3JCMV

Cryo-em structure of the spliceosomal u4/u6.u5 tri-snrnp
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
84
structure length
72
Chain Sequence
b'MVPPINCIFNFLQQQTPVTIWLFEQIGIRIKGKIVGFDEFMNVVIDEAVEIKEDVEKKILLKGDNITLITSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pre-mRNA-splicing factor 8
publication title The 3.8 angstrom structure of the U4/U6.U5 tri-snRNP: Insights into spliceosome assembly and catalysis
pubmed doi rcsb
molecule tags Transcription
total genus 7
structure length 72
sequence length 84
chains with identical sequence Y
ec nomenclature
pdb deposition date 2015-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3jcmV00
4M75E 2DEQA 4M77F 3SB2A 2EJGA 3RKXA 3JCMg 4EMKB 5LJ3d 4HT8A 1KQ1A 3FB9A 5GAMe 3PGGA 3RKWA 3JB9G 3GIBA 3BW1A 1JBMA 3JCMh 4HT9A 2EWNA 4M75A 4M7DC 5GANe 3QO3A 3BFMA 2VXEA 4M7DB 2JN0A 1MGQA 4HA8A 2VC8A 4JRKA 4XQ3A 5GMKj 5GAN6 2DZCA 1M8VA 2EAYA 4NOYA 3RKYA 1WQWA 4M7DF 1WNLA 1WQ7A 3HSBA 5GAOr 3AHUA 4C8QE 3JB9I 1I4K1 2CGHA 5GAMh 4XU3A 2DTOA 4XTYA 3V8LA 2Y90A 5GANg 4M7DD 3JCMd 2RD1A 1D3BA 4PJOE 4M75C 1LJOA 5GAOp 3QHSA 4J5YA 4M7AG 1X01A 4M75B 3JCMf 5GANh 4M78G 4XTWA 4PJOG 3JCMX 4PNOA 4C92G 5GAN8 2EJ9A 4M75F 4N0AA 4XU1A 1U1SA 3BY7A 4X9CA 2DTHA 1U1TA 2E64A 3V7RA 4F7UG 5GAN3 3JB9H 4OP0A 1YCYA 4M75D 1BIBA 3QSUA 4A53A 2E1HA 3SWNA 3L2ZA 3V7SA 1D3BB 5GAN5 4V2SA 5GAMg 3RESA 4C8QC 5CAIA 2K57A 3EFRA 4J6XA 5GANf 5GAOl 2HNIA 4N0AC 5GMKl 3JCMQ 4PJOC 5LJ3e 5GAMj 2RM4A 4M7AE 4X9DA 1I5LA 4C8QF 4QVDA 2E65A 4M78E 4M7AD 5LJ5e 4C92E 3VU3C 1N9RA 4M77G 4PJOF 3SWNC 4EMHA 5GANj 2DZ9A 4MMLA 5GAN2 3SWNB 4XTUA 4C8QA 3INZA 4C8QD 4F7UE 5GAN7 1KQ2A 2RA2A 4M7AA 3JB9F 5LJ3g 2DTIA 4M78A 5GAOm 4PJOA 1H641 5GMKm 3FIFA 4PJOD 4Y91A 4RCCA 4XU0A 4C92A 3JCMb 5LJ5g 2YLCA 1M5Q1 5GAMd 3JB9D 5LJ3h 2VXFA 2YLBA 3JCMV 4F7UA 1BIAA 3HFNA 5GAMf 5LJ5h 3L1AA 4M7DG 2I2LA 5GANd 1N9SA 4NL2A 4A54A 2FYKA 1HK9A 4NL3A 4M7AC 2EJFA 4MMKA 3BDUA 4C8QB 4M7AB 4M78C 4XTZA 3V8KA 2E10A 2FB7A 5GMKe 4C92C 4M78B 3M4GA 4M77E 4XU2A 4PJOB 4EMKC 4C92B 1Y96A 4M7AF 2DJZA 1I8FA 4XTVA 1LOJA 4M78F 3JCMP 3JCMc 4DQ2A 5GAOn 4F7UB 1HXDA 4C92F 1B34A 5I21A 4XTXA 1JRIA 4M75G 4RCBA 5LJ3f 4M77D 4J6WA 4M77A 1I81A 5DY9A 3V7CA 3HFOA 3V8JA 5GMKi 4M78D 5LJ5f 2RB6A 4F7UF 2YHTA 2DVEA 4C92D 4QVCA 3QUIA 4EMKA 2DXUA 3JCMJ 4M7DE 5GMKh 4EMGA 5LJ3j 3JB9J 4J6YA 5GAN4 5GAOq 2E41A 1Y96B 4JRIA 4JLIA 5LJ5j 3JCMe 3FJPA 4WF2A 1LNXA 2DKGA 2QTXA 4M77C 1B34B 5LJ5d 4M7DA 4JUVA 4M77B 2DXTA 3EFSA 4C8QG 3RERA 1WPYA 3JCMW 1TH7A 3RIRA 2ZGWA 3RUXA
chains in the Genus database with same CATH superfamily
2DEQA 3H0HA 1JQQA 1M27C 4HT8A 3QXEB 3CMET 1AD5A 3CCST 1QVGP 2E3HA 1V1CA 3NHNA 4JRKA 2D8JA 5GAN6 2DZCA 2MWOA 3M5AA 1NPRA 4PFOA 5GAOr 2EFIA 2LJ0A 2GFAA 3M0UA 2KT1A 1LJOA 4FYVB 2PZ1A 1GXIE 1VQNA 3M59A 1M30A 1MMNA 2COYA 3LH0A 3S3NA 1WXTA 2D0NA 4BE0A 2BIVA 1Q7YC 1U1TA 1YJWA 1BI1A 2RJEA 3QKJA 2VGNA 1M3AA 3QSUA 4QT7A 3CCQA 1N8RU 1O9SA 4J9EA 3G6EA 2ZCFB 4V2SA 4Y28E 2DL7A 1G83A 4N0AC 2GTJA 3CC2Q 2HMAA 1NE8A 2LMJA 4PJOF 2CP3A 2JUFA 4CRIA 1OI1A 1PD0A 4PLIA 4RCCA 4LD6A 1BYMA 1WHHA 2KRSA 5LJ3h 1NM7A 1T0JA 3CC4Q 1SPKA 1RL2A 2XMFA 1Q81C 4BY6B 1PSFA 1M1GA 1HXDA 5KYUA 5LJ5d 4M7AD 1FXXA 1ZBXA 2NYSA 1LVKA 4IUUA 4CC4B 1KG1A 5C0MA 1VQKQ 2K9GA 3HP9A 4KH0B 3CC7Q 2E5QA 2F5KA 4PK4A 3OY9A 2C0TA 5CKEA 5CKBA 3EFSA 5HY6A 2KXCA 3RIRA 4E7ZA 4JRPA 3PMTA 1I1JA 4MZTA 3OYJA 1YJ9A 3BW1A 2MF2A 2EWNA 2RJCA 1QCOA 1RAGB 3R6NA 3M53A 4A4FA 4HCZA 2KI7A 4LDWA 1S72Q 3CQTA 3OA6A 1WNLA 2FG0A 4EDUA 2A28A 1W70A 2F2WA 3QHSA 3MP1A 4ORZA 3HRUA 3T9NA 3UPUA 1UGVA 5A0GA 4BI4A 1Y7XA 3G71A 2CDTA 2SRCA 3VJPA 2L3SA 4IUQA 1ABOA 3CCUQ 3X25B 3HL8A 5GAN5 3A1PA 1E6GA 2DF6A 5GAMg 4PFPA 1YJNQ 3X20B 3IQLA 3OYCA 1Q82U 2E65A 2ZAEA 2G3RA 3CCLQ 4LDXA 2MOXA 1M2VB 3TSZA 4C8QD 3INZA 1UGSB 3GF5A 4D6WA 1D1AA 1ACMB 2EIFA 3UDCA 3TEEA 1QVGA 1VQ8Q 4DBRA 3OMGA 2FYKA 3QDRB 4Z89A 4C8QB 1Q86C 3M4GA 1M90C 4E2FB 1XTDA 4XTXA 3CMEQ 1KD1R 1N5ZA 2XHCA 3SHWA 3CCSQ 5A0LA 1IGQA 3QUIA 1UE9A 1PG5B 1QVFA 2R5AA 5KYWA 4QKUA 2JW4A 1MV3A 1TUGB 9ATCB 4KGXB 4M77C 1FMWA 4A4KA 4HVUA 1KC8U 4ZGJB 2RQTA 3RERA 3D7SB 1YCSB 2DXBA 5FWCA 4BB7A 2ZGWA 3RUXA 3OMCA 3PNWC 1RAEB 2YUPA 3C0CA 1G3SA 5GANe 2L3RA 1TUCA 1OZ3A 2HQEA 1ZSZB 4XQ3A 2RJDA 3OYDA 1BKBA 3OYLA 4N4IA 1UB4A 2P4TA 1GBQA 1OQKA 2CZ0B 2AIRB 3JCMd 3BE3A 2ATCB 4IKFA 1VQ9T 3FRNA 3L2UA 1SKUB 1G2BA 4J9BA 1Y57A 2O4XB 3EH1A 2ABLA 3G7ZA 2EVRA 3LH5A 3THKA 3OS1A 2QGGA 1K8AR 2E1HA 1AZGB 3CBPA 4C5HA 1H3ZA 3EGUA 5DLOA 1YI2A 2K3BA 2DO3A 4YTLA 1WA7A 2J06A 3EGDA 3CD6A 1VYVA 4M7AE 1NPPA 2VV5A 3X24B 3CMAQ 2BE9B 5FW9A 5LJ5e 1AVZC 5KYNA 2F5TX 1N9RA 5GANj 4EMHA 5J39A 5GAN2 1HSQA 3CC4A 1K9MC 5GAOm 4QW2A 4R0KA 1FMKA 1MMAA 3MO8A 4BACA 2QTVA 4HCBA 1RAIB 1YITT 2LJ1A 1OX8A 1TTHB 2FZGB 2EQMA 4NL2A 4ZTFA 2K79A 2LZ6B 3KFVA 3CBOA 5CCAA 3S3MA 4OMOA 3CPWS 1YP5A 2MIOA 5D7UA 3OS5A 1SHGA 3JCMc 1SHFA 4JZ3A 4HVWA 2BZYA 4RCBA 4M77D 2KVQG 3HFOA 2CH4A 2JVVA 1LPLA 1OV3A 2NUZA 5GMKh 4EMGA 3N5BB 5LJ5j 1VQPA 2BTTA 3FJPA 4ZTJA 3PE0A 1JJ2P 2QQSA 2JXBA 4M77B 1UECA 3WXMB 4M77F 4C0DC 1YWPA 1IHVA 2EYYA 2DM1A 1EX4A 4OB1B 2X4JA 4C0FA 2EYZA 2EAYA 1VQOA 1WHJA 1SRLA 1WQ7A 4O6JA 2K7AA 4AG1C 4C8QE 2Y90A 4OMLA 3A8MB 4PL6A 2HD0A 2FZKB 1OULA 2DL3A 4MZPA 4E7IA 2DPPB 1YJNA 5D6XA 3LGLA 4RTXA 1VQLA 3CXCS 4A53A 1W1FA 2PUOB 3CCLA 3M57A 2J05A 4EIKA 1M3CA 2K57A 4JJCA 3UATA 4OF1A 2W10A 2BZ8A 5C6SA 2QEXT 2DXCA 2CYZB 1G5VA 3DLLA 3OYGA 3URGA 1NJIC 2KDSA 3H41A 2JTMA 2XG8D 2RPNA 1BIAA 3G1JA 3E9FA 3L1AA 4KH1B 2I2LA 1R77A 1N9SA 1RABB 1OX9A 1ZLMA 3QWXX 2RQRA 1QWEA 4C92C 1SF9A 1QCNA 2KRMA 2X4YA 4D8KA 3M54A 3I5RA 5LJ3f 3QDFA 1QCFA 2FVUA 3TU4K 2AT1B 1KHIA 5AYFA 4LDYA 1OOTA 2FRWA 2COZA 2RB6A 2DVEA 4LXCA 4J9CA 3PVLA 2L5QA 3NPFA 1BBZA 3JCMe 2FPEA 3PVQA 2A3LA 1N8RC 1C1AA 2JTEA 5FU6C 4IUTA 1UUEA 1VQ9Q 3CCJA 3M4YA 1QP3A 4C0DB 3PIOA 1ZUYA 2LCCA 1MUZA 2PU9B 4IUVA 4KGVB 1VQMT 2RHUA 5IAYA 2PNIA 3CCET 5IXFA 3CCMA 1MHNA 1K0SA 3OYAA 3NTKA 2EPDA 2MYSA 2CGHA 2I0NA 1X75C 2R5MA 2XIDA 3M0SA 2ROTA 3MEUA 1JJ2S 5I11A 2L2PA 1MMGA 1M9SA 3OBWA 4N0AA 1UJYA 4XU1A 2LDMA 4HCCA 4BI3A 2EYXA 2HBWA 3HPWA 1M2VA 2MPXC 1WX6A 5IH2A 2OTLT 3SFMA 3CC7T 5FLXE 4DBQA 1JB0E 3NGPA 3CCVT 1PKSA 1BI3A 4RTVA 4M77G 4N4HA 2DZ9A 1J3TA 4Z02A 4C8QA 2DTIA 2JM9A 1H641 2K3XA 1ZHIA 1PM3A 3EFOB 3JCMb 3LX7A 3HFNA 4J9FA 3I55T 1PWTA 4E7HA 1SSHA 1IB8A 3VV0A 4C92B 3OQ5A 1U8RA 4KT0E 1PRMC 2RH2A 2CKKA 1X2QA 4C92F 4F7UB 1X6OA 2JMCA 1YIJA 3OS0A 1EZZB 4F7UF 4LD9K 1E6HA 1YN8A 2FZCB 2CREA 3JB9J 2YSQA 2V1QA 4FCYA 5KH6A 2YRDA 2VUBA 4L5GA 2MK5A 4KGZB 4CI0C 4L59A 1X27A 1M1KR 1ZSZA 2D8HA 2QG9B 2HL3A 3J80E 3KUFA 3TVTA 5IXBA 5FU6B 2CP7A 1K73R 1KQ1A 3FB9A 1MMDA 3JSCA 3RKWA 1Q82C 3VS0A 4M7DC 2VYTA 2OTJA 3QIIA 2O4XA 1B7TA 1TOVA 1VQ8T 3QWYA 2E6ZA 3VS2A 3JB9I 5FWBA 1IRXA 3CCRT 4M75C 4UC4A 1C0MA 1YHQA 4JS5A 1TS9A 5FU7B 1Y0MA 2QQ9A 2XKOC 1KFZA 2EJ9A 2X4WA 1XQHA 4NS5A 2RI3A 4HKEA 1PCXA 1D3BB 2KT8A 3JCMQ 2DNUA 2KEAA 2KMTA 1Z9ZA 1H8KA 3META 4D8DA 4PKCC 1KC8C 3G4SA 4PJOD 4ME7A 4AFZC 2PVDB 1H3HA 1RAHB 3P8BB 2AZVA 4FYYB 3OW2S 2ED0A 3EAEA 5GAMf 1NEBA 8ATCB 5GANd 2QK0A 1GCQA 1VQ6T 5J3BA 2KXDA 4M78C 3E1SA 4PJOB 1NYFA 1BK2A 4EMKC 3OYYA 3JCMP 2J6KA 2LRQA 2CUDA 1JRIA 2FPFA 4M77A 3JAME 1PRLC 2HZYA 1T3LA 2FO0A 3QYGB 1VQMQ 1QMCA 3MP8A 2A7YA 3CCEQ 3C12A 2LNHB 1Y96B 3J81E 1R0BG 3ULRB 2HKQB 3CMAT 1S1NA 4IUPA 3SB2A 1KD1U 1QW1A 2X4XA 2ZPIB 2JOYA 3GIBA 1EFNA 3I56A 3EG1A 4M7DB 5KCOA 4F17A 2OTLQ 1M8VA 4M7DF 1RUWA 4FL6A 2LCLA 4JPBW 4RTUA 2QA4T 1OPLA 2DTOA 4MDWA 4XTYA 3QBYA 4R56A 3CCVQ 1D09B 4M75B 2P84A 1YITA 3NMZC 1SG5A 4PNOA 4C92G 2KY9A 4M75F 3ZEHA 2EKOA 2VASA 3V7RA 4F7UG 2O31A 2A08A 2L89A 1G3YA 1QKWA 2L8DA 3DB3A 4FYWB 4IURA 4JJBA 4QVZA 3I55Q 4LN2A 2E12A 3QYHB 4XAXB 1UGRB 3MP6A 2LP5A 4RMOA 1UTIA 1TWBA 2XI9A 4OMQA 3CBMA 3QZ5B 2GQIA 2DX1A 2RHZA 3OYEA 5D6YA 4Y91A 1X43A 2RO0A 1TU0B 3H6ZA 1MNDA 3JCMV 1WDXA 2LTOA 4CC2A 3VYHB 4ZNXA 2IPOB 3CPWP 1ARKA 1FX7A 2R57A 4QQ6A 4II1A 2EJFA 1VQ7T 2FB7A 2YUOA 4M78B 1VQ4T 4M78F 1QP2A 2OI3A 4FT2A 5KYYB 2K5LA 2M0OA 4KRTA 2L0AA 1G3TA 4VUBA 4OB0B 1DJ7B 3OYIA 1YBYA 1NLPC 4GLMA 2MMPA 2E41A 3QJYA 1X69A 1A0NB 5DLQE 4JUVA 2J6OA 2DEUA 2HBPA 1WPYA 3UF4A 3OYMA 3CCRQ 5CQYA 2CUBA 3I9QA 5GAMe 3SEMA 2LNVA 2QDLA 4RTZA 1SRMA 1X6GA 2A36A 4GLKA 2L3PA 3PFSA 2QEXA 4MDXA 3QPHA 2O88A 2LT4A 5GANg 5CIUA 4PJOE 2M1HA 3HRSA 3FC3A 4X34A 1X2KA 2ZPGB 4PJOG 2CZ7B 3OBYA 1PSEA 3CXCP 1AEYA 5CK9A 4FM4B 4X1VA 3EG3A 1RLPC 4ESRA 4RG2A 1M4ZA 1VYUA 1V29B 1M3BA 1C6VX 2D1XA 1E7OA 3EFRA 3EFOA 1YJWT 3L2QA 1VQ6Q 1PKTA 5GAMj 1IZ6A 1I5LA 3MPUB 1OYXA 2HQHA 2MI6A 2V1RA 2Y4YA 4J9IA 3G6ET 5EC7A 3RMSA 3M0PA 3VRZA 3GPLA 4C92A 4XU0A 5LJ5g 3CC2A 3HRTA 4F7UA 4HCKA 4M7DG 3X28B 1XJWB 4XTZA 2CT3A 4MZMA 1KQSP 2ZZDA 4XTVA 2IIMA 2ZPBB 4OMMA 5GAOn 4M75G 1IO6A 4FIBA 2KROA 2FPDA 3DB4A 4QVCA 2M51A 2HDAA 5GAOq 3U23A 2DKGA 2QA4Q 3MEWA 4JDSA 1IGUA 3TQ7P 3I35A 3A8GB 3GNFB 1WLPB 1VQ5Q 1VQKA 2OTLA 3C4SA 2EQUA 3KXTA 3CC7A 2EQKA 3CCVA 3ASKA 2VC8A 2DJQA 1YJ9T 4LDVA 3HSBA 1I4K1 1KSWA 3V8LA 1W2BS 2KYBA 1D3BA 5D6WA 3CPWA 3HHTB 4J5YA 3JRZA 5GANh 4M78G 1HJDA 5CKFA 2JNGA 2RK1A 3BY7A 1S72A 2CP6A 3A98A 4N4GA 4J7FA 1AWJA 1T0HA 3LYIA 2RHIA 3V7SA 1I0CA 2F69A 5L8RE 4AFQC 5CAIA 1EIFA 3VS3A 3G71T 4LDUA 2B8AA 5GMKl 1K0XA 2K2MA 3NFCA 4X9DA 1JO8A 4JLGA 1VQ7Q 3RDVA 2QASA 1D1BA 2CP2A 1VQ4Q 3SWNC 2DILA 3CCUA 1Q7YR 5GAN7 4PJOA 5IT9E 3OYKA 2VXFA 2YLBA 3M0TA 4OB2B 5LJ5h 3VS1A 2PVGB 2FEIA 2K4YA 3M58A 4LE9A 2GFUA 2YRVA 1Y96A 1RLQC 3S3OA 4DBFA 4FSXA 5A2QE 1N27A 2DL5A 2CP5A 4OVAA 4QQDA 2DA9A 1VQ8A 3VYGA 2W0ZA 2FRYA 3I5SA 2DXUA 2J6FA 3EG9B 3M0RA 2KRNA 4JRIA 2XDDA 2DRMA 1ZQ1A 2F1LA 1Q81R 4PLLA 1B34B 3CMEA 4M7DA 3CCSA 3JCMW 1TH7A 1IREB 3E9GA 3JCMg 2EJGA 3M0QA 3LLRA 1KQSS 4M75A 1VQNQ 3QO3A 4OMNA 1ZUKA 2KGTA 1OU8A 1M1KU 1WXUA 4XK8E 4DEXA 1YJWQ 2QDYB 1NG2A 2PUKB 4XU3A 3F70A 2CP0A 2EGCA 1VUBA 3G6EQ 1K73U 2YT6A 2MWPA 4HXJA 3CEYA 4XTWA 5GAN8 5GJVB 1WYXA 1GBRA 1UFFA 1NLOC 2XDBA 4K11A 1ZA2B 1QVPA 1AWXA 2F2VA 3UA7A 3L2WA 1FMVA 3R6OA 2DAQA 2EQJA 1YI2T 3RR6A 3SWNB 3CD6T 3JB9F 4M78A 3OW2P 3FIFA 1KD1C 1UJ0A 2VKNA 5KYYA 3CMAA 3WVDB 2RQWA 2XICA 4BI8B 2CZ1B 1SEMA 4M77E 1K76A 2ESWA 1D0XA 3M55A 1JJ2A 3EG0A 4GBQA 1OEBA 2V8JA 4J6WA 3OYHA 1BU1A 4C92D 4J7IA 2ENMA 1ZX6A 4A4EA 1YJ9Q 3H8ZA 2AHJB 4WF2A 2BKDN 1Q86R 1JU5C 1M90R 2QTXA 4RUGA 3DKMA 2DXTA 2GBQA 3ZBDA 2A37A 2GCXA 2D6FA 1Y07A 1RI9A 1VQPT 1RAFB 1AWOA 4JJNK 1M1FA 3VS7A 3RKXA 2X51A 2ROLA 1QQJA 3JCMh 3L2VA 2DL8A 1Y71A 2V8IA 2WACA 2JN0A 1AOJA 2IG0A 3A8OB 2RI2A 2AK5A 3RKYA 1I5OB 1K8AC 2M9UA 3G71Q 4OMPA 2RMOA 2LQ8A 2RD1A 1JXOA 1K9AA 2DIGA 2JT4A 2JM8A 2DYIA 2K3YA 4Z8AA 1RAAB 2CZ6B 2K5IA 4PJNA 1VQ7A 1IXDA 1Q95G 3GBQA 1R8OB 1VQLT 1U06A 4BY6C 5LJ3e 3X26B 4AMCA 1BB9A 5CO7A 3S6WA 1R0CB 3LGFA 2RA2A 1OU9A 1UG1A 4B9WA 1KJWA 2KK4A 4FW2A 2KE9A 5GAMd 1UGQB 2KAFA 1NEGA 2O2OA 4M7AC 2RK2A 2NWMA 2E10A 1TXQA 2KR3A 1I8FA 1JEGA 1K9MR 4DQ2A 2P0PA 1WIEA 3REBB 5GMKi 3EGXB 3GOXA 2SEMA 5LJ3j 2M02A 4ZGDB 1U5SA 5CKHA 5HK0A 4ZGEB 1PHTA 3UA6A 2JJ9A 1B07A 2K6DA 4FT4A 1RACB 5KYXB 2ED1A 4E47A 2LX7A 1QVFP 2DERA 3WVEB 3JB9G 5FRMA 3CCJT 3O5ZA 3OW2A 3ME9A 1VQ9A 2QGFB 4ZN1A 4E7LA 2CSIA 2HEQA 5FRNA 3CCMT 4M7DD 2KYMA 3FEOA 2QQRA 2A0FB 1YI2Q 4OGCA 3JCMX 4FSSA 4BE2A 4F16A 1P92A 4E7JA 3CD6Q 1T3SA 4LUDA 4AG2C 1KIKA 5GAN3 2O9SA 4M75D 4J9DA 1GFCA 3L2ZA 2RF0A 7AT1B 4C8QC 2J7IA 3EG2A 5GANf 5GAOl 1IHWA 2JMAA 3PMIA 4Z88A 3PIPA 3VS4A 1W6XA 2L3QA 5HK3A 4C92E 1VQ5T 8AT1B 4XTUA 1PD1A 4F7UE 3TREA 5HKCA 3A8LB 2XU8A 2GF7A 2WSFE 4PJLA 2YLCA 1M2OA 3NTIA 4TVRA 3VKIA 4F14A 1H92A 2YUNA 4A54A 2RNAA 2QYZA 5DM7R 4M7AB 3BDLA 3EG9A 4M7AF 1VQPQ 2NUTB 1YWOA 4PFZA 1NJIR 1B34A 5DY9A 2LQNA 2EW3A 4M78D 5LJ5f 1ZSZC 1K8AU 3JV3A 1HD3A 1M8MA 1F1BB 1PC0A 2DD5A 2EGAA 4J6YA 4C5GA 1YIJT 2KNBB 4HVVA 2HSPA 1QLYA 3LW5E 2E3IA 6AT1B 1K1ZA 2RQVA 4OGEA 3SDZA 2HQXA 4A4GA 3MEVA 2Y4XA 2P4RA 4CC7A 1VQOQ 2HAXA 4EMKB 1SSFA 1XOVA 2GQVA 2AKKA 2H3JA 2QI2A 1V76A 1BI2A 3BFMA 1MGQA 4HA8A 2KBTA 3TCJA 2CS7A 1QVGS 4AFSC 2CT4A 1W2BP 3O8VA 1WJRA 2NUPB 1N8RR 1RI0A 4ELZC 2Z0WA 1VQLQ 2OTJT 2FL7A 5GAOp 2QQAA 1NBEB 3CPFA 1WHMA 2FHDA 2P0KA 3OYBA 3ZFJA 1YHQT 1AZEA 1CKBA 1QVFS 2LJ3A 1UEBA 3SWNA 3FLGA 1YNZA 2M0YA 1OZ2A 3MHXA 4J6XA 3HTRA 3QZ9B 1WHGA 4KBMB 1GFDA 4C8QF 2K5FA 4A63B 2OAUA 2GGRA 4C0ZA 4R55A 1KQ2A 1VA7A 1GCQC 2OX7A 5KE3A 3ZL7C 2C06A 3L42A 2HCKA 1VOMA 1VQNT 2ZPHB 1WHKA 4LNPA 2CSQA 3G4ST 4GY5A 2COWA 4DBHA 4WCIA 1HK9A 4NL3A 4CC3A 3BDUA 2WSEE 4AFUC 3FDRA 2LQWA 5GMKe 2EBPA 1OPKA 4ELYC 3CCQT 3OSSC 1M1KC 3E19A 1WXBA 2YDLA 1Q7YU 2DJZA 2X3WD 3J7AF 1BI0A 3TSWA 5I21A 1U3OA 1I07A 1ABQA 1UHFA 1K73C 3NTHA 4KULA 2NLUA 3CCJQ 4M7DE 5J26A 4KUDK 2GTOA 1KK7A 3CCMQ 1VQMA 2ZPEB 5IHKA 5EG2A 1QKXA 4M75E 2DBMA 3CCEA 1QWFA 2LT1A 2O9VA 2JZ2A 5M9OA 2E5KA 3A8HB 1JBMA 4BE1A 2PTKA 1MV0B 2VXEA 2HKNA 5GMKj 4JS4A 1O75A 4Y92A 2C0IA 2VWFA 1Q81U 3I56T 1NYGA 3AHUA 4E7KA 3OYNA 2XK0A 5GAMh 5CR2A 2VGMA 4M7AG 1X01A 3C95A 3MEAA 3JCMf 1Q82R 2LVMA 3SD4A 4RG8A 2DTHA 3MCAB 2PVOB 1CKAA 1G3WA 1AHJB 4JZ4A 1LCKA 4QVDA 4M78E 2MCNA 4F04B 1ZBJA 1ZSGA 4ZN3A 2D0QB 2EKHA 3C94A 4O5VA 5CKDA 3I55A 3Q1JA 1NZ9A 1M5Q1 2MAMA 3M56A 4J9HA 2LC4A 3RBBB 3MJXA 2O01E 2XD0A 3EGXA 1YIJQ 4JJDA 2EYWA 2BE7D 5ECAA 4MMKA 3RNJA 3H9NA 5CVIA 1W2BA 1W4SA 1WJQA 4DOWA 4DA4A 1KC8R 4DOVA 4ANJA 5KE2A 2RJFA 3LWIA 3V7CA 3LWHA 1YFNA 2V8KA 5KYXA 2H8HA 2DL4A 1XNIA 2EYQA 1UHCA 5I22A 4JRQA 1VIFA 1JXMA 1LNXA 4PJMA 2P0QA 1D0ZA 5KYUB 3FJ5A 2DBKA 2OTJQ 4C8QG 1RADB 1VIEA 2DIQA 2LQKA 4E6RA 5LJ3d 2VB6A 3PGGA 3EHQA 5A0DA 4Q5WA 1AWWA 1YHQQ 2KQWA 3EH2A 3GP8A 3CXCA 3CCRA 5I2MA 3H0FA 1Q86U 2ZPFB 1M90U 3QJ6A 2DYBA 3E2UA 3VUZA 2DMOA 2RHXA 3P8DA 1ZUUA 1UDLA 3PTAA 4BDZA 2DRKA 2C0OA 2BUDA 1GCPA 4X9CA 3JB9H 4OP0A 1BCOA 4FW1A 3OS2A 1FWZA 1BIBA 3H0IA 1WFWA 2VVKA 2IVWA 3VS6A 4RTYA 3G4SQ 5I2SA 1WHLA 2H3EB 2X3XD 3RESA 5HCKA 2HNIA 3RMQA 2DE0X 2V26A 2AZSA 2RM4A 5AT1B 1WGSA 3CCQQ 1N6AA 4RTTA 5CQXA 3VU3C 1CSKA 2RHYA 2WSCE 4M7AA 1TSFA 1D0YA 3A5ZB 1KQSA 5L23A 1VQ6A 2KSSA 4OMFB 2NUTA 3JB9D 4AT1B 4M4ZA 2EQIA 2G6FX 4RKUE 4FYXB 4IIOA 3CC2T 5LL6S 4XU2A 4E7SA 5FROA 4C0GA 2PQWA 3HKSA 2RN8A 3UWNA 1GRIA 3EHRA 2F2XA 1I81A 4DEYA 4BD3A 2YHTA 4EMKA 3OSVA 3L2RA 2M16A 3CC4T 4JLIA 3I56Q 4KUIA 4EPCA 1G8XA 5IHNA 1Z9QA 3VS5A 5FU7C 1K9MU 2JS2A 3DLMA 2ECZA 2NUPA 1UGPB 5KYWB 1AT1B 2DFUA 3M9QA 1BCMA 4HT9A 2QXFA 4J9GA 2QA4A 1YITQ 1VQKT 2E70A 3REAB 2LX9A 4NOYA 1WQWA 1VQ5A 4C5EA 4QQGA 4FU6A 3QG1A 3GLXA 1VYTA 2CH4W 5IHIA 4B9XA 1B3QA 1MNEA 2QQBA 2X9HA 2R58A 4J8OA 2AKLA 3VUBA 2GNCA 1WJSA 2DVJA 1U1SA 3GNGA 5IN1A 2DK3A 2E64A 1GL5A 2DLPA 1YCYA 1TG0A 5GJWB 2OJ2A 1S72T 3AT1B 2YRCA 1KHCA 1WZOA 4PJOC 2EGEA 1FYNA 3KBGA 2BZXA 2D9TA 4C5IA 3P8HA 1VQOT 2K2VA 4MMLA 2OAWA 3UT1A 4OB3B 5LJ3g 5GMKm 4RTWA 4L6V5 3ER0A 3CCUT 3EGDB 4A4HA 4BUGA 2HL5C 1D1CA 4PJJA 2DD4A 5KCHA 1VQ4A 1YJNT 2HSEB 2LCSA 2XDPA 4IIMA 1X6BA 1TUDA 3V8KA 2JS0A 3CCLT 4BDYA 3MKDA 2YUQA 4WTOB 1LOJA 2E6NA 2YWWA 1WI7A 4LUEA 4B6MA 1HYOA 3V8JA 1ZA1B 3JCMJ 2YXYA 2DETA 2X35A 5GAN4 2B86A 1K4US 2JTFA 2QAZA 4P5NA 2RQUA 3VRYA 3OB9A 2E4HA 3OYFA 3PT9A 2QEXQ 4J83A 1NJIU 4ATOA 1PNJA 2RI5A
chains in the Genus database with same CATH topology
3GNFB 2DEQA 1VQKA 4EMKB 3CCJA 1SSFA 3M4YA 2OTLA 1XOVA 1QP3A 3C4SA 4HT8A 2GQVA 4C0DB 3QXEB 2EQUA 2LCCA 3PIOA 3CMET 3KXTA 2H3JA 2QI2A 2PU9B 3CC7A 4IUVA 3CCST 1VQMT 1BI2A 2EQKA 2RHUA 3BFMA 5IAYA 3CCVA 3CCET 3ASKA 3CCMA 1MGQA 1MHNA 2VC8A 4HA8A 4JRKA 3TCJA 2CS7A 5GAN6 2DZCA 2MWOA 3OYAA 1YJ9T 1QVGS 4LDVA 3O8VA 1WJRA 3NTKA 3HSBA 1RI0A 1NPRA 3M5AA 4ELZC 5GAOr 2EFIA 1I4K1 2CGHA 2GFAA 3V8LA 1W2BS 2OTJT 1X75C 2FL7A 1D3BA 2R5MA 5D6WA 2XIDA 3CPWA 1LJOA 3HHTB 4J5YA 5GAOp 2QQAA 3JRZA 3MEUA 1JJ2S 5GANh 1VQNA 1GXIE 3M59A 4M78G 3S3NA 3LH0A 5CKFA 4BE0A 2JNGA 1M9SA 3OBWA 4N0AA 2RK1A 4XU1A 3CPFA 3BY7A 1S72A 2BIVA 1Q7YC 2FHDA 1U1TA 1YHQA 2LDMA 2P0KA 3OYBA 3ZFJA 1BI1A 2RJEA 3QKJA 4N4GA 4J7FA 4BI3A 2VGNA 1YJWA 3HPWA 1QVFS 3QSUA 3SWNA 1UEBA 3CCQA 1N8RU 3FLGA 2RHIA 3LYIA 3V7SA 1O9SA 2OTLT 3G6EA 2F69A 2ZCFB 5L8RE 4V2SA 4Y28E 5CAIA 1EIFA 3SFMA 3CC7T 1OZ2A 3MHXA 4J6XA 3G71T 4LDUA 2B8AA 5FLXE 4N0AC 5GMKl 3QZ9B 1JB0E 3NFCA 4KBMB 4X9DA 4JLGA 3CCVT 4C8QF 2K5FA 1BI3A 1NE8A 2OAUA 4M77G 4PJOF 3SWNC 2JUFA 4N4HA 2DZ9A 4CRIA 1OI1A 3CCUA 4Z02A 4C0ZA 4C8QA 5GAN7 4R55A 1KQ2A 2DTIA 5KE3A 4PJOA 1H641 4PLIA 2K3XA 1ZHIA 4RCCA 4LD6A 3JCMb 2C06A 1BYMA 3L42A 1VQNT 5IT9E 2ZPHB 3OYKA 5LJ3h 2VXFA 2YLBA 4OB2B 3LX7A 3HFNA 3G4ST 5LJ5h 2PVGB 4GY5A 3I55T 2K4YA 1HK9A 4NL3A 3M58A 3BDUA 2GFUA 2WSEE 3FDRA 4E7HA 5GMKe 1RL2A 2YRVA 4ELYC 3CCQT 3VV0A 3OSSC 1Q81C 4BY6B 4C92B 1Y96A 3E19A 3OQ5A 3S3OA 2DJZA 1U8RA 1Q7YU 1M1KC 4KT0E 4HCCA 4FSXA 1BI0A 1N27A 5A2QE 3J7AF 2RH2A 1PSFA 1M1GA 2CKKA 1HXDA 4C92F 4F7UB 5I21A 5LJ5d 1X6OA 4M7AD 1FXXA 4OVAA 4QQDA 1ZBXA 3OS0A 1YIJA 1K73C 3NTHA 1VQ8A 4KULA 4F7UF 4LD9K 4IUUA 3VYGA 2NLUA 5C0MA 1KG1A 2DXUA 4M7DE 5J26A 3JB9J 3HP9A 4JRIA 5KH6A 2VUBA 4L5GA 2E5QA 2F5KA 2XDDA 4KUDK 4CI0C 3OY9A 1ZQ1A 4L59A 4PLLA 1B34B 5CKEA 3CMEA 4M7DA 5CKBA 3J80E 3EFSA 3KUFA 5HY6A 3CCSA 3JCMW 1TH7A 1IREB 3RIRA 1VQMA 3E9GA 2ZPEB 4JRPA 1YHQT 5FU6B 5EG2A 4M75E 3JCMg 2EJGA 3CCEA 3PMTA 4MZTA 1KQ1A 2LT1A 3FB9A 2JZ2A 3JSCA 3RKWA 5M9OA 3OYJA 3LLRA 3BW1A 1YJ9A 1Q82C 3A8HB 1JBMA 2MF2A 2EWNA 2RJCA 1KQSS 4M75A 4BE1A 4M7DC 3QO3A 2VXEA 2VYTA 2OTJA 3QIIA 5GMKj 4JS4A 2O4XA 3M53A 4A4FA 1O75A 4HCZA 4LDWA 1Q81U 1M1KU 3OA6A 1WNLA 1VQ8T 3I56T 4XK8E 3AHUA 2E6ZA 2QDYB 4E7KA 3JB9I 4EDUA 2XK0A 5GAMh 3OYNA 2PUKB 4XU3A 3F70A 3CCRT 4M75C 2VGMA 4UC4A 1VUBA 3QHSA 3MP1A 5CR2A 1X01A 4JS5A 2MWPA 3C95A 3HRUA 3MEAA 5FU7B 3JCMf 4M7AG 2QQ9A 2XKOC 3CEYA 4XTWA 3T9NA 3UPUA 5GAN8 2EJ9A 2LVMA 2X4WA 5A0GA 3SD4A 4RG8A 4BI4A 1XQHA 2DTHA 1Y7XA 3G71A 3MCAB 2XDBA 4NS5A 3VJPA 2RI3A 2PVOB 4IUQA 1QVPA 4HKEA 3X25B 3HL8A 1D3BB 5GAN5 5GAMg 1G3WA 3L2WA 3X20B 3JCMQ 1AHJB 2KMTA 3OYCA 1Q82U 4QVDA 2E65A 3R6OA 4M78E 2G3RA 2DAQA 3META 4LDXA 2EQJA 1YI2T 4PKCC 3SWNB 4C8QD 1KC8C 3INZA 1UGSB 3GF5A 4D6WA 4ZN3A 3G4SA 2D0QB 4O5VA 3C94A 5CKDA 3CD6T 4M78A 3JB9F 4PJOD 4ME7A 3FIFA 2PVDB 2EIFA 3I55A 1KD1C 3Q1JA 3P8BB 1NZ9A 1M5Q1 2MAMA 3M56A 3UDCA 3TEEA 3OW2S 3CMAA 2LC4A 3WVDB 1QVGA 3EAEA 2XICA 5GAMf 2O01E 2XD0A 4BI8B 5GANd 3OMGA 2FYKA 3QDRB 2CZ1B 1VQ6T 4MMKA 5J3BA 4C8QB 5CVIA 4M78C 1W2BA 1W4SA 3E1SA 1Q86C 1WJQA 3M4GA 4M77E 4DOWA 4EMKC 1M90C 3OYYA 4PJOB 3M55A 4DA4A 4DOVA 1JJ2A 1XTDA 5KE2A 3JCMP 2LRQA 2RJFA 2V8JA 4XTXA 1JRIA 3V7CA 3LWIA 4M77A 4J6WA 3JAME 3LWHA 2XHCA 2V8KA 3OYHA 5A0LA 3QYGB 4C92D 3MP8A 3QUIA 1XNIA 2A7YA 2EYQA 4J7IA 1QVFA 2R5AA 3C12A 4A4EA 4JRQA 1Y96B 3H8ZA 3J81E 1VIFA 2AHJB 4WF2A 1LNXA 2BKDN 1K73U 2P0QA 2QTXA 4M77C 4A4KA 1KC8U 3DKMA 4ZGJB 2DXTA 3ZBDA 4C8QG 3RERA 2GCXA 1VIEA 2DXBA 3CMAT 2D6FA 2DIQA 1Y07A 4BB7A 2LQKA 2ZGWA 4IUPA 1VQPT 3RUXA 4JJNK 1M1FA 3OMCA 3SB2A 1QW1A 3RKXA 3PNWC 1KD1U 5LJ3d 2X4XA 2ZPIB 3PGGA 2JOYA 5A0DA 3GIBA 3JCMh 4Q5WA 3L2VA 3I56A 1G3SA 1Y71A 5GANe 2KQWA 2L3RA 1OZ3A 2V8IA 2WACA 3GP8A 5KCOA 4M7DB 2JN0A 2HQEA 3CXCA 4XQ3A 2RJDA 2IG0A 3OYDA 3A8OB 3CCRA 5I2MA 1BKBA 1Q86U 2ZPFB 2RI2A 3RKYA 4N4IA 3OYLA 3QJ6A 1K8AC 1M90U 1UB4A 2LCLA 4FL6A 4M7DF 2M9UA 2QA4T 2P4TA 3VUZA 2RHXA 2DTOA 2LQ8A 4MDWA 4XTYA 2CZ0B 3QBYA 3JCMd 4R56A 2RD1A 3P8DA 2DIGA 4M75B 1VQ9T 3FRNA 3L2UA 3PTAA 4BDZA 1YITA 4IKFA 2K3YA 4PNOA 4C92G 2KY9A 4M75F 2BUDA 2O4XB 3ZEHA 2CZ6B 2EKOA 4X9CA 3V7RA 3G7ZA 4F7UG 3OS1A 3JB9H 2K5IA 2L89A 1G3YA 4OP0A 3OS2A 1VQ7A 1FWZA 1BIBA 2L8DA 2E1HA 3DB3A 3CBPA 4C5HA 1H3ZA 2IVWA 4IURA 5I2SA 5DLOA 1R8OB 3RESA 4QVZA 1YI2A 2DO3A 2E12A 4YTLA 3QYHB 2HNIA 3RMQA 1VQLT 4XAXB 4BY6C 1UGRB 3X26B 2RM4A 3MP6A 5LJ3e 1NPPA 1WGSA 3CD6A 2VV5A 3X24B 4M7AE 4RMOA 1N6AA 5LJ5e 5CO7A 2F5TX 5CQXA 1N9RA 3S6WA 2RHYA 2WSCE 2XI9A 3LGFA 3VU3C 4EMHA 5GANj 5J39A 5GAN2 4M7AA 3CBMA 3QZ5B 2RA2A 3CC4A 1K9MC 3A5ZB 5GAOm 4QW2A 4B9WA 2RHZA 3OYEA 5D6YA 2KK4A 4Y91A 3MO8A 2RO0A 1KQSA 4BACA 1VQ6A 2KSSA 4OMFB 4HCBA 5GAMd 3JB9D 3H6ZA 1YITT 3JCMV 2LTOA 1UGQB 3VYHB 2EQMA 2KAFA 4NL2A 1FX7A 2R57A 4II1A 2RK2A 2EJFA 4QQ6A 4RKUE 4ZTFA 4M7AC 3CC2T 3CBOA 2E10A 2FB7A 5LL6S 5CCAA 3S3MA 1VQ7T 4M78B 4XU2A 3CPWS 5FROA 1I8FA 4C0GA 1VQ4T 2PQWA 3HKSA 3OS5A 4M78F 1QP2A 3JCMc 4FT2A 3UWNA 4DQ2A 2K5LA 2P0PA 2M0OA 4RCBA 4M77D 5GMKi 1I81A 2KVQG 3HFOA 3GOXA 1G3TA 4VUBA 4BD3A 2JVVA 2YHTA 4OB0B 1DJ7B 3OYIA 1YBYA 4EMKA 1M8VA 3OSVA 3L2RA 5GMKh 4EMGA 5LJ3j 3N5BB 2MMPA 2E41A 4ZGDB 2M16A 3CC4T 5LJ5j 4JLIA 1VQPA 5CKHA 3FJPA 5HK0A 4KUIA 4ZTJA 2QQSA 4EPCA 3QJYA 4ZGEB 5DLQE 4JUVA 4M77B 5FU7C 2HBPA 1K9MU 1WPYA 3OYMA 4FT4A 3DLMA 3WXMB 5CQYA 4M77F 4C0DC 4E47A 1UGPB 5GAMe 2LNVA 3M9QA 3WVEB 3JB9G 5FRMA 4HT9A 2QXFA 2QA4A 1VQKT 3CCJT 4OB1B 2E70A 3OW2A 2LX9A 2X4JA 3PFSA 4GLKA 4C0FA 2QEXA 2EAYA 4NOYA 1VQOA 3ME9A 1WQWA 4MDXA 1VQ5A 1VQ9A 3QPHA 1WQ7A 4O6JA 4C5EA 4QQGA 4FU6A 4ZN1A 4C8QE 2LT4A 3QG1A 3GLXA 5GANg 5CIUA 4E7LA 5FRNA 3CCMT 2Y90A 4M7DD 4B9XA 3A8MB 4PJOE 2M1HA 4PL6A 2QQBA 3HRSA 3FEOA 2QQRA 2HD0A 3FC3A 2R58A 4X34A 2ZPGB 4J8OA 4OGCA 4PJOG 2CZ7B 3JCMX 3OBYA 3VUBA 4BE2A 1PSEA 4MZPA 4E7IA 1P92A 4E7JA 1WJSA 2DPPB 5CK9A 1YJNA 1U1SA 3GNGA 4FM4B 5D6XA 2DK3A 5IN1A 2E64A 5GAN3 3LGLA 4RG2A 1VQLA 1YCYA 4M75D 3CXCS 1M4ZA 4A53A 1V29B 3L2ZA 2PUOB 3CCLA 3M57A 1S72T 4C8QC 2K57A 3EFRA 1YJWT 1KHCA 5GANf 4OF1A 5GAOl 3L2QA 4PJOC 5GAMj 3PMIA 1IZ6A 1I5LA 1OYXA 2Y4YA 2MI6A 4C5IA 3KBGA 3PIPA 2D9TA 5C6SA 3P8HA 5HK3A 4C92E 3G6ET 2QEXT 1VQOT 2DXCA 2K2VA 1VQ5T 2CYZB 4MMLA 1G5VA 4XTUA 3RMSA 4F7UE 3TREA 5HKCA 3DLLA 3UT1A 3A8LB 4OB3B 5LJ3g 2XU8A 3OYGA 3URGA 3GPLA 1NJIC 5GMKm 2GF7A 4C92A 4XU0A 2KDSA 2WSFE 4L6V5 5LJ5g 3ER0A 2YLCA 3CCUT 4A4HA 3NTIA 2JTMA 2XG8D 3HRTA 4BUGA 4F7UA 1BIAA 4TVRA 3VKIA 3CC2A 2DD4A 3E9FA 5KCHA 3L1AA 4M7DG 1VQ4A 2I2LA 3X28B 1N9SA 4A54A 1YJNT 2XDPA 5DM7R 4M7AB 4XTZA 3BDLA 3V8KA 4C92C 4MZMA 3CCLT 4M7AF 4BDYA 2ZZDA 4XTVA 1LOJA 2X4YA 2ZPBB 5GAOn 3M54A 2E6NA 1B34A 4M75G 5LJ3f 2FVUA 4FIBA 5DY9A 3TU4K 1KHIA 5AYFA 3V8JA 4LDYA 4M78D 5LJ5f 2RB6A 3DB4A 2DVEA 1K8AU 4QVCA 3JCMJ 2L5QA 2X35A 2HAXA 2DD5A 4J6YA 5GAN4 5GAOq 4C5GA 1YIJT 3JCMe 2JTFA 4P5NA 3LW5E 2DKGA 2A3LA 3MEWA 1N8RC 4OGEA 3SDZA 2HQXA 3OB9A 4JDSA 3MEVA 2Y4XA 4A4GA 3OYFA 3PT9A 5FU6C 4J83A 1NJIU 4IUTA 4ATOA 3A8GB 2RI5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M75 E;  2DEQ A;  4M77 F;  3SB2 A;  2EJG A;  3RKX A;  3JCM g;  4EMK B;  5LJ3 d;  4HT8 A;  1KQ1 A;  3FB9 A;  5GAM e;  3PGG A;  3RKW A;  3JB9 G;  3GIB A;  3BW1 A;  1JBM A;  3JCM h;  4HT9 A;  2EWN A;  4M75 A;  4M7D C;  5GAN e;  3QO3 A;  3BFM A;  2VXE A;  4M7D B;  2JN0 A;  1MGQ A;  4HA8 A;  2VC8 A;  4JRK A;  4XQ3 A;  5GMK j;  5GAN 6;  2DZC A;  1M8V A;  2EAY A;  4NOY A;  3RKY A;  1WQW A;  4M7D F;  1WNL A;  1WQ7 A;  3HSB A;  5GAO r;  3AHU A;  4C8Q E;  3JB9 I;  1I4K 1;  2CGH A;  5GAM h;  4XU3 A;  2DTO A;  4XTY A;  3V8L A;  2Y90 A;  5GAN g;  4M7D D;  3JCM d;  2RD1 A;  1D3B A;  4PJO E;  4M75 C;  1LJO A;  5GAO p;  3QHS A;  4J5Y A;  4M7A G;  1X01 A;  4M75 B;  3JCM f;  5GAN h;  4M78 G;  4XTW A;  4PJO G;  3JCM X;  4PNO A;  4C92 G;  5GAN 8;  2EJ9 A;  4M75 F;  4N0A A;  4XU1 A;  1U1S A;  3BY7 A;  4X9C A;  2DTH A;  1U1T A;  2E64 A;  3V7R A;  4F7U G;  5GAN 3;  3JB9 H;  4OP0 A;  1YCY A;  4M75 D;  1BIB A;  3QSU A;  4A53 A;  2E1H A;  3SWN A;  3L2Z A;  3V7S A;  1D3B B;  5GAN 5;  4V2S A;  5GAM g;  3RES A;  4C8Q C;  5CAI A;  2K57 A;  3EFR A;  4J6X A;  5GAN f;  5GAO l;  2HNI A;  4N0A C;  5GMK l;  3JCM Q;  4PJO C;  5LJ3 e;  5GAM j;  2RM4 A;  4M7A E;  4X9D A;  1I5L A;  4C8Q F;  4QVD A;  2E65 A;  4M78 E;  4M7A D;  5LJ5 e;  4C92 E;  3VU3 C;  1N9R A;  4M77 G;  4PJO F;  3SWN C;  4EMH A;  5GAN j;  2DZ9 A;  4MML A;  5GAN 2;  3SWN B;  4XTU A;  4C8Q A;  3INZ A;  4C8Q D;  4F7U E;  5GAN 7;  1KQ2 A;  2RA2 A;  4M7A A;  3JB9 F;  5LJ3 g;  2DTI A;  4M78 A;  5GAO m;  4PJO A;  1H64 1;  5GMK m;  3FIF A;  4PJO D;  4Y91 A;  4RCC A;  4XU0 A;  4C92 A;  3JCM b;  5LJ5 g;  2YLC A;  1M5Q 1;  5GAM d;  3JB9 D;  5LJ3 h;  2VXF A;  2YLB A;  3JCM V;  4F7U A;  1BIA A;  3HFN A;  5GAM f;  5LJ5 h;  3L1A A;  4M7D G;  2I2L A;  5GAN d;  1N9S A;  4NL2 A;  4A54 A;  2FYK A;  1HK9 A;  4NL3 A;  4M7A C;  2EJF A;  4MMK A;  3BDU A;  4C8Q B;  4M7A B;  4M78 C;  4XTZ A;  3V8K A;  2E10 A;  2FB7 A;  5GMK e;  4C92 C;  4M78 B;  3M4G A;  4M77 E;  4XU2 A;  4PJO B;  4EMK C;  4C92 B;  1Y96 A;  4M7A F;  2DJZ A;  1I8F A;  4XTV A;  1LOJ A;  4M78 F;  3JCM P;  3JCM c;  4DQ2 A;  5GAO n;  4F7U B;  1HXD A;  4C92 F;  1B34 A;  5I21 A;  4XTX A;  1JRI A;  4M75 G;  4RCB A;  5LJ3 f;  4M77 D;  4J6W A;  4M77 A;  1I81 A;  5DY9 A;  3V7C A;  3HFO A;  3V8J A;  5GMK i;  4M78 D;  5LJ5 f;  2RB6 A;  4F7U F;  2YHT A;  2DVE A;  4C92 D;  4QVC A;  3QUI A;  4EMK A;  2DXU A;  3JCM J;  4M7D E;  5GMK h;  4EMG A;  5LJ3 j;  3JB9 J;  4J6Y A;  5GAN 4;  5GAO q;  2E41 A;  1Y96 B;  4JRI A;  4JLI A;  5LJ5 j;  3JCM e;  3FJP A;  4WF2 A;  1LNX A;  2DKG A;  2QTX A;  4M77 C;  1B34 B;  5LJ5 d;  4M7D A;  4JUV A;  4M77 B;  2DXT A;  3EFS A;  4C8Q G;  3RER A;  1WPY A;  3JCM W;  1TH7 A;  3RIR A;  2ZGW A;  3RUX A; 
#chains in the Genus database with same CATH topology
 2DEQ A;  3H0H A;  1JQQ A;  1M27 C;  4HT8 A;  3QXE B;  3CME T;  1AD5 A;  3CCS T;  1QVG P;  2E3H A;  1V1C A;  3NHN A;  4JRK A;  2D8J A;  5GAN 6;  2DZC A;  2MWO A;  3M5A A;  1NPR A;  4PFO A;  5GAO r;  2EFI A;  2LJ0 A;  2GFA A;  3M0U A;  2KT1 A;  1LJO A;  4FYV B;  2PZ1 A;  1GXI E;  1VQN A;  3M59 A;  1M30 A;  1MMN A;  2COY A;  3LH0 A;  3S3N A;  1WXT A;  2D0N A;  4BE0 A;  2BIV A;  1Q7Y C;  1U1T A;  1YJW A;  1BI1 A;  2RJE A;  3QKJ A;  2VGN A;  1M3A A;  3QSU A;  4QT7 A;  3CCQ A;  1N8R U;  1O9S A;  4J9E A;  3G6E A;  2ZCF B;  4V2S A;  4Y28 E;  2DL7 A;  1G83 A;  4N0A C;  2GTJ A;  3CC2 Q;  2HMA A;  1NE8 A;  2LMJ A;  4PJO F;  2CP3 A;  2JUF A;  4CRI A;  1OI1 A;  1PD0 A;  4PLI A;  4RCC A;  4LD6 A;  1BYM A;  1WHH A;  2KRS A;  5LJ3 h;  1NM7 A;  1T0J A;  3CC4 Q;  1SPK A;  1RL2 A;  2XMF A;  1Q81 C;  4BY6 B;  1PSF A;  1M1G A;  1HXD A;  5KYU A;  5LJ5 d;  4M7A D;  1FXX A;  1ZBX A;  2NYS A;  1LVK A;  4IUU A;  4CC4 B;  1KG1 A;  5C0M A;  1VQK Q;  2K9G A;  3HP9 A;  4KH0 B;  3CC7 Q;  2E5Q A;  2F5K A;  4PK4 A;  3OY9 A;  2C0T A;  5CKE A;  5CKB A;  3EFS A;  5HY6 A;  2KXC A;  3RIR A;  4E7Z A;  4JRP A;  3PMT A;  1I1J A;  4MZT A;  3OYJ A;  1YJ9 A;  3BW1 A;  2MF2 A;  2EWN A;  2RJC A;  1QCO A;  1RAG B;  3R6N A;  3M53 A;  4A4F A;  4HCZ A;  2KI7 A;  4LDW A;  1S72 Q;  3CQT A;  3OA6 A;  1WNL A;  2FG0 A;  4EDU A;  2A28 A;  1W70 A;  2F2W A;  3QHS A;  3MP1 A;  4ORZ A;  3HRU A;  3T9N A;  3UPU A;  1UGV A;  5A0G A;  4BI4 A;  1Y7X A;  3G71 A;  2CDT A;  2SRC A;  3VJP A;  2L3S A;  4IUQ A;  1ABO A;  3CCU Q;  3X25 B;  3HL8 A;  5GAN 5;  3A1P A;  1E6G A;  2DF6 A;  5GAM g;  4PFP A;  1YJN Q;  3X20 B;  3IQL A;  3OYC A;  1Q82 U;  2E65 A;  2ZAE A;  2G3R A;  3CCL Q;  4LDX A;  2MOX A;  1M2V B;  3TSZ A;  4C8Q D;  3INZ A;  1UGS B;  3GF5 A;  4D6W A;  1D1A A;  1ACM B;  2EIF A;  3UDC A;  3TEE A;  1QVG A;  1VQ8 Q;  4DBR A;  3OMG A;  2FYK A;  3QDR B;  4Z89 A;  4C8Q B;  1Q86 C;  3M4G A;  1M90 C;  4E2F B;  1XTD A;  4XTX A;  3CME Q;  1KD1 R;  1N5Z A;  2XHC A;  3SHW A;  3CCS Q;  5A0L A;  1IGQ A;  3QUI A;  1UE9 A;  1PG5 B;  1QVF A;  2R5A A;  5KYW A;  4QKU A;  2JW4 A;  1MV3 A;  1TUG B;  9ATC B;  4KGX B;  4M77 C;  1FMW A;  4A4K A;  4HVU A;  1KC8 U;  4ZGJ B;  2RQT A;  3RER A;  3D7S B;  1YCS B;  2DXB A;  5FWC A;  4BB7 A;  2ZGW A;  3RUX A;  3OMC A;  3PNW C;  1RAE B;  2YUP A;  3C0C A;  1G3S A;  5GAN e;  2L3R A;  1TUC A;  1OZ3 A;  2HQE A;  1ZSZ B;  4XQ3 A;  2RJD A;  3OYD A;  1BKB A;  3OYL A;  4N4I A;  1UB4 A;  2P4T A;  1GBQ A;  1OQK A;  2CZ0 B;  2AIR B;  3JCM d;  3BE3 A;  2ATC B;  4IKF A;  1VQ9 T;  3FRN A;  3L2U A;  1SKU B;  1G2B A;  4J9B A;  1Y57 A;  2O4X B;  3EH1 A;  2ABL A;  3G7Z A;  2EVR A;  3LH5 A;  3THK A;  3OS1 A;  2QGG A;  1K8A R;  2E1H A;  1AZG B;  3CBP A;  4C5H A;  1H3Z A;  3EGU A;  5DLO A;  1YI2 A;  2K3B A;  2DO3 A;  4YTL A;  1WA7 A;  2J06 A;  3EGD A;  3CD6 A;  1VYV A;  4M7A E;  1NPP A;  2VV5 A;  3X24 B;  3CMA Q;  2BE9 B;  5FW9 A;  5LJ5 e;  1AVZ C;  5KYN A;  2F5T X;  1N9R A;  5GAN j;  4EMH A;  5J39 A;  5GAN 2;  1HSQ A;  3CC4 A;  1K9M C;  5GAO m;  4QW2 A;  4R0K A;  1FMK A;  1MMA A;  3MO8 A;  4BAC A;  2QTV A;  4HCB A;  1RAI B;  1YIT T;  2LJ1 A;  1OX8 A;  1TTH B;  2FZG B;  2EQM A;  4NL2 A;  4ZTF A;  2K79 A;  2LZ6 B;  3KFV A;  3CBO A;  5CCA A;  3S3M A;  4OMO A;  3CPW S;  1YP5 A;  2MIO A;  5D7U A;  3OS5 A;  1SHG A;  3JCM c;  1SHF A;  4JZ3 A;  4HVW A;  2BZY A;  4RCB A;  4M77 D;  2KVQ G;  3HFO A;  2CH4 A;  2JVV A;  1LPL A;  1OV3 A;  2NUZ A;  5GMK h;  4EMG A;  3N5B B;  5LJ5 j;  1VQP A;  2BTT A;  3FJP A;  4ZTJ A;  3PE0 A;  1JJ2 P;  2QQS A;  2JXB A;  4M77 B;  1UEC A;  3WXM B;  4M77 F;  4C0D C;  1YWP A;  1IHV A;  2EYY A;  2DM1 A;  1EX4 A;  4OB1 B;  2X4J A;  4C0F A;  2EYZ A;  2EAY A;  1VQO A;  1WHJ A;  1SRL A;  1WQ7 A;  4O6J A;  2K7A A;  4AG1 C;  4C8Q E;  2Y90 A;  4OML A;  3A8M B;  4PL6 A;  2HD0 A;  2FZK B;  1OUL A;  2DL3 A;  4MZP A;  4E7I A;  2DPP B;  1YJN A;  5D6X A;  3LGL A;  4RTX A;  1VQL A;  3CXC S;  4A53 A;  1W1F A;  2PUO B;  3CCL A;  3M57 A;  2J05 A;  4EIK A;  1M3C A;  2K57 A;  4JJC A;  3UAT A;  4OF1 A;  2W10 A;  2BZ8 A;  5C6S A;  2QEX T;  2DXC A;  2CYZ B;  1G5V A;  3DLL A;  3OYG A;  3URG A;  1NJI C;  2KDS A;  3H41 A;  2JTM A;  2XG8 D;  2RPN A;  1BIA A;  3G1J A;  3E9F A;  3L1A A;  4KH1 B;  2I2L A;  1R77 A;  1N9S A;  1RAB B;  1OX9 A;  1ZLM A;  3QWX X;  2RQR A;  1QWE A;  4C92 C;  1SF9 A;  1QCN A;  2KRM A;  2X4Y A;  4D8K A;  3M54 A;  3I5R A;  5LJ3 f;  3QDF A;  1QCF A;  2FVU A;  3TU4 K;  2AT1 B;  1KHI A;  5AYF A;  4LDY A;  1OOT A;  2FRW A;  2COZ A;  2RB6 A;  2DVE A;  4LXC A;  4J9C A;  3PVL A;  2L5Q A;  3NPF A;  1BBZ A;  3JCM e;  2FPE A;  3PVQ A;  2A3L A;  1N8R C;  1C1A A;  2JTE A;  5FU6 C;  4IUT A;  1UUE A;  1VQ9 Q;  3CCJ A;  3M4Y A;  1QP3 A;  4C0D B;  3PIO A;  1ZUY A;  2LCC A;  1MUZ A;  2PU9 B;  4IUV A;  4KGV B;  1VQM T;  2RHU A;  5IAY A;  2PNI A;  3CCE T;  5IXF A;  3CCM A;  1MHN A;  1K0S A;  3OYA A;  3NTK A;  2EPD A;  2MYS A;  2CGH A;  2I0N A;  1X75 C;  2R5M A;  2XID A;  3M0S A;  2ROT A;  3MEU A;  1JJ2 S;  5I11 A;  2L2P A;  1MMG A;  1M9S A;  3OBW A;  4N0A A;  1UJY A;  4XU1 A;  2LDM A;  4HCC A;  4BI3 A;  2EYX A;  2HBW A;  3HPW A;  1M2V A;  2MPX C;  1WX6 A;  5IH2 A;  2OTL T;  3SFM A;  3CC7 T;  5FLX E;  4DBQ A;  1JB0 E;  3NGP A;  3CCV T;  1PKS A;  1BI3 A;  4RTV A;  4M77 G;  4N4H A;  2DZ9 A;  1J3T A;  4Z02 A;  4C8Q A;  2DTI A;  2JM9 A;  1H64 1;  2K3X A;  1ZHI A;  1PM3 A;  3EFO B;  3JCM b;  3LX7 A;  3HFN A;  4J9F A;  3I55 T;  1PWT A;  4E7H A;  1SSH A;  1IB8 A;  3VV0 A;  4C92 B;  3OQ5 A;  1U8R A;  4KT0 E;  1PRM C;  2RH2 A;  2CKK A;  1X2Q A;  4C92 F;  4F7U B;  1X6O A;  2JMC A;  1YIJ A;  3OS0 A;  1EZZ B;  4F7U F;  4LD9 K;  1E6H A;  1YN8 A;  2FZC B;  2CRE A;  3JB9 J;  2YSQ A;  2V1Q A;  4FCY A;  5KH6 A;  2YRD A;  2VUB A;  4L5G A;  2MK5 A;  4KGZ B;  4CI0 C;  4L59 A;  1X27 A;  1M1K R;  1ZSZ A;  2D8H A;  2QG9 B;  2HL3 A;  3J80 E;  3KUF A;  3TVT A;  5IXB A;  5FU6 B;  2CP7 A;  1K73 R;  1KQ1 A;  3FB9 A;  1MMD A;  3JSC A;  3RKW A;  1Q82 C;  3VS0 A;  4M7D C;  2VYT A;  2OTJ A;  3QII A;  2O4X A;  1B7T A;  1TOV A;  1VQ8 T;  3QWY A;  2E6Z A;  3VS2 A;  3JB9 I;  5FWB A;  1IRX A;  3CCR T;  4M75 C;  4UC4 A;  1C0M A;  1YHQ A;  4JS5 A;  1TS9 A;  5FU7 B;  1Y0M A;  2QQ9 A;  2XKO C;  1KFZ A;  2EJ9 A;  2X4W A;  1XQH A;  4NS5 A;  2RI3 A;  4HKE A;  1PCX A;  1D3B B;  2KT8 A;  3JCM Q;  2DNU A;  2KEA A;  2KMT A;  1Z9Z A;  1H8K A;  3MET A;  4D8D A;  4PKC C;  1KC8 C;  3G4S A;  4PJO D;  4ME7 A;  4AFZ C;  2PVD B;  1H3H A;  1RAH B;  3P8B B;  2AZV A;  4FYY B;  3OW2 S;  2ED0 A;  3EAE A;  5GAM f;  1NEB A;  8ATC B;  5GAN d;  2QK0 A;  1GCQ A;  1VQ6 T;  5J3B A;  2KXD A;  4M78 C;  3E1S A;  4PJO B;  1NYF A;  1BK2 A;  4EMK C;  3OYY A;  3JCM P;  2J6K A;  2LRQ A;  2CUD A;  1JRI A;  2FPF A;  4M77 A;  3JAM E;  1PRL C;  2HZY A;  1T3L A;  2FO0 A;  3QYG B;  1VQM Q;  1QMC A;  3MP8 A;  2A7Y A;  3CCE Q;  3C12 A;  2LNH B;  1Y96 B;  3J81 E;  1R0B G;  3ULR B;  2HKQ B;  3CMA T;  1S1N A;  4IUP A;  3SB2 A;  1KD1 U;  1QW1 A;  2X4X A;  2ZPI B;  2JOY A;  3GIB A;  1EFN A;  3I56 A;  3EG1 A;  4M7D B;  5KCO A;  4F17 A;  2OTL Q;  1M8V A;  4M7D F;  1RUW A;  4FL6 A;  2LCL A;  4JPB W;  4RTU A;  2QA4 T;  1OPL A;  2DTO A;  4MDW A;  4XTY A;  3QBY A;  4R56 A;  3CCV Q;  1D09 B;  4M75 B;  2P84 A;  1YIT A;  3NMZ C;  1SG5 A;  4PNO A;  4C92 G;  2KY9 A;  4M75 F;  3ZEH A;  2EKO A;  2VAS A;  3V7R A;  4F7U G;  2O31 A;  2A08 A;  2L89 A;  1G3Y A;  1QKW A;  2L8D A;  3DB3 A;  4FYW B;  4IUR A;  4JJB A;  4QVZ A;  3I55 Q;  4LN2 A;  2E12 A;  3QYH B;  4XAX B;  1UGR B;  3MP6 A;  2LP5 A;  4RMO A;  1UTI A;  1TWB A;  2XI9 A;  4OMQ A;  3CBM A;  3QZ5 B;  2GQI A;  2DX1 A;  2RHZ A;  3OYE A;  5D6Y A;  4Y91 A;  1X43 A;  2RO0 A;  1TU0 B;  3H6Z A;  1MND A;  3JCM V;  1WDX A;  2LTO A;  4CC2 A;  3VYH B;  4ZNX A;  2IPO B;  3CPW P;  1ARK A;  1FX7 A;  2R57 A;  4QQ6 A;  4II1 A;  2EJF A;  1VQ7 T;  2FB7 A;  2YUO A;  4M78 B;  1VQ4 T;  4M78 F;  1QP2 A;  2OI3 A;  4FT2 A;  5KYY B;  2K5L A;  2M0O A;  4KRT A;  2L0A A;  1G3T A;  4VUB A;  4OB0 B;  1DJ7 B;  3OYI A;  1YBY A;  1NLP C;  4GLM A;  2MMP A;  2E41 A;  3QJY A;  1X69 A;  1A0N B;  5DLQ E;  4JUV A;  2J6O A;  2DEU A;  2HBP A;  1WPY A;  3UF4 A;  3OYM A;  3CCR Q;  5CQY A;  2CUB A;  3I9Q A;  5GAM e;  3SEM A;  2LNV A;  2QDL A;  4RTZ A;  1SRM A;  1X6G A;  2A36 A;  4GLK A;  2L3P A;  3PFS A;  2QEX A;  4MDX A;  3QPH A;  2O88 A;  2LT4 A;  5GAN g;  5CIU A;  4PJO E;  2M1H A;  3HRS A;  3FC3 A;  4X34 A;  1X2K A;  2ZPG B;  4PJO G;  2CZ7 B;  3OBY A;  1PSE A;  3CXC P;  1AEY A;  5CK9 A;  4FM4 B;  4X1V A;  3EG3 A;  1RLP C;  4ESR A;  4RG2 A;  1M4Z A;  1VYU A;  1V29 B;  1M3B A;  1C6V X;  2D1X A;  1E7O A;  3EFR A;  3EFO A;  1YJW T;  3L2Q A;  1VQ6 Q;  1PKT A;  5GAM j;  1IZ6 A;  1I5L A;  3MPU B;  1OYX A;  2HQH A;  2MI6 A;  2V1R A;  2Y4Y A;  4J9I A;  3G6E T;  5EC7 A;  3RMS A;  3M0P A;  3VRZ A;  3GPL A;  4C92 A;  4XU0 A;  5LJ5 g;  3CC2 A;  3HRT A;  4F7U A;  4HCK A;  4M7D G;  3X28 B;  1XJW B;  4XTZ A;  2CT3 A;  4MZM A;  1KQS P;  2ZZD A;  4XTV A;  2IIM A;  2ZPB B;  4OMM A;  5GAO n;  4M75 G;  1IO6 A;  4FIB A;  2KRO A;  2FPD A;  3DB4 A;  4QVC A;  2M51 A;  2HDA A;  5GAO q;  3U23 A;  2DKG A;  2QA4 Q;  3MEW A;  4JDS A;  1IGU A;  3TQ7 P;  3I35 A;  3A8G B;  3GNF B;  1WLP B;  1VQ5 Q;  1VQK A;  2OTL A;  3C4S A;  2EQU A;  3KXT A;  3CC7 A;  2EQK A;  3CCV A;  3ASK A;  2VC8 A;  2DJQ A;  1YJ9 T;  4LDV A;  3HSB A;  1I4K 1;  1KSW A;  3V8L A;  1W2B S;  2KYB A;  1D3B A;  5D6W A;  3CPW A;  3HHT B;  4J5Y A;  3JRZ A;  5GAN h;  4M78 G;  1HJD A;  5CKF A;  2JNG A;  2RK1 A;  3BY7 A;  1S72 A;  2CP6 A;  3A98 A;  4N4G A;  4J7F A;  1AWJ A;  1T0H A;  3LYI A;  2RHI A;  3V7S A;  1I0C A;  2F69 A;  5L8R E;  4AFQ C;  5CAI A;  1EIF A;  3VS3 A;  3G71 T;  4LDU A;  2B8A A;  5GMK l;  1K0X A;  2K2M A;  3NFC A;  4X9D A;  1JO8 A;  4JLG A;  1VQ7 Q;  3RDV A;  2QAS A;  1D1B A;  2CP2 A;  1VQ4 Q;  3SWN C;  2DIL A;  3CCU A;  1Q7Y R;  5GAN 7;  4PJO A;  5IT9 E;  3OYK A;  2VXF A;  2YLB A;  3M0T A;  4OB2 B;  5LJ5 h;  3VS1 A;  2PVG B;  2FEI A;  2K4Y A;  3M58 A;  4LE9 A;  2GFU A;  2YRV A;  1Y96 A;  1RLQ C;  3S3O A;  4DBF A;  4FSX A;  5A2Q E;  1N27 A;  2DL5 A;  2CP5 A;  4OVA A;  4QQD A;  2DA9 A;  1VQ8 A;  3VYG A;  2W0Z A;  2FRY A;  3I5S A;  2DXU A;  2J6F A;  3EG9 B;  3M0R A;  2KRN A;  4JRI A;  2XDD A;  2DRM A;  1ZQ1 A;  2F1L A;  1Q81 R;  4PLL A;  1B34 B;  3CME A;  4M7D A;  3CCS A;  3JCM W;  1TH7 A;  1IRE B;  3E9G A;  3JCM g;  2EJG A;  3M0Q A;  3LLR A;  1KQS S;  4M75 A;  1VQN Q;  3QO3 A;  4OMN A;  1ZUK A;  2KGT A;  1OU8 A;  1M1K U;  1WXU A;  4XK8 E;  4DEX A;  1YJW Q;  2QDY B;  1NG2 A;  2PUK B;  4XU3 A;  3F70 A;  2CP0 A;  2EGC A;  1VUB A;  3G6E Q;  1K73 U;  2YT6 A;  2MWP A;  4HXJ A;  3CEY A;  4XTW A;  5GAN 8;  5GJV B;  1WYX A;  1GBR A;  1UFF A;  1NLO C;  2XDB A;  4K11 A;  1ZA2 B;  1QVP A;  1AWX A;  2F2V A;  3UA7 A;  3L2W A;  1FMV A;  3R6O A;  2DAQ A;  2EQJ A;  1YI2 T;  3RR6 A;  3SWN B;  3CD6 T;  3JB9 F;  4M78 A;  3OW2 P;  3FIF A;  1KD1 C;  1UJ0 A;  2VKN A;  5KYY A;  3CMA A;  3WVD B;  2RQW A;  2XIC A;  4BI8 B;  2CZ1 B;  1SEM A;  4M77 E;  1K76 A;  2ESW A;  1D0X A;  3M55 A;  1JJ2 A;  3EG0 A;  4GBQ A;  1OEB A;  2V8J A;  4J6W A;  3OYH A;  1BU1 A;  4C92 D;  4J7I A;  2ENM A;  1ZX6 A;  4A4E A;  1YJ9 Q;  3H8Z A;  2AHJ B;  4WF2 A;  2BKD N;  1Q86 R;  1JU5 C;  1M90 R;  2QTX A;  4RUG A;  3DKM A;  2DXT A;  2GBQ A;  3ZBD A;  2A37 A;  2GCX A;  2D6F A;  1Y07 A;  1RI9 A;  1VQP T;  1RAF B;  1AWO A;  4JJN K;  1M1F A;  3VS7 A;  3RKX A;  2X51 A;  2ROL A;  1QQJ A;  3JCM h;  3L2V A;  2DL8 A;  1Y71 A;  2V8I A;  2WAC A;  2JN0 A;  1AOJ A;  2IG0 A;  3A8O B;  2RI2 A;  2AK5 A;  3RKY A;  1I5O B;  1K8A C;  2M9U A;  3G71 Q;  4OMP A;  2RMO A;  2LQ8 A;  2RD1 A;  1JXO A;  1K9A A;  2DIG A;  2JT4 A;  2JM8 A;  2DYI A;  2K3Y A;  4Z8A A;  1RAA B;  2CZ6 B;  2K5I A;  4PJN A;  1VQ7 A;  1IXD A;  1Q95 G;  3GBQ A;  1R8O B;  1VQL T;  1U06 A;  4BY6 C;  5LJ3 e;  3X26 B;  4AMC A;  1BB9 A;  5CO7 A;  3S6W A;  1R0C B;  3LGF A;  2RA2 A;  1OU9 A;  1UG1 A;  4B9W A;  1KJW A;  2KK4 A;  4FW2 A;  2KE9 A;  5GAM d;  1UGQ B;  2KAF A;  1NEG A;  2O2O A;  4M7A C;  2RK2 A;  2NWM A;  2E10 A;  1TXQ A;  2KR3 A;  1I8F A;  1JEG A;  1K9M R;  4DQ2 A;  2P0P A;  1WIE A;  3REB B;  5GMK i;  3EGX B;  3GOX A;  2SEM A;  5LJ3 j;  2M02 A;  4ZGD B;  1U5S A;  5CKH A;  5HK0 A;  4ZGE B;  1PHT A;  3UA6 A;  2JJ9 A;  1B07 A;  2K6D A;  4FT4 A;  1RAC B;  5KYX B;  2ED1 A;  4E47 A;  2LX7 A;  1QVF P;  2DER A;  3WVE B;  3JB9 G;  5FRM A;  3CCJ T;  3O5Z A;  3OW2 A;  3ME9 A;  1VQ9 A;  2QGF B;  4ZN1 A;  4E7L A;  2CSI A;  2HEQ A;  5FRN A;  3CCM T;  4M7D D;  2KYM A;  3FEO A;  2QQR A;  2A0F B;  1YI2 Q;  4OGC A;  3JCM X;  4FSS A;  4BE2 A;  4F16 A;  1P92 A;  4E7J A;  3CD6 Q;  1T3S A;  4LUD A;  4AG2 C;  1KIK A;  5GAN 3;  2O9S A;  4M75 D;  4J9D A;  1GFC A;  3L2Z A;  2RF0 A;  7AT1 B;  4C8Q C;  2J7I A;  3EG2 A;  5GAN f;  5GAO l;  1IHW A;  2JMA A;  3PMI A;  4Z88 A;  3PIP A;  3VS4 A;  1W6X A;  2L3Q A;  5HK3 A;  4C92 E;  1VQ5 T;  8AT1 B;  4XTU A;  1PD1 A;  4F7U E;  3TRE A;  5HKC A;  3A8L B;  2XU8 A;  2GF7 A;  2WSF E;  4PJL A;  2YLC A;  1M2O A;  3NTI A;  4TVR A;  3VKI A;  4F14 A;  1H92 A;  2YUN A;  4A54 A;  2RNA A;  2QYZ A;  5DM7 R;  4M7A B;  3BDL A;  3EG9 A;  4M7A F;  1VQP Q;  2NUT B;  1YWO A;  4PFZ A;  1NJI R;  1B34 A;  5DY9 A;  2LQN A;  2EW3 A;  4M78 D;  5LJ5 f;  1ZSZ C;  1K8A U;  3JV3 A;  1HD3 A;  1M8M A;  1F1B B;  1PC0 A;  2DD5 A;  2EGA A;  4J6Y A;  4C5G A;  1YIJ T;  2KNB B;  4HVV A;  2HSP A;  1QLY A;  3LW5 E;  2E3I A;  6AT1 B;  1K1Z A;  2RQV A;  4OGE A;  3SDZ A;  2HQX A;  4A4G A;  3MEV A;  2Y4X A;  2P4R A;  4CC7 A;  1VQO Q;  2HAX A;  4EMK B;  1SSF A;  1XOV A;  2GQV A;  2AKK A;  2H3J A;  2QI2 A;  1V76 A;  1BI2 A;  3BFM A;  1MGQ A;  4HA8 A;  2KBT A;  3TCJ A;  2CS7 A;  1QVG S;  4AFS C;  2CT4 A;  1W2B P;  3O8V A;  1WJR A;  2NUP B;  1N8R R;  1RI0 A;  4ELZ C;  2Z0W A;  1VQL Q;  2OTJ T;  2FL7 A;  5GAO p;  2QQA A;  1NBE B;  3CPF A;  1WHM A;  2FHD A;  2P0K A;  3OYB A;  3ZFJ A;  1YHQ T;  1AZE A;  1CKB A;  1QVF S;  2LJ3 A;  1UEB A;  3SWN A;  3FLG A;  1YNZ A;  2M0Y A;  1OZ2 A;  3MHX A;  4J6X A;  3HTR A;  3QZ9 B;  1WHG A;  4KBM B;  1GFD A;  4C8Q F;  2K5F A;  4A63 B;  2OAU A;  2GGR A;  4C0Z A;  4R55 A;  1KQ2 A;  1VA7 A;  1GCQ C;  2OX7 A;  5KE3 A;  3ZL7 C;  2C06 A;  3L42 A;  2HCK A;  1VOM A;  1VQN T;  2ZPH B;  1WHK A;  4LNP A;  2CSQ A;  3G4S T;  4GY5 A;  2COW A;  4DBH A;  4WCI A;  1HK9 A;  4NL3 A;  4CC3 A;  3BDU A;  2WSE E;  4AFU C;  3FDR A;  2LQW A;  5GMK e;  2EBP A;  1OPK A;  4ELY C;  3CCQ T;  3OSS C;  1M1K C;  3E19 A;  1WXB A;  2YDL A;  1Q7Y U;  2DJZ A;  2X3W D;  3J7A F;  1BI0 A;  3TSW A;  5I21 A;  1U3O A;  1I07 A;  1ABQ A;  1UHF A;  1K73 C;  3NTH A;  4KUL A;  2NLU A;  3CCJ Q;  4M7D E;  5J26 A;  4KUD K;  2GTO A;  1KK7 A;  3CCM Q;  1VQM A;  2ZPE B;  5IHK A;  5EG2 A;  1QKX A;  4M75 E;  2DBM A;  3CCE A;  1QWF A;  2LT1 A;  2O9V A;  2JZ2 A;  5M9O A;  2E5K A;  3A8H B;  1JBM A;  4BE1 A;  2PTK A;  1MV0 B;  2VXE A;  2HKN A;  5GMK j;  4JS4 A;  1O75 A;  4Y92 A;  2C0I A;  2VWF A;  1Q81 U;  3I56 T;  1NYG A;  3AHU A;  4E7K A;  3OYN A;  2XK0 A;  5GAM h;  5CR2 A;  2VGM A;  4M7A G;  1X01 A;  3C95 A;  3MEA A;  3JCM f;  1Q82 R;  2LVM A;  3SD4 A;  4RG8 A;  2DTH A;  3MCA B;  2PVO B;  1CKA A;  1G3W A;  1AHJ B;  4JZ4 A;  1LCK A;  4QVD A;  4M78 E;  2MCN A;  4F04 B;  1ZBJ A;  1ZSG A;  4ZN3 A;  2D0Q B;  2EKH A;  3C94 A;  4O5V A;  5CKD A;  3I55 A;  3Q1J A;  1NZ9 A;  1M5Q 1;  2MAM A;  3M56 A;  4J9H A;  2LC4 A;  3RBB B;  3MJX A;  2O01 E;  2XD0 A;  3EGX A;  1YIJ Q;  4JJD A;  2EYW A;  2BE7 D;  5ECA A;  4MMK A;  3RNJ A;  3H9N A;  5CVI A;  1W2B A;  1W4S A;  1WJQ A;  4DOW A;  4DA4 A;  1KC8 R;  4DOV A;  4ANJ A;  5KE2 A;  2RJF A;  3LWI A;  3V7C A;  3LWH A;  1YFN A;  2V8K A;  5KYX A;  2H8H A;  2DL4 A;  1XNI A;  2EYQ A;  1UHC A;  5I22 A;  4JRQ A;  1VIF A;  1JXM A;  1LNX A;  4PJM A;  2P0Q A;  1D0Z A;  5KYU B;  3FJ5 A;  2DBK A;  2OTJ Q;  4C8Q G;  1RAD B;  1VIE A;  2DIQ A;  2LQK A;  4E6R A;  5LJ3 d;  2VB6 A;  3PGG A;  3EHQ A;  5A0D A;  4Q5W A;  1AWW A;  1YHQ Q;  2KQW A;  3EH2 A;  3GP8 A;  3CXC A;  3CCR A;  5I2M A;  3H0F A;  1Q86 U;  2ZPF B;  1M90 U;  3QJ6 A;  2DYB A;  3E2U A;  3VUZ A;  2DMO A;  2RHX A;  3P8D A;  1ZUU A;  1UDL A;  3PTA A;  4BDZ A;  2DRK A;  2C0O A;  2BUD A;  1GCP A;  4X9C A;  3JB9 H;  4OP0 A;  1BCO A;  4FW1 A;  3OS2 A;  1FWZ A;  1BIB A;  3H0I A;  1WFW A;  2VVK A;  2IVW A;  3VS6 A;  4RTY A;  3G4S Q;  5I2S A;  1WHL A;  2H3E B;  2X3X D;  3RES A;  5HCK A;  2HNI A;  3RMQ A;  2DE0 X;  2V26 A;  2AZS A;  2RM4 A;  5AT1 B;  1WGS A;  3CCQ Q;  1N6A A;  4RTT A;  5CQX A;  3VU3 C;  1CSK A;  2RHY A;  2WSC E;  4M7A A;  1TSF A;  1D0Y A;  3A5Z B;  1KQS A;  5L23 A;  1VQ6 A;  2KSS A;  4OMF B;  2NUT A;  3JB9 D;  4AT1 B;  4M4Z A;  2EQI A;  2G6F X;  4RKU E;  4FYX B;  4IIO A;  3CC2 T;  5LL6 S;  4XU2 A;  4E7S A;  5FRO A;  4C0G A;  2PQW A;  3HKS A;  2RN8 A;  3UWN A;  1GRI A;  3EHR A;  2F2X A;  1I81 A;  4DEY A;  4BD3 A;  2YHT A;  4EMK A;  3OSV A;  3L2R A;  2M16 A;  3CC4 T;  4JLI A;  3I56 Q;  4KUI A;  4EPC A;  1G8X A;  5IHN A;  1Z9Q A;  3VS5 A;  5FU7 C;  1K9M U;  2JS2 A;  3DLM A;  2ECZ A;  2NUP A;  1UGP B;  5KYW B;  1AT1 B;  2DFU A;  3M9Q A;  1BCM A;  4HT9 A;  2QXF A;  4J9G A;  2QA4 A;  1YIT Q;  1VQK T;  2E70 A;  3REA B;  2LX9 A;  4NOY A;  1WQW A;  1VQ5 A;  4C5E A;  4QQG A;  4FU6 A;  3QG1 A;  3GLX A;  1VYT A;  2CH4 W;  5IHI A;  4B9X A;  1B3Q A;  1MNE A;  2QQB A;  2X9H A;  2R58 A;  4J8O A;  2AKL A;  3VUB A;  2GNC A;  1WJS A;  2DVJ A;  1U1S A;  3GNG A;  5IN1 A;  2DK3 A;  2E64 A;  1GL5 A;  2DLP A;  1YCY A;  1TG0 A;  5GJW B;  2OJ2 A;  1S72 T;  3AT1 B;  2YRC A;  1KHC A;  1WZO A;  4PJO C;  2EGE A;  1FYN A;  3KBG A;  2BZX A;  2D9T A;  4C5I A;  3P8H A;  1VQO T;  2K2V A;  4MML A;  2OAW A;  3UT1 A;  4OB3 B;  5LJ3 g;  5GMK m;  4RTW A;  4L6V 5;  3ER0 A;  3CCU T;  3EGD B;  4A4H A;  4BUG A;  2HL5 C;  1D1C A;  4PJJ A;  2DD4 A;  5KCH A;  1VQ4 A;  1YJN T;  2HSE B;  2LCS A;  2XDP A;  4IIM A;  1X6B A;  1TUD A;  3V8K A;  2JS0 A;  3CCL T;  4BDY A;  3MKD A;  2YUQ A;  4WTO B;  1LOJ A;  2E6N A;  2YWW A;  1WI7 A;  4LUE A;  4B6M A;  1HYO A;  3V8J A;  1ZA1 B;  3JCM J;  2YXY A;  2DET A;  2X35 A;  5GAN 4;  2B86 A;  1K4U S;  2JTF A;  2QAZ A;  4P5N A;  2RQU A;  3VRY A;  3OB9 A;  2E4H A;  3OYF A;  3PT9 A;  2QEX Q;  4J83 A;  1NJI U;  4ATO A;  1PNJ A;  2RI5 A; 
#chains in the Genus database with same CATH homology
 3GNF B;  2DEQ A;  1VQK A;  4EMK B;  3CCJ A;  1SSF A;  3M4Y A;  2OTL A;  1XOV A;  1QP3 A;  3C4S A;  4HT8 A;  2GQV A;  4C0D B;  3QXE B;  2EQU A;  2LCC A;  3PIO A;  3CME T;  3KXT A;  2H3J A;  2QI2 A;  2PU9 B;  3CC7 A;  4IUV A;  3CCS T;  1VQM T;  1BI2 A;  2EQK A;  2RHU A;  3BFM A;  5IAY A;  3CCV A;  3CCE T;  3ASK A;  3CCM A;  1MGQ A;  1MHN A;  2VC8 A;  4HA8 A;  4JRK A;  3TCJ A;  2CS7 A;  5GAN 6;  2DZC A;  2MWO A;  3OYA A;  1YJ9 T;  1QVG S;  4LDV A;  3O8V A;  1WJR A;  3NTK A;  3HSB A;  1RI0 A;  1NPR A;  3M5A A;  4ELZ C;  5GAO r;  2EFI A;  1I4K 1;  2CGH A;  2GFA A;  3V8L A;  1W2B S;  2OTJ T;  1X75 C;  2FL7 A;  1D3B A;  2R5M A;  5D6W A;  2XID A;  3CPW A;  1LJO A;  3HHT B;  4J5Y A;  5GAO p;  2QQA A;  3JRZ A;  3MEU A;  1JJ2 S;  5GAN h;  1VQN A;  1GXI E;  3M59 A;  4M78 G;  3S3N A;  3LH0 A;  5CKF A;  4BE0 A;  2JNG A;  1M9S A;  3OBW A;  4N0A A;  2RK1 A;  4XU1 A;  3CPF A;  3BY7 A;  1S72 A;  2BIV A;  1Q7Y C;  2FHD A;  1U1T A;  1YHQ A;  2LDM A;  2P0K A;  3OYB A;  3ZFJ A;  1BI1 A;  2RJE A;  3QKJ A;  4N4G A;  4J7F A;  4BI3 A;  2VGN A;  1YJW A;  3HPW A;  1QVF S;  3QSU A;  3SWN A;  1UEB A;  3CCQ A;  1N8R U;  3FLG A;  2RHI A;  3LYI A;  3V7S A;  1O9S A;  2OTL T;  3G6E A;  2F69 A;  2ZCF B;  5L8R E;  4V2S A;  4Y28 E;  5CAI A;  1EIF A;  3SFM A;  3CC7 T;  1OZ2 A;  3MHX A;  4J6X A;  3G71 T;  4LDU A;  2B8A A;  5FLX E;  4N0A C;  5GMK l;  3QZ9 B;  1JB0 E;  3NFC A;  4KBM B;  4X9D A;  4JLG A;  3CCV T;  4C8Q F;  2K5F A;  1BI3 A;  1NE8 A;  2OAU A;  4M77 G;  4PJO F;  3SWN C;  2JUF A;  4N4H A;  2DZ9 A;  4CRI A;  1OI1 A;  3CCU A;  4Z02 A;  4C0Z A;  4C8Q A;  5GAN 7;  4R55 A;  1KQ2 A;  2DTI A;  5KE3 A;  4PJO A;  1H64 1;  4PLI A;  2K3X A;  1ZHI A;  4RCC A;  4LD6 A;  3JCM b;  2C06 A;  1BYM A;  3L42 A;  1VQN T;  5IT9 E;  2ZPH B;  3OYK A;  5LJ3 h;  2VXF A;  2YLB A;  4OB2 B;  3LX7 A;  3HFN A;  3G4S T;  5LJ5 h;  2PVG B;  4GY5 A;  3I55 T;  2K4Y A;  1HK9 A;  4NL3 A;  3M58 A;  3BDU A;  2GFU A;  2WSE E;  3FDR A;  4E7H A;  5GMK e;  1RL2 A;  2YRV A;  4ELY C;  3CCQ T;  3VV0 A;  3OSS C;  1Q81 C;  4BY6 B;  4C92 B;  1Y96 A;  3E19 A;  3OQ5 A;  3S3O A;  2DJZ A;  1U8R A;  1Q7Y U;  1M1K C;  4KT0 E;  4HCC A;  4FSX A;  1BI0 A;  1N27 A;  5A2Q E;  3J7A F;  2RH2 A;  1PSF A;  1M1G A;  2CKK A;  1HXD A;  4C92 F;  4F7U B;  5I21 A;  5LJ5 d;  1X6O A;  4M7A D;  1FXX A;  4OVA A;  4QQD A;  1ZBX A;  3OS0 A;  1YIJ A;  1K73 C;  3NTH A;  1VQ8 A;  4KUL A;  4F7U F;  4LD9 K;  4IUU A;  3VYG A;  2NLU A;  5C0M A;  1KG1 A;  2DXU A;  4M7D E;  5J26 A;  3JB9 J;  3HP9 A;  4JRI A;  5KH6 A;  2VUB A;  4L5G A;  2E5Q A;  2F5K A;  2XDD A;  4KUD K;  4CI0 C;  3OY9 A;  1ZQ1 A;  4L59 A;  4PLL A;  1B34 B;  5CKE A;  3CME A;  4M7D A;  5CKB A;  3J80 E;  3EFS A;  3KUF A;  5HY6 A;  3CCS A;  3JCM W;  1TH7 A;  1IRE B;  3RIR A;  1VQM A;  3E9G A;  2ZPE B;  4JRP A;  1YHQ T;  5FU6 B;  5EG2 A;  4M75 E;  3JCM g;  2EJG A;  3CCE A;  3PMT A;  4MZT A;  1KQ1 A;  2LT1 A;  3FB9 A;  2JZ2 A;  3JSC A;  3RKW A;  5M9O A;  3OYJ A;  3LLR A;  3BW1 A;  1YJ9 A;  1Q82 C;  3A8H B;  1JBM A;  2MF2 A;  2EWN A;  2RJC A;  1KQS S;  4M75 A;  4BE1 A;  4M7D C;  3QO3 A;  2VXE A;  2VYT A;  2OTJ A;  3QII A;  5GMK j;  4JS4 A;  2O4X A;  3M53 A;  4A4F A;  1O75 A;  4HCZ A;  4LDW A;  1Q81 U;  1M1K U;  3OA6 A;  1WNL A;  1VQ8 T;  3I56 T;  4XK8 E;  3AHU A;  2E6Z A;  2QDY B;  4E7K A;  3JB9 I;  4EDU A;  2XK0 A;  5GAM h;  3OYN A;  2PUK B;  4XU3 A;  3F70 A;  3CCR T;  4M75 C;  2VGM A;  4UC4 A;  1VUB A;  3QHS A;  3MP1 A;  5CR2 A;  1X01 A;  4JS5 A;  2MWP A;  3C95 A;  3HRU A;  3MEA A;  5FU7 B;  3JCM f;  4M7A G;  2QQ9 A;  2XKO C;  3CEY A;  4XTW A;  3T9N A;  3UPU A;  5GAN 8;  2EJ9 A;  2LVM A;  2X4W A;  5A0G A;  3SD4 A;  4RG8 A;  4BI4 A;  1XQH A;  2DTH A;  1Y7X A;  3G71 A;  3MCA B;  2XDB A;  4NS5 A;  3VJP A;  2RI3 A;  2PVO B;  4IUQ A;  1QVP A;  4HKE A;  3X25 B;  3HL8 A;  1D3B B;  5GAN 5;  5GAM g;  1G3W A;  3L2W A;  3X20 B;  3JCM Q;  1AHJ B;  2KMT A;  3OYC A;  1Q82 U;  4QVD A;  2E65 A;  3R6O A;  4M78 E;  2G3R A;  2DAQ A;  3MET A;  4LDX A;  2EQJ A;  1YI2 T;  4PKC C;  3SWN B;  4C8Q D;  1KC8 C;  3INZ A;  1UGS B;  3GF5 A;  4D6W A;  4ZN3 A;  3G4S A;  2D0Q B;  4O5V A;  3C94 A;  5CKD A;  3CD6 T;  4M78 A;  3JB9 F;  4PJO D;  4ME7 A;  3FIF A;  2PVD B;  2EIF A;  3I55 A;  1KD1 C;  3Q1J A;  3P8B B;  1NZ9 A;  1M5Q 1;  2MAM A;  3M56 A;  3UDC A;  3TEE A;  3OW2 S;  3CMA A;  2LC4 A;  3WVD B;  1QVG A;  3EAE A;  2XIC A;  5GAM f;  2O01 E;  2XD0 A;  4BI8 B;  5GAN d;  3OMG A;  2FYK A;  3QDR B;  2CZ1 B;  1VQ6 T;  4MMK A;  5J3B A;  4C8Q B;  5CVI A;  4M78 C;  1W2B A;  1W4S A;  3E1S A;  1Q86 C;  1WJQ A;  3M4G A;  4M77 E;  4DOW A;  4EMK C;  1M90 C;  3OYY A;  4PJO B;  3M55 A;  4DA4 A;  4DOV A;  1JJ2 A;  1XTD A;  5KE2 A;  3JCM P;  2LRQ A;  2RJF A;  2V8J A;  4XTX A;  1JRI A;  3V7C A;  3LWI A;  4M77 A;  4J6W A;  3JAM E;  3LWH A;  2XHC A;  2V8K A;  3OYH A;  5A0L A;  3QYG B;  4C92 D;  3MP8 A;  3QUI A;  1XNI A;  2A7Y A;  2EYQ A;  4J7I A;  1QVF A;  2R5A A;  3C12 A;  4A4E A;  4JRQ A;  1Y96 B;  3H8Z A;  3J81 E;  1VIF A;  2AHJ B;  4WF2 A;  1LNX A;  2BKD N;  1K73 U;  2P0Q A;  2QTX A;  4M77 C;  4A4K A;  1KC8 U;  3DKM A;  4ZGJ B;  2DXT A;  3ZBD A;  4C8Q G;  3RER A;  2GCX A;  1VIE A;  2DXB A;  3CMA T;  2D6F A;  2DIQ A;  1Y07 A;  4BB7 A;  2LQK A;  2ZGW A;  4IUP A;  1VQP T;  3RUX A;  4JJN K;  1M1F A;  3OMC A;  3SB2 A;  1QW1 A;  3RKX A;  3PNW C;  1KD1 U;  5LJ3 d;  2X4X A;  2ZPI B;  3PGG A;  2JOY A;  5A0D A;  3GIB A;  3JCM h;  4Q5W A;  3L2V A;  3I56 A;  1G3S A;  1Y71 A;  5GAN e;  2KQW A;  2L3R A;  1OZ3 A;  2V8I A;  2WAC A;  3GP8 A;  5KCO A;  4M7D B;  2JN0 A;  2HQE A;  3CXC A;  4XQ3 A;  2RJD A;  2IG0 A;  3OYD A;  3A8O B;  3CCR A;  5I2M A;  1BKB A;  1Q86 U;  2ZPF B;  2RI2 A;  3RKY A;  4N4I A;  3OYL A;  3QJ6 A;  1K8A C;  1M90 U;  1UB4 A;  2LCL A;  4FL6 A;  4M7D F;  2M9U A;  2QA4 T;  2P4T A;  3VUZ A;  2RHX A;  2DTO A;  2LQ8 A;  4MDW A;  4XTY A;  2CZ0 B;  3QBY A;  3JCM d;  4R56 A;  2RD1 A;  3P8D A;  2DIG A;  4M75 B;  1VQ9 T;  3FRN A;  3L2U A;  3PTA A;  4BDZ A;  1YIT A;  4IKF A;  2K3Y A;  4PNO A;  4C92 G;  2KY9 A;  4M75 F;  2BUD A;  2O4X B;  3ZEH A;  2CZ6 B;  2EKO A;  4X9C A;  3V7R A;  3G7Z A;  4F7U G;  3OS1 A;  3JB9 H;  2K5I A;  2L89 A;  1G3Y A;  4OP0 A;  3OS2 A;  1VQ7 A;  1FWZ A;  1BIB A;  2L8D A;  2E1H A;  3DB3 A;  3CBP A;  4C5H A;  1H3Z A;  2IVW A;  4IUR A;  5I2S A;  5DLO A;  1R8O B;  3RES A;  4QVZ A;  1YI2 A;  2DO3 A;  2E12 A;  4YTL A;  3QYH B;  2HNI A;  3RMQ A;  1VQL T;  4XAX B;  4BY6 C;  1UGR B;  3X26 B;  2RM4 A;  3MP6 A;  5LJ3 e;  1NPP A;  1WGS A;  3CD6 A;  2VV5 A;  3X24 B;  4M7A E;  4RMO A;  1N6A A;  5LJ5 e;  5CO7 A;  2F5T X;  5CQX A;  1N9R A;  3S6W A;  2RHY A;  2WSC E;  2XI9 A;  3LGF A;  3VU3 C;  4EMH A;  5GAN j;  5J39 A;  5GAN 2;  4M7A A;  3CBM A;  3QZ5 B;  2RA2 A;  3CC4 A;  1K9M C;  3A5Z B;  5GAO m;  4QW2 A;  4B9W A;  2RHZ A;  3OYE A;  5D6Y A;  2KK4 A;  4Y91 A;  3MO8 A;  2RO0 A;  1KQS A;  4BAC A;  1VQ6 A;  2KSS A;  4OMF B;  4HCB A;  5GAM d;  3JB9 D;  3H6Z A;  1YIT T;  3JCM V;  2LTO A;  1UGQ B;  3VYH B;  2EQM A;  2KAF A;  4NL2 A;  1FX7 A;  2R57 A;  4II1 A;  2RK2 A;  2EJF A;  4QQ6 A;  4RKU E;  4ZTF A;  4M7A C;  3CC2 T;  3CBO A;  2E10 A;  2FB7 A;  5LL6 S;  5CCA A;  3S3M A;  1VQ7 T;  4M78 B;  4XU2 A;  3CPW S;  5FRO A;  1I8F A;  4C0G A;  1VQ4 T;  2PQW A;  3HKS A;  3OS5 A;  4M78 F;  1QP2 A;  3JCM c;  4FT2 A;  3UWN A;  4DQ2 A;  2K5L A;  2P0P A;  2M0O A;  4RCB A;  4M77 D;  5GMK i;  1I81 A;  2KVQ G;  3HFO A;  3GOX A;  1G3T A;  4VUB A;  4BD3 A;  2JVV A;  2YHT A;  4OB0 B;  1DJ7 B;  3OYI A;  1YBY A;  4EMK A;  1M8V A;  3OSV A;  3L2R A;  5GMK h;  4EMG A;  5LJ3 j;  3N5B B;  2MMP A;  2E41 A;  4ZGD B;  2M16 A;  3CC4 T;  5LJ5 j;  4JLI A;  1VQP A;  5CKH A;  3FJP A;  5HK0 A;  4KUI A;  4ZTJ A;  2QQS A;  4EPC A;  3QJY A;  4ZGE B;  5DLQ E;  4JUV A;  4M77 B;  5FU7 C;  2HBP A;  1K9M U;  1WPY A;  3OYM A;  4FT4 A;  3DLM A;  3WXM B;  5CQY A;  4M77 F;  4C0D C;  4E47 A;  1UGP B;  5GAM e;  2LNV A;  3M9Q A;  3WVE B;  3JB9 G;  5FRM A;  4HT9 A;  2QXF A;  2QA4 A;  1VQK T;  3CCJ T;  4OB1 B;  2E70 A;  3OW2 A;  2LX9 A;  2X4J A;  3PFS A;  4GLK A;  4C0F A;  2QEX A;  2EAY A;  4NOY A;  1VQO A;  3ME9 A;  1WQW A;  4MDX A;  1VQ5 A;  1VQ9 A;  3QPH A;  1WQ7 A;  4O6J A;  4C5E A;  4QQG A;  4FU6 A;  4ZN1 A;  4C8Q E;  2LT4 A;  3QG1 A;  3GLX A;  5GAN g;  5CIU A;  4E7L A;  5FRN A;  3CCM T;  2Y90 A;  4M7D D;  4B9X A;  3A8M B;  4PJO E;  2M1H A;  4PL6 A;  2QQB A;  3HRS A;  3FEO A;  2QQR A;  2HD0 A;  3FC3 A;  2R58 A;  4X34 A;  2ZPG B;  4J8O A;  4OGC A;  4PJO G;  2CZ7 B;  3JCM X;  3OBY A;  3VUB A;  4BE2 A;  1PSE A;  4MZP A;  4E7I A;  1P92 A;  4E7J A;  1WJS A;  2DPP B;  5CK9 A;  1YJN A;  1U1S A;  3GNG A;  4FM4 B;  5D6X A;  2DK3 A;  5IN1 A;  2E64 A;  5GAN 3;  3LGL A;  4RG2 A;  1VQL A;  1YCY A;  4M75 D;  3CXC S;  1M4Z A;  4A53 A;  1V29 B;  3L2Z A;  2PUO B;  3CCL A;  3M57 A;  1S72 T;  4C8Q C;  2K57 A;  3EFR A;  1YJW T;  1KHC A;  5GAN f;  4OF1 A;  5GAO l;  3L2Q A;  4PJO C;  5GAM j;  3PMI A;  1IZ6 A;  1I5L A;  1OYX A;  2Y4Y A;  2MI6 A;  4C5I A;  3KBG A;  3PIP A;  2D9T A;  5C6S A;  3P8H A;  5HK3 A;  4C92 E;  3G6E T;  2QEX T;  1VQO T;  2DXC A;  2K2V A;  1VQ5 T;  2CYZ B;  4MML A;  1G5V A;  4XTU A;  3RMS A;  4F7U E;  3TRE A;  5HKC A;  3DLL A;  3UT1 A;  3A8L B;  4OB3 B;  5LJ3 g;  2XU8 A;  3OYG A;  3URG A;  3GPL A;  1NJI C;  5GMK m;  2GF7 A;  4C92 A;  4XU0 A;  2KDS A;  2WSF E;  4L6V 5;  5LJ5 g;  3ER0 A;  2YLC A;  3CCU T;  4A4H A;  3NTI A;  2JTM A;  2XG8 D;  3HRT A;  4BUG A;  4F7U A;  1BIA A;  4TVR A;  3VKI A;  3CC2 A;  2DD4 A;  3E9F A;  5KCH A;  3L1A A;  4M7D G;  1VQ4 A;  2I2L A;  3X28 B;  1N9S A;  4A54 A;  1YJN T;  2XDP A;  5DM7 R;  4M7A B;  4XTZ A;  3BDL A;  3V8K A;  4C92 C;  4MZM A;  3CCL T;  4M7A F;  4BDY A;  2ZZD A;  4XTV A;  1LOJ A;  2X4Y A;  2ZPB B;  5GAO n;  3M54 A;  2E6N A;  1B34 A;  4M75 G;  5LJ3 f;  2FVU A;  4FIB A;  5DY9 A;  3TU4 K;  1KHI A;  5AYF A;  3V8J A;  4LDY A;  4M78 D;  5LJ5 f;  2RB6 A;  3DB4 A;  2DVE A;  1K8A U;  4QVC A;  3JCM J;  2L5Q A;  2X35 A;  2HAX A;  2DD5 A;  4J6Y A;  5GAN 4;  5GAO q;  4C5G A;  1YIJ T;  3JCM e;  2JTF A;  4P5N A;  3LW5 E;  2DKG A;  2A3L A;  3MEW A;  1N8R C;  4OGE A;  3SDZ A;  2HQX A;  3OB9 A;  4JDS A;  3MEV A;  2Y4X A;  4A4G A;  3OYF A;  3PT9 A;  5FU6 C;  4J83 A;  1NJI U;  4IUT A;  4ATO A;  3A8G B;  2RI5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...