3JCMb

Cryo-em structure of the spliceosomal u4/u6.u5 tri-snrnp
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
65
structure length
65
Chain Sequence
ATLKDYLNKRVVIIKVDGECLIASLNGFDKNTNLFITNVFNRISKEFICKAQLLRGSEIALVGLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pre-mRNA-splicing factor 8
publication title The 3.8 angstrom structure of the U4/U6.U5 tri-snRNP: Insights into spliceosome assembly and catalysis
pubmed doi rcsb
molecule tags Transcription
total genus 11
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2015-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
b PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3jcmb00
2RD1A 4J6WA 4M7AE 4M7DF 4XTWA 2Y90A 3RKYA 3V7RA 5GAN4 3JCMV 4F7UF 5GAMe 5DY9A 3VU3C 1TH7A 5GAMh 4NL3A 3JCMf 2E1HA 2K57A 4C92F 3RKXA 2RM4A 4QVDA 3QO3A 5LJ5e 5LJ3j 5LJ5h 5GMKl 4M75D 3JCMX 4XTXA 4PJOD 2E65A 5GAN5 4M75C 4N0AA 4PJOC 5GAN3 4V2SA 3RESA 4M75B 5I21A 4XQ3A 4EMKB 5GAOr 4M7DG 4M7AD 4M78F 4Y91A 2I2LA 1B34A 2EJ9A 4F7UG 2FB7A 4M7AB 3JCMJ 3JCMP 4C8QC 1M5Q1 1X01A 3M4GA 3FJPA 1B34B 1H641 5GAOq 4XTUA 5LJ5g 4M7DA 4HA8A 2E41A 4PNOA 4C92G 3JCMQ 5GANd 4M7DB 3HFNA 4WF2A 3SB2A 4F7UA 1I8FA 3RIRA 3FIFA 3EFSA 1YCYA 4J6XA 3JCMW 5GANj 3GIBA 4M78G 3RERA 3QSUA 4MMKA 2HNIA 4M77F 4XU2A 4M7DE 3JB9F 2JN0A 1WNLA 4M78A 5LJ3f 2YLCA 4F7UE 3HFOA 2EJGA 2RB6A 4RCBA 4X9DA 3AHUA 3L1AA 1KQ1A 1WQWA 4EMKC 2CGHA 1KQ2A 3PGGA 5GANf 4JRKA 3BDUA 1HXDA 5GAMg 4M7AC 3SWNA 1N9RA 5LJ3e 3INZA 4M77G 2DVEA 3QHSA 5LJ3h 3SWNB 4C8QF 1M8VA 3JB9G 1WQ7A 2EJFA 4M78E 4M7DD 2YLBA 4M7DC 3JB9I 2DZ9A 1HK9A 2RA2A 4JRIA 2ZGWA 2FYKA 4M77A 3V8LA 4F7UB 1Y96A 4X9CA 4XU3A 4OP0A 5CAIA 4M77B 1D3BA 4C92D 3JB9J 5GMKj 2QTXA 4C92A 3JCMb 3JCMe 5LJ3g 4JLIA 3JCMh 4C92B 2DXUA 1LJOA 1U1SA 4A54A 4NL2A 1I4K1 4C8QG 3EFRA 4M78D 4JUVA 5GANe 4XU0A 1BIAA 4M77E 2YHTA 5GANh 4M78B 1I5LA 4C8QA 3FB9A 5GAMd 2E10A 4M75F 1JRIA 1JBMA 4N0AC 4PJOF 3JCMg 4C92E 1WPYA 2DJZA 5GAN7 3QUIA 4J6YA 5GAOl 3JCMc 4HT9A 4M7AF 4EMGA 3RUXA 4QVCA 3SWNC 5LJ5d 5GAMj 2DTHA 1LNXA 1MGQA 2DTIA 1N9SA 1BIBA 2EAYA 5GANg 5GAN2 3L2ZA 1LOJA 4RCCA 3V8JA 4A53A 5LJ5j 4M77D 4C8QE 4M77C 5GAOm 1I81A 3JB9D 4PJOG 4M75G 5LJ3d 1Y96B 4C92C 5GAOp 1D3BB 5GAN8 4XU1A 2DEQA 1U1TA 2E64A 4XTVA 5GAMf 4HT8A 4M7AG 4PJOA 2EWNA 4M75A 4EMKA 3V7SA 3RKWA 3BFMA 4PJOB 2DZCA 5GMKe 4XTZA 4M78C 3HSBA 5LJ5f 4M7AA 4J5YA 3V7CA 5GMKh 3JCMd 3BW1A 4C8QD 5GMKi 3BY7A 2VC8A 4C8QB 5GAN6 4MMLA 4XTYA 5GMKm 3JB9H 2DKGA 4EMHA 5GAOn 2VXFA 2DTOA 4DQ2A 4PJOE 4M75E 2DXTA 3V8KA 4NOYA 2VXEA
chains in the Genus database with same CATH superfamily
2DBKA 2A3LA 1YFNA 4IKFA 3M0TA 4IURA 1NEBA 2MMPA 1LCKA 1VQMQ 2RQWA 3NMZC 1M90U 1PCXA 4M75D 4XTXA 5FLXE 1K0SA 4AFQC 1S72A 1KIKA 2HL3A 4E7HA 4M7DG 2F1LA 3VYGA 3CCLT 1KD1U 3SD4A 2E41A 3CC7Q 5GANd 1OI1A 5GJWB 1N8RR 4CC7A 5KCOA 4HVUA 4FU6A 1QQJA 1VQ8T 1R0CB 3E1SA 3I55A 3JB9F 4KBMB 1VQMT 4QT7A 4D6WA 3EG1A 1I5OB 3INZA 3SWNB 2KVQG 3CQTA 3R6NA 4E7KA 4M7DC 3CC7T 2R57A 2XD0A 3EG2A 2K5IA 4HVWA 3G4SQ 2CP2A 2RPNA 2K3XA 1LJOA 5IHIA 4C8QG 3LWHA 1Q82R 2CZ7B 2FZKB 2DJZA 4EMGA 5LJ5d 4QVCA 5GAMj 3OYMA 3CMEA 4O6JA 4RTWA 4A4GA 5IN1A 5KCHA 4FL6A 1WHGA 2KK4A 4C92C 2LC4A 3EAEA 1TUDA 3ASKA 4M7AG 3LX7A 2PUKB 1VQ9A 3QZ9B 1AT1B 2D8JA 2XHCA 2DX1A 3CCEQ 4X1VA 3VS5A 4FYYB 1K8AC 2DXCA 5IT9E 1BCOA 2EBPA 5GAN4 2MCNA 5D6WA 5FRNA 1ZSZB 5GAMh 4AT1B 2RI5A 2LDMA 3OYDA 3QO3A 3CCRQ 3G71Q 5LJ3j 4OF1A 2KQWA 4M75B 4FYVB 1JXMA 2C0IA 1X01A 1IB8A 2FRYA 4IUPA 1VQ7A 4CC4B 1I8FA 2EQKA 1N8RC 2KMTA 2AKKA 2GQIA 3IQLA 1SSHA 4BI4A 3CCVA 4NS5A 3PIPA 1KQSS 2QQSA 3OMCA 6AT1B 3G71T 1QVFS 4Z8AA 2KI7A 4ZGEB 2OI3A 2KDSA 4PLLA 3J7AF 2LTOA 5LJ3h 3E9GA 2ZPHB 2LCLA 1UUEA 3META 3URGA 2MF2A 4C5EA 1GCQA 1Y96A 2DM1A 4C92D 2WSEE 2EW3A 1SF9A 4O5VA 4C0FA 5I11A 2HQHA 3X25B 1PM3A 1PHTA 1Q82C 3C0CA 2X35A 2OTJQ 2ECZA 4AFZC 2YXYA 3UF4A 1RAFB 5FU6C 5CCAA 2G6FX 3S3NA 1NYFA 3MEAA 1C1AA 4JRPA 1PRLC 4ZN1A 1HJDA 5GAOp 3H9NA 1SRMA 3SFMA 4PJOA 4ORZA 5KYUB 2QA4A 2RQVA 3EG9A 4LN2A 4HCBA 3DLLA 1JQQA 4NOYA 1NJIU 2JMCA 2KEAA 4PK4A 1KHIA 3OA6A 3G6EQ 4RTTA 2Y90A 3M57A 5FWBA 2XU8A 1D1BA 5IAYA 1FYNA 1M30A 2LQ8A 4EDUA 2XDDA 4BI8B 2LX9A 2RHXA 2NUPA 3JCMX 2K79A 3TSZA 3QDFA 1K4US 3TSWA 1GFCA 2RI2A 3H0IA 2LQNA 2JM9A 1YWPA 4J9GA 3JCMJ 1GRIA 2VGNA 2LP5A 1VQNQ 4M7DB 2EYZA 2BE9B 4IUQA 2J6FA 3CC4Q 3G6ET 4M78G 4HCKA 4B6MA 2CREA 1RLQC 3NTKA 2J05A 3QKJA 1MV0B 2M16A 2YLCA 2BZ8A 3M56A 1VQLT 5FRMA 4N4GA 2ZZDA 3CXCS 2GQVA 1KSWA 2AIRB 2X9HA 4MDXA 2RH2A 2MK5A 4PL6A 1WQ7A 1VQNT 1BI1A 1TXQA 4FSSA 1IHVA 1X2QA 2KE9A 1SKUB 1D3BA 2M51A 1K76A 4QQGA 1KJWA 2RJCA 4C92B 3OYLA 4A54A 3EFRA 2CKKA 3EFOB 4XU0A 1BIAA 5I22A 2RHUA 4MZTA 1I5LA 3HRTA 4E7ZA 2HEQA 5D7UA 8ATCB 4LDYA 4LXCA 2ZPFB 1Q95G 1YIJA 1AEYA 2BE7D 3PIOA 3NTHA 1BIBA 1YI2A 4FM4B 3WVDB 3OMGA 1OZ2A 1ACMB 1TUGB 4KT0E 4XTVA 2X3XD 3GLXA 5GAMf 5FU7C 1HSQA 1X6GA 1VUBA 5FROA 4LUDA 2DRMA 2VASA 1YN8A 2L8DA 4BI3A 3MP1A 1BBZA 1UGVA 5L8RE 3VS2A 3CC2T 1AZGB 1IGQA 1YITT 2MPXC 3FRNA 1NM7A 3QJ6A 4PJOD 1X6OA 2X51A 4N0AA 4PJMA 5I21A 3CCJA 1VQPT 4Z88A 2I2LA 4OMQA 4QW2A 2DA9A 3MP6A 4OMLA 4WF2A 2ESWA 3VS7A 4F7UA 2DE0X 2J06A 2FRWA 4B9XA 1Q7YR 1A0NB 3L1AA 1BCMA 2LRQA 4WTOB 4MZMA 1GBQA 1Q86R 3M4YA 1MNDA 3SWNA 1TSFA 3DB3A 3I5RA 1H8KA 2BKDN 5FU6B 2DIGA 3G4SA 1C6VX 2X4XA 1RABB 3CD6Q 3PVQA 4E7SA 3FDRA 4PLIA 1D0XA 2EQJA 3LH5A 2F5TX 2AZVA 4BB7A 3QWXX 4JUVA 4M77E 1JRIA 4N0AC 4BE2A 4M4ZA 4BACA 3CBOA 1TUCA 4ANJA 3CCUA 2EYWA 1M3AA 2GFAA 2DTIA 5GAN2 1E6HA 1M3CA 4FSXA 2GGRA 2RQUA 3R6OA 5CKEA 1Y96B 4IUUA 4J9EA 3CMAA 1Q81R 5D6XA 1M9SA 1M8MA 1ZQ1A 3CCEA 2PVOB 3HSBA 1ZBXA 2YUNA 1JU5C 2E12A 4OMNA 2X4JA 2MI6A 1VQ4Q 3UDCA 4XTYA 5GAOn 4ATOA 2O9VA 3REAB 3F70A 2QYZA 3QZ5B 4JRQA 1NBEB 1VYUA 4J9CA 4XK8E 1ZSZA 3CEYA 2KT1A 2AK5A 2XIDA 3CCRA 3G71A 1VQ5Q 5A2QE 2LJ0A 4F16A 3M0SA 3TEEA 2EPDA 4V2SA 2FO0A 9ATCB 2K5FA 2C06A 2OTLQ 5GAOq 2K4YA 1VQ4T 1UGSB 4FCYA 3A5ZB 2V1QA 2DL5A 4ZGJB 1GBRA 1G3SA 4M77F 3EHRA 1RUWA 1JJ2A 1VQ5T 1Q7YC 1RI9A 1VIFA 1WJQA 2PVGB 3LH0A 3CBMA 1Q86C 3H0FA 1JB0E 2OTLT 1N6AA 3QHSA 1M8VA 3JB9G 2JOYA 4J7FA 3RDVA 1AWWA 3QPHA 1C0MA 5CR2A 5FU7B 4ME7A 3CPWS 2OTJA 3OBYA 2E5QA 5DLQE 2K3BA 1MMGA 1VQKA 5GAN7 3VS4A 1O9SA 2RJFA 1OZ3A 3OBWA 4JJCA 2F2XA 3J80E 2CUDA 5LJ3d 1AVZC 1W2BA 3E19A 2OJ2A 1D3BB 2YRVA 1YJNA 1Q81C 4F17A 3RKWA 5KYUA 4RTXA 1H92A 1ZA2B 3V7CA 2CUBA 1G83A 1I07A 2KYMA 2ZPGB 3PTAA 5GAN6 3VS1A 2PNIA 1YJ9A 2CP6A 2NLUA 2QK0A 4M75E 4LD6A 1W70A 3CBPA 3M9QA 4A4HA 1AZEA 1WHKA 5GAMe 1NEGA 3JCMf 3PE0A 3OYCA 1UG1A 2NUZA 1VQNA 2CZ6B 4DEYA 3CCMT 1VQ6Q 3CCLQ 1K8AU 2D1XA 3FJPA 1CKBA 2FZGB 4XTUA 4M7DA 2CP5A 4RTVA 3CC4A 3QBYA 3FIFA 2O4XA 2RJDA 2P4TA 4ZTJA 2CP0A 1VQ8Q 4MMKA 4B9WA 1OQKA 5D6YA 2V8JA 3AHUA 2RB6A 4RG2A 2OAWA 2CYZB 4BE0A 3UATA 2ED0A 1VQ6T 5LJ3e 3MEWA 4TVRA 2WSCE 1N8RU 3WVEB 3CCSQ 3M54A 3VRZA 3DB4A 2CSIA 4F7UB 4C92A 2DYBA 3CCQT 4A4FA 5LJ3g 3C94A 2CZ0B 3EFOA 1ZUUA 2KAFA 1OULA 4BD3A 3SDZA 4C8QA 1D0YA 4M75F 2EFIA 4A63B 2K7AA 4AMCA 4AFUC 1QKXA 3RR6A 2A28A 1YNZA 3I56T 3CCST 4ZN3A 2YRDA 2DD5A 3CPFA 4FW1A 4GBQA 3HRSA 1R77A 2DVJA 3OW2S 4OB2B 1Q82U 4M7AA 1QCOA 1PNJA 2X4YA 4EMHA 2VXFA 2DTOA 1RAEB 1YHQA 1QVPA 4LUEA 2DXTA 3HRUA 3OS5A 3X26B 2DD4A 3VU3C 2NUTB 4GY5A 1SRLA 2V26A 5IHNA 1KFZA 5GAOr 2JW4A 2BIVA 1QMCA 4C8QC 2BTTA 3OY9A 3RBBB 3KUFA 3HFNA 3HPWA 3LWIA 4LDWA 1OEBA 1YCYA 1X75C 3GIBA 2KNBB 2K9GA 2JTEA 2I0NA 1JJ2P 2QGFB 1KC8R 4X9DA 4QVZA 1ZLMA 1IGUA 1RI0A 1KQ2A 1WHLA 4MDWA 3H8ZA 3C95A 4M7AC 1UFFA 3CD6A 2P0KA 4M7DD 4OMPA 4DOVA 1VQOA 1HK9A 1NZ9A 4JRIA 3SEMA 4J83A 2DL8A 4N4IA 1BK2A 1U8RA 1RL2A 2QEXT 1I4K1 1WGSA 4MZPA 4KUIA 3M58A 2E10A 1TU0B 4DBHA 3OSSC 3RMQA 2ZAEA 1MGQA 4F04B 1SHGA 2QG9B 1YJWT 2FPEA 8AT1B 4RCCA 4KH0B 3NGPA 3VUZA 2KRMA 2CH4A 5GAOm 1MHNA 2QDYB 3O5ZA 4LD9K 1W2BP 2E3HA 2PVDB 2V1RA 3BFMA 5J26A 1IXDA 1XOVA 2LQKA 3JSCA 5C6SA 1K9AA 2ENMA 3QXEB 4J5YA 4C8QD 3EH2A 2K6DA 2D0NA 2DIQA 3Q1JA 1RAIB 5GAN5 2HBWA 1E7OA 2XKOC 3KBGA 3E9FA 5KE3A 1NYGA 3DKMA 1GFDA 3LYIA 3QG1A 3DLMA 2JMAA 2QQ9A 2K57A 4C92F 2GTJA 1K73R 2VKNA 3OYAA 2LNHB 3GP8A 1VYTA 4XQ3A 4M7AD 1ZSGA 4DBQA 1FXXA 1QVFA 2O2OA 2EYXA 1MV3A 1WZOA 4Q5WA 3JRZA 3C4SA 2GNCA 3LGFA 4R55A 5GANj 1U06A 5KYXB 2LMJA 2NYSA 3QSUA 1CKAA 2CSQA 1ZBJA 4M78A 1KC8C 1VQLQ 1PG5B 1IHWA 2FG0A 1VOMA 3GNFB 3EH1A 5IXBA 4JRKA 1M1KR 1G8XA 4LDVA 2RI3A 3GBQA 1MUZA 2QTXA 1NLPC 2O4XB 2DYIA 1G2BA 5A0DA 1SSFA 4AG1C 5GANh 2F69A 3GOXA 1N5ZA 5I2MA 1WHMA 1OPKA 1G3TA 1D09B 2RQTA 5KE2A 2A0FB 1AWXA 5LJ5j 2WSFE 1JEGA 1JXOA 2AZSA 2J7IA 2QASA 1NE8A 3OYKA 5CKDA 4M78C 5HK3A 4FIBA 1S72Q 2A08A 3L2RA 5CKFA 5GMKi 1IO6A 4C8QB 1WJRA 1Y71A 2VV5A 4PJOE 2H3EB 3A8GB 1LPLA 1B07A 2G3RA 4FYXB 3CC2Q 4IIOA 4KUDK 4DOWA 1YBYA 1YITQ 2GF7A 4JLGA 4QVDA 4EPCA 5LJ5h 3I55Q 2C0OA 3OYBA 1R8OB 1K73C 2GBQA 3D7SB 1VQ6A 4HKEA 3CCLA 1VQPQ 3P8BB 1S72T 2D6FA 4M7AB 5CQYA 1M5Q1 1RAGB 2IVWA 2CDTA 3L2WA 1BI0A 4KULA 2RMOA 1VQ8A 3CXCA 2BZXA 3OYYA 2KSSA 4C0GA 2VYTA 1VQMA 3X28B 5LL6S 2YUPA 2L5QA 2OX7A 1GXIE 3I55T 2D8HA 2ZCFB 4FT2A 3PVLA 3EGXB 1D1AA 1M1KC 3CC7A 1B3QA 4M77G 2DZ9A 3CMEQ 1ZUYA 4RTYA 1EZZB 3VV0A 4OMFB 3JCMh 2L3RA 3VRYA 1Q7YU 3M0PA 4NL2A 3REBB 4E6RA 3BE3A 4M78D 4C5IA 2VUBA 1Q86U 4PJOF 1WPYA 3QUIA 1QVGA 2FVUA 1WHJA 2DTHA 2RHZA 3E2UA 5IXFA 4IUVA 3CMET 2GCXA 4RUGA 4M77C 2LJ3A 1BI2A 1NPRA 1Y57A 1X2KA 2DEQA 5CKHA 4X34A 1YWOA 1OU8A 2LCCA 2CH4W 2DZCA 1VQ9T 3EGUA 3BY7A 2DMOA 4HVVA 4MMLA 3ZBDA 1NLOC 3L2VA 2XMFA 2HSPA 3SB2A 1VQ7Q 2QQRA 4J6WA 2M0YA 4BDYA 1RAHB 2EIFA 1I0CA 2MYSA 2NUTA 2QTVA 4QQDA 3ZFJA 1Q81U 4PFOA 2E1HA 2R5AA 2JUFA 1V1CA 3QWYA 3RESA 1QCNA 3GPLA 2ED1A 3ME9A 5A0LA 2K2MA 1PD1A 5CVIA 3OS2A 2MIOA 1QVFP 3NTIA 2DETA 4Z02A 4RTZA 1VQ7T 2RNAA 3L42A 4QKUA 4J6XA 2RQRA 1TS9A 4PJLA 1BKBA 2KY9A 3CCVT 1W6XA 2EYQA 4F7UE 4BE1A 1M2VB 1F1BB 1UHCA 5GANf 4UC4A 1HXDA 2F5KA 3J81E 3THKA 2LX7A 2ROLA 2KBTA 2ROTA 3L2QA 5HKCA 1H3ZA 3A8MB 1ARKA 2ABLA 4J7IA 2JS2A 4II1A 4R0KA 3NFCA 4A4KA 1U1SA 1EIFA 1TWBA 3FEOA 4C0DC 2EVRA 5IHKA 1H3HA 4M78B 1FMVA 5GAMd 1W4SA 1WLPB 2QA4Q 4DBRA 1W2BS 2L3QA 3OYFA 3MP8A 2R5MA 4R56A 2L3PA 2ZPEB 1UTIA 3L2ZA 4AFSC 4EIKA 2COZA 4M75G 1QKWA 1O75A 2SRCA 1X43A 4EMKA 3V7SA 4LDXA 2AHJB 5LJ5f 4C0ZA 3OYNA 1N27A 1QP3A 2QA4T 1NPPA 2DNUA 1WYXA 7AT1B 4CC3A 5KYWB 3KXTA 4D8KA 1PD0A 4PFPA 1Z9QA 4F7UF 4LNPA 1TG0A 2P84A 2BUDA 2O9SA 3N5BB 4M75C 2DFUA 1SG5A 3FC3A 2V8IA 2H3JA 3CCMQ 3UPUA 1AHJB 1B34B 1I1JA 4PNOA 3JCMQ 3A8LB 4CRIA 2CT3A 3G6EA 2Y4XA 2MAMA 4BY6C 5KYXA 1T3SA 3CXCP 4KRTA 3X20B 2O88A 1KK7A 2COYA 2HNIA 1BB9A 1VQLA 2DJQA 3A1PA 1T3LA 1OPLA 2P0PA 2FPFA 4EMKC 1DJ7B 1U5SA 4HCCA 5GAMg 2DEUA 2D9TA 3CPWA 4OVAA 3ER0A 3H41A 4L6V5 3MCAB 2LNVA 1G3YA 1PKSA 2YRCA 3UT1A 3V8LA 3M0RA 1YI2Q 1K9MR 4XU3A 4M77B 2PQWA 5GMKj 2HKNA 2KRNA 3CCQQ 3NPFA 5KH6A 4ZTFA 3HTRA 1UEBA 1X27A 1MMDA 1HD3A 2EGCA 3PMIA 5DM7R 2M0OA 5DLOA 3JAME 1QVGP 2E6NA 3VS6A 3RUXA 2O01E 3RNJA 2L89A 1N9SA 3OS1A 2DL3A 3I56Q 1LOJA 1YIJT 2KRSA 3HKSA 1YI2T 5KYNA 3JB9D 1QWFA 3I35A 2E3IA 2GFUA 2KT8A 5EC7A 2JM8A 2HZYA 2B8AA 3A8OB 1M90R 2EQIA 5GMKh 3M55A 1GCPA 3CCJQ 3S3OA 2DKGA 3MKDA 1KD1R 5EG2A 1QCFA 4JJDA 3CC2A 1YITA 3V7RA 3S3MA 4ESRA 5KYYA 4BUGA 2DLPA 3PFSA 2QQAA 5CK9A 4HCZA 2RM4A 5HCKA 4JS5A 2X4WA 1VQPA 3C12A 2YWWA 3TU4K 5GJVB 4Z89A 2J6KA 2DXBA 3CCJT 3EGDA 3PNWC 1ZHIA 3FLGA 2NWMA 4C92G 4C5GA 2BZYA 1M1GA 2KR3A 3M0QA 4GLMA 4FYWB 1UJ0A 4M7DE 2HAXA 1WNLA 2AT1B 4C0DB 2DILA 4KGZB 2YUQA 3EGXA 2IG0A 4GLKA 1M27C 2CT4A 5J39A 1QW1A 2FEIA 2M1HA 2LVMA 3CCUQ 1AOJA 2ZGWA 3G4ST 1M3BA 1K9MC 4OP0A 2WACA 3JCMb 1IRXA 4JLIA 4DBFA 2C0TA 2QDLA 3P8DA 1KC8U 2QEXQ 2R58A 1M2OA 3CMAQ 5GANe 3GF5A 3QIIA 3JV3A 1PSFA 1PRMC 4C92E 2P0QA 4J6YA 1WXBA 2FHDA 2GTOA 4RMOA 3OW2A 4PJNA 1YJWQ 5GANg 2EAYA 3CCUT 2LT4A 4C8QE 1EFNA 2LJ1A 1YCSB 1X69A 3VJPA 4C5HA 3BDLA 1UGRB 5L23A 4CC2A 1J3TA 1OX9A 3CMAT 4WCIA 4Y28E 4JDSA 1M90C 3JCMd 4AG2C 4JS4A 3CCET 1SEMA 2M9UA 2IIMA 5I2SA 2RHYA 3G7ZA 4KGVB 4E47A 1KD1C 2YT6A 2FZCB 3V8KA 2EGEA 4IIMA 4BY6B 4M7AE 4M7DF 4PFZA 2A37A 1M4ZA 1IREB 5LJ5e 3CCRT 5GMKl 2E65A 1BYMA 1BI3A 3OSVA 2KGTA 2DO3A 4EMKB 2JTMA 2JS0A 1VQ4A 4Y91A 4DA4A 1ZUKA 1H641 2DF6A 1MMNA 5LJ5g 3ZEHA 1SHFA 1QLYA 4PJJA 3HP9A 1PWTA 2COWA 2RF0A 4P5NA 1VQ5A 2LT1A 1WX6A 4JZ3A 2AKLA 2JVVA 1EX4A 3OYJA 4ELYC 2VVKA 5CKBA 3TQ7P 1M2VA 3I9QA 1K73U 4HXJA 1ABQA 2KXCA 1KG1A 3UA7A 4JJNK 1WQWA 2CGHA 2VWFA 2OTLA 3UWNA 1KQSA 1VQKQ 1N9RA 4L59A 4C8QF 3CPWP 2OAUA 2CS7A 2RO0A 3MEUA 2FYKA 2Z0WA 3VS0A 5ECAA 1E6GA 1CSKA 2K3YA 4X9CA 5HK0A 3L2UA 2V8KA 3JCMe 3OQ5A 4OMMA 5A0GA 2FPDA 3MEVA 1PKTA 5CIUA 1YJNQ 1T0HA 1HYOA 2E5KA 5FWCA 3VS3A 1Y0MA 1XNIA 1M1KU 1WJSA 2OTJT 1BU1A 3JCMg 1X6BA 3JCMc 1VQKT 4HT9A 4M7AF 1YJ9Q 1SPKA 4A53A 1NJIR 1AWOA 1XTDA 2IPOB 1WXUA 1Z9ZA 2P4RA 1WDXA 1I81A 5AYFA 4PJOG 1GCQC 2MWOA 1OV3A 1KHCA 4HT8A 3OYHA 1UGPB 2E64A 2EWNA 1YJNT 4XTZA 1PSEA 5CO7A 3BW1A 2EYYA 2XI9A 4J9FA 2HDAA 4E2FB 3M53A 2ZPBB 1WA7A 3MPUB 1RADB 1XJWB 2RD1A 5KYWA 1YJ9T 3SHWA 2YUOA 2F2VA 2D0QB 4XTWA 3RKYA 3A8HB 3QJYA 1UB4A 4NL3A 4PKCC 4J9IA 2DAQA 3OS0A 5FW9A 4D8DA 1AWJA 4PJOC 2PU9B 3CCMA 2CZ1B 1FMWA 1B34A 1VA7A 1G3WA 3EG0A 2X3WD 1WFWA 3RIRA 3MO8A 3CC4T 2HKQB 3KFVA 2XDBA 1D0ZA 3OYIA 1VIEA 2FL7A 5KYYB 2JN0A 2RJEA 2JTFA 1RLPC 3HFOA 4E7JA 4JPBW 2HBPA 1G5VA 3PGGA 1S1NA 2HQEA 1LVKA 2A36A 2DVEA 3EHQA 2EJFA 4M78E 5HY6A 1QP2A 3EGDB 3JB9I 3M5AA 4KGXB 2RA2A 2HD0A 3G1JA 4M77A 3CCQA 2EKOA 3TREA 4Y92A 1GL5A 1XQHA 2DXUA 1QVGS 1JO8A 2VGMA 1UJYA 3VUBA 2LCSA 4OGCA 3TVTA 1JBMA 2QGGA 3LGLA 2CP3A 1OOTA 3X24B 3CCSA 3I56A 3OW2P 2RK2A 1WI7A 2ATCB 4QQ6A 4ELZC 1YHQQ 1RAAB 3QDRB 2HCKA 1NJIC 2K5LA 2JJ9A 1ZA1B 5GAN8 1U1TA 3VYHB 2B86A 3O8VA 2EQMA 5AT1B 1VQ9Q 3NHNA 4OGEA 3PT9A 2JNGA 2DBMA 1D1CA 5CQXA 5LJ3f 2VXEA 1V29B 1YHQT 2L0AA 3ZL7C 2DK3A 3JCMV 3UA6A 4F14A 1B7TA 1FX7A 1FWZA 4N4HA 3WXMB 2ZPIB 2VB6A 2MOXA 3MJXA 4KH1B 4E7IA 4JZ4A 3QYGB 1NG2A 5GAN3 5J3BA 4A4EA 4M78F 2EJ9A 2JXBA 4F7UG 2XG8D 3OYGA 3MHXA 1FMKA 3LW5E 1Y7XA 3QYHB 4FT4A 1ABOA 2QQBA 2PUOB 4RTUA 5C0MA 1VQOQ 1RACB 2DL4A 2EGAA 3EG3A 3A98A 2HSEB 4XU2A 3CCVQ 2O31A 1UDLA 2MWPA 2YSQA 1QWEA 1KQSP 4J9HA 3U23A 2DERA 2E6ZA 2YLBA 2H8HA 4OB1B 1TTHB 1K1ZA 2J6OA 5IH2A 1JJ2S 3CD6T 3JB9J 1VQOT 1R0BG 2QEXA 2QAZA 3VKIA 4JJBA 4OB0B 3HHTB 1OX8A 2JT4A 4RKUE 2XK0A 3FB9A 4J9BA 2DPPB 1OU9A 5GAOl 1YJWA 2RN8A 3SWNC 2XICA 3H0HA 2SEMA 2EQUA 4M77D 2RK1A 3M59A 4ZGDB 4OMOA 2K2VA 4M75A 3AT1B 1MNEA 4PJOB 5GMKe 5M9OA 1V76A 2QXFA 2HL5C 4LE9A 1TOVA 3I5SA 5GMKm 3JB9H 3EG9B 3M0UA 4DQ2A 1VYVA 2KYBA 1T0JA 1AD5A 3FJ5A 2JZ2A 2DL7A 2E70A 1P92A 1UGQB 2W10A 5DY9A 2LQWA 1TH7A 4RG8A 4K11A 1MMAA 1M1FA 4ZNXA 3RKXA 1UECA 2EKHA 4CI0C 2HMAA 1K0XA 2NUPB 2L3SA 3LLRA 1YP5A 2M02A 2FB7A 3JCMP 3M4GA 4FW2A 2E4HA 2CP7A 4HA8A 3EFSA 2PTKA 3JCMW 1OYXA 3RERA 1ZSZC 1IZ6A 4IUTA 3RMSA 4RCBA 2EJGA 2KROA 4LDUA 1ZX6A 1KQ1A 4J9DA 1Y07A 3BDUA 1WXTA 3GNGA 2YDLA 4BDZA 4XAXB 1WIEA 4VUBA 5CAIA 1W1FA 2DRKA 2W0ZA 3H6ZA 3TCJA 2Y4YA 4DEXA 4OB3B 2HQXA 2YHTA 4E7LA 3ULRB 2L2PA 2F2WA 3PMTA 1LNXA 3HL8A 1PC0A 3V8JA 1YIJQ 2XDPA 1K9MU 2LZ6B 3OYEA 4YTLA 2PZ1A 2QI2A 4XU1A 3T9NA 3P8HA 3OB9A 1U3OA 2KXDA 1UHFA 4L5GA 1WHHA 2RHIA 2A7YA 2VC8A 3S6WA 1K8AR 4J8OA 1UE9A
chains in the Genus database with same CATH topology
3A8GB 4BY6B 2A3LA 4M7AE 4IKFA 3QZ5B 4JRQA 4M7DF 4XK8E 4IURA 2G3RA 3CEYA 1M4ZA 2MMPA 4KUDK 2XIDA 4DOWA 1YBYA 3G71A 3CCRA 4M7DD 5A2QE 2GF7A 1IREB 4JLGA 4QVDA 4EPCA 5LJ5e 3CCRT 3TEEA 5LJ5h 5GMKl 4M75D 1M90U 4XTXA 2E65A 5FLXE 1BI3A 1R8OB 3OSVA 3OYBA 1S72A 1K73C 2DO3A 4V2SA 1VQ6A 4HKEA 4EMKB 2JTMA 4E7HA 3CCLA 1VQ4A 3P8BB 2K5FA 4Y91A 4DA4A 4M7DG 1S72T 2D6FA 4M7AB 5CQYA 3VYGA 3CCLT 1M5Q1 1KD1U 5GAOq 2IVWA 2K4YA 1H641 1VQ4T 3SD4A 1UGSB 3L2WA 5LJ5g 1BI0A 2E41A 4KULA 3ZEHA 5GANd 1OI1A 5KCOA 1VQ8A 3CXCA 3HP9A 3OYYA 3A5ZB 4FU6A 4ZGJB 2KSSA 4P5NA 4C0GA 1VQ8T 2LT1A 1VQ5A 1G3SA 2VYTA 4M77F 3E1SA 3X28B 2JVVA 3OYJA 1VQMA 4ELYC 3I55A 5LL6S 1JJ2A 1VQ5T 3JB9F 2L5QA 5CKBA 1Q7YC 1K73U 4KBMB 1GXIE 1VQMT 1VIFA 3I55T 1WJQA 2PVGB 1KG1A 4JJNK 1WQWA 3LH0A 2ZCFB 2CGHA 4FT2A 4D6WA 3CBMA 2OTLA 3UWNA 1Q86C 1KQSA 1M1KC 1JB0E 1N9RA 3CC7A 3INZA 4M77G 1N6AA 2OTLT 4L59A 3QHSA 4C8QF 3SWNB 2KVQG 1M8VA 2OAUA 3JB9G 4E7KA 2CS7A 4M7DC 2JOYA 4J7FA 3CC7T 2RO0A 2DZ9A 2R57A 3MEUA 2FYKA 2XD0A 2K5IA 5HK0A 2K3YA 4X9CA 3VV0A 4OMFB 3L2UA 3QPHA 2V8KA 3JCMe 3OQ5A 2K3XA 3JCMh 2L3RA 5A0GA 1Q7YU 1LJOA 3MEVA 5CR2A 4NL2A 4C8QG 5FU7B 4ME7A 4M78D 5CIUA 3CPWS 3LWHA 4C5IA 2OTJA 3OBYA 2E5QA 2VUBA 2CZ7B 1Q86U 1XNIA 5DLQE 1M1KU 1WJSA 4PJOF 1VQKA 2OTJT 3JCMg 1WPYA 2DJZA 5GAN7 3QUIA 1QVGA 3JCMc 1VQKT 2FVUA 4HT9A 4M7AF 4EMGA 5LJ5d 4QVCA 1O9SA 2RJFA 5GAMj 2DTHA 1OZ3A 2RHZA 4O6JA 4A4GA 3OYMA 3CMEA 5IN1A 5KCHA 3OBWA 4IUVA 4A53A 3CMET 1XTDA 4FL6A 2GCXA 3J80E 4M77C 1I81A 2KK4A 5AYFA 4PJOG 2MWOA 1BI2A 1NPRA 3E19A 5LJ3d 1W2BA 4C92C 2LC4A 3EAEA 1D3BB 1KHCA 2YRVA 3ASKA 2DEQA 1UGPB 2E64A 3OYHA 1YJNA 4HT8A 4M7AG 3LX7A 1Q81C 2PUKB 2EWNA 5CKHA 4X34A 3QZ9B 1VQ9A 3RKWA 2LCCA 1YJNT 2DZCA 2XHCA 4XTZA 3V7CA 1PSEA 1VQ9T 5CO7A 3BW1A 2XI9A 2ZPGB 3BY7A 5GAN6 3PTAA 4MMLA 3ZBDA 3L2VA 3M53A 1YJ9A 2NLUA 2ZPBB 1K8AC 4M75E 4LD6A 2DXCA 3SB2A 5IT9E 2QQRA 2RD1A 4J6WA 1YJ9T 4BDYA 3CBPA 3M9QA 4A4HA 2D0QB 4XTWA 2EIFA 5GAN4 3RKYA 3A8HB 5D6WA 5GAMe 5FRNA 3ZFJA 4QQDA 5GAMh 2RI5A 3QJYA 1Q81U 2LDMA 1UB4A 4NL3A 3JCMf 2E1HA 3OYDA 2R5AA 3QO3A 4PKCC 5LJ3j 2DAQA 2JUFA 3OS0A 3OYCA 4PJOC 4OF1A 2PU9B 3CCMA 2KQWA 4M75B 3RESA 3GPLA 2CZ1B 3ME9A 1B34A 5A0LA 2CZ6B 3CCMT 1VQNA 1K8AU 3OS2A 1X01A 5CVIA 3FJPA 1G3WA 4IUPA 4XTUA 1VQ7A 4M7DA 3NTIA 4Z02A 3CC4A 1I8FA 2EQKA 3FIFA 3QBYA 3RIRA 1N8RC 2KMTA 3L42A 2O4XA 1VQ7T 2RJDA 3MO8A 3CC4T 4J6XA 2P4TA 4BI4A 3CCVA 4ZTJA 4NS5A 4MMKA 1BKBA 2KY9A 4B9WA 2XDBA 3PIPA 3OYIA 1VIEA 2QQSA 2FL7A 3OMCA 5D6YA 3CCVT 1KQSS 2JN0A 2RJEA 2JTFA 2EYQA 2V8JA 4F7UE 3AHUA 3HFOA 2RB6A 4RG2A 3G71T 4BE1A 1QVFS 4E7JA 2HBPA 4ZGEB 2CYZB 1G5VA 4BE0A 3PGGA 5GANf 2HQEA 4UC4A 1HXDA 2KDSA 1VQ6T 5LJ3e 4PLLA 2F5KA 3MEWA 4TVRA 2DVEA 3J81E 2LTOA 2WSCE 5LJ3h 3J7AF 2EJFA 3E9GA 4M78E 1QP2A 2ZPHB 2LCLA 3META 3M54A 5HY6A 2MF2A 3A8MB 3M5AA 3URGA 3WVEB 5HKCA 3JB9I 3DB4A 2RA2A 2HD0A 4M77A 3CCQA 1BYMA 4C5EA 1Y96A 2EKOA 4J7IA 4F7UB 4C92D 2WSEE 3TREA 4II1A 4C92A 3CCQT 4O5VA 4A4FA 1XQHA 5LJ3g 3NFCA 2DXUA 4A4KA 4C0FA 3X25B 1U1SA 3C94A 1EIFA 2CZ0B 1QVGS 3FEOA 4C0DC 2VGMA 2KAFA 4BD3A 3VUBA 4M78B 3SDZA 4OGCA 4C8QA 1Q82C 5GAMd 1W4SA 2EFIA 1JBMA 2X35A 4M75F 3LGLA 1W2BS 3X24B 3OYFA 3CCSA 3MP8A 3I56A 2R5MA 5FU6C 4R56A 5CCAA 2RK2A 2ZPEB 3L2QA 4QQ6A 4ELZC 3S3NA 3MEAA 3CCST 3L2ZA 3QDRB 3I56T 4ZN3A 4JRPA 1NJIC 2K5LA 4ZN1A 4M75G 2DD5A 1O75A 3CPFA 5GAOp 3HRSA 5GAN8 1U1TA 3VYHB 3SFMA 4PJOA 4EMKA 3OW2S 3O8VA 2EQMA 4OB2B 3V7SA 4LDXA 1Q82U 2AHJB 5LJ5f 4M7AA 4C0ZA 2QA4A 4OGEA 3OYNA 1N27A 1QP3A 3PT9A 2QA4T 2X4YA 2JNGA 4HCBA 4EMHA 1NPPA 2VXFA 2DTOA 1YHQA 1QVPA 5CQXA 2DXTA 5LJ3f 3DLLA 4NOYA 1NJIU 2VXEA 1V29B 3HRUA 3OS5A 1KHIA 3X26B 3OA6A 1YHQT 3KXTA 2DD4A 2Y90A 2DK3A 3JCMV 3M57A 4F7UF 2XU8A 1FX7A 3VU3C 1FWZA 4N4HA 3WXMB 5IAYA 1N8RU 2LQ8A 2ZPIB 4EDUA 2XDDA 4GY5A 4BI8B 4E7IA 2BUDA 2LX9A 2RHXA 3N5BB 3JCMX 3QYGB 4M75C 5GAN3 5J3BA 2RI2A 5GAOr 4A4EA 4M78F 3FC3A 2V8IA 2H3JA 2EJ9A 3JCMJ 4F7UG 2BIVA 2VGNA 2XG8D 3OYGA 3MHXA 4C8QC 3UPUA 3LW5E 1B34B 1AHJB 1Y7XA 3QYHB 4FT4A 4PNOA 3JCMQ 2QQBA 3A8LB 3OY9A 2PUOB 4CRIA 3KUFA 4M7DB 3HFNA 3G6EA 2Y4XA 2MAMA 3HPWA 4BY6C 3LWIA 4IUQA 1YCYA 4LDWA 5C0MA 1X75C 3G6ET 3X20B 3GIBA 4M78G 2HNIA 1VQLA 4XU2A 3NTKA 3QKJA 2M16A 2YLCA 3M56A 1VQLT 4X9DA 5FRMA 2P0PA 4N4GA 4QVZA 2MWPA 2ZZDA 1RI0A 1DJ7B 4EMKC 4MDWA 1KQ2A 4HCCA 3CXCS 2GQVA 3H8ZA 3C95A 5GAMg 4M7AC 2D9TA 4MDXA 2RH2A 4PL6A 3CPWA 3CD6A 2P0KA 1WQ7A 3ER0A 4OVAA 4L6V5 2E6ZA 1BI1A 2YLBA 3MCAB 2LNVA 4OB1B 4DOVA 1VQOA 1JJ2S 1HK9A 1NZ9A 1G3YA 3CD6T 4JRIA 3UT1A 3V8LA 3JB9J 1VQOT 4XU3A 4J83A 1D3BA 2PQWA 4M77B 5GMKj 2QEXA 4QQGA 4N4IA 3VKIA 2RJCA 4C92B 1RL2A 1U8RA 4OB0B 3OYLA 5KH6A 2QEXT 3HHTB 4A54A 1I4K1 4ZTFA 1WGSA 3EFRA 4MZPA 4RKUE 2CKKA 1UEBA 4XU0A 1BIAA 2XK0A 2RHUA 4KUIA 4MZTA 1I5LA 3PMIA 3FB9A 3HRTA 2E10A 3M58A 5DM7R 2M0OA 5DLOA 2DPPB 4LDYA 3JAME 5GAOl 2E6NA 2ZPFB 3OSSC 1YJWA 3RUXA 3SWNC 1YIJA 3RMQA 1MGQA 2O01E 3PIOA 2L89A 1N9SA 1BIBA 3NTHA 3OS1A 1YI2A 1YJWT 2XICA 4FM4B 3WVDB 1LOJA 4RCCA 3OMGA 1YIJT 3VUZA 2EQUA 4M77D 1OZ2A 3HKSA 1YI2T 5GAOm 2RK1A 1MHNA 2QDYB 3M59A 4ZGDB 3JB9D 4LD9K 4KT0E 2K2VA 4XTVA 5GAMf 3GLXA 2GFUA 5FU7C 4M75A 2PVDB 1VUBA 3BFMA 5J26A 3A8OB 5FROA 1XOVA 2B8AA 2LQKA 5GMKe 4PJOB 3JSCA 5C6SA 3QXEB 4J5YA 5GMKh 3M55A 5M9OA 4C8QD 2QXFA 3S3OA 5GMKm 3JB9H 2DKGA 2DIQA 3Q1JA 5EG2A 4DQ2A 2L8DA 5GAN5 4BI3A 3MP1A 2XKOC 3KBGA 3CC2A 3E9FA 5KE3A 5L8RE 1YITA 2JZ2A 3V7RA 2E70A 1P92A 1UGQB 3S3MA 3DKMA 3CC2T 3LYIA 3QG1A 5DY9A 3DLMA 4BUGA 2C06A 1TH7A 1YITT 3PFSA 4RG8A 2QQ9A 2QQAA 3FRNA 2K57A 1M1FA 4HCZA 3RKXA 2RM4A 4C92F 3QJ6A 5CK9A 2X4WA 4JS5A 4PJOD 4CI0C 1VQPA 1X6OA 3OYAA 3GP8A 4N0AA 3C12A 3TU4K 5I21A 3LLRA 4XQ3A 3CCJA 4M7AD 1VQPT 2I2LA 1FXXA 2FB7A 3JCMP 4QW2A 3M4GA 2DXBA 3CCJT 3PNWC 1QVFA 4HA8A 1ZHIA 3FLGA 3MP6A 4C92G 4C5GA 4WF2A 4F7UA 4Q5WA 1M1GA 3JRZA 3EFSA 3C4SA 4R55A 3LGFA 3JCMW 5GANj 1OYXA 4B9XA 3RERA 3QSUA 1IZ6A 4IUTA 4M7DE 3RMSA 2HAXA 1WNLA 4M78A 4C0DB 1KC8C 4RCBA 2EJGA 4LDUA 3L1AA 1KQ1A 2LRQA 3GNFB 2IG0A 4GLKA 4MZMA 1Y07A 3M4YA 3BDUA 4JRKA 4LDVA 3SWNA 5J39A 3GNGA 1QW1A 3DB3A 2M1HA 2BKDN 5FU6B 2DIGA 2LVMA 4BDZA 3G4SA 2X4XA 4XAXB 2RI3A 2ZGWA 3G4ST 4VUBA 5CAIA 1K9MC 3FDRA 2WACA 4OP0A 2QTXA 4PLIA 2O4XB 3JCMb 1VQNT 2EQJA 4JLIA 2F5TX 3P8DA 1KC8U 3H6ZA 2R58A 4BB7A 3TCJA 2Y4YA 5A0DA 1SSFA 4JUVA 5GANe 4OB3B 3GF5A 3QIIA 2HQXA 2YHTA 4M77E 2F69A 5GANh 3GOXA 4E7LA 1PSFA 1JRIA 4N0AC 4C92E 4BE2A 2P0QA 5I2MA 4BACA 3CBOA 4J6YA 2FHDA 3PMTA 4RMOA 3CCUA 3OW2A 1G3TA 1LNXA 5KE2A 2GFAA 2DTIA 3HL8A 5GANg 2EAYA 5GAN2 1H3ZA 3CCUT 1K9MU 3V8JA 5LJ5j 2XDPA 2WSFE 2LT4A 4FSXA 4C8QE 3R6OA 5CKEA 3OYEA 4YTLA 1Y96B 3VJPA 4C5HA 2QI2A 3BDLA 4IUUA 1UGRB 4XU1A 3T9NA 3P8HA 3CMAA 5D6XA 1M9SA 1NE8A 3OB9A 1ZQ1A 3CCEA 3OYKA 5CKDA 2PVOB 4L5GA 4Y28E 3CMAT 4JDSA 2RHIA 4M78C 1ZBXA 5HK3A 1M90C 3HSBA 4FIBA 3JCMd 4JS4A 2E12A 3CCET 2M9UA 2X4JA 5CKFA 3L2RA 5GMKi 2MI6A 2A7YA 2VC8A 3UDCA 4XTYA 4C8QB 1WJRA 1Y71A 2RHYA 3S6WA 5I2SA 5GAOn 3G7ZA 2VV5A 4J8OA 4E47A 1KD1C 4ATOA 4PJOE 3V8KA 3F70A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RD1 A;  4J6W A;  4M7A E;  4M7D F;  4XTW A;  2Y90 A;  3RKY A;  3V7R A;  5GAN 4;  3JCM V;  4F7U F;  5GAM e;  5DY9 A;  3VU3 C;  1TH7 A;  5GAM h;  4NL3 A;  3JCM f;  2E1H A;  2K57 A;  4C92 F;  3RKX A;  2RM4 A;  4QVD A;  3QO3 A;  5LJ5 e;  5LJ3 j;  5LJ5 h;  5GMK l;  4M75 D;  3JCM X;  4XTX A;  4PJO D;  2E65 A;  5GAN 5;  4M75 C;  4N0A A;  4PJO C;  5GAN 3;  4V2S A;  3RES A;  4M75 B;  5I21 A;  4XQ3 A;  4EMK B;  5GAO r;  4M7D G;  4M7A D;  4M78 F;  4Y91 A;  2I2L A;  1B34 A;  2EJ9 A;  4F7U G;  2FB7 A;  4M7A B;  3JCM J;  3JCM P;  4C8Q C;  1M5Q 1;  1X01 A;  3M4G A;  3FJP A;  1B34 B;  1H64 1;  5GAO q;  4XTU A;  5LJ5 g;  4M7D A;  4HA8 A;  2E41 A;  4PNO A;  4C92 G;  3JCM Q;  5GAN d;  4M7D B;  3HFN A;  4WF2 A;  3SB2 A;  4F7U A;  1I8F A;  3RIR A;  3FIF A;  3EFS A;  1YCY A;  4J6X A;  3JCM W;  5GAN j;  3GIB A;  4M78 G;  3RER A;  3QSU A;  4MMK A;  2HNI A;  4M77 F;  4XU2 A;  4M7D E;  3JB9 F;  2JN0 A;  1WNL A;  4M78 A;  5LJ3 f;  2YLC A;  4F7U E;  3HFO A;  2EJG A;  2RB6 A;  4RCB A;  4X9D A;  3AHU A;  3L1A A;  1KQ1 A;  1WQW A;  4EMK C;  2CGH A;  1KQ2 A;  3PGG A;  5GAN f;  4JRK A;  3BDU A;  1HXD A;  5GAM g;  4M7A C;  3SWN A;  1N9R A;  5LJ3 e;  3INZ A;  4M77 G;  2DVE A;  3QHS A;  5LJ3 h;  3SWN B;  4C8Q F;  1M8V A;  3JB9 G;  1WQ7 A;  2EJF A;  4M78 E;  4M7D D;  2YLB A;  4M7D C;  3JB9 I;  2DZ9 A;  1HK9 A;  2RA2 A;  4JRI A;  2ZGW A;  2FYK A;  4M77 A;  3V8L A;  4F7U B;  1Y96 A;  4X9C A;  4XU3 A;  4OP0 A;  5CAI A;  4M77 B;  1D3B A;  4C92 D;  3JB9 J;  5GMK j;  2QTX A;  4C92 A;  3JCM b;  3JCM e;  5LJ3 g;  4JLI A;  3JCM h;  4C92 B;  2DXU A;  1LJO A;  1U1S A;  4A54 A;  4NL2 A;  1I4K 1;  4C8Q G;  3EFR A;  4M78 D;  4JUV A;  5GAN e;  4XU0 A;  1BIA A;  4M77 E;  2YHT A;  5GAN h;  4M78 B;  1I5L A;  4C8Q A;  3FB9 A;  5GAM d;  2E10 A;  4M75 F;  1JRI A;  1JBM A;  4N0A C;  4PJO F;  3JCM g;  4C92 E;  1WPY A;  2DJZ A;  5GAN 7;  3QUI A;  4J6Y A;  5GAO l;  3JCM c;  4HT9 A;  4M7A F;  4EMG A;  3RUX A;  4QVC A;  3SWN C;  5LJ5 d;  5GAM j;  2DTH A;  1LNX A;  1MGQ A;  2DTI A;  1N9S A;  1BIB A;  2EAY A;  5GAN g;  5GAN 2;  3L2Z A;  1LOJ A;  4RCC A;  3V8J A;  4A53 A;  5LJ5 j;  4M77 D;  4C8Q E;  4M77 C;  5GAO m;  1I81 A;  3JB9 D;  4PJO G;  4M75 G;  5LJ3 d;  1Y96 B;  4C92 C;  5GAO p;  1D3B B;  5GAN 8;  4XU1 A;  2DEQ A;  1U1T A;  2E64 A;  4XTV A;  5GAM f;  4HT8 A;  4M7A G;  4PJO A;  2EWN A;  4M75 A;  4EMK A;  3V7S A;  3RKW A;  3BFM A;  4PJO B;  2DZC A;  5GMK e;  4XTZ A;  4M78 C;  3HSB A;  5LJ5 f;  4M7A A;  4J5Y A;  3V7C A;  5GMK h;  3JCM d;  3BW1 A;  4C8Q D;  5GMK i;  3BY7 A;  2VC8 A;  4C8Q B;  5GAN 6;  4MML A;  4XTY A;  5GMK m;  3JB9 H;  2DKG A;  4EMH A;  5GAO n;  2VXF A;  2DTO A;  4DQ2 A;  4PJO E;  4M75 E;  2DXT A;  3V8K A;  4NOY A;  2VXE A; 
#chains in the Genus database with same CATH topology
 2DBK A;  2A3L A;  1YFN A;  4IKF A;  3M0T A;  4IUR A;  1NEB A;  2MMP A;  1LCK A;  1VQM Q;  2RQW A;  3NMZ C;  1M90 U;  1PCX A;  4M75 D;  4XTX A;  5FLX E;  1K0S A;  4AFQ C;  1S72 A;  1KIK A;  2HL3 A;  4E7H A;  4M7D G;  2F1L A;  3VYG A;  3CCL T;  1KD1 U;  3SD4 A;  2E41 A;  3CC7 Q;  5GAN d;  1OI1 A;  5GJW B;  1N8R R;  4CC7 A;  5KCO A;  4HVU A;  4FU6 A;  1QQJ A;  1VQ8 T;  1R0C B;  3E1S A;  3I55 A;  3JB9 F;  4KBM B;  1VQM T;  4QT7 A;  4D6W A;  3EG1 A;  1I5O B;  3INZ A;  3SWN B;  2KVQ G;  3CQT A;  3R6N A;  4E7K A;  4M7D C;  3CC7 T;  2R57 A;  2XD0 A;  3EG2 A;  2K5I A;  4HVW A;  3G4S Q;  2CP2 A;  2RPN A;  2K3X A;  1LJO A;  5IHI A;  4C8Q G;  3LWH A;  1Q82 R;  2CZ7 B;  2FZK B;  2DJZ A;  4EMG A;  5LJ5 d;  4QVC A;  5GAM j;  3OYM A;  3CME A;  4O6J A;  4RTW A;  4A4G A;  5IN1 A;  5KCH A;  4FL6 A;  1WHG A;  2KK4 A;  4C92 C;  2LC4 A;  3EAE A;  1TUD A;  3ASK A;  4M7A G;  3LX7 A;  2PUK B;  1VQ9 A;  3QZ9 B;  1AT1 B;  2D8J A;  2XHC A;  2DX1 A;  3CCE Q;  4X1V A;  3VS5 A;  4FYY B;  1K8A C;  2DXC A;  5IT9 E;  1BCO A;  2EBP A;  5GAN 4;  2MCN A;  5D6W A;  5FRN A;  1ZSZ B;  5GAM h;  4AT1 B;  2RI5 A;  2LDM A;  3OYD A;  3QO3 A;  3CCR Q;  3G71 Q;  5LJ3 j;  4OF1 A;  2KQW A;  4M75 B;  4FYV B;  1JXM A;  2C0I A;  1X01 A;  1IB8 A;  2FRY A;  4IUP A;  1VQ7 A;  4CC4 B;  1I8F A;  2EQK A;  1N8R C;  2KMT A;  2AKK A;  2GQI A;  3IQL A;  1SSH A;  4BI4 A;  3CCV A;  4NS5 A;  3PIP A;  1KQS S;  2QQS A;  3OMC A;  6AT1 B;  3G71 T;  1QVF S;  4Z8A A;  2KI7 A;  4ZGE B;  2OI3 A;  2KDS A;  4PLL A;  3J7A F;  2LTO A;  5LJ3 h;  3E9G A;  2ZPH B;  2LCL A;  1UUE A;  3MET A;  3URG A;  2MF2 A;  4C5E A;  1GCQ A;  1Y96 A;  2DM1 A;  4C92 D;  2WSE E;  2EW3 A;  1SF9 A;  4O5V A;  4C0F A;  5I11 A;  2HQH A;  3X25 B;  1PM3 A;  1PHT A;  1Q82 C;  3C0C A;  2X35 A;  2OTJ Q;  2ECZ A;  4AFZ C;  2YXY A;  3UF4 A;  1RAF B;  5FU6 C;  5CCA A;  2G6F X;  3S3N A;  1NYF A;  3MEA A;  1C1A A;  4JRP A;  1PRL C;  4ZN1 A;  1HJD A;  5GAO p;  3H9N A;  1SRM A;  3SFM A;  4PJO A;  4ORZ A;  5KYU B;  2QA4 A;  2RQV A;  3EG9 A;  4LN2 A;  4HCB A;  3DLL A;  1JQQ A;  4NOY A;  1NJI U;  2JMC A;  2KEA A;  4PK4 A;  1KHI A;  3OA6 A;  3G6E Q;  4RTT A;  2Y90 A;  3M57 A;  5FWB A;  2XU8 A;  1D1B A;  5IAY A;  1FYN A;  1M30 A;  2LQ8 A;  4EDU A;  2XDD A;  4BI8 B;  2LX9 A;  2RHX A;  2NUP A;  3JCM X;  2K79 A;  3TSZ A;  3QDF A;  1K4U S;  3TSW A;  1GFC A;  2RI2 A;  3H0I A;  2LQN A;  2JM9 A;  1YWP A;  4J9G A;  3JCM J;  1GRI A;  2VGN A;  2LP5 A;  1VQN Q;  4M7D B;  2EYZ A;  2BE9 B;  4IUQ A;  2J6F A;  3CC4 Q;  3G6E T;  4M78 G;  4HCK A;  4B6M A;  2CRE A;  1RLQ C;  3NTK A;  2J05 A;  3QKJ A;  1MV0 B;  2M16 A;  2YLC A;  2BZ8 A;  3M56 A;  1VQL T;  5FRM A;  4N4G A;  2ZZD A;  3CXC S;  2GQV A;  1KSW A;  2AIR B;  2X9H A;  4MDX A;  2RH2 A;  2MK5 A;  4PL6 A;  1WQ7 A;  1VQN T;  1BI1 A;  1TXQ A;  4FSS A;  1IHV A;  1X2Q A;  2KE9 A;  1SKU B;  1D3B A;  2M51 A;  1K76 A;  4QQG A;  1KJW A;  2RJC A;  4C92 B;  3OYL A;  4A54 A;  3EFR A;  2CKK A;  3EFO B;  4XU0 A;  1BIA A;  5I22 A;  2RHU A;  4MZT A;  1I5L A;  3HRT A;  4E7Z A;  2HEQ A;  5D7U A;  8ATC B;  4LDY A;  4LXC A;  2ZPF B;  1Q95 G;  1YIJ A;  1AEY A;  2BE7 D;  3PIO A;  3NTH A;  1BIB A;  1YI2 A;  4FM4 B;  3WVD B;  3OMG A;  1OZ2 A;  1ACM B;  1TUG B;  4KT0 E;  4XTV A;  2X3X D;  3GLX A;  5GAM f;  5FU7 C;  1HSQ A;  1X6G A;  1VUB A;  5FRO A;  4LUD A;  2DRM A;  2VAS A;  1YN8 A;  2L8D A;  4BI3 A;  3MP1 A;  1BBZ A;  1UGV A;  5L8R E;  3VS2 A;  3CC2 T;  1AZG B;  1IGQ A;  1YIT T;  2MPX C;  3FRN A;  1NM7 A;  3QJ6 A;  4PJO D;  1X6O A;  2X51 A;  4N0A A;  4PJM A;  5I21 A;  3CCJ A;  1VQP T;  4Z88 A;  2I2L A;  4OMQ A;  4QW2 A;  2DA9 A;  3MP6 A;  4OML A;  4WF2 A;  2ESW A;  3VS7 A;  4F7U A;  2DE0 X;  2J06 A;  2FRW A;  4B9X A;  1Q7Y R;  1A0N B;  3L1A A;  1BCM A;  2LRQ A;  4WTO B;  4MZM A;  1GBQ A;  1Q86 R;  3M4Y A;  1MND A;  3SWN A;  1TSF A;  3DB3 A;  3I5R A;  1H8K A;  2BKD N;  5FU6 B;  2DIG A;  3G4S A;  1C6V X;  2X4X A;  1RAB B;  3CD6 Q;  3PVQ A;  4E7S A;  3FDR A;  4PLI A;  1D0X A;  2EQJ A;  3LH5 A;  2F5T X;  2AZV A;  4BB7 A;  3QWX X;  4JUV A;  4M77 E;  1JRI A;  4N0A C;  4BE2 A;  4M4Z A;  4BAC A;  3CBO A;  1TUC A;  4ANJ A;  3CCU A;  2EYW A;  1M3A A;  2GFA A;  2DTI A;  5GAN 2;  1E6H A;  1M3C A;  4FSX A;  2GGR A;  2RQU A;  3R6O A;  5CKE A;  1Y96 B;  4IUU A;  4J9E A;  3CMA A;  1Q81 R;  5D6X A;  1M9S A;  1M8M A;  1ZQ1 A;  3CCE A;  2PVO B;  3HSB A;  1ZBX A;  2YUN A;  1JU5 C;  2E12 A;  4OMN A;  2X4J A;  2MI6 A;  1VQ4 Q;  3UDC A;  4XTY A;  5GAO n;  4ATO A;  2O9V A;  3REA B;  3F70 A;  2QYZ A;  3QZ5 B;  4JRQ A;  1NBE B;  1VYU A;  4J9C A;  4XK8 E;  1ZSZ A;  3CEY A;  2KT1 A;  2AK5 A;  2XID A;  3CCR A;  3G71 A;  1VQ5 Q;  5A2Q E;  2LJ0 A;  4F16 A;  3M0S A;  3TEE A;  2EPD A;  4V2S A;  2FO0 A;  9ATC B;  2K5F A;  2C06 A;  2OTL Q;  5GAO q;  2K4Y A;  1VQ4 T;  1UGS B;  4FCY A;  3A5Z B;  2V1Q A;  2DL5 A;  4ZGJ B;  1GBR A;  1G3S A;  4M77 F;  3EHR A;  1RUW A;  1JJ2 A;  1VQ5 T;  1Q7Y C;  1RI9 A;  1VIF A;  1WJQ A;  2PVG B;  3LH0 A;  3CBM A;  1Q86 C;  3H0F A;  1JB0 E;  2OTL T;  1N6A A;  3QHS A;  1M8V A;  3JB9 G;  2JOY A;  4J7F A;  3RDV A;  1AWW A;  3QPH A;  1C0M A;  5CR2 A;  5FU7 B;  4ME7 A;  3CPW S;  2OTJ A;  3OBY A;  2E5Q A;  5DLQ E;  2K3B A;  1MMG A;  1VQK A;  5GAN 7;  3VS4 A;  1O9S A;  2RJF A;  1OZ3 A;  3OBW A;  4JJC A;  2F2X A;  3J80 E;  2CUD A;  5LJ3 d;  1AVZ C;  1W2B A;  3E19 A;  2OJ2 A;  1D3B B;  2YRV A;  1YJN A;  1Q81 C;  4F17 A;  3RKW A;  5KYU A;  4RTX A;  1H92 A;  1ZA2 B;  3V7C A;  2CUB A;  1G83 A;  1I07 A;  2KYM A;  2ZPG B;  3PTA A;  5GAN 6;  3VS1 A;  2PNI A;  1YJ9 A;  2CP6 A;  2NLU A;  2QK0 A;  4M75 E;  4LD6 A;  1W70 A;  3CBP A;  3M9Q A;  4A4H A;  1AZE A;  1WHK A;  5GAM e;  1NEG A;  3JCM f;  3PE0 A;  3OYC A;  1UG1 A;  2NUZ A;  1VQN A;  2CZ6 B;  4DEY A;  3CCM T;  1VQ6 Q;  3CCL Q;  1K8A U;  2D1X A;  3FJP A;  1CKB A;  2FZG B;  4XTU A;  4M7D A;  2CP5 A;  4RTV A;  3CC4 A;  3QBY A;  3FIF A;  2O4X A;  2RJD A;  2P4T A;  4ZTJ A;  2CP0 A;  1VQ8 Q;  4MMK A;  4B9W A;  1OQK A;  5D6Y A;  2V8J A;  3AHU A;  2RB6 A;  4RG2 A;  2OAW A;  2CYZ B;  4BE0 A;  3UAT A;  2ED0 A;  1VQ6 T;  5LJ3 e;  3MEW A;  4TVR A;  2WSC E;  1N8R U;  3WVE B;  3CCS Q;  3M54 A;  3VRZ A;  3DB4 A;  2CSI A;  4F7U B;  4C92 A;  2DYB A;  3CCQ T;  4A4F A;  5LJ3 g;  3C94 A;  2CZ0 B;  3EFO A;  1ZUU A;  2KAF A;  1OUL A;  4BD3 A;  3SDZ A;  4C8Q A;  1D0Y A;  4M75 F;  2EFI A;  4A63 B;  2K7A A;  4AMC A;  4AFU C;  1QKX A;  3RR6 A;  2A28 A;  1YNZ A;  3I56 T;  3CCS T;  4ZN3 A;  2YRD A;  2DD5 A;  3CPF A;  4FW1 A;  4GBQ A;  3HRS A;  1R77 A;  2DVJ A;  3OW2 S;  4OB2 B;  1Q82 U;  4M7A A;  1QCO A;  1PNJ A;  2X4Y A;  4EMH A;  2VXF A;  2DTO A;  1RAE B;  1YHQ A;  1QVP A;  4LUE A;  2DXT A;  3HRU A;  3OS5 A;  3X26 B;  2DD4 A;  3VU3 C;  2NUT B;  4GY5 A;  1SRL A;  2V26 A;  5IHN A;  1KFZ A;  5GAO r;  2JW4 A;  2BIV A;  1QMC A;  4C8Q C;  2BTT A;  3OY9 A;  3RBB B;  3KUF A;  3HFN A;  3HPW A;  3LWI A;  4LDW A;  1OEB A;  1YCY A;  1X75 C;  3GIB A;  2KNB B;  2K9G A;  2JTE A;  2I0N A;  1JJ2 P;  2QGF B;  1KC8 R;  4X9D A;  4QVZ A;  1ZLM A;  1IGU A;  1RI0 A;  1KQ2 A;  1WHL A;  4MDW A;  3H8Z A;  3C95 A;  4M7A C;  1UFF A;  3CD6 A;  2P0K A;  4M7D D;  4OMP A;  4DOV A;  1VQO A;  1HK9 A;  1NZ9 A;  4JRI A;  3SEM A;  4J83 A;  2DL8 A;  4N4I A;  1BK2 A;  1U8R A;  1RL2 A;  2QEX T;  1I4K 1;  1WGS A;  4MZP A;  4KUI A;  3M58 A;  2E10 A;  1TU0 B;  4DBH A;  3OSS C;  3RMQ A;  2ZAE A;  1MGQ A;  4F04 B;  1SHG A;  2QG9 B;  1YJW T;  2FPE A;  8AT1 B;  4RCC A;  4KH0 B;  3NGP A;  3VUZ A;  2KRM A;  2CH4 A;  5GAO m;  1MHN A;  2QDY B;  3O5Z A;  4LD9 K;  1W2B P;  2E3H A;  2PVD B;  2V1R A;  3BFM A;  5J26 A;  1IXD A;  1XOV A;  2LQK A;  3JSC A;  5C6S A;  1K9A A;  2ENM A;  3QXE B;  4J5Y A;  4C8Q D;  3EH2 A;  2K6D A;  2D0N A;  2DIQ A;  3Q1J A;  1RAI B;  5GAN 5;  2HBW A;  1E7O A;  2XKO C;  3KBG A;  3E9F A;  5KE3 A;  1NYG A;  3DKM A;  1GFD A;  3LYI A;  3QG1 A;  3DLM A;  2JMA A;  2QQ9 A;  2K57 A;  4C92 F;  2GTJ A;  1K73 R;  2VKN A;  3OYA A;  2LNH B;  3GP8 A;  1VYT A;  4XQ3 A;  4M7A D;  1ZSG A;  4DBQ A;  1FXX A;  1QVF A;  2O2O A;  2EYX A;  1MV3 A;  1WZO A;  4Q5W A;  3JRZ A;  3C4S A;  2GNC A;  3LGF A;  4R55 A;  5GAN j;  1U06 A;  5KYX B;  2LMJ A;  2NYS A;  3QSU A;  1CKA A;  2CSQ A;  1ZBJ A;  4M78 A;  1KC8 C;  1VQL Q;  1PG5 B;  1IHW A;  2FG0 A;  1VOM A;  3GNF B;  3EH1 A;  5IXB A;  4JRK A;  1M1K R;  1G8X A;  4LDV A;  2RI3 A;  3GBQ A;  1MUZ A;  2QTX A;  1NLP C;  2O4X B;  2DYI A;  1G2B A;  5A0D A;  1SSF A;  4AG1 C;  5GAN h;  2F69 A;  3GOX A;  1N5Z A;  5I2M A;  1WHM A;  1OPK A;  1G3T A;  1D09 B;  2RQT A;  5KE2 A;  2A0F B;  1AWX A;  5LJ5 j;  2WSF E;  1JEG A;  1JXO A;  2AZS A;  2J7I A;  2QAS A;  1NE8 A;  3OYK A;  5CKD A;  4M78 C;  5HK3 A;  4FIB A;  1S72 Q;  2A08 A;  3L2R A;  5CKF A;  5GMK i;  1IO6 A;  4C8Q B;  1WJR A;  1Y71 A;  2VV5 A;  4PJO E;  2H3E B;  3A8G B;  1LPL A;  1B07 A;  2G3R A;  4FYX B;  3CC2 Q;  4IIO A;  4KUD K;  4DOW A;  1YBY A;  1YIT Q;  2GF7 A;  4JLG A;  4QVD A;  4EPC A;  5LJ5 h;  3I55 Q;  2C0O A;  3OYB A;  1R8O B;  1K73 C;  2GBQ A;  3D7S B;  1VQ6 A;  4HKE A;  3CCL A;  1VQP Q;  3P8B B;  1S72 T;  2D6F A;  4M7A B;  5CQY A;  1M5Q 1;  1RAG B;  2IVW A;  2CDT A;  3L2W A;  1BI0 A;  4KUL A;  2RMO A;  1VQ8 A;  3CXC A;  2BZX A;  3OYY A;  2KSS A;  4C0G A;  2VYT A;  1VQM A;  3X28 B;  5LL6 S;  2YUP A;  2L5Q A;  2OX7 A;  1GXI E;  3I55 T;  2D8H A;  2ZCF B;  4FT2 A;  3PVL A;  3EGX B;  1D1A A;  1M1K C;  3CC7 A;  1B3Q A;  4M77 G;  2DZ9 A;  3CME Q;  1ZUY A;  4RTY A;  1EZZ B;  3VV0 A;  4OMF B;  3JCM h;  2L3R A;  3VRY A;  1Q7Y U;  3M0P A;  4NL2 A;  3REB B;  4E6R A;  3BE3 A;  4M78 D;  4C5I A;  2VUB A;  1Q86 U;  4PJO F;  1WPY A;  3QUI A;  1QVG A;  2FVU A;  1WHJ A;  2DTH A;  2RHZ A;  3E2U A;  5IXF A;  4IUV A;  3CME T;  2GCX A;  4RUG A;  4M77 C;  2LJ3 A;  1BI2 A;  1NPR A;  1Y57 A;  1X2K A;  2DEQ A;  5CKH A;  4X34 A;  1YWO A;  1OU8 A;  2LCC A;  2CH4 W;  2DZC A;  1VQ9 T;  3EGU A;  3BY7 A;  2DMO A;  4HVV A;  4MML A;  3ZBD A;  1NLO C;  3L2V A;  2XMF A;  2HSP A;  3SB2 A;  1VQ7 Q;  2QQR A;  4J6W A;  2M0Y A;  4BDY A;  1RAH B;  2EIF A;  1I0C A;  2MYS A;  2NUT A;  2QTV A;  4QQD A;  3ZFJ A;  1Q81 U;  4PFO A;  2E1H A;  2R5A A;  2JUF A;  1V1C A;  3QWY A;  3RES A;  1QCN A;  3GPL A;  2ED1 A;  3ME9 A;  5A0L A;  2K2M A;  1PD1 A;  5CVI A;  3OS2 A;  2MIO A;  1QVF P;  3NTI A;  2DET A;  4Z02 A;  4RTZ A;  1VQ7 T;  2RNA A;  3L42 A;  4QKU A;  4J6X A;  2RQR A;  1TS9 A;  4PJL A;  1BKB A;  2KY9 A;  3CCV T;  1W6X A;  2EYQ A;  4F7U E;  4BE1 A;  1M2V B;  1F1B B;  1UHC A;  5GAN f;  4UC4 A;  1HXD A;  2F5K A;  3J81 E;  3THK A;  2LX7 A;  2ROL A;  2KBT A;  2ROT A;  3L2Q A;  5HKC A;  1H3Z A;  3A8M B;  1ARK A;  2ABL A;  4J7I A;  2JS2 A;  4II1 A;  4R0K A;  3NFC A;  4A4K A;  1U1S A;  1EIF A;  1TWB A;  3FEO A;  4C0D C;  2EVR A;  5IHK A;  1H3H A;  4M78 B;  1FMV A;  5GAM d;  1W4S A;  1WLP B;  2QA4 Q;  4DBR A;  1W2B S;  2L3Q A;  3OYF A;  3MP8 A;  2R5M A;  4R56 A;  2L3P A;  2ZPE B;  1UTI A;  3L2Z A;  4AFS C;  4EIK A;  2COZ A;  4M75 G;  1QKW A;  1O75 A;  2SRC A;  1X43 A;  4EMK A;  3V7S A;  4LDX A;  2AHJ B;  5LJ5 f;  4C0Z A;  3OYN A;  1N27 A;  1QP3 A;  2QA4 T;  1NPP A;  2DNU A;  1WYX A;  7AT1 B;  4CC3 A;  5KYW B;  3KXT A;  4D8K A;  1PD0 A;  4PFP A;  1Z9Q A;  4F7U F;  4LNP A;  1TG0 A;  2P84 A;  2BUD A;  2O9S A;  3N5B B;  4M75 C;  2DFU A;  1SG5 A;  3FC3 A;  2V8I A;  2H3J A;  3CCM Q;  3UPU A;  1AHJ B;  1B34 B;  1I1J A;  4PNO A;  3JCM Q;  3A8L B;  4CRI A;  2CT3 A;  3G6E A;  2Y4X A;  2MAM A;  4BY6 C;  5KYX A;  1T3S A;  3CXC P;  4KRT A;  3X20 B;  2O88 A;  1KK7 A;  2COY A;  2HNI A;  1BB9 A;  1VQL A;  2DJQ A;  3A1P A;  1T3L A;  1OPL A;  2P0P A;  2FPF A;  4EMK C;  1DJ7 B;  1U5S A;  4HCC A;  5GAM g;  2DEU A;  2D9T A;  3CPW A;  4OVA A;  3ER0 A;  3H41 A;  4L6V 5;  3MCA B;  2LNV A;  1G3Y A;  1PKS A;  2YRC A;  3UT1 A;  3V8L A;  3M0R A;  1YI2 Q;  1K9M R;  4XU3 A;  4M77 B;  2PQW A;  5GMK j;  2HKN A;  2KRN A;  3CCQ Q;  3NPF A;  5KH6 A;  4ZTF A;  3HTR A;  1UEB A;  1X27 A;  1MMD A;  1HD3 A;  2EGC A;  3PMI A;  5DM7 R;  2M0O A;  5DLO A;  3JAM E;  1QVG P;  2E6N A;  3VS6 A;  3RUX A;  2O01 E;  3RNJ A;  2L89 A;  1N9S A;  3OS1 A;  2DL3 A;  3I56 Q;  1LOJ A;  1YIJ T;  2KRS A;  3HKS A;  1YI2 T;  5KYN A;  3JB9 D;  1QWF A;  3I35 A;  2E3I A;  2GFU A;  2KT8 A;  5EC7 A;  2JM8 A;  2HZY A;  2B8A A;  3A8O B;  1M90 R;  2EQI A;  5GMK h;  3M55 A;  1GCP A;  3CCJ Q;  3S3O A;  2DKG A;  3MKD A;  1KD1 R;  5EG2 A;  1QCF A;  4JJD A;  3CC2 A;  1YIT A;  3V7R A;  3S3M A;  4ESR A;  5KYY A;  4BUG A;  2DLP A;  3PFS A;  2QQA A;  5CK9 A;  4HCZ A;  2RM4 A;  5HCK A;  4JS5 A;  2X4W A;  1VQP A;  3C12 A;  2YWW A;  3TU4 K;  5GJV B;  4Z89 A;  2J6K A;  2DXB A;  3CCJ T;  3EGD A;  3PNW C;  1ZHI A;  3FLG A;  2NWM A;  4C92 G;  4C5G A;  2BZY A;  1M1G A;  2KR3 A;  3M0Q A;  4GLM A;  4FYW B;  1UJ0 A;  4M7D E;  2HAX A;  1WNL A;  2AT1 B;  4C0D B;  2DIL A;  4KGZ B;  2YUQ A;  3EGX A;  2IG0 A;  4GLK A;  1M27 C;  2CT4 A;  5J39 A;  1QW1 A;  2FEI A;  2M1H A;  2LVM A;  3CCU Q;  1AOJ A;  2ZGW A;  3G4S T;  1M3B A;  1K9M C;  4OP0 A;  2WAC A;  3JCM b;  1IRX A;  4JLI A;  4DBF A;  2C0T A;  2QDL A;  3P8D A;  1KC8 U;  2QEX Q;  2R58 A;  1M2O A;  3CMA Q;  5GAN e;  3GF5 A;  3QII A;  3JV3 A;  1PSF A;  1PRM C;  4C92 E;  2P0Q A;  4J6Y A;  1WXB A;  2FHD A;  2GTO A;  4RMO A;  3OW2 A;  4PJN A;  1YJW Q;  5GAN g;  2EAY A;  3CCU T;  2LT4 A;  4C8Q E;  1EFN A;  2LJ1 A;  1YCS B;  1X69 A;  3VJP A;  4C5H A;  3BDL A;  1UGR B;  5L23 A;  4CC2 A;  1J3T A;  1OX9 A;  3CMA T;  4WCI A;  4Y28 E;  4JDS A;  1M90 C;  3JCM d;  4AG2 C;  4JS4 A;  3CCE T;  1SEM A;  2M9U A;  2IIM A;  5I2S A;  2RHY A;  3G7Z A;  4KGV B;  4E47 A;  1KD1 C;  2YT6 A;  2FZC B;  3V8K A;  2EGE A;  4IIM A;  4BY6 B;  4M7A E;  4M7D F;  4PFZ A;  2A37 A;  1M4Z A;  1IRE B;  5LJ5 e;  3CCR T;  5GMK l;  2E65 A;  1BYM A;  1BI3 A;  3OSV A;  2KGT A;  2DO3 A;  4EMK B;  2JTM A;  2JS0 A;  1VQ4 A;  4Y91 A;  4DA4 A;  1ZUK A;  1H64 1;  2DF6 A;  1MMN A;  5LJ5 g;  3ZEH A;  1SHF A;  1QLY A;  4PJJ A;  3HP9 A;  1PWT A;  2COW A;  2RF0 A;  4P5N A;  1VQ5 A;  2LT1 A;  1WX6 A;  4JZ3 A;  2AKL A;  2JVV A;  1EX4 A;  3OYJ A;  4ELY C;  2VVK A;  5CKB A;  3TQ7 P;  1M2V A;  3I9Q A;  1K73 U;  4HXJ A;  1ABQ A;  2KXC A;  1KG1 A;  3UA7 A;  4JJN K;  1WQW A;  2CGH A;  2VWF A;  2OTL A;  3UWN A;  1KQS A;  1VQK Q;  1N9R A;  4L59 A;  4C8Q F;  3CPW P;  2OAU A;  2CS7 A;  2RO0 A;  3MEU A;  2FYK A;  2Z0W A;  3VS0 A;  5ECA A;  1E6G A;  1CSK A;  2K3Y A;  4X9C A;  5HK0 A;  3L2U A;  2V8K A;  3JCM e;  3OQ5 A;  4OMM A;  5A0G A;  2FPD A;  3MEV A;  1PKT A;  5CIU A;  1YJN Q;  1T0H A;  1HYO A;  2E5K A;  5FWC A;  3VS3 A;  1Y0M A;  1XNI A;  1M1K U;  1WJS A;  2OTJ T;  1BU1 A;  3JCM g;  1X6B A;  3JCM c;  1VQK T;  4HT9 A;  4M7A F;  1YJ9 Q;  1SPK A;  4A53 A;  1NJI R;  1AWO A;  1XTD A;  2IPO B;  1WXU A;  1Z9Z A;  2P4R A;  1WDX A;  1I81 A;  5AYF A;  4PJO G;  1GCQ C;  2MWO A;  1OV3 A;  1KHC A;  4HT8 A;  3OYH A;  1UGP B;  2E64 A;  2EWN A;  1YJN T;  4XTZ A;  1PSE A;  5CO7 A;  3BW1 A;  2EYY A;  2XI9 A;  4J9F A;  2HDA A;  4E2F B;  3M53 A;  2ZPB B;  1WA7 A;  3MPU B;  1RAD B;  1XJW B;  2RD1 A;  5KYW A;  1YJ9 T;  3SHW A;  2YUO A;  2F2V A;  2D0Q B;  4XTW A;  3RKY A;  3A8H B;  3QJY A;  1UB4 A;  4NL3 A;  4PKC C;  4J9I A;  2DAQ A;  3OS0 A;  5FW9 A;  4D8D A;  1AWJ A;  4PJO C;  2PU9 B;  3CCM A;  2CZ1 B;  1FMW A;  1B34 A;  1VA7 A;  1G3W A;  3EG0 A;  2X3W D;  1WFW A;  3RIR A;  3MO8 A;  3CC4 T;  2HKQ B;  3KFV A;  2XDB A;  1D0Z A;  3OYI A;  1VIE A;  2FL7 A;  5KYY B;  2JN0 A;  2RJE A;  2JTF A;  1RLP C;  3HFO A;  4E7J A;  4JPB W;  2HBP A;  1G5V A;  3PGG A;  1S1N A;  2HQE A;  1LVK A;  2A36 A;  2DVE A;  3EHQ A;  2EJF A;  4M78 E;  5HY6 A;  1QP2 A;  3EGD B;  3JB9 I;  3M5A A;  4KGX B;  2RA2 A;  2HD0 A;  3G1J A;  4M77 A;  3CCQ A;  2EKO A;  3TRE A;  4Y92 A;  1GL5 A;  1XQH A;  2DXU A;  1QVG S;  1JO8 A;  2VGM A;  1UJY A;  3VUB A;  2LCS A;  4OGC A;  3TVT A;  1JBM A;  2QGG A;  3LGL A;  2CP3 A;  1OOT A;  3X24 B;  3CCS A;  3I56 A;  3OW2 P;  2RK2 A;  1WI7 A;  2ATC B;  4QQ6 A;  4ELZ C;  1YHQ Q;  1RAA B;  3QDR B;  2HCK A;  1NJI C;  2K5L A;  2JJ9 A;  1ZA1 B;  5GAN 8;  1U1T A;  3VYH B;  2B86 A;  3O8V A;  2EQM A;  5AT1 B;  1VQ9 Q;  3NHN A;  4OGE A;  3PT9 A;  2JNG A;  2DBM A;  1D1C A;  5CQX A;  5LJ3 f;  2VXE A;  1V29 B;  1YHQ T;  2L0A A;  3ZL7 C;  2DK3 A;  3JCM V;  3UA6 A;  4F14 A;  1B7T A;  1FX7 A;  1FWZ A;  4N4H A;  3WXM B;  2ZPI B;  2VB6 A;  2MOX A;  3MJX A;  4KH1 B;  4E7I A;  4JZ4 A;  3QYG B;  1NG2 A;  5GAN 3;  5J3B A;  4A4E A;  4M78 F;  2EJ9 A;  2JXB A;  4F7U G;  2XG8 D;  3OYG A;  3MHX A;  1FMK A;  3LW5 E;  1Y7X A;  3QYH B;  4FT4 A;  1ABO A;  2QQB A;  2PUO B;  4RTU A;  5C0M A;  1VQO Q;  1RAC B;  2DL4 A;  2EGA A;  3EG3 A;  3A98 A;  2HSE B;  4XU2 A;  3CCV Q;  2O31 A;  1UDL A;  2MWP A;  2YSQ A;  1QWE A;  1KQS P;  4J9H A;  3U23 A;  2DER A;  2E6Z A;  2YLB A;  2H8H A;  4OB1 B;  1TTH B;  1K1Z A;  2J6O A;  5IH2 A;  1JJ2 S;  3CD6 T;  3JB9 J;  1VQO T;  1R0B G;  2QEX A;  2QAZ A;  3VKI A;  4JJB A;  4OB0 B;  3HHT B;  1OX8 A;  2JT4 A;  4RKU E;  2XK0 A;  3FB9 A;  4J9B A;  2DPP B;  1OU9 A;  5GAO l;  1YJW A;  2RN8 A;  3SWN C;  2XIC A;  3H0H A;  2SEM A;  2EQU A;  4M77 D;  2RK1 A;  3M59 A;  4ZGD B;  4OMO A;  2K2V A;  4M75 A;  3AT1 B;  1MNE A;  4PJO B;  5GMK e;  5M9O A;  1V76 A;  2QXF A;  2HL5 C;  4LE9 A;  1TOV A;  3I5S A;  5GMK m;  3JB9 H;  3EG9 B;  3M0U A;  4DQ2 A;  1VYV A;  2KYB A;  1T0J A;  1AD5 A;  3FJ5 A;  2JZ2 A;  2DL7 A;  2E70 A;  1P92 A;  1UGQ B;  2W10 A;  5DY9 A;  2LQW A;  1TH7 A;  4RG8 A;  4K11 A;  1MMA A;  1M1F A;  4ZNX A;  3RKX A;  1UEC A;  2EKH A;  4CI0 C;  2HMA A;  1K0X A;  2NUP B;  2L3S A;  3LLR A;  1YP5 A;  2M02 A;  2FB7 A;  3JCM P;  3M4G A;  4FW2 A;  2E4H A;  2CP7 A;  4HA8 A;  3EFS A;  2PTK A;  3JCM W;  1OYX A;  3RER A;  1ZSZ C;  1IZ6 A;  4IUT A;  3RMS A;  4RCB A;  2EJG A;  2KRO A;  4LDU A;  1ZX6 A;  1KQ1 A;  4J9D A;  1Y07 A;  3BDU A;  1WXT A;  3GNG A;  2YDL A;  4BDZ A;  4XAX B;  1WIE A;  4VUB A;  5CAI A;  1W1F A;  2DRK A;  2W0Z A;  3H6Z A;  3TCJ A;  2Y4Y A;  4DEX A;  4OB3 B;  2HQX A;  2YHT A;  4E7L A;  3ULR B;  2L2P A;  2F2W A;  3PMT A;  1LNX A;  3HL8 A;  1PC0 A;  3V8J A;  1YIJ Q;  2XDP A;  1K9M U;  2LZ6 B;  3OYE A;  4YTL A;  2PZ1 A;  2QI2 A;  4XU1 A;  3T9N A;  3P8H A;  3OB9 A;  1U3O A;  2KXD A;  1UHF A;  4L5G A;  1WHH A;  2RHI A;  2A7Y A;  2VC8 A;  3S6W A;  1K8A R;  4J8O A;  1UE9 A; 
#chains in the Genus database with same CATH homology
 3A8G B;  4BY6 B;  2A3L A;  4M7A E;  4IKF A;  3QZ5 B;  4JRQ A;  4M7D F;  4XK8 E;  4IUR A;  2G3R A;  3CEY A;  1M4Z A;  2MMP A;  4KUD K;  2XID A;  4DOW A;  1YBY A;  3G71 A;  3CCR A;  4M7D D;  5A2Q E;  2GF7 A;  1IRE B;  4JLG A;  4QVD A;  4EPC A;  5LJ5 e;  3CCR T;  3TEE A;  5LJ5 h;  5GMK l;  4M75 D;  1M90 U;  4XTX A;  2E65 A;  5FLX E;  1BI3 A;  1R8O B;  3OSV A;  3OYB A;  1S72 A;  1K73 C;  2DO3 A;  4V2S A;  1VQ6 A;  4HKE A;  4EMK B;  2JTM A;  4E7H A;  3CCL A;  1VQ4 A;  3P8B B;  2K5F A;  4Y91 A;  4DA4 A;  4M7D G;  1S72 T;  2D6F A;  4M7A B;  5CQY A;  3VYG A;  3CCL T;  1M5Q 1;  1KD1 U;  5GAO q;  2IVW A;  2K4Y A;  1H64 1;  1VQ4 T;  3SD4 A;  1UGS B;  3L2W A;  5LJ5 g;  1BI0 A;  2E41 A;  4KUL A;  3ZEH A;  5GAN d;  1OI1 A;  5KCO A;  1VQ8 A;  3CXC A;  3HP9 A;  3OYY A;  3A5Z B;  4FU6 A;  4ZGJ B;  2KSS A;  4P5N A;  4C0G A;  1VQ8 T;  2LT1 A;  1VQ5 A;  1G3S A;  2VYT A;  4M77 F;  3E1S A;  3X28 B;  2JVV A;  3OYJ A;  1VQM A;  4ELY C;  3I55 A;  5LL6 S;  1JJ2 A;  1VQ5 T;  3JB9 F;  2L5Q A;  5CKB A;  1Q7Y C;  1K73 U;  4KBM B;  1GXI E;  1VQM T;  1VIF A;  3I55 T;  1WJQ A;  2PVG B;  1KG1 A;  4JJN K;  1WQW A;  3LH0 A;  2ZCF B;  2CGH A;  4FT2 A;  4D6W A;  3CBM A;  2OTL A;  3UWN A;  1Q86 C;  1KQS A;  1M1K C;  1JB0 E;  1N9R A;  3CC7 A;  3INZ A;  4M77 G;  1N6A A;  2OTL T;  4L59 A;  3QHS A;  4C8Q F;  3SWN B;  2KVQ G;  1M8V A;  2OAU A;  3JB9 G;  4E7K A;  2CS7 A;  4M7D C;  2JOY A;  4J7F A;  3CC7 T;  2RO0 A;  2DZ9 A;  2R57 A;  3MEU A;  2FYK A;  2XD0 A;  2K5I A;  5HK0 A;  2K3Y A;  4X9C A;  3VV0 A;  4OMF B;  3L2U A;  3QPH A;  2V8K A;  3JCM e;  3OQ5 A;  2K3X A;  3JCM h;  2L3R A;  5A0G A;  1Q7Y U;  1LJO A;  3MEV A;  5CR2 A;  4NL2 A;  4C8Q G;  5FU7 B;  4ME7 A;  4M78 D;  5CIU A;  3CPW S;  3LWH A;  4C5I A;  2OTJ A;  3OBY A;  2E5Q A;  2VUB A;  2CZ7 B;  1Q86 U;  1XNI A;  5DLQ E;  1M1K U;  1WJS A;  4PJO F;  1VQK A;  2OTJ T;  3JCM g;  1WPY A;  2DJZ A;  5GAN 7;  3QUI A;  1QVG A;  3JCM c;  1VQK T;  2FVU A;  4HT9 A;  4M7A F;  4EMG A;  5LJ5 d;  4QVC A;  1O9S A;  2RJF A;  5GAM j;  2DTH A;  1OZ3 A;  2RHZ A;  4O6J A;  4A4G A;  3OYM A;  3CME A;  5IN1 A;  5KCH A;  3OBW A;  4IUV A;  4A53 A;  3CME T;  1XTD A;  4FL6 A;  2GCX A;  3J80 E;  4M77 C;  1I81 A;  2KK4 A;  5AYF A;  4PJO G;  2MWO A;  1BI2 A;  1NPR A;  3E19 A;  5LJ3 d;  1W2B A;  4C92 C;  2LC4 A;  3EAE A;  1D3B B;  1KHC A;  2YRV A;  3ASK A;  2DEQ A;  1UGP B;  2E64 A;  3OYH A;  1YJN A;  4HT8 A;  4M7A G;  3LX7 A;  1Q81 C;  2PUK B;  2EWN A;  5CKH A;  4X34 A;  3QZ9 B;  1VQ9 A;  3RKW A;  2LCC A;  1YJN T;  2DZC A;  2XHC A;  4XTZ A;  3V7C A;  1PSE A;  1VQ9 T;  5CO7 A;  3BW1 A;  2XI9 A;  2ZPG B;  3BY7 A;  5GAN 6;  3PTA A;  4MML A;  3ZBD A;  3L2V A;  3M53 A;  1YJ9 A;  2NLU A;  2ZPB B;  1K8A C;  4M75 E;  4LD6 A;  2DXC A;  3SB2 A;  5IT9 E;  2QQR A;  2RD1 A;  4J6W A;  1YJ9 T;  4BDY A;  3CBP A;  3M9Q A;  4A4H A;  2D0Q B;  4XTW A;  2EIF A;  5GAN 4;  3RKY A;  3A8H B;  5D6W A;  5GAM e;  5FRN A;  3ZFJ A;  4QQD A;  5GAM h;  2RI5 A;  3QJY A;  1Q81 U;  2LDM A;  1UB4 A;  4NL3 A;  3JCM f;  2E1H A;  3OYD A;  2R5A A;  3QO3 A;  4PKC C;  5LJ3 j;  2DAQ A;  2JUF A;  3OS0 A;  3OYC A;  4PJO C;  4OF1 A;  2PU9 B;  3CCM A;  2KQW A;  4M75 B;  3RES A;  3GPL A;  2CZ1 B;  3ME9 A;  1B34 A;  5A0L A;  2CZ6 B;  3CCM T;  1VQN A;  1K8A U;  3OS2 A;  1X01 A;  5CVI A;  3FJP A;  1G3W A;  4IUP A;  4XTU A;  1VQ7 A;  4M7D A;  3NTI A;  4Z02 A;  3CC4 A;  1I8F A;  2EQK A;  3FIF A;  3QBY A;  3RIR A;  1N8R C;  2KMT A;  3L42 A;  2O4X A;  1VQ7 T;  2RJD A;  3MO8 A;  3CC4 T;  4J6X A;  2P4T A;  4BI4 A;  3CCV A;  4ZTJ A;  4NS5 A;  4MMK A;  1BKB A;  2KY9 A;  4B9W A;  2XDB A;  3PIP A;  3OYI A;  1VIE A;  2QQS A;  2FL7 A;  3OMC A;  5D6Y A;  3CCV T;  1KQS S;  2JN0 A;  2RJE A;  2JTF A;  2EYQ A;  2V8J A;  4F7U E;  3AHU A;  3HFO A;  2RB6 A;  4RG2 A;  3G71 T;  4BE1 A;  1QVF S;  4E7J A;  2HBP A;  4ZGE B;  2CYZ B;  1G5V A;  4BE0 A;  3PGG A;  5GAN f;  2HQE A;  4UC4 A;  1HXD A;  2KDS A;  1VQ6 T;  5LJ3 e;  4PLL A;  2F5K A;  3MEW A;  4TVR A;  2DVE A;  3J81 E;  2LTO A;  2WSC E;  5LJ3 h;  3J7A F;  2EJF A;  3E9G A;  4M78 E;  1QP2 A;  2ZPH B;  2LCL A;  3MET A;  3M54 A;  5HY6 A;  2MF2 A;  3A8M B;  3M5A A;  3URG A;  3WVE B;  5HKC A;  3JB9 I;  3DB4 A;  2RA2 A;  2HD0 A;  4M77 A;  3CCQ A;  1BYM A;  4C5E A;  1Y96 A;  2EKO A;  4J7I A;  4F7U B;  4C92 D;  2WSE E;  3TRE A;  4II1 A;  4C92 A;  3CCQ T;  4O5V A;  4A4F A;  1XQH A;  5LJ3 g;  3NFC A;  2DXU A;  4A4K A;  4C0F A;  3X25 B;  1U1S A;  3C94 A;  1EIF A;  2CZ0 B;  1QVG S;  3FEO A;  4C0D C;  2VGM A;  2KAF A;  4BD3 A;  3VUB A;  4M78 B;  3SDZ A;  4OGC A;  4C8Q A;  1Q82 C;  5GAM d;  1W4S A;  2EFI A;  1JBM A;  2X35 A;  4M75 F;  3LGL A;  1W2B S;  3X24 B;  3OYF A;  3CCS A;  3MP8 A;  3I56 A;  2R5M A;  5FU6 C;  4R56 A;  5CCA A;  2RK2 A;  2ZPE B;  3L2Q A;  4QQ6 A;  4ELZ C;  3S3N A;  3MEA A;  3CCS T;  3L2Z A;  3QDR B;  3I56 T;  4ZN3 A;  4JRP A;  1NJI C;  2K5L A;  4ZN1 A;  4M75 G;  2DD5 A;  1O75 A;  3CPF A;  5GAO p;  3HRS A;  5GAN 8;  1U1T A;  3VYH B;  3SFM A;  4PJO A;  4EMK A;  3OW2 S;  3O8V A;  2EQM A;  4OB2 B;  3V7S A;  4LDX A;  1Q82 U;  2AHJ B;  5LJ5 f;  4M7A A;  4C0Z A;  2QA4 A;  4OGE A;  3OYN A;  1N27 A;  1QP3 A;  3PT9 A;  2QA4 T;  2X4Y A;  2JNG A;  4HCB A;  4EMH A;  1NPP A;  2VXF A;  2DTO A;  1YHQ A;  1QVP A;  5CQX A;  2DXT A;  5LJ3 f;  3DLL A;  4NOY A;  1NJI U;  2VXE A;  1V29 B;  3HRU A;  3OS5 A;  1KHI A;  3X26 B;  3OA6 A;  1YHQ T;  3KXT A;  2DD4 A;  2Y90 A;  2DK3 A;  3JCM V;  3M57 A;  4F7U F;  2XU8 A;  1FX7 A;  3VU3 C;  1FWZ A;  4N4H A;  3WXM B;  5IAY A;  1N8R U;  2LQ8 A;  2ZPI B;  4EDU A;  2XDD A;  4GY5 A;  4BI8 B;  4E7I A;  2BUD A;  2LX9 A;  2RHX A;  3N5B B;  3JCM X;  3QYG B;  4M75 C;  5GAN 3;  5J3B A;  2RI2 A;  5GAO r;  4A4E A;  4M78 F;  3FC3 A;  2V8I A;  2H3J A;  2EJ9 A;  3JCM J;  4F7U G;  2BIV A;  2VGN A;  2XG8 D;  3OYG A;  3MHX A;  4C8Q C;  3UPU A;  3LW5 E;  1B34 B;  1AHJ B;  1Y7X A;  3QYH B;  4FT4 A;  4PNO A;  3JCM Q;  2QQB A;  3A8L B;  3OY9 A;  2PUO B;  4CRI A;  3KUF A;  4M7D B;  3HFN A;  3G6E A;  2Y4X A;  2MAM A;  3HPW A;  4BY6 C;  3LWI A;  4IUQ A;  1YCY A;  4LDW A;  5C0M A;  1X75 C;  3G6E T;  3X20 B;  3GIB A;  4M78 G;  2HNI A;  1VQL A;  4XU2 A;  3NTK A;  3QKJ A;  2M16 A;  2YLC A;  3M56 A;  1VQL T;  4X9D A;  5FRM A;  2P0P A;  4N4G A;  4QVZ A;  2MWP A;  2ZZD A;  1RI0 A;  1DJ7 B;  4EMK C;  4MDW A;  1KQ2 A;  4HCC A;  3CXC S;  2GQV A;  3H8Z A;  3C95 A;  5GAM g;  4M7A C;  2D9T A;  4MDX A;  2RH2 A;  4PL6 A;  3CPW A;  3CD6 A;  2P0K A;  1WQ7 A;  3ER0 A;  4OVA A;  4L6V 5;  2E6Z A;  1BI1 A;  2YLB A;  3MCA B;  2LNV A;  4OB1 B;  4DOV A;  1VQO A;  1JJ2 S;  1HK9 A;  1NZ9 A;  1G3Y A;  3CD6 T;  4JRI A;  3UT1 A;  3V8L A;  3JB9 J;  1VQO T;  4XU3 A;  4J83 A;  1D3B A;  2PQW A;  4M77 B;  5GMK j;  2QEX A;  4QQG A;  4N4I A;  3VKI A;  2RJC A;  4C92 B;  1RL2 A;  1U8R A;  4OB0 B;  3OYL A;  5KH6 A;  2QEX T;  3HHT B;  4A54 A;  1I4K 1;  4ZTF A;  1WGS A;  3EFR A;  4MZP A;  4RKU E;  2CKK A;  1UEB A;  4XU0 A;  1BIA A;  2XK0 A;  2RHU A;  4KUI A;  4MZT A;  1I5L A;  3PMI A;  3FB9 A;  3HRT A;  2E10 A;  3M58 A;  5DM7 R;  2M0O A;  5DLO A;  2DPP B;  4LDY A;  3JAM E;  5GAO l;  2E6N A;  2ZPF B;  3OSS C;  1YJW A;  3RUX A;  3SWN C;  1YIJ A;  3RMQ A;  1MGQ A;  2O01 E;  3PIO A;  2L89 A;  1N9S A;  1BIB A;  3NTH A;  3OS1 A;  1YI2 A;  1YJW T;  2XIC A;  4FM4 B;  3WVD B;  1LOJ A;  4RCC A;  3OMG A;  1YIJ T;  3VUZ A;  2EQU A;  4M77 D;  1OZ2 A;  3HKS A;  1YI2 T;  5GAO m;  2RK1 A;  1MHN A;  2QDY B;  3M59 A;  4ZGD B;  3JB9 D;  4LD9 K;  4KT0 E;  2K2V A;  4XTV A;  5GAM f;  3GLX A;  2GFU A;  5FU7 C;  4M75 A;  2PVD B;  1VUB A;  3BFM A;  5J26 A;  3A8O B;  5FRO A;  1XOV A;  2B8A A;  2LQK A;  5GMK e;  4PJO B;  3JSC A;  5C6S A;  3QXE B;  4J5Y A;  5GMK h;  3M55 A;  5M9O A;  4C8Q D;  2QXF A;  3S3O A;  5GMK m;  3JB9 H;  2DKG A;  2DIQ A;  3Q1J A;  5EG2 A;  4DQ2 A;  2L8D A;  5GAN 5;  4BI3 A;  3MP1 A;  2XKO C;  3KBG A;  3CC2 A;  3E9F A;  5KE3 A;  5L8R E;  1YIT A;  2JZ2 A;  3V7R A;  2E70 A;  1P92 A;  1UGQ B;  3S3M A;  3DKM A;  3CC2 T;  3LYI A;  3QG1 A;  5DY9 A;  3DLM A;  4BUG A;  2C06 A;  1TH7 A;  1YIT T;  3PFS A;  4RG8 A;  2QQ9 A;  2QQA A;  3FRN A;  2K57 A;  1M1F A;  4HCZ A;  3RKX A;  2RM4 A;  4C92 F;  3QJ6 A;  5CK9 A;  2X4W A;  4JS5 A;  4PJO D;  4CI0 C;  1VQP A;  1X6O A;  3OYA A;  3GP8 A;  4N0A A;  3C12 A;  3TU4 K;  5I21 A;  3LLR A;  4XQ3 A;  3CCJ A;  4M7A D;  1VQP T;  2I2L A;  1FXX A;  2FB7 A;  3JCM P;  4QW2 A;  3M4G A;  2DXB A;  3CCJ T;  3PNW C;  1QVF A;  4HA8 A;  1ZHI A;  3FLG A;  3MP6 A;  4C92 G;  4C5G A;  4WF2 A;  4F7U A;  4Q5W A;  1M1G A;  3JRZ A;  3EFS A;  3C4S A;  4R55 A;  3LGF A;  3JCM W;  5GAN j;  1OYX A;  4B9X A;  3RER A;  3QSU A;  1IZ6 A;  4IUT A;  4M7D E;  3RMS A;  2HAX A;  1WNL A;  4M78 A;  4C0D B;  1KC8 C;  4RCB A;  2EJG A;  4LDU A;  3L1A A;  1KQ1 A;  2LRQ A;  3GNF B;  2IG0 A;  4GLK A;  4MZM A;  1Y07 A;  3M4Y A;  3BDU A;  4JRK A;  4LDV A;  3SWN A;  5J39 A;  3GNG A;  1QW1 A;  3DB3 A;  2M1H A;  2BKD N;  5FU6 B;  2DIG A;  2LVM A;  4BDZ A;  3G4S A;  2X4X A;  4XAX B;  2RI3 A;  2ZGW A;  3G4S T;  4VUB A;  5CAI A;  1K9M C;  3FDR A;  2WAC A;  4OP0 A;  2QTX A;  4PLI A;  2O4X B;  3JCM b;  1VQN T;  2EQJ A;  4JLI A;  2F5T X;  3P8D A;  1KC8 U;  3H6Z A;  2R58 A;  4BB7 A;  3TCJ A;  2Y4Y A;  5A0D A;  1SSF A;  4JUV A;  5GAN e;  4OB3 B;  3GF5 A;  3QII A;  2HQX A;  2YHT A;  4M77 E;  2F69 A;  5GAN h;  3GOX A;  4E7L A;  1PSF A;  1JRI A;  4N0A C;  4C92 E;  4BE2 A;  2P0Q A;  5I2M A;  4BAC A;  3CBO A;  4J6Y A;  2FHD A;  3PMT A;  4RMO A;  3CCU A;  3OW2 A;  1G3T A;  1LNX A;  5KE2 A;  2GFA A;  2DTI A;  3HL8 A;  5GAN g;  2EAY A;  5GAN 2;  1H3Z A;  3CCU T;  1K9M U;  3V8J A;  5LJ5 j;  2XDP A;  2WSF E;  2LT4 A;  4FSX A;  4C8Q E;  3R6O A;  5CKE A;  3OYE A;  4YTL A;  1Y96 B;  3VJP A;  4C5H A;  2QI2 A;  3BDL A;  4IUU A;  1UGR B;  4XU1 A;  3T9N A;  3P8H A;  3CMA A;  5D6X A;  1M9S A;  1NE8 A;  3OB9 A;  1ZQ1 A;  3CCE A;  3OYK A;  5CKD A;  2PVO B;  4L5G A;  4Y28 E;  3CMA T;  4JDS A;  2RHI A;  4M78 C;  1ZBX A;  5HK3 A;  1M90 C;  3HSB A;  4FIB A;  3JCM d;  4JS4 A;  2E12 A;  3CCE T;  2M9U A;  2X4J A;  5CKF A;  3L2R A;  5GMK i;  2MI6 A;  2A7Y A;  2VC8 A;  3UDC A;  4XTY A;  4C8Q B;  1WJR A;  1Y71 A;  2RHY A;  3S6W A;  5I2S A;  5GAO n;  3G7Z A;  2VV5 A;  4J8O A;  4E47 A;  1KD1 C;  4ATO A;  4PJO E;  3V8K A;  3F70 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...