P;  3NGP A;  1WJQ A;  1PSF A;  4IUU A;  2DJZ A;  4Z8A A;  4TVR A;  2W0Z A;  2VXE A;  4C5I A;  2RK1 A;  4M78 B;  1AEY A;  3OBW A;  5I2M A;  1OU9 A;  4F04 B;  3RKY A;  2YUO A;  5FU7 B;  3IQL A;  4FW2 A;  3NTI A;  2PTK A;  2Z0W A;  1M27 C;  1Y7X A;  1QVF A;  1YN8 A;  2YUP A;  3HRT A;  5J26 A;  3OYK A;  1M5Q 1;  2YDL A;  4J9G A;  4QT7 A;  1M8M A;  4QVZ A;  1UGS B;  4E47 A;  2KBT A;  1UEB A;  2ZGW A;  4A54 A;  4OMO A;  2HKQ B;  4ELZ C;  2PUO B;  2VV5 A;  5FLX E;  4DA4 A;  2F2W A;  1Z9Q A;  3JCM X;  1H3Z A;  4A4H A;  4Z88 A;  2QGF B;  2EVR A;  3RKW A;  2G3R A;  4JUV A;  4X34 A;  2K57 A;  2FG0 A;  4M78 G;  4OMM A;  2ROT A;  4IKF A;  2GBQ A;  4HVU A;  3H8Z A;  1QP2 A;  1I1J A;  2VUB A;  4JS5 A;  1JJ2 S;  3I5S A;  3QPH A;  2NUT A;  4MDX A;  3EGX A;  5LJ5 f;  2M02 A;  2QDL A;  4Q5W A;  5GJW B;  3MP8 A;  1SF9 A;  2MYS A;  4EMH A;  2FB7 A;  5GMK m;  3QDR B;  1GBR A;  4BY6 B;  3CEY A;  2RA2 A;  1K76 A;  2SEM A;  4C8Q C;  3LLR A;  1GCP A;  2JM8 A;  1VQ4 T;  4GY5 A;  2LX7 A;  2DX1 A;  1UUE A;  1OU8 A;  3SWN A;  4C0D C;  1W2B P;  4N4I A;  2A28 A;  2EQK A;  4UC4 A;  1Q82 U;  4XK8 E;  1UGV A;  1VQ6 A;  2KT1 A;  1KQS P;  2FPF A;  2D0Q B;  3H0I A;  3QII A;  1T0J A;  5IXB A;  1PHT A;  3FDR A;  3TEE A;  3RMQ A;  2IIM A;  1Y96 B;  4J7I A;  4F7U E;  2DIQ A;  3P8B B;  2VKN A;  2JS2 A;  4B9X A;  1JO8 A;  3VUZ A;  2X4X A;  4EMK C;  2KSS A;  1VIE A;  3OMG A;  1U1T A;  1T0H A;  3DKM A;  1VQ4 A;  2VAS A;  2RB6 A;  1JQQ A;  4IIO A;  1QVF S;  3G1J A;  4BDZ A;  2ZCF B;  4ZN1 A;  3QJ6 A;  1K8A R;  3PTA A;  3LH0 A;  2EGE A;  4OMQ A;  4FM4 B;  2DBM A;  4AFS C; 
#chains in the Genus database with same CATH homology
 2MWO A;  5GAM h;  3CD6 T;  3PNW C;  2LVM A;  4PJO D;  1WGS A;  2V8K A;  4MML A;  2D6F A;  2YLB A;  4JJN K;  4PJO A;  3Q1J A;  2XDP A;  1Q86 C;  5C0M A;  5FU6 B;  2R5M A;  4BI4 A;  2L3R A;  2YLC A;  1NPR A;  3GLX A;  4C0Z A;  5CK9 A;  3CCM T;  1QW1 A;  1ZQ1 A;  1OYX A;  3LGL A;  2O4X B;  4FT2 A;  2ZPH B;  1YJN T;  5D6W A;  3H6Z A;  4ZN3 A;  4FIB A;  3G6E T;  4E7J A;  4NS5 A;  1K8A C;  1VQK A;  2CKK A;  5LL6 S;  4M75 B;  2XDB A;  2FVU A;  4EPC A;  3CC4 T;  2KMT A;  2LRQ A;  2X4W A;  3MEW A;  4FL6 A;  1FX7 A;  5GAN e;  5I2S A;  1LJO A;  1LOJ A;  2QQS A;  2RHZ A;  1OI1 A;  2A7Y A;  2XU8 A;  2E70 A;  3QXE B;  2ZPF B;  3QBY A;  4M75 D;  4M78 C;  1G3W A;  1KHC A;  3MEA A;  1W4S A;  2CZ7 B;  1G3Y A;  5KCH A;  1M1K C;  2C06 A;  5GAN 5;  4C92 G;  3WVD B;  4EDU A;  2DXU A;  5A2Q E;  4M7D B;  2GFU A;  4HT9 A;  3GOX A;  4M7D F;  2LQ8 A;  4A4E A;  2CYZ B;  5FU7 C;  2IVW A;  3LYI A;  3JCM W;  1YCY A;  5LJ5 h;  3G71 A;  5CKE A;  2JOY A;  4IUT A;  4F7U B;  4M7D D;  4XTZ A;  4IUV A;  4F7U F;  1GXI E;  4HT8 A;  2NLU A;  3I56 A;  3OSS C;  1M4Z A;  2DIG A;  1G3S A;  2V8I A;  4IUP A;  4XU0 A;  3CC7 A;  4M7D A;  3BW1 A;  1Y71 A;  3A5Z B;  3E19 A;  4FT4 A;  4IUQ A;  5CAI A;  1VQ6 T;  1D3B B;  4NL2 A;  4PJO G;  2QA4 A;  3CCL A;  5GAO p;  3CD6 A;  2WSE E;  1S72 T;  2M0O A;  3X20 B;  5LJ3 h;  4F7U A;  4C92 E;  2JZ2 A;  4A53 A;  2K3Y A;  1NE8 A;  1JBM A;  5A0L A;  1WQW A;  1N9S A;  3CCM A;  3DLL A;  1KC8 C;  5GAM g;  2JTF A;  1D3B A;  4LDW A;  5GAN f;  3QZ9 B;  3CBM A;  3CC2 T;  2LCC A;  3OB9 A;  1YJN A;  4N0A A;  3G6E A;  2HQE A;  3CBO A;  4J7F A;  3V8L A;  3X25 B;  3OYG A;  3L42 A;  3A8M B;  3SFM A;  1LNX A;  4N4H A;  3CC4 A;  3GIB A;  3S6W A;  4PJO E;  2DZC A;  1XTD A;  2EAY A;  3BDU A;  2WSF E;  5GAN 6;  4M75 G;  2MF2 A;  3CBP A;  4BE0 A;  4M77 B;  4ZGJ B;  3P8H A;  4M77 F;  2EYQ A;  5GAN 3;  2HNI A;  5J3B A;  4BAC A;  1OZ3 A;  4QQD A;  4M77 D;  3L2U A;  2L5Q A;  3ZEH A;  1JB0 E;  3BY7 A;  3WVE B;  4C5G A;  3CCV A;  3JRZ A;  1WJR A;  2DXT A;  4M77 A;  2FYK A;  3JCM Q;  5GMK j;  3GNF B;  3A8H B;  1QP3 A;  3M4G A;  4E7K A;  4HCB A;  4OF1 A;  3VKI A;  2R58 A;  2QTX A;  2PUK B;  3PT9 A;  1JJ2 A;  4M75 E;  4QQG A;  1DJ7 B;  4KT0 E;  4N0A C;  2LC4 A;  3MP6 A;  1S72 A;  5IT9 E;  3M9Q A;  2WSC E;  3FC3 A;  1M1F A;  5GAM d;  4C5E A;  3CXC S;  1BI2 A;  4RMO A;  3QKJ A;  1VQ7 A;  2QXF A;  3OYE A;  2Y4Y A;  2CZ0 B;  4OB3 B;  1M1G A;  1I5L A;  4C8Q G;  2LCL A;  5LJ3 g;  1KD1 U;  3CC2 A;  5AYF A;  3FLG A;  2MI6 A;  4C0G A;  3JCM h;  4BY6 C;  5GAO m;  1BI3 A;  4M7A B;  2RJE A;  1NJI C;  2I2L A;  3CMA T;  3EFR A;  1VQK T;  2KAF A;  2X35 A;  2Y4X A;  4JRP A;  1VQ9 T;  1VQP T;  3V7S A;  2CS7 A;  3GNG A;  3PMT A;  3PFS A;  3VYH B;  3KXT A;  2K5L A;  3L2V A;  4KUD K;  4M7A D;  1G5V A;  3SWN C;  3QUI A;  2RJF A;  1R8O B;  3LWH A;  2DXC A;  2RHY A;  3A8G B;  3URG A;  2P0P A;  4C92 B;  2DEQ A;  2V8J A;  5CQX A;  4C92 F;  2M9U A;  2HBP A;  1Y96 A;  1M9S A;  2GF7 A;  4M77 G;  1Q7Y C;  4C8Q E;  1WNL A;  2OAU A;  2QQA A;  1EIF A;  4C0F A;  3CCS A;  1WPY A;  2CZ6 B;  4C92 D;  4J6X A;  3INZ A;  3OY9 A;  2ZZD A;  5IN1 A;  1KHI A;  3GPL A;  3M55 A;  3OYB A;  3NTH A;  4PL6 A;  4QW2 A;  1UGR B;  4C92 A;  4JS4 A;  2XKO C;  2E6N A;  2EJG A;  1VQO A;  4KUL A;  2CGH A;  4RG8 A;  3I56 T;  1N6A A;  4JDS A;  4PLL A;  4EMG A;  3UPU A;  3PGG A;  5D6X A;  2XI9 A;  4X9C A;  3CCL T;  4BE1 A;  2QA4 T;  3MEU A;  4M77 E;  4KBM B;  2RH2 A;  4J8O A;  4II1 A;  2RHI A;  2XIC A;  2RI2 A;  2AHJ B;  2ZPE B;  3S3O A;  2BKD N;  1BI0 A;  4J6Y A;  5GAM e;  1PSE A;  2Y90 A;  3MHX A;  2DVE A;  3JB9 I;  3CCQ T;  3G7Z A;  1P92 A;  2WAC A;  4A4F A;  1U1S A;  4V2S A;  4ZGD B;  3CMA A;  3LW5 E;  4QQ6 A;  1Q86 U;  4GLK A;  1VQP A;  4VUB A;  4BD3 A;  4ZTF A;  3J80 E;  3CPW S;  3HFN A;  1VQ9 A;  3F70 A;  1YJ9 T;  1N8R C;  4M7A G;  4HA8 A;  3HHT B;  1VIF A;  4M75 F;  3JCM g;  2EKO A;  1BKB A;  2YHT A;  3DB3 A;  3M56 A;  4C92 C;  1K8A U;  3OYD A;  5GAN 4;  3I55 T;  3CCU A;  5GMK e;  3J81 E;  1VQ5 A;  4O6J A;  1K9M U;  2O4X A;  1SSF A;  2KK4 A;  1BI1 A;  4A4K A;  4HCZ A;  5CO7 A;  4M75 A;  4OGC A;  1HXD A;  1RI0 A;  2E12 A;  4C5H A;  5GAO r;  2DAQ A;  3RIR A;  2XDD A;  3LX7 A;  3O8V A;  1Q81 C;  2FHD A;  2XK0 A;  3CCJ T;  3CCV T;  3M59 A;  4RCB A;  3C95 A;  3PMI A;  3ZBD A;  4M7A E;  1KQS A;  4PJO C;  2XG8 D;  5GAN h;  5GAO q;  1QVG A;  5CIU A;  3SD4 A;  4CRI A;  2RK2 A;  5GAM f;  1HK9 A;  2LTO A;  3QYH B;  4RKU E;  4XU3 A;  3MO8 A;  4DOW A;  4NL3 A;  3ZFJ A;  3X28 B;  3OYM A;  3QZ5 B;  3VYG A;  4C8Q B;  4C8Q F;  3OYH A;  3OS0 A;  5FU6 C;  2PVG B;  3PIO A;  3MET A;  1VQ7 T;  5HKC A;  1XQH A;  3CCQ A;  2QDY B;  4C8Q D;  2DO3 A;  4JLI A;  3QJY A;  2VGM A;  4XTW A;  4XTV A;  2EJF A;  4BUG A;  1AHJ B;  2HQX A;  4JRI A;  3JCM d;  3M53 A;  4M75 C;  4C0D B;  1BIA A;  4JLG A;  4C8Q A;  1YHQ T;  2E41 A;  4E7I A;  5EG2 A;  1YJ9 A;  1KC8 U;  3JB9 F;  1QVG S;  5CR2 A;  3TRE A;  5FRO A;  1YIJ T;  5GMK l;  5GAM j;  2JVV A;  2QQB A;  3I55 A;  1BIB A;  2E1H A;  3CPF A;  3MP1 A;  3LWI A;  3JB9 D;  2E64 A;  2XD0 A;  2DTO A;  3FB9 A;  3JCM J;  3HPW A;  4M7D C;  4PLI A;  3KBG A;  3CCS T;  3GP8 A;  3FJP A;  3CCJ A;  1VQN A;  3HP9 A;  4DOV A;  2QEX T;  2K4Y A;  2K3X A;  5CKH A;  2JNG A;  4PNO A;  1VQO T;  2RD1 A;  4XQ3 A;  3RMS A;  2OTL T;  2ZPG B;  3AHU A;  5LJ5 g;  3C4S A;  3HFO A;  3NTK A;  2LT1 A;  4LD9 K;  4MZT A;  2GQV A;  2XID A;  1G3T A;  3LGF A;  4EMK B;  5GAN g;  4R56 A;  3NFC A;  2VXF A;  3OSV A;  4LDY A;  4FU6 A;  3FEO A;  4PKC C;  1QVP A;  2LNV A;  4OB2 B;  1VQ8 T;  5LJ5 j;  3QHS A;  1VQL T;  5DLQ E;  1MHN A;  2E5Q A;  2MMP A;  5CKB A;  1Q82 C;  4EMK A;  4BE2 A;  2QQR A;  2DTI A;  3ASK A;  3RUX A;  4M7A F;  1YHQ A;  2L89 A;  1N9R A;  4D6W A;  2RI5 A;  3M54 A;  3R6O A;  3FRN A;  3JCM e;  3L2W A;  1IZ6 A;  1ZHI A;  2DD5 A;  2RHX A;  1YIJ A;  3JCM V;  4M77 C;  3JB9 G;  1YIT T;  5L8R E;  5LJ3 j;  1NJI U;  1M90 U;  4E7L A;  2QQ9 A;  3VUB A;  3CCU T;  2EQJ A;  1VUB A;  2DK3 A;  4M7A A;  1VQ5 T;  4LD6 A;  4OB1 B;  3T9N A;  1NZ9 A;  2KQW A;  3E9G A;  4XU2 A;  5I21 A;  3OYL A;  2EJ9 A;  3UT1 A;  4RCC A;  3OW2 S;  3EFS A;  3V7R A;  3JB9 H;  1VQM A;  2M16 A;  3KUF A;  2PQW A;  4MZP A;  4L59 A;  5GAN 2;  2BIV A;  1Q7Y U;  4CI0 C;  2QEX A;  5LJ5 d;  2PVD B;  3VV0 A;  3X24 B;  2OTL A;  2QI2 A;  5CKD A;  5M9O A;  2E10 A;  2JUF A;  5J39 A;  5GAN 8;  2ZPB B;  5DLO A;  3QO3 A;  1K73 C;  4YTL A;  5FRN A;  4LDU A;  3JCM P;  3CCE A;  1I4K 1;  4BDY A;  1WJQ A;  1PSF A;  2KY9 A;  4N4G A;  4IUU A;  1Y07 A;  2LX9 A;  4OB0 B;  2RHU A;  5GAN 7;  3CXC A;  5CCA A;  2B8A A;  1NPP A;  2DJZ A;  1MGQ A;  3M5A A;  2XHC A;  4IUR A;  4TVR A;  2RJD A;  3C12 A;  5LJ3 d;  2VXE A;  1VQ8 A;  3M4Y A;  5CQY A;  2RK1 A;  4M78 B;  4C5I A;  2O01 E;  4DQ2 A;  4M78 F;  3JCM f;  3OBW A;  5GMK i;  1I8F A;  5I2M A;  1VQL A;  5DM7 R;  2IG0 A;  4M7A C;  2A3L A;  3RKY A;  4ATO A;  1TH7 A;  3SDZ A;  2KDS A;  3OBY A;  4M78 D;  5FU7 B;  4BI8 B;  1BYM A;  3OYJ A;  3JCM b;  3HRS A;  2F5T X;  3NTI A;  1OZ2 A;  4M78 A;  2JTM A;  2R5A A;  3DLM A;  3E1S A;  2EQU A;  1YIT A;  2EQM A;  3OYY A;  4RG2 A;  1Y7X A;  3DB4 A;  3S3M A;  1QVF A;  2OTJ A;  1N8R U;  2L8D A;  4J83 A;  3L2R A;  3HRT A;  4XTX A;  5J26 A;  1M5Q 1;  3OYK A;  1W2B A;  3JSC A;  1B34 B;  3N5B B;  3C94 A;  3SB2 A;  3UWN A;  3OYC A;  3QYG B;  3RER A;  1XOV A;  1VQN T;  3TCJ A;  1M1K U;  4QVZ A;  1UGS B;  4Y28 E;  4E47 A;  1YJW A;  2HAX A;  1UEB A;  2ZGW A;  1UGP B;  4A54 A;  3QSU A;  4Z02 A;  1K9M C;  4ELZ C;  5GMK h;  1Q81 U;  5LJ5 e;  5CKF A;  1X75 C;  2DZ9 A;  2PUO B;  1B34 A;  2VV5 A;  3HRU A;  4HKE A;  4OMF B;  5DY9 A;  5FLX E;  5KE2 A;  4LDX A;  1O75 A;  2KVQ G;  3X26 B;  4DA4 A;  3OQ5 A;  2VYT A;  5KCO A;  2GCX A;  4JRQ A;  2P0K A;  3JCM X;  1H3Z A;  3S3N A;  4A4H A;  3J7A F;  2K5F A;  2VGN A;  3RKW A;  1O9S A;  2G3R A;  4JUV A;  3M57 A;  2K57 A;  4X34 A;  2HD0 A;  3ER0 A;  3PIP A;  5LJ3 e;  3FIF A;  2EIF A;  4M78 G;  3HKS A;  1FXX A;  3CPW A;  3OS5 A;  4NOY A;  4IKF A;  2D9T A;  5IAY A;  3OYA A;  2DD4 A;  3H8Z A;  1QP2 A;  4MMK A;  3L1A A;  4WF2 A;  1RL2 A;  3WXM B;  2FL7 A;  2VUB A;  4KUI A;  2VC8 A;  4JS5 A;  1JJ2 S;  3QPH A;  3OYI A;  4OP0 A;  2GFA A;  2EWN A;  4MDX A;  1ZBX A;  4MZM A;  1UB4 A;  3RES A;  4M78 E;  2DPP B;  4Q5W A;  5LJ5 f;  3MP8 A;  3V7C A;  1VQM T;  1WQ7 A;  2K2V A;  2M1H A;  4EMH A;  4ZTJ A;  2FB7 A;  5GMK m;  1YI2 T;  3MCA B;  3ME9 A;  3QDR B;  4A4G A;  1IRE B;  1FWZ A;  5CVI A;  5C6S A;  2P0Q A;  4X9D A;  4BY6 B;  3CEY A;  2RA2 A;  4MDW A;  3RKX A;  3G4S T;  2RM4 A;  3A8L B;  3JB9 J;  5LJ3 f;  3CCE T;  5KH6 A;  3OS2 A;  5HY6 A;  3SWN B;  4C8Q C;  3LLR A;  5FRM A;  1N27 A;  4LDV A;  4ZGE B;  2LDM A;  5HK0 A;  3OS1 A;  1VQ4 T;  4GY5 A;  3TU4 K;  1KQ2 A;  2DKG A;  1YBY A;  5D6Y A;  3BFM A;  4L6V 5;  4R55 A;  1I81 A;  3QG1 A;  4B9W A;  4XTU A;  5GAO n;  4M7D G;  3CME T;  3EAE A;  5GAN j;  2MWP A;  3SWN A;  4C0D C;  5HK3 A;  4XAX B;  2DTH A;  4N4I A;  4QVC A;  4FSX A;  3M58 A;  2LT4 A;  3CCR T;  2X4J A;  2E6Z A;  1WJS A;  2EQK A;  3OYF A;  1KQ1 A;  4UC4 A;  4F7U G;  1Q82 U;  3P8D A;  2MAM A;  3BDL A;  4XK8 E;  1KG1 A;  5A0D A;  1VQ6 A;  3OMC A;  2F5K A;  5GAO l;  1V29 B;  1JRI A;  3V8K A;  4J5Y A;  2D0Q B;  2E65 A;  1KD1 C;  2EFI A;  1X6O A;  2OTJ T;  2P4T A;  3QII A;  2RI3 A;  3OYN A;  1M8V A;  3HL8 A;  4ME7 A;  2R57 A;  3JAM E;  5A0G A;  2CZ1 B;  4M7D E;  2PU9 B;  3FDR A;  4XU1 A;  3TEE A;  3RMQ A;  1YI2 A;  1U8R A;  3VJP A;  2JN0 A;  3GF5 A;  3MEV A;  3V8J A;  3VU3 C;  1M90 C;  1Y96 B;  4ELY C;  4J7I A;  4F7U E;  2DIQ A;  4XTY A;  3P8B B;  3G4S A;  1YJW T;  4B9X A;  2PVO B;  3UDC A;  5GAN d;  2X4Y A;  3VUZ A;  3L2Q A;  2X4X A;  2BUD A;  4Y91 A;  2KSS A;  4EMK C;  4JRK A;  3A8O B;  2H3J A;  2RJC A;  1VIE A;  3E9F A;  1H64 1;  4O5V A;  3OMG A;  1U1T A;  3DKM A;  3L2Z A;  1K73 U;  2YRV A;  4BI3 A;  3JCM c;  2K5I A;  1VQ4 A;  2RB6 A;  3HSB A;  4J6W A;  4BB7 A;  3OA6 A;  1QVF S;  4P5N A;  3CME A;  2DXB A;  1W2B S;  4OVA A;  2F69 A;  2ZPI B;  4OGE A;  4QVD A;  3G71 T;  4BDZ A;  2ZCF B;  1X01 A;  4ZN1 A;  3CCR A;  1UGQ B;  4E7H A;  3QJ6 A;  4L5G A;  4PJO B;  3CC7 T;  4PJO F;  3PTA A;  1XNI A;  5KE3 A;  1KQS S;  3LH0 A;  2LQK A;  4HCC A;  4FM4 B;  3OW2 A;  2RO0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...