3JCMb

Cryo-em structure of the spliceosomal u4/u6.u5 tri-snrnp
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
65
structure length
65
Chain Sequence
ATLKDYLNKRVVIIKVDGECLIASLNGFDKNTNLFITNVFNRISKEFICKAQLLRGSEIALVGLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pre-mRNA-splicing factor 8
publication title The 3.8 angstrom structure of the U4/U6.U5 tri-snRNP: Insights into spliceosome assembly and catalysis
pubmed doi rcsb
molecule tags Transcription
total genus 11
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2015-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
b PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3jcmb00
2E64A 5GAN7 5CAIA 4M75A 1I8FA 5GMKm 5LJ3d 2VXEA 4M77A 4XTXA 4QVCA 5LJ3g 5GAMj 4M78A 5GAOq 5GAMd 4M75C 5GAMg 4EMKA 4XTWA 1N9SA 4M7DG 4M77C 3QHSA 2FB7A 2RB6A 4M78C 1TH7A 1I5LA 4EMGA 4EMKC 3EFSA 4C92C 4N0AA 5LJ3e 5LJ5j 5GAOm 4M7AD 2YLCA 3BFMA 4XTVA 5GAMe 5LJ5g 2E1HA 2K57A 1JBMA 4JLIA 4N0AC 5LJ5d 1M8VA 2E10A 3RESA 3HFOA 1N9RA 3JCMb 4X9CA 4F7UB 5GAN3 3FB9A 4XQ3A 1WNLA 1B34A 1HK9A 4PJOA 1M5Q1 2DXTA 2YHTA 3BDUA 4M7AB 5LJ5e 3JB9D 4M7AG 5GAN4 5GANh 5GAOp 2EWNA 3QSUA 5GMKl 4EMHA 5GANg 5GANd 3HSBA 4MMKA 2RM4A 4M75D 3FIFA 5LJ3j 3JCMc 3JCMV 4PJOD 5DY9A 1X01A 3SWNB 4XU1A 4J5YA 5GAN6 4XTZA 5GAN2 3FJPA 4C92A 1WPYA 4F7UE 3SB2A 4M7AF 4C8QA 5GAOl 4XU0A 2DZ9A 2VC8A 4M75B 2DTHA 4XU3A 2CGHA 4M77B 4C8QC 2DKGA 4M7AE 4HT9A 4PJOB 4M78B 3GIBA 3BY7A 4XU2A 3JCMh 4EMKB 1BIAA 2VXFA 4NOYA 5LJ3f 3JCMX 1H641 3JCMg 4F7UG 3JCMd 2DXUA 3AHUA 1MGQA 3RKYA 5GAMf 3JB9F 2DVEA 4M7DC 2DZCA 2EJGA 3L1AA 4C8QG 4XTYA 1KQ1A 4JUVA 3HFNA 4NL3A 3V8JA 4M75F 3V7RA 1JRIA 4PJOF 5GANj 2YLBA 5LJ5f 4V2SA 4J6WA 2JN0A 4M75E 2Y90A 4MMLA 1B34B 4M77D 4F7UF 3JB9H 4PJOE 3QUIA 1D3BA 1Y96A 1U1TA 4M78E 4M78D 4J6XA 5GMKh 3JB9G 4X9DA 4M7DA 4PNOA 4M7AA 4C92D 5GANe 4J6YA 4C8QD 4M7AC 1HXDA 4M75G 4JRKA 3V8LA 3V8KA 4PJOG 4M77G 4JRIA 5GANf 3PGGA 2EAYA 3BW1A 4M78G 4DQ2A 3RKXA 3SWNA 4Y91A 3QO3A 3V7CA 4M7DD 1I4K1 4A53A 4C92B 4HT8A 3EFRA 3SWNC 4C8QB 3JCMP 2DEQA 1U1SA 1WQWA 2EJFA 1YCYA 3L2ZA 5LJ3h 1BIBA 4RCCA 5GAMh 3JCMQ 3V7SA 5GAOn 2RD1A 4M77F 4WF2A 3RIRA 5GMKi 3JCMe 4M78F 2QTXA 3JCMW 2ZGWA 4M7DB 4PJOC 2E41A 2I2LA 4F7UA 1WQ7A 4OP0A 3RUXA 3JCMJ 4A54A 2FYKA 1I81A 4M77E 3JCMf 4C92F 5GAN8 5GAOr 4RCBA 4C8QF 5GAN5 5LJ5h 3M4GA 3INZA 5GMKj 2HNIA 3VU3C 4C92E 2RA2A 4QVDA 1LNXA 1KQ2A 4C8QE 3JB9I 4HA8A 2DJZA 2DTIA 4XTUA 4M7DF 5I21A 1LOJA 1D3BB 1Y96B 2DTOA 3JB9J 5GMKe 3RERA 4M7DE 4C92G 4NL2A 3RKWA 2EJ9A 1LJOA 2E65A
chains in the Genus database with same CATH superfamily
3PMTA 3A8LB 5CAIA 3H0FA 4AT1B 2JVVA 5CKEA 5LJ3d 5LJ3g 1YJWT 1VQMT 3CC7A 1NEGA 3O5ZA 4BE1A 4QVZA 3M55A 3MJXA 5GAOm 3C12A 4E7SA 4N0AC 3OYEA 2E10A 3L2RA 1O75A 1KFZA 4FYWB 1HSQA 1WXTA 1RLPC 3QDRB 1ZLMA 4M7AB 2KY9A 1M4ZA 1AZEA 3HRUA 2MI6A 4JS4A 3CCMT 1GRIA 5GAN6 3ASKA 1PKSA 4BY6B 1KQSA 2DM1A 5IHKA 3M0UA 4Z89A 1KC8U 4ME7A 1Q95G 3RMSA 4M7DC 4AFQC 1VQ5T 4C8QG 4XTYA 2H3JA 1T0HA 3QXEB 1NBEB 2DA9A 3CCSQ 1VQ9A 2KT1A 3JB9G 4X9DA 3UA6A 1AHJB 2EQIA 3FDRA 3I5RA 1UUEA 2RJEA 4HKEA 1VQ6T 4DBQA 1M30A 5KYWB 2QDYB 1S72A 1VYVA 3CXCS 1BIBA 2QTXA 2IG0A 3Q1JA 2VWFA 3FC3A 2RQUA 2GCXA 3UPUA 2DXBA 5GAN5 5LJ5h 1MNEA 2EGEA 2LCCA 2V1QA 3M0RA 2YUPA 3GNFB 1GFCA 1QP2A 1K8AU 2LT1A 4FIBA 4F16A 2M1HA 3WVDB 3RERA 1NG2A 2EBPA 2YRCA 5FWCA 2FRWA 2M51A 4PJOA 1U5SA 2XMFA 3H41A 4M78A 2J6OA 3DB4A 2KRSA 1NPPA 4JPBW 2MAMA 2PNIA 1WHKA 2KRMA 1OEBA 4JLIA 2PQWA 1U06A 2CP6A 2M9UA 1C6VX 1N5ZA 3BDUA 3M5AA 1QVGS 1O9SA 3CEYA 5C0MA 2DD5A 2NLUA 2KT8A 3LX7A 4M75D 4HVWA 3NTKA 2ZPIB 2JUFA 1W6XA 1X01A 2PU9B 1I1JA 2JOYA 5GAN2 4KT0E 3SB2A 1QVFP 4CC3A 2DL8A 5KE3A 2AT1B 4JJBA 2CP5A 1N27A 4XU2A 1AZGB 4NOYA 4J9EA 4CRIA 2L3PA 4L5GA 3L1AA 2X51A 2WACA 5FWBA 2KXCA 1FMWA 1R0BG 1VQ8Q 3I9QA 3TSWA 4F7UF 4QT7A 1SRLA 3AT1B 4M7AA 4C92D 2R58A 1OPKA 1W1FA 2X4YA 5CKBA 4IIMA 4ELZC 1KC8C 2L3RA 4ATOA 4PJOG 1Q86R 4M78G 1ZQ1A 5IH2A 2P4TA 3OYKA 2OTJQ 3R6NA 1EFNA 1VQLQ 2NUTB 5LJ3h 1ABOA 2FO0A 3JCMQ 2RF0A 3EG2A 3JCMe 3QJYA 3PIPA 2EW3A 2I2LA 2E4HA 1FX7A 3UT1A 3CCST 1RI0A 4C8QF 3PVQA 3M4GA 1ZSZB 1UGRB 2D9TA 4ZGDB 3PE0A 2QYZA 1WHLA 2D8JA 5CIUA 1LOJA 2LQKA 2QQBA 2PUOB 4CC2A 1X43A 1W2BA 5GJVB 5FU7C 1Y0MA 1ZBJA 2KVQG 4E7ZA 3OW2S 1I5LA 1I07A 1NJIU 1K0SA 2JS0A 2KXDA 3TQ7P 3H9NA 2RQRA 2E5QA 2DL3A 1UGSB 1X2QA 4GLMA 5M9OA 4LD9K 1T0JA 2MWPA 4E7IA 2GFAA 4A4FA 1YWOA 1K9MR 4M7AG 1PRMC 3REBB 1OOTA 3HL8A 1YBYA 3CPWA 4K11A 2VV5A 3UA7A 1YIJA 3CD6A 3GP8A 2DTHA 2MYSA 4C8QC 4M7AE 4KBMB 2VXFA 2CKKA 3JB9F 3H6ZA 2HQEA 2QGFB 2YXYA 5IN1A 1R8OB 4DA4A 4J9DA 1M3CA 3VJPA 2PZ1A 2JN0A 4CC4B 2K5IA 1YJ9Q 2CDTA 2H3EB 1RI9A 1Y7XA 2AKKA 1E6HA 1M3BA 1VA7A 4DQ2A 1MMGA 2EPDA 3CQTA 3QO3A 4M7DD 4CI0C 3PVLA 4JZ4A 3CC2Q 3QDFA 2COZA 4RTVA 2KK4A 2HSEB 1MUZA 2L3QA 4EIKA 3CC2A 3C95A 1VQ8T 3CCUQ 2ECZA 3QWXX 2HL3A 4BDYA 1RL2A 2NYSA 2KR3A 5GMKj 3VS3A 2DEUA 3CCUA 2DJZA 2QK0A 2BKDN 4D8KA 3M4YA 4GY5A 5GMKe 4ZTJA 3A8MB 3H8ZA 1NLPC 2OTJT 2E64A 2VB6A 1C1AA 4PL6A 1VQLT 3KFVA 2P0QA 1SSFA 4R0KA 5D7UA 3VYHB 2DERA 2RB6A 1RUWA 1VQ4A 1QVPA 5CQYA 3M9QA 4RTYA 1WGSA 1BBZA 3CMAQ 2FEIA 4F7UB 3FB9A 4EDUA 3GBQA 2YUQA 1TWBA 1ZSZA 1D1CA 2LJ3A 4C5IA 5CKFA 3MEVA 2RM4A 3MO8A 2LRQA 4D6WA 3OYGA 4ZTFA 4QQDA 3LYIA 1NJIC 1D0YA 1UGQB 1ZHIA 2GNCA 1IRXA 3DB3A 2DKGA 4AFUC 3M0SA 4IURA 1MV0B 1TUCA 3M56A 4IUUA 4DEYA 2F2VA 4RKUE 1LCKA 4ELYC 3VS2A 1KQSP 2FPFA 2GF7A 4PJOF 1R0CB 2ED0A 2CP0A 3OS0A 1XTDA 1M8MA 3M54A 4OMQA 3UATA 3X20B 3OBYA 3QUIA 1SHFA 2L8DA 1VQPQ 4KUDK 2O4XB 2VVKA 4JRKA 1ZUUA 2O9VA 4LUEA 2NWMA 1VQPA 2O01E 4Y91A 3VS0A 1I4K1 2V26A 1VYUA 3OMGA 1JXMA 2DETA 4M77F 3QWYA 3G7ZA 3VYGA 1TUGB 1Q81U 3FJ5A 1A0NB 2E41A 2HBWA 3PTAA 1Q82U 1YJ9T 1E6GA 2CUDA 4A4HA 2HNIA 1WHMA 1R77A 2CZ7B 4HA8A 5I21A 4BE2A 2K3BA 2X4JA 4C5EA 3MP6A 1Q7YU 2DBKA 4DEXA 2PVDB 2QTVA 3LGLA 1YHQQ 2OTLQ 5GMKm 2EYZA 5GAOq 3L2UA 3CC2T 4UC4A 2P0PA 4OMMA 1PWTA 4M78C 1VQOQ 3OYDA 3LH0A 1JB0E 3CCUT 2RI2A 2D0NA 1TOVA 1AD5A 3JCMb 1N9RA 2L5QA 1B34A 4FW1A 2F1LA 1UEBA 1QWEA 4OGCA 3CCLQ 2XDDA 4JRPA 2EWNA 3VS5A 3TU4K 2MPXC 1N8RU 4A4EA 1VQ7A 2X3XD 2DYBA 2KAFA 1AWJA 5CVIA 4IIOA 4DBRA 1YN8A 4RTTA 2QQRA 4J9GA 5GAOl 1PM3A 1H3HA 1RACB 4FT2A 2EVRA 1BIAA 1MMAA 3JCMd 3JCMg 3CMAT 3AHUA 4LE9A 2QEXA 3H0HA 2EKHA 3DLLA 4DBHA 1K73R 2KYMA 4HCBA 1MHNA 4R55A 4IUPA 3C94A 1M90U 1YITA 2GFUA 4FYXB 2CT3A 2HKQB 3G6EQ 2A08A 2A3LA 1RADB 2LX9A 2JM9A 4C8QD 5FU6B 1FYNA 4M7AC 2RN8A 5DLQE 5GANf 1ARKA 3QBYA 4LDXA 1OV3A 3A5ZB 4A53A 3EFRA 1ZX6A 3P8HA 2XDPA 4BY6C 1MMNA 4E7JA 1YCYA 3L2ZA 2JTEA 1WI7A 1XNIA 2RD1A 4WF2A 4DBFA 2HSPA 2LQNA 3JCMW 4FSSA 4LNPA 2E3IA 5GAOr 3GPLA 2HAXA 2MWOA 3CCEQ 2CH4A 1FMVA 2XHCA 1W4SA 4OB0B 3S3OA 1VQNA 2RH2A 1LNXA 4KRTA 1VQPT 3JB9I 1VQKQ 3EHRA 4XTUA 1Y96B 2DTOA 3JB9J 1QWFA 2K2MA 2E65A 5GAN7 2AZVA 1NYFA 4PLLA 1Y57A 4XTXA 5GAMd 5GAMg 1Q81C 4XK8E 2XI9A 4HVUA 2FB7A 3OSSC 4PFPA 2AZSA 1Q82C 2HMAA 1OZ3A 3BFMA 1BK2A 4YTLA 3HFOA 2JW4A 1MV3A 1K4US 1N6AA 4KGXB 1HJDA 3JB9D 2QA4Q 2VGMA 5GANh 5GAN4 1Q7YC 2VGNA 3CC4A 3CC7Q 2CZ1B 3FIFA 3GLXA 2QA4A 1YHQT 2OTLT 1H8KA 4WTOB 2JTFA 4F7UE 1QCFA 2FVUA 1VQOT 2VC8A 4M75B 4E7LA 2MOXA 1IREB 2O9SA 4M77B 1WHHA 4EMKB 2EKOA 2LC4A 2CP2A 1YI2A 3M0TA 2EJGA 3CPWP 5KYYA 2EFIA 2ZPHB 2O2OA 5KE2A 4BE0A 2LVMA 3REAB 4PJMA 2IPOB 3CCLT 4LXCA 5LJ5f 3OSVA 1C0MA 1K1ZA 1N8RC 3I5SA 4KULA 4PLIA 3QKJA 1IHWA 1WFWA 2QXFA 4JLGA 2ED1A 5IHNA 1OU9A 2RNAA 1CKAA 2EAYA 2LT4A 1AWWA 3HHTB 1OQKA 4C92B 4PFZA 4BD3A 3THKA 1J3TA 4RCCA 4IUQA 1VQ9Q 5DM7R 3GF5A 1VYTA 2H8HA 4X1VA 3OQ5A 1M90C 3JV3A 1IZ6A 2K5FA 4RCBA 1KJWA 3G6ET 4AFZC 4E2FB 1G5VA 1KSWA 1M2VA 3G4ST 3HPWA 2YUOA 3O8VA 1S72Q 4RG2A 3EGDB 4IKFA 3GOXA 1IXDA 2CP3A 2RJCA 1XOVA 5KYUB 2P4RA 4WCIA 1QVGA 2JS2A 1N9SA 1V76A 1D1BA 2EQKA 1M9SA 3SD4A 3I56A 4Z8AA 1RAAB 2E3HA 3CCET 1WHJA 5KYXA 4MZMA 1OPLA 3X28B 1VQKT 3E2UA 2RI5A 2CYZB 3QSUA 2R5AA 1RAFB 1PC0A 1ZSZC 3RR6A 2NUZA 2ZPBB 4PJOD 4HCZA 2CZ6B 4FCYA 3CCJA 3G71A 4RMOA 1IGQA 2FL7A 1AEYA 1B07A 1Z9ZA 1V1CA 3QZ9B 2KROA 1GCQC 3EFOB 3GIBA 3M53A 2ZPEB 3SDZA 5LJ3f 1H641 1UGVA 1D09B 5D6XA 1RLQC 1EZZB 2LJ0A 3V8JA 2HL5C 2VUBA 4JDSA 2QA4T 4V2SA 4J6WA 4HCCA 4M77D 1TG0A 4L59A 3ZBDA 3CC7T 4OMNA 4QQGA 3KUFA 4LD6A 2W10A 4J9CA 3V8LA 3JAME 2CS7A 4IUVA 2X4XA 5I2SA 1PD1A 4JJDA 1GL5A 3QZ5B 2LQ8A 2Y4YA 4RTZA 2EQMA 3NPFA 5GAMh 1I0CA 3V7SA 2XG8D 4M7DB 2RMOA 1GXIE 4F04B 5A0DA 3JCMJ 4A54A 1E7OA 1SG5A 1WX6A 2L89A 2OI3A 1WA7A 1WHGA 3OYHA 1UTIA 4A4KA 4L6V5 3WXMB 3EAEA 5CK9A 1NLOC 3G1JA 4D8DA 1I8FA 2VXEA 2DBMA 1PHTA 4IUTA 1VQ9T 1TH7A 5A0LA 2DX1A 5LJ5j 3ZEHA 3IQLA 2JTMA 3KXTA 1ACMB 2HQXA 3QPHA 3CCQQ 4O5VA 1Y07A 5LJ5e 4FW2A 1S72T 2K6DA 1BYMA 3CCQA 2PVOB 4MMKA 1RAGB 3OYNA 4HCKA 1TS9A 5KYWA 3MEWA 1JU5C 5D6YA 2CGHA 4LDUA 1QQJA 4OMOA 1H3ZA 2EYWA 1MGQA 1K8AC 3WVEB 3ME9A 2DZCA 2LDMA 3HFNA 1OI1A 2KE9A 3ER0A 4JJNK 1JJ2S 3E19A 2MK5A 4M75E 1PCXA 2K5LA 1AWXA 1YIJQ 1M1KU 4QQ6A 3CD6Q 5FLXE 3R6OA 2ESWA 4PJJA 4JRIA 5AT1B 1OULA 3M58A 1QW1A 1KC8R 2LCLA 2HBPA 1G3SA 2JM8A 4QKUA 1RAHB 2RQVA 4FYVB 1UG1A 3ZFJA 5CKDA 2F5TX 5A2QE 4C92E 1JXOA 1K76A 1W2BS 4FU6A 4HVVA 3L2VA 2ZCFB 2ATCB 2DRKA 5GJWB 2DE0X 3QJ6A 1NM7A 1HD3A 5I11A 3HRSA 3A98A 4J9FA 3A8GB 2AIRB 4EMGA 3LWHA 2RHXA 2KEAA 5LJ3e 2J05A 3E9FA 2ZAEA 4LDVA 3CMEA 5IHIA 2ZPFB 3CPWS 1M5Q1 3T9NA 2COYA 2EGCA 5GMKl 3HSBA 1VQ4Q 5FW9A 5CCAA 2C0OA 2QDLA 4II1A 3URGA 5FU7B 1KD1U 2NUTA 3OS5A 1G2BA 3CCVA 2RJFA 3RKYA 4A63B 4NS5A 2QQSA 2WSFE 4NL3A 3CCQT 2KNBB 3S6WA 5KCOA 5J26A 2DPPB 2MF2A 2FZGB 3I55A 2NUPB 2FZKB 2O88A 3P8DA 2QI2A 2GGRA 2B86A 1GCQA 2Y4XA 1WYXA 4OB1B 2BE7D 1OX8A 2KDSA 3LWIA 2P0KA 1UGPB 1ZBXA 1IHVA 4C8QB 4JJCA 5A0GA 4KH1B 2BTTA 3CXCP 1QLYA 2M0YA 5C6SA 3S3MA 2LTOA 4Z02A 2HDAA 4M78F 3CBOA 1M1KC 3L2WA 2DFUA 4E6RA 1YIJT 3CD6T 3CCRA 1BI1A 1D3BB 3TSZA 2DMOA 4M7DE 1ZUYA 3EH2A 4EMHA 3EGXB 1BU1A 2JNGA 3PNWC 1QCOA 2V1RA 2V8IA 2DL5A 2KRNA 3EFSA 2DXCA 3UDCA 3P8BB 1BKBA 2K7AA 1YJNQ 4PKCC 4EPCA 2X35A 4GBQA 1QVGP 4FM4B 1YJNA 1VIEA 5GAOp 4AFSC 2HCKA 2I0NA 3EGUA 3J80E 3E1SA 4BACA 4C0DC 3FJPA 4M7AF 3MCAB 2W0ZA 2F2WA 4QW2A 1QVFS 2DZ9A 4XU3A 1HYOA 1K0XA 4DOVA 1NJIR 1EX4A 2XD0A 2SRCA 3OS1A 4C0ZA 3DKMA 4O6JA 1VQ7Q 3L2QA 2GTJA 2F2XA 2YDLA 5I2MA 1YJWA 3A1PA 1XQHA 1VQMA 2EIFA 3JB9H 1VQ4T 1UJYA 1KIKA 2ROLA 1KD1C 3OYIA 3U23A 2QEXQ 1PSEA 1K9AA 2OJ2A 3BW1A 2CSQA 2J7IA 4JZ3A 5AYFA 1YITQ 4AG1C 4F14A 1G3YA 1V29B 5GAOn 3VUZA 2X4WA 5FROA 7AT1B 3C0CA 1XJWB 4F7UA 3CCMA 1I81A 4MDXA 1JEGA 2ZPGB 1X2KA 3EG0A 3MP1A 4OF1A 2FPDA 2CUBA 2DTIA 4J83A 2X3WD 2A28A 4PFOA 2NUPA 1S1NA 1WXBA 2FPEA 4C5HA 2K4YA 4X34A 2E6NA 3OYAA 3OYJA 5IT9E 3S3NA 4BI4A 2BE9B 2COWA 1VQNQ 8ATCB 4C92C 5DLOA 2G6FX 2F5KA 4XAXB 3I35A 4B9XA 1VQ6A 1H92A 2O4XA 2LX7A 2EYXA 1X75C 1M1GA 2LQWA 4BI8B 2J06A 3SWNB 1GBRA 2IIMA 3VS6A 1Q86U 3OA6A 4MZTA 4PJOB 1UDLA 4M78B 3TCJA 3OYFA 3CPFA 4F7UG 1OZ2A 1WLPB 2DVEA 1YJNT 1X6OA 2GQIA 2Z0WA 1GFDA 3CC4Q 2VYTA 4C0GA 1OYXA 3OS2A 1F1BB 5EG2A 1NEBA 4OMFB 1BI2A 1HXDA 2HD0A 4FSXA 2YRVA 1SEMA 1YI2Q 3NTIA 3PGGA 3QIIA 2HKNA 2DLPA 1D0XA 4BI3A 2P84A 3C4SA 3V7CA 2DL7A 1MMDA 2O31A 2C0IA 4AG2C 3OYLA 4HT8A 1WXUA 1BCMA 3LLRA 5CKHA 2JXBA 1VQ7T 4FT4A 3JCMf 4KH0B 3CXCA 3MPUB 4CC7A 5CQXA 4HXJA 1K9MU 1KQ2A 4C8QE 4BB7A 3J81E 2EGAA 1ZA1B 4B6MA 2QEXT 1ZSGA 2C0TA 2EJ9A 2K79A 2DVJA 3NHNA 1QP3A 2KMTA 2RJDA 1IGUA 1YITT 4N4HA 1X69A 1WZOA 2K2VA 1TTHB 2A37A 3PIOA 4E7HA 4KUIA 3F70A 1Q81R 3QG1A 3E9GA 1OX9A 1Q82R 4C5GA 1SHGA 1WNLA 2DK3A 2QQ9A 3SEMA 3J7AF 3A8HB 5FRNA 2DXTA 1W70A 1GCPA 4P5NA 2RQWA 2RO0A 3EG1A 4KGZB 4ZGEB 2IVWA 3I56Q 1Q7YR 3CCSA 1VQNT 2DNUA 3OMCA 3JCMh 2RHIA 2JZ2A 2ABLA 5GAMf 3LGFA 3TVTA 1KQ1A 3VS1A 2L3SA 2PTKA 1KQSS 4C0FA 5GANj 2CP7A 2K9GA 3CCJQ 3G71Q 2CREA 2M02A 1Y96A 2ENMA 4M78D 4J6XA 1Q86C 4RG8A 5GANe 1N8RR 2DILA 2RHZA 3X26B 3V8KA 2RPNA 3RKXA 3SWNA 3M0QA 3VV0A 4Y92A 2ZZDA 3CC4T 2BZ8A 5GMKi 2ZGWA 1YCSB 5IXBA 3SFMA 1PG5B 4OMLA 2X9HA 2VASA 1M90R 1M3AA 1CSKA 1YI2T 3BDLA 3EG9B 2QASA 3VUBA 1QKWA 1T3LA 4M75A 4M77A 4QVCA 1SSHA 4EMKA 3QHSA 2E70A 2BUDA 2DJQA 4PJLA 4M7AD 1M8VA 1K9MC 5IAYA 2BZYA 3OW2A 2MCNA 1YFNA 2KSSA 1I5OB 2YHTA 3VRZA 3RNJA 1D0ZA 1NPRA 3JCMV 1UECA 2QGGA 3OYMA 3FLGA 1JJ2A 1VQ8A 2KBTA 4C92A 2HQHA 4RTWA 4RTXA 2FG0A 4LDYA 2OAWA 2JMCA 4HT9A 1U8RA 3BY7A 2LNHB 2PUKB 2E5KA 4KGVB 2FHDA 1U3OA 1PD0A 1KK7A 5J3BA 2EYQA 1KHCA 2OTJA 2OX7A 1VQLA 2OAUA 2QG9B 1B3QA 1SKUB 4PJOE 2LP5A 3FEOA 4M78E 2EQUA 5GMKh 3EGDA 3I56T 4J7FA 2MIOA 4M75G 1FWZA 5KYUA 4M77G 3FRNA 3M59A 4RTUA 1YP5A 3OYYA 2AK5A 1TXQA 3OY9A 1WIEA 1EIFA 1T3SA 3EHQA 3RIRA 3OYCA 3ZL7C 1X6GA 4LDWA 3RUXA 3MEAA 5GAN8 1Z9QA 4M77E 2A0FB 3CCJT 1GBQA 3G71T 3INZA 3VU3C 2RA2A 1G83A 2L2PA 3VS7A 4ZN3A 3X24B 3M0PA 2RHYA 4C92G 5GAMj 2WSCE 3EFOA 2V8KA 4XTWA 2KQWA 2AHJB 2CH4W 1ZUKA 3D7SB 4N0AA 2KYBA 5HCKA 4XTVA 4J9IA 5GAMe 2E1HA 1JBMA 2XICA 4A4GA 1K73U 3RESA 5GAN3 2XIDA 2EYYA 4FYYB 4OB3B 1M2OA 3UF4A 5LJ3j 3A8OB 1FMKA 2GQVA 2D6FA 2DRMA 3EG9A 4ANJA 2SEMA 3M57A 3GNGA 1YJ9A 2LZ6B 2CSIA 3CMEQ 1TUDA 4Y28E 9ATCB 3JCMX 4M7DA 3QYHB 2JT4A 2XKOC 2YT6A 4JS5A 3X25B 1QKXA 2LMJA 1UHFA 2XDBA 2R5MA 3MP8A 1K8AR 5HK0A 2KI7A 2K3XA 1LPLA 3MKDA 2JMAA 2Y90A 1B34B 4MMLA 1U1TA 3CBPA 6AT1B 3VRYA 2J6FA 3CCVQ 2GTOA 4PNOA 1TU0B 2RK2A 3N5BB 4ESRA 2L0AA 5LL6S 1UE9A 1LVKA 3JSCA 3PFSA 4MDWA 1U1SA 2DIGA 2RQTA 5CR2A 2DIQA 1X6BA 2HZYA 2M16A 3OYBA 4E7KA 1VUBA 2DAQA 2RK1A 3I55Q 2WSEE 4J7IA 3PMIA 1FXXA 5IXFA 2E6ZA 4OVAA 1ABQA 1M1FA 4ORZA 1BCOA 2YWWA 2MMPA 3JRZA 4QVDA 2QQAA 4J9BA 1JO8A 1RABB 3CMAA 2DO3A 1AT1B 3PT9A 1G3WA 1TSFA 4JRQA 3RKWA 1WDXA 4F17A 3EH1A 2FRYA 4MZPA 4OGEA 4M7DG 4BDZA 1PNJA 3CCRQ 1BI0A 1WJQA 4PK4A 2JJ9A 3RDVA 2YLCA 5L23A 4X9CA 3KBGA 1KHIA 3UWNA 1QVFA 2DYIA 2E12A 4OB2B 1UB4A 1G8XA 5GANg 5GANd 1QCNA 5FU6C 4XU1A 4J5YA 4XTZA 1WPYA 2J6KA 4B9WA 4XU0A 2CZ0B 3SHWA 2LNVA 3META 1K73C 3L42A 3MEUA 3TEEA 2DXUA 4OMPA 1SRMA 4M75F 3V7RA 1JRIA 2D0QB 1PRLC 1AVZC 3OBWA 3NTHA 3CBMA 2LJ1A 2HEQA 3DLMA 3RBBB 2BZXA 5D6WA 3CMET 1KG1A 3SWNC 2EJFA 1YJWQ 1CKBA 5ECAA 3LH5A 4VUBA 1VQMQ 4J9HA 3H0IA 4PJOC 2F69A 5KYNA 3TREA 5KH6A 1YHQA 2OTLA 1NZ9A 3VKIA 4C92F 4N4IA 5KYYB 2QAZA 1VQOA 2KGTA 3CCVT 4ZN1A 1M1KR 2DD4A 1Y71A 1AWOA 4LN2A 3QYGB 2M0OA 2LCSA 1D1AA 5L8RE 3HP9A 4Q5WA 4BUGA 2R57A 5FRMA 2XK0A 1NYGA 1YNZA 1B7TA 2YRDA 2G3RA 3BE3A 3CCMQ 3CCLA 2ROTA 5J39A 4M75C 3VS4A 4M77C 5KCHA 1BI3A 3I55T 4EMKC 1JQQA 4N4GA 1PSFA 5EC7A 2RI3A 5LJ5d 5LJ5g 2K57A 2D8HA 1VOMA 4XQ3A 1VQ5Q 2A7YA 3NMZC 3ULRB 1OU8A 1HK9A 2C06A 1VQ5A 1M2VB 4TVRA 2EQJA 1UFFA 3JCMc 2FZCB 5DY9A 3OW2P 8AT1B 5CO7A 4DOWA 4C8QA 3G4SQ 3G6EA 2K3YA 4GLKA 2AKLA 3HKSA 3HTRA 3CCRT 2CT4A 2YUNA 1PKTA 4ZGJB 4FL6A 3G4SA 1IO6A 1VQ6Q 1UHCA 4Z88A 4R56A 5HKCA 4E47A 5HY6A 1AOJA 4JUVA 1JJ2P 3NFCA 2D1XA 3NGPA 3EG3A 2DF6A 2YLBA 1VIFA 4PJNA 5KYXB 4J8OA 1RAIB 1WJRA 2XU8A 1SF9A 1D3BA 1QMCA 1M27C 4ZNXA 1ZA2B 2B8AA 1X27A 4J6YA 3EGXA 3CCEA 3HRTA 4C0DB 1KD1R 1VQKA 2YSQA 3JCMP 1RAEB 1NE8A 2DEQA 1WQWA 5HK3A 1G3TA 4LUDA 2A36A 2DL4A 2VKNA 1IB8A 1UJ0A 1YWPA 2V8JA 3MHXA 1WQ7A 4OP0A 1BB9A 2FYKA 4AMCA 1SPKA 4RUGA 1WJSA 1W2BP 4M7DF 2RHUA 2GBQA 1P92A 5I22A 1MNDA 1DJ7B 2BIVA 3RMQA 4M4ZA 3LW5E 2PVGB 4NL2A 1LJOA 3OB9A
chains in the Genus database with same CATH topology
3PMTA 3A8LB 5CAIA 2PVDB 3LGLA 4M75A 2JVVA 5CKEA 5GMKm 5LJ3d 4M77A 4QVCA 5LJ3g 5GAOq 3L2UA 1YJWT 3CC2T 4UC4A 2P0PA 3HRSA 1VQMT 4EMKA 3QHSA 3CC7A 4M78C 2E70A 3A8GB 4EMGA 3LWHA 3OYDA 2RHXA 2BUDA 4BE1A 3LH0A 1JB0E 4QVZA 3CCUT 2RI2A 5LJ3e 3M55A 5GAOm 4M7AD 1M8VA 3C12A 3E9FA 5IAYA 4N0AC 3OW2A 3OYEA 1K9MC 2E10A 4LDVA 3JCMb 1N9RA 1O75A 3L2RA 3CC2A 2L5QA 2KSSA 3CMEA 1B34A 2ZPFB 3QDRB 3CPWS 1M5Q1 2YHTA 1UEBA 4OGCA 4M7AB 3T9NA 2KY9A 2XDDA 4JRPA 1M4ZA 2EWNA 5GMKl 3HSBA 3HRUA 1NPRA 2MI6A 3TU4K 3JCMV 1N8RU 4A4EA 5CCAA 4JS4A 1VQ7A 3CCMT 5GAN6 2KAFA 3ASKA 3FLGA 5CVIA 3OYMA 1JJ2A 1VQ8A 4BY6B 4II1A 3URGA 5FU7B 4C92A 1KQSA 2QQRA 1KD1U 5GAOl 4LDYA 1KC8U 3OS5A 3CCVA 4ME7A 4HT9A 4NL2A 1U8RA 3BY7A 2PUKB 4FT2A 1BIAA 2RJFA 3RMSA 3JCMd 3JCMg 3CMAT 3AHUA 2FHDA 3RKYA 4NS5A 2QEXA 4M7DC 5J3BA 1VQ5T 2QQSA 4C8QG 4XTYA 2EYQA 1KHCA 2H3JA 3DLLA 2OTJA 2WSFE 4NL3A 3QXEB 3CCQT 4HCBA 1MHNA 3S6WA 4R55A 5KCOA 1VQLA 2OAUA 4IUPA 3C94A 1M90U 5J26A 1YITA 2DPPB 2GFUA 1VQ9A 4PJOE 2MF2A 3FEOA 4M78E 3I55A 2EQUA 2A3LA 5GMKh 4X9DA 3JB9G 2LX9A 1K73C 1AHJB 3FDRA 3I56T 3P8DA 2QI2A 4J7FA 4C8QD 5FU6B 2Y4XA 4M7AC 4M75G 1FWZA 4OB1B 2RJEA 4M77G 5DLQE 5GANf 2KDSA 3QBYA 4LDXA 3FRNA 3LWIA 2P0KA 3M59A 4HKEA 3A5ZB 1UGPB 4A53A 1VQ6T 3EFRA 1ZBXA 3OYYA 3P8HA 4C8QB 5A0GA 2QDYB 2XDPA 1S72A 4BY6C 4E7JA 1YCYA 3L2ZA 3OY9A 3CXCS 1BIBA 5C6SA 3S3MA 1EIFA 1XNIA 2LTOA 2RD1A 4WF2A 4Z02A 3RIRA 3OYCA 4M78F 2QTXA 3JCMW 3CBOA 4LDWA 3RUXA 2IG0A 3Q1JA 3MEAA 5GAN8 4M77E 3FC3A 2GCXA 3UPUA 3GPLA 2DXBA 5GAOr 2MWOA 3CCJT 1M1KC 3G71T 3L2WA 2HAXA 5GAN5 4OB0B 2XHCA 1W4SA 3INZA 5LJ5h 3S3OA 1YIJT 3CD6T 2LCCA 1VQNA 2RH2A 3VU3C 3CCRA 1BI1A 2RA2A 1LNXA 3GNFB 1VQPT 3JB9I 1QP2A 4ZN3A 4XTUA 3X24B 1K8AU 2RHYA 1D3BB 1Y96B 2LT1A 2DTOA 4FIBA 3JB9J 2M1HA 3WVDB 3RERA 4M7DE 4C92G 2E65A 4EMHA 5GAN7 4PLLA 2JNGA 4PJOA 4XTXA 5GAMj 2WSCE 3PNWC 4M78A 2V8KA 5GAMd 5GAMg 4XTWA 4XK8E 1Q81C 2KQWA 2XI9A 3DB4A 1NPPA 2FB7A 3OSSC 2AHJB 2MAMA 2V8IA 3EFSA 1Q82C 2DXCA 4N0AA 1OZ3A 3BFMA 4XTVA 3UDCA 5GAMe 2E1HA 4JLIA 1JBMA 4YTLA 2XICA 1BKBA 3P8BB 4A4GA 1K73U 3RESA 3HFOA 5GAN3 4PKCC 4EPCA 2PQWA 2XIDA 2M9UA 2X35A 1N6AA 4FM4B 3BDUA 3M5AA 3JB9D 1O9SA 3CEYA 5C0MA 1YJNA 1QVGS 2DD5A 4OB3B 1VIEA 2VGMA 2NLUA 5GANh 5GAN4 5GAOp 1Q7YC 2VGNA 3LX7A 3CC4A 4M75D 5LJ3j 2CZ1B 3A8OB 3FIFA 3GLXA 3NTKA 2ZPIB 2QA4A 2JUFA 3J80E 1X01A 2GQVA 3E1SA 1YHQT 2OTLT 2PU9B 4BACA 2D6FA 2JOYA 4C0DC 5GAN2 3FJPA 2JTFA 3M57A 4KT0E 4F7UE 3GNGA 3SB2A 4M7AF 3MCAB 1YJ9A 4QW2A 1QVFS 2DZ9A 2FVUA 2VC8A 4M75B 4XU3A 1VQOT 4E7LA 5KE3A 1IREB 4M77B 4Y28E 4DOVA 1N27A 4XU2A 4EMKB 4NOYA 3JCMX 4M7DA 2EKOA 2LC4A 2XKOC 3QYHB 4CRIA 2XD0A 1YI2A 4JS5A 3OS1A 3X25B 2EJGA 4L5GA 3L1AA 4C0ZA 3DKMA 2WACA 2EFIA 2ZPHB 4O6JA 5KE2A 2XDBA 2R5MA 4BE0A 2LVMA 3MP8A 3L2QA 3CCLT 5HK0A 5I2MA 5LJ5f 3OSVA 1YJWA 2K3XA 1XQHA 1VQMA 2EIFA 2Y90A 4MMLA 1B34B 1N8RC 4KULA 4PLIA 3QKJA 4F7UF 1VQ4T 3JB9H 1U1TA 3CBPA 2QXFA 4JLGA 4PNOA 4M7AA 4C92D 2R58A 2X4YA 5CKBA 1KD1C 2RK2A 3OYIA 3N5BB 4ELZC 1KC8C 2L3RA 4ATOA 5LL6S 4PJOG 1PSEA 2EAYA 3BW1A 4M78G 1ZQ1A 2P4TA 3OYKA 2LT4A 3HHTB 3JSCA 4C92B 3PFSA 4BD3A 4MDWA 1U1SA 2DIGA 5AYFA 5LJ3h 5CR2A 2DIQA 4RCCA 4IUQA 1G3YA 1V29B 3JCMQ 3OYBA 2M16A 5DM7R 5GAOn 4E7KA 1VUBA 2DAQA 2RK1A 2X4WA 3GF5A 3QJYA 5FROA 3VUZA 3JCMe 3PIPA 2WSEE 3OQ5A 4J7IA 2I2LA 4F7UA 3CCMA 1M90C 1IZ6A 3PMIA 1FX7A 1FXXA 1I81A 4MDXA 2K5FA 3UT1A 3CCST 1RI0A 4RCBA 2E6ZA 4C8QF 3G6ET 3M4GA 4OVAA 1M1FA 1UGRB 2D9TA 2ZPGB 1G5VA 4ZGDB 2MMPA 3JRZA 3MP1A 4QVDA 2QQAA 4OF1A 2DTIA 4J83A 3G4ST 5CIUA 3HPWA 1LOJA 3CMAA 3O8VA 2DO3A 2LQKA 2QQBA 4RG2A 2PUOB 3PT9A 1G3WA 4IKFA 3GOXA 4JRQA 3RKWA 1W2BA 2RJCA 1XOVA 5FU7C 4C5HA 2K4YA 4MZPA 2KVQG 4OGEA 2E6NA 4X34A 3OYAA 3OYJA 5IT9E 1QVGA 3S3NA 4BI4A 1N9SA 4M7DG 3OW2S 4BDZA 1I5LA 2EQKA 1NJIU 1BI0A 1M9SA 1Q7YU 1WJQA 3SD4A 3I56A 4C92C 5DLOA 2E5QA 3CCET 2F5KA 1UGSB 2YLCA 4XAXB 5M9OA 4MZMA 4X9CA 3KBGA 4LD9K 1KHIA 2MWPA 3UWNA 2GFAA 3X28B 4A4FA 4E7IA 4B9XA 1VQKT 1QVFA 1VQ6A 2E12A 4M7AG 4OB2B 2RI5A 2CYZB 2O4XA 3HL8A 1YBYA 3QSUA 2R5AA 1UB4A 5GANd 5GANg 3GIBA 1X75C 1M1GA 2ZPBB 5FU6C 4BI8B 4PJOD 4HCZA 3SWNB 4XU1A 4J5YA 3CPWA 2CZ6B 4XTZA 2VV5A 1Q86U 1WPYA 3CCJA 3G71A 4B9WA 2FL7A 4RMOA 1YIJA 4XU0A 2CZ0B 4MZTA 3OA6A 3CD6A 3GP8A 2DTHA 4C8QC 3QZ9B 4PJOB 4M7AE 4M78B 3TCJA 2LNVA 4KBMB 3M53A 2ZPEB 3META 3SDZA 2VXFA 3CPFA 3L42A 2CKKA 5LJ3f 1H641 3MEUA 4F7UG 3TEEA 2DXUA 1OZ2A 5D6XA 3JB9F 3H6ZA 2DVEA 2HQEA 1YJNT 1X6OA 5IN1A 1R8OB 4DA4A 2VYTA 3V8JA 4M75F 3V7RA 1JRIA 3VJPA 2D0QB 4C0GA 2VUBA 1OYXA 4JDSA 2QA4T 4V2SA 3OS2A 3OBWA 4J6WA 4HCCA 2JN0A 3NTHA 3CBMA 4M77D 2K5IA 4L59A 3ZBDA 3CC7T 5EG2A 4QQGA 3DLMA 3KUFA 4OMFB 4LD6A 1BI2A 1Y7XA 1HXDA 2HD0A 4FSXA 2YRVA 3V8LA 3JAME 2CS7A 3NTIA 5D6WA 3PGGA 3QIIA 4DQ2A 4IUVA 3CMET 4BI3A 2X4XA 3C4SA 3QO3A 3V7CA 5I2SA 3OYLA 4M7DD 1KG1A 4HT8A 3QZ5B 3SWNC 4CI0C 2LQ8A 2Y4YA 2EJFA 2EQMA 4VUBA 5GAMh 3V7SA 2KK4A 2XG8D 3LLRA 4M7DB 5CKHA 1VQ7T 4PJOC 2F69A 1GXIE 4FT4A 3TREA 5A0DA 5KH6A 3JCMJ 3C95A 1YHQA 1VQ8T 2OTLA 4A54A 3JCMf 1NZ9A 3VKIA 4C92F 1RL2A 2L89A 4N4IA 3CXCA 4BDYA 5CQXA 5GMKj 1VQOA 3CCUA 3CCVT 1K9MU 1KQ2A 4ZN1A 4C8QE 4BB7A 3J81E 2DD4A 2DJZA 3OYHA 4A4KA 2BKDN 3M4YA 4L6V5 3WXMB 3EAEA 3QYGB 4GY5A 2QEXT 2M0OA 5L8RE 5GMKe 3HP9A 4Q5WA 3A8MB 3H8ZA 4BUGA 5CK9A 4ZTJA 2OTJT 2EJ9A 2R57A 2E64A 5FRMA 1QP3A 2XK0A 4PL6A 1VQLT 2G3RA 2KMTA 1I8FA 3CCLA 2VXEA 2P0QA 2RJDA 5J39A 4IUTA 4M75C 1SSFA 4N4HA 1YITT 1VQ9T 4M77C 3VYHB 5KCHA 1BI3A 2K2VA 2RB6A 3I55T 1TH7A 1VQ4A 4EMKC 1QVPA 4N4GA 5CQYA 3M9QA 3PIOA 1PSFA 1WGSA 4KUIA 5A0LA 4E7HA 3F70A 5LJ5j 2RI3A 3QG1A 5LJ5g 5LJ5d 3ZEHA 2K57A 3E9GA 4C5GA 2JTMA 3KXTA 4F7UB 3FB9A 2HQXA 4XQ3A 2A7YA 1WNLA 3QPHA 2DK3A 2QQ9A 4EDUA 3J7AF 3A8HB 1HK9A 4O5VA 5FRNA 1Y07A 2DXTA 5LJ5e 1S72T 2C06A 1VQ5A 1BYMA 4P5NA 2RO0A 3CCQA 4TVRA 4C5IA 2PVOB 5CKFA 2EQJA 3MEVA 4MMKA 4ZGEB 2RM4A 3MO8A 3JCMc 2LRQA 5DY9A 4D6WA 3OYGA 2IVWA 3OYNA 4ZTFA 3CCSA 4QQDA 3LYIA 5CO7A 1NJIC 4DOWA 4C8QA 3G6EA 2K3YA 3HKSA 1UGQB 1ZHIA 4GLKA 3CCRT 1VQNT 3MEWA 5D6YA 2CGHA 3DB3A 2DKGA 4LDUA 4ZGJB 3OMCA 4FL6A 4IURA 3JCMh 3G4SA 1H3ZA 2RHIA 2JZ2A 3OYFA 4R56A 3M56A 1MGQA 4E47A 3WVEB 4IUUA 5GAMf 5HKCA 3LGFA 1K8AC 3ME9A 2DZCA 5HY6A 2LDMA 1KQ1A 4JUVA 3HFNA 3NFCA 1OI1A 4RKUE 3ER0A 4ELYC 4JJNK 1JJ2S 1KQSS 2GF7A 3E19A 4PJOF 2YLBA 4C0FA 5GANj 1VIFA 3OS0A 1XTDA 3M54A 4J8OA 3X20B 1WJRA 2XU8A 4M75E 2K5LA 3OBYA 1D3BA 1Y96A 3QUIA 4M78D 4QQ6A 2L8DA 4J6XA 1M1KU 1Q86C 4KUDK 2O4XB 4RG8A 2B8AA 5GANe 4J6YA 5FLXE 3R6OA 3CCEA 2RHZA 4JRKA 3X26B 3V8KA 4JRIA 1VQPA 3HRTA 4C0DB 3M58A 3RKXA 2O01E 3SWNA 1QW1A 4Y91A 1I4K1 2LCLA 1VQKA 3VV0A 3JCMP 1NE8A 2DEQA 3OMGA 1WQWA 5HK3A 1G3TA 2ZZDA 2HBPA 1G3SA 3CC4T 4M77F 5GMKi 3G7ZA 2V8JA 3MHXA 3VYGA 1Q81U 2ZGWA 2E41A 1WQ7A 4OP0A 3ZFJA 5CKDA 3PTAA 2FYKA 2F5TX 1Q82U 1WJSA 3SFMA 5A2QE 1YJ9T 4A4HA 2HNIA 4C92E 1W2BS 2CZ7B 4FU6A 4HA8A 3L2VA 4M7DF 2ZCFB 2RHUA 5I21A 4BE2A 1P92A 1YI2T 1DJ7B 2BIVA 3BDLA 3RMQA 3LW5E 2X4JA 3QJ6A 4C5EA 3VUBA 2PVGB 1Y71A 3MP6A 1LJOA 3OB9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E64 A;  5GAN 7;  5CAI A;  4M75 A;  1I8F A;  5GMK m;  5LJ3 d;  2VXE A;  4M77 A;  4XTX A;  4QVC A;  5LJ3 g;  5GAM j;  4M78 A;  5GAO q;  5GAM d;  4M75 C;  5GAM g;  4EMK A;  4XTW A;  1N9S A;  4M7D G;  4M77 C;  3QHS A;  2FB7 A;  2RB6 A;  4M78 C;  1TH7 A;  1I5L A;  4EMG A;  4EMK C;  3EFS A;  4C92 C;  4N0A A;  5LJ3 e;  5LJ5 j;  5GAO m;  4M7A D;  2YLC A;  3BFM A;  4XTV A;  5GAM e;  5LJ5 g;  2E1H A;  2K57 A;  1JBM A;  4JLI A;  4N0A C;  5LJ5 d;  1M8V A;  2E10 A;  3RES A;  3HFO A;  1N9R A;  3JCM b;  4X9C A;  4F7U B;  5GAN 3;  3FB9 A;  4XQ3 A;  1WNL A;  1B34 A;  1HK9 A;  4PJO A;  1M5Q 1;  2DXT A;  2YHT A;  3BDU A;  4M7A B;  5LJ5 e;  3JB9 D;  4M7A G;  5GAN 4;  5GAN h;  5GAO p;  2EWN A;  3QSU A;  5GMK l;  4EMH A;  5GAN g;  5GAN d;  3HSB A;  4MMK A;  2RM4 A;  4M75 D;  3FIF A;  5LJ3 j;  3JCM c;  3JCM V;  4PJO D;  5DY9 A;  1X01 A;  3SWN B;  4XU1 A;  4J5Y A;  5GAN 6;  4XTZ A;  5GAN 2;  3FJP A;  4C92 A;  1WPY A;  4F7U E;  3SB2 A;  4M7A F;  4C8Q A;  5GAO l;  4XU0 A;  2DZ9 A;  2VC8 A;  4M75 B;  2DTH A;  4XU3 A;  2CGH A;  4M77 B;  4C8Q C;  2DKG A;  4M7A E;  4HT9 A;  4PJO B;  4M78 B;  3GIB A;  3BY7 A;  4XU2 A;  3JCM h;  4EMK B;  1BIA A;  2VXF A;  4NOY A;  5LJ3 f;  3JCM X;  1H64 1;  3JCM g;  4F7U G;  3JCM d;  2DXU A;  3AHU A;  1MGQ A;  3RKY A;  5GAM f;  3JB9 F;  2DVE A;  4M7D C;  2DZC A;  2EJG A;  3L1A A;  4C8Q G;  4XTY A;  1KQ1 A;  4JUV A;  3HFN A;  4NL3 A;  3V8J A;  4M75 F;  3V7R A;  1JRI A;  4PJO F;  5GAN j;  2YLB A;  5LJ5 f;  4V2S A;  4J6W A;  2JN0 A;  4M75 E;  2Y90 A;  4MML A;  1B34 B;  4M77 D;  4F7U F;  3JB9 H;  4PJO E;  3QUI A;  1D3B A;  1Y96 A;  1U1T A;  4M78 E;  4M78 D;  4J6X A;  5GMK h;  3JB9 G;  4X9D A;  4M7D A;  4PNO A;  4M7A A;  4C92 D;  5GAN e;  4J6Y A;  4C8Q D;  4M7A C;  1HXD A;  4M75 G;  4JRK A;  3V8L A;  3V8K A;  4PJO G;  4M77 G;  4JRI A;  5GAN f;  3PGG A;  2EAY A;  3BW1 A;  4M78 G;  4DQ2 A;  3RKX A;  3SWN A;  4Y91 A;  3QO3 A;  3V7C A;  4M7D D;  1I4K 1;  4A53 A;  4C92 B;  4HT8 A;  3EFR A;  3SWN C;  4C8Q B;  3JCM P;  2DEQ A;  1U1S A;  1WQW A;  2EJF A;  1YCY A;  3L2Z A;  5LJ3 h;  1BIB A;  4RCC A;  5GAM h;  3JCM Q;  3V7S A;  5GAO n;  2RD1 A;  4M77 F;  4WF2 A;  3RIR A;  5GMK i;  3JCM e;  4M78 F;  2QTX A;  3JCM W;  2ZGW A;  4M7D B;  4PJO C;  2E41 A;  2I2L A;  4F7U A;  1WQ7 A;  4OP0 A;  3RUX A;  3JCM J;  4A54 A;  2FYK A;  1I81 A;  4M77 E;  3JCM f;  4C92 F;  5GAN 8;  5GAO r;  4RCB A;  4C8Q F;  5GAN 5;  5LJ5 h;  3M4G A;  3INZ A;  5GMK j;  2HNI A;  3VU3 C;  4C92 E;  2RA2 A;  4QVD A;  1LNX A;  1KQ2 A;  4C8Q E;  3JB9 I;  4HA8 A;  2DJZ A;  2DTI A;  4XTU A;  4M7D F;  5I21 A;  1LOJ A;  1D3B B;  1Y96 B;  2DTO A;  3JB9 J;  5GMK e;  3RER A;  4M7D E;  4C92 G;  4NL2 A;  3RKW A;  2EJ9 A;  1LJO A;  2E65 A; 
#chains in the Genus database with same CATH topology
 3PMT A;  3A8L B;  5CAI A;  3H0F A;  4AT1 B;  2JVV A;  5CKE A;  5LJ3 d;  5LJ3 g;  1YJW T;  1VQM T;  3CC7 A;  1NEG A;  3O5Z A;  4BE1 A;  4QVZ A;  3M55 A;  3MJX A;  5GAO m;  3C12 A;  4E7S A;  4N0A C;  3OYE A;  2E10 A;  3L2R A;  1O75 A;  1KFZ A;  4FYW B;  1HSQ A;  1WXT A;  1RLP C;  3QDR B;  1ZLM A;  4M7A B;  2KY9 A;  1M4Z A;  1AZE A;  3HRU A;  2MI6 A;  4JS4 A;  3CCM T;  1GRI A;  5GAN 6;  3ASK A;  1PKS A;  4BY6 B;  1KQS A;  2DM1 A;  5IHK A;  3M0U A;  4Z89 A;  1KC8 U;  4ME7 A;  1Q95 G;  3RMS A;  4M7D C;  4AFQ C;  1VQ5 T;  4C8Q G;  4XTY A;  2H3J A;  1T0H A;  3QXE B;  1NBE B;  2DA9 A;  3CCS Q;  1VQ9 A;  2KT1 A;  3JB9 G;  4X9D A;  3UA6 A;  1AHJ B;  2EQI A;  3FDR A;  3I5R A;  1UUE A;  2RJE A;  4HKE A;  1VQ6 T;  4DBQ A;  1M30 A;  5KYW B;  2QDY B;  1S72 A;  1VYV A;  3CXC S;  1BIB A;  2QTX A;  2IG0 A;  3Q1J A;  2VWF A;  3FC3 A;  2RQU A;  2GCX A;  3UPU A;  2DXB A;  5GAN 5;  5LJ5 h;  1MNE A;  2EGE A;  2LCC A;  2V1Q A;  3M0R A;  2YUP A;  3GNF B;  1GFC A;  1QP2 A;  1K8A U;  2LT1 A;  4FIB A;  4F16 A;  2M1H A;  3WVD B;  3RER A;  1NG2 A;  2EBP A;  2YRC A;  5FWC A;  2FRW A;  2M51 A;  4PJO A;  1U5S A;  2XMF A;  3H41 A;  4M78 A;  2J6O A;  3DB4 A;  2KRS A;  1NPP A;  4JPB W;  2MAM A;  2PNI A;  1WHK A;  2KRM A;  1OEB A;  4JLI A;  2PQW A;  1U06 A;  2CP6 A;  2M9U A;  1C6V X;  1N5Z A;  3BDU A;  3M5A A;  1QVG S;  1O9S A;  3CEY A;  5C0M A;  2DD5 A;  2NLU A;  2KT8 A;  3LX7 A;  4M75 D;  4HVW A;  3NTK A;  2ZPI B;  2JUF A;  1W6X A;  1X01 A;  2PU9 B;  1I1J A;  2JOY A;  5GAN 2;  4KT0 E;  3SB2 A;  1QVF P;  4CC3 A;  2DL8 A;  5KE3 A;  2AT1 B;  4JJB A;  2CP5 A;  1N27 A;  4XU2 A;  1AZG B;  4NOY A;  4J9E A;  4CRI A;  2L3P A;  4L5G A;  3L1A A;  2X51 A;  2WAC A;  5FWB A;  2KXC A;  1FMW A;  1R0B G;  1VQ8 Q;  3I9Q A;  3TSW A;  4F7U F;  4QT7 A;  1SRL A;  3AT1 B;  4M7A A;  4C92 D;  2R58 A;  1OPK A;  1W1F A;  2X4Y A;  5CKB A;  4IIM A;  4ELZ C;  1KC8 C;  2L3R A;  4ATO A;  4PJO G;  1Q86 R;  4M78 G;  1ZQ1 A;  5IH2 A;  2P4T A;  3OYK A;  2OTJ Q;  3R6N A;  1EFN A;  1VQL Q;  2NUT B;  5LJ3 h;  1ABO A;  2FO0 A;  3JCM Q;  2RF0 A;  3EG2 A;  3JCM e;  3QJY A;  3PIP A;  2EW3 A;  2I2L A;  2E4H A;  1FX7 A;  3UT1 A;  3CCS T;  1RI0 A;  4C8Q F;  3PVQ A;  3M4G A;  1ZSZ B;  1UGR B;  2D9T A;  4ZGD B;  3PE0 A;  2QYZ A;  1WHL A;  2D8J A;  5CIU A;  1LOJ A;  2LQK A;  2QQB A;  2PUO B;  4CC2 A;  1X43 A;  1W2B A;  5GJV B;  5FU7 C;  1Y0M A;  1ZBJ A;  2KVQ G;  4E7Z A;  3OW2 S;  1I5L A;  1I07 A;  1NJI U;  1K0S A;  2JS0 A;  2KXD A;  3TQ7 P;  3H9N A;  2RQR A;  2E5Q A;  2DL3 A;  1UGS B;  1X2Q A;  4GLM A;  5M9O A;  4LD9 K;  1T0J A;  2MWP A;  4E7I A;  2GFA A;  4A4F A;  1YWO A;  1K9M R;  4M7A G;  1PRM C;  3REB B;  1OOT A;  3HL8 A;  1YBY A;  3CPW A;  4K11 A;  2VV5 A;  3UA7 A;  1YIJ A;  3CD6 A;  3GP8 A;  2DTH A;  2MYS A;  4C8Q C;  4M7A E;  4KBM B;  2VXF A;  2CKK A;  3JB9 F;  3H6Z A;  2HQE A;  2QGF B;  2YXY A;  5IN1 A;  1R8O B;  4DA4 A;  4J9D A;  1M3C A;  3VJP A;  2PZ1 A;  2JN0 A;  4CC4 B;  2K5I A;  1YJ9 Q;  2CDT A;  2H3E B;  1RI9 A;  1Y7X A;  2AKK A;  1E6H A;  1M3B A;  1VA7 A;  4DQ2 A;  1MMG A;  2EPD A;  3CQT A;  3QO3 A;  4M7D D;  4CI0 C;  3PVL A;  4JZ4 A;  3CC2 Q;  3QDF A;  2COZ A;  4RTV A;  2KK4 A;  2HSE B;  1MUZ A;  2L3Q A;  4EIK A;  3CC2 A;  3C95 A;  1VQ8 T;  3CCU Q;  2ECZ A;  3QWX X;  2HL3 A;  4BDY A;  1RL2 A;  2NYS A;  2KR3 A;  5GMK j;  3VS3 A;  2DEU A;  3CCU A;  2DJZ A;  2QK0 A;  2BKD N;  4D8K A;  3M4Y A;  4GY5 A;  5GMK e;  4ZTJ A;  3A8M B;  3H8Z A;  1NLP C;  2OTJ T;  2E64 A;  2VB6 A;  1C1A A;  4PL6 A;  1VQL T;  3KFV A;  2P0Q A;  1SSF A;  4R0K A;  5D7U A;  3VYH B;  2DER A;  2RB6 A;  1RUW A;  1VQ4 A;  1QVP A;  5CQY A;  3M9Q A;  4RTY A;  1WGS A;  1BBZ A;  3CMA Q;  2FEI A;  4F7U B;  3FB9 A;  4EDU A;  3GBQ A;  2YUQ A;  1TWB A;  1ZSZ A;  1D1C A;  2LJ3 A;  4C5I A;  5CKF A;  3MEV A;  2RM4 A;  3MO8 A;  2LRQ A;  4D6W A;  3OYG A;  4ZTF A;  4QQD A;  3LYI A;  1NJI C;  1D0Y A;  1UGQ B;  1ZHI A;  2GNC A;  1IRX A;  3DB3 A;  2DKG A;  4AFU C;  3M0S A;  4IUR A;  1MV0 B;  1TUC A;  3M56 A;  4IUU A;  4DEY A;  2F2V A;  4RKU E;  1LCK A;  4ELY C;  3VS2 A;  1KQS P;  2FPF A;  2GF7 A;  4PJO F;  1R0C B;  2ED0 A;  2CP0 A;  3OS0 A;  1XTD A;  1M8M A;  3M54 A;  4OMQ A;  3UAT A;  3X20 B;  3OBY A;  3QUI A;  1SHF A;  2L8D A;  1VQP Q;  4KUD K;  2O4X B;  2VVK A;  4JRK A;  1ZUU A;  2O9V A;  4LUE A;  2NWM A;  1VQP A;  2O01 E;  4Y91 A;  3VS0 A;  1I4K 1;  2V26 A;  1VYU A;  3OMG A;  1JXM A;  2DET A;  4M77 F;  3QWY A;  3G7Z A;  3VYG A;  1TUG B;  1Q81 U;  3FJ5 A;  1A0N B;  2E41 A;  2HBW A;  3PTA A;  1Q82 U;  1YJ9 T;  1E6G A;  2CUD A;  4A4H A;  2HNI A;  1WHM A;  1R77 A;  2CZ7 B;  4HA8 A;  5I21 A;  4BE2 A;  2K3B A;  2X4J A;  4C5E A;  3MP6 A;  1Q7Y U;  2DBK A;  4DEX A;  2PVD B;  2QTV A;  3LGL A;  1YHQ Q;  2OTL Q;  5GMK m;  2EYZ A;  5GAO q;  3L2U A;  3CC2 T;  4UC4 A;  2P0P A;  4OMM A;  1PWT A;  4M78 C;  1VQO Q;  3OYD A;  3LH0 A;  1JB0 E;  3CCU T;  2RI2 A;  2D0N A;  1TOV A;  1AD5 A;  3JCM b;  1N9R A;  2L5Q A;  1B34 A;  4FW1 A;  2F1L A;  1UEB A;  1QWE A;  4OGC A;  3CCL Q;  2XDD A;  4JRP A;  2EWN A;  3VS5 A;  3TU4 K;  2MPX C;  1N8R U;  4A4E A;  1VQ7 A;  2X3X D;  2DYB A;  2KAF A;  1AWJ A;  5CVI A;  4IIO A;  4DBR A;  1YN8 A;  4RTT A;  2QQR A;  4J9G A;  5GAO l;  1PM3 A;  1H3H A;  1RAC B;  4FT2 A;  2EVR A;  1BIA A;  1MMA A;  3JCM d;  3JCM g;  3CMA T;  3AHU A;  4LE9 A;  2QEX A;  3H0H A;  2EKH A;  3DLL A;  4DBH A;  1K73 R;  2KYM A;  4HCB A;  1MHN A;  4R55 A;  4IUP A;  3C94 A;  1M90 U;  1YIT A;  2GFU A;  4FYX B;  2CT3 A;  2HKQ B;  3G6E Q;  2A08 A;  2A3L A;  1RAD B;  2LX9 A;  2JM9 A;  4C8Q D;  5FU6 B;  1FYN A;  4M7A C;  2RN8 A;  5DLQ E;  5GAN f;  1ARK A;  3QBY A;  4LDX A;  1OV3 A;  3A5Z B;  4A53 A;  3EFR A;  1ZX6 A;  3P8H A;  2XDP A;  4BY6 C;  1MMN A;  4E7J A;  1YCY A;  3L2Z A;  2JTE A;  1WI7 A;  1XNI A;  2RD1 A;  4WF2 A;  4DBF A;  2HSP A;  2LQN A;  3JCM W;  4FSS A;  4LNP A;  2E3I A;  5GAO r;  3GPL A;  2HAX A;  2MWO A;  3CCE Q;  2CH4 A;  1FMV A;  2XHC A;  1W4S A;  4OB0 B;  3S3O A;  1VQN A;  2RH2 A;  1LNX A;  4KRT A;  1VQP T;  3JB9 I;  1VQK Q;  3EHR A;  4XTU A;  1Y96 B;  2DTO A;  3JB9 J;  1QWF A;  2K2M A;  2E65 A;  5GAN 7;  2AZV A;  1NYF A;  4PLL A;  1Y57 A;  4XTX A;  5GAM d;  5GAM g;  1Q81 C;  4XK8 E;  2XI9 A;  4HVU A;  2FB7 A;  3OSS C;  4PFP A;  2AZS A;  1Q82 C;  2HMA A;  1OZ3 A;  3BFM A;  1BK2 A;  4YTL A;  3HFO A;  2JW4 A;  1MV3 A;  1K4U S;  1N6A A;  4KGX B;  1HJD A;  3JB9 D;  2QA4 Q;  2VGM A;  5GAN h;  5GAN 4;  1Q7Y C;  2VGN A;  3CC4 A;  3CC7 Q;  2CZ1 B;  3FIF A;  3GLX A;  2QA4 A;  1YHQ T;  2OTL T;  1H8K A;  4WTO B;  2JTF A;  4F7U E;  1QCF A;  2FVU A;  1VQO T;  2VC8 A;  4M75 B;  4E7L A;  2MOX A;  1IRE B;  2O9S A;  4M77 B;  1WHH A;  4EMK B;  2EKO A;  2LC4 A;  2CP2 A;  1YI2 A;  3M0T A;  2EJG A;  3CPW P;  5KYY A;  2EFI A;  2ZPH B;  2O2O A;  5KE2 A;  4BE0 A;  2LVM A;  3REA B;  4PJM A;  2IPO B;  3CCL T;  4LXC A;  5LJ5 f;  3OSV A;  1C0M A;  1K1Z A;  1N8R C;  3I5S A;  4KUL A;  4PLI A;  3QKJ A;  1IHW A;  1WFW A;  2QXF A;  4JLG A;  2ED1 A;  5IHN A;  1OU9 A;  2RNA A;  1CKA A;  2EAY A;  2LT4 A;  1AWW A;  3HHT B;  1OQK A;  4C92 B;  4PFZ A;  4BD3 A;  3THK A;  1J3T A;  4RCC A;  4IUQ A;  1VQ9 Q;  5DM7 R;  3GF5 A;  1VYT A;  2H8H A;  4X1V A;  3OQ5 A;  1M90 C;  3JV3 A;  1IZ6 A;  2K5F A;  4RCB A;  1KJW A;  3G6E T;  4AFZ C;  4E2F B;  1G5V A;  1KSW A;  1M2V A;  3G4S T;  3HPW A;  2YUO A;  3O8V A;  1S72 Q;  4RG2 A;  3EGD B;  4IKF A;  3GOX A;  1IXD A;  2CP3 A;  2RJC A;  1XOV A;  5KYU B;  2P4R A;  4WCI A;  1QVG A;  2JS2 A;  1N9S A;  1V76 A;  1D1B A;  2EQK A;  1M9S A;  3SD4 A;  3I56 A;  4Z8A A;  1RAA B;  2E3H A;  3CCE T;  1WHJ A;  5KYX A;  4MZM A;  1OPL A;  3X28 B;  1VQK T;  3E2U A;  2RI5 A;  2CYZ B;  3QSU A;  2R5A A;  1RAF B;  1PC0 A;  1ZSZ C;  3RR6 A;  2NUZ A;  2ZPB B;  4PJO D;  4HCZ A;  2CZ6 B;  4FCY A;  3CCJ A;  3G71 A;  4RMO A;  1IGQ A;  2FL7 A;  1AEY A;  1B07 A;  1Z9Z A;  1V1C A;  3QZ9 B;  2KRO A;  1GCQ C;  3EFO B;  3GIB A;  3M53 A;  2ZPE B;  3SDZ A;  5LJ3 f;  1H64 1;  1UGV A;  1D09 B;  5D6X A;  1RLQ C;  1EZZ B;  2LJ0 A;  3V8J A;  2HL5 C;  2VUB A;  4JDS A;  2QA4 T;  4V2S A;  4J6W A;  4HCC A;  4M77 D;  1TG0 A;  4L59 A;  3ZBD A;  3CC7 T;  4OMN A;  4QQG A;  3KUF A;  4LD6 A;  2W10 A;  4J9C A;  3V8L A;  3JAM E;  2CS7 A;  4IUV A;  2X4X A;  5I2S A;  1PD1 A;  4JJD A;  1GL5 A;  3QZ5 B;  2LQ8 A;  2Y4Y A;  4RTZ A;  2EQM A;  3NPF A;  5GAM h;  1I0C A;  3V7S A;  2XG8 D;  4M7D B;  2RMO A;  1GXI E;  4F04 B;  5A0D A;  3JCM J;  4A54 A;  1E7O A;  1SG5 A;  1WX6 A;  2L89 A;  2OI3 A;  1WA7 A;  1WHG A;  3OYH A;  1UTI A;  4A4K A;  4L6V 5;  3WXM B;  3EAE A;  5CK9 A;  1NLO C;  3G1J A;  4D8D A;  1I8F A;  2VXE A;  2DBM A;  1PHT A;  4IUT A;  1VQ9 T;  1TH7 A;  5A0L A;  2DX1 A;  5LJ5 j;  3ZEH A;  3IQL A;  2JTM A;  3KXT A;  1ACM B;  2HQX A;  3QPH A;  3CCQ Q;  4O5V A;  1Y07 A;  5LJ5 e;  4FW2 A;  1S72 T;  2K6D A;  1BYM A;  3CCQ A;  2PVO B;  4MMK A;  1RAG B;  3OYN A;  4HCK A;  1TS9 A;  5KYW A;  3MEW A;  1JU5 C;  5D6Y A;  2CGH A;  4LDU A;  1QQJ A;  4OMO A;  1H3Z A;  2EYW A;  1MGQ A;  1K8A C;  3WVE B;  3ME9 A;  2DZC A;  2LDM A;  3HFN A;  1OI1 A;  2KE9 A;  3ER0 A;  4JJN K;  1JJ2 S;  3E19 A;  2MK5 A;  4M75 E;  1PCX A;  2K5L A;  1AWX A;  1YIJ Q;  1M1K U;  4QQ6 A;  3CD6 Q;  5FLX E;  3R6O A;  2ESW A;  4PJJ A;  4JRI A;  5AT1 B;  1OUL A;  3M58 A;  1QW1 A;  1KC8 R;  2LCL A;  2HBP A;  1G3S A;  2JM8 A;  4QKU A;  1RAH B;  2RQV A;  4FYV B;  1UG1 A;  3ZFJ A;  5CKD A;  2F5T X;  5A2Q E;  4C92 E;  1JXO A;  1K76 A;  1W2B S;  4FU6 A;  4HVV A;  3L2V A;  2ZCF B;  2ATC B;  2DRK A;  5GJW B;  2DE0 X;  3QJ6 A;  1NM7 A;  1HD3 A;  5I11 A;  3HRS A;  3A98 A;  4J9F A;  3A8G B;  2AIR B;  4EMG A;  3LWH A;  2RHX A;  2KEA A;  5LJ3 e;  2J05 A;  3E9F A;  2ZAE A;  4LDV A;  3CME A;  5IHI A;  2ZPF B;  3CPW S;  1M5Q 1;  3T9N A;  2COY A;  2EGC A;  5GMK l;  3HSB A;  1VQ4 Q;  5FW9 A;  5CCA A;  2C0O A;  2QDL A;  4II1 A;  3URG A;  5FU7 B;  1KD1 U;  2NUT A;  3OS5 A;  1G2B A;  3CCV A;  2RJF A;  3RKY A;  4A63 B;  4NS5 A;  2QQS A;  2WSF E;  4NL3 A;  3CCQ T;  2KNB B;  3S6W A;  5KCO A;  5J26 A;  2DPP B;  2MF2 A;  2FZG B;  3I55 A;  2NUP B;  2FZK B;  2O88 A;  3P8D A;  2QI2 A;  2GGR A;  2B86 A;  1GCQ A;  2Y4X A;  1WYX A;  4OB1 B;  2BE7 D;  1OX8 A;  2KDS A;  3LWI A;  2P0K A;  1UGP B;  1ZBX A;  1IHV A;  4C8Q B;  4JJC A;  5A0G A;  4KH1 B;  2BTT A;  3CXC P;  1QLY A;  2M0Y A;  5C6S A;  3S3M A;  2LTO A;  4Z02 A;  2HDA A;  4M78 F;  3CBO A;  1M1K C;  3L2W A;  2DFU A;  4E6R A;  1YIJ T;  3CD6 T;  3CCR A;  1BI1 A;  1D3B B;  3TSZ A;  2DMO A;  4M7D E;  1ZUY A;  3EH2 A;  4EMH A;  3EGX B;  1BU1 A;  2JNG A;  3PNW C;  1QCO A;  2V1R A;  2V8I A;  2DL5 A;  2KRN A;  3EFS A;  2DXC A;  3UDC A;  3P8B B;  1BKB A;  2K7A A;  1YJN Q;  4PKC C;  4EPC A;  2X35 A;  4GBQ A;  1QVG P;  4FM4 B;  1YJN A;  1VIE A;  5GAO p;  4AFS C;  2HCK A;  2I0N A;  3EGU A;  3J80 E;  3E1S A;  4BAC A;  4C0D C;  3FJP A;  4M7A F;  3MCA B;  2W0Z A;  2F2W A;  4QW2 A;  1QVF S;  2DZ9 A;  4XU3 A;  1HYO A;  1K0X A;  4DOV A;  1NJI R;  1EX4 A;  2XD0 A;  2SRC A;  3OS1 A;  4C0Z A;  3DKM A;  4O6J A;  1VQ7 Q;  3L2Q A;  2GTJ A;  2F2X A;  2YDL A;  5I2M A;  1YJW A;  3A1P A;  1XQH A;  1VQM A;  2EIF A;  3JB9 H;  1VQ4 T;  1UJY A;  1KIK A;  2ROL A;  1KD1 C;  3OYI A;  3U23 A;  2QEX Q;  1PSE A;  1K9A A;  2OJ2 A;  3BW1 A;  2CSQ A;  2J7I A;  4JZ3 A;  5AYF A;  1YIT Q;  4AG1 C;  4F14 A;  1G3Y A;  1V29 B;  5GAO n;  3VUZ A;  2X4W A;  5FRO A;  7AT1 B;  3C0C A;  1XJW B;  4F7U A;  3CCM A;  1I81 A;  4MDX A;  1JEG A;  2ZPG B;  1X2K A;  3EG0 A;  3MP1 A;  4OF1 A;  2FPD A;  2CUB A;  2DTI A;  4J83 A;  2X3W D;  2A28 A;  4PFO A;  2NUP A;  1S1N A;  1WXB A;  2FPE A;  4C5H A;  2K4Y A;  4X34 A;  2E6N A;  3OYA A;  3OYJ A;  5IT9 E;  3S3N A;  4BI4 A;  2BE9 B;  2COW A;  1VQN Q;  8ATC B;  4C92 C;  5DLO A;  2G6F X;  2F5K A;  4XAX B;  3I35 A;  4B9X A;  1VQ6 A;  1H92 A;  2O4X A;  2LX7 A;  2EYX A;  1X75 C;  1M1G A;  2LQW A;  4BI8 B;  2J06 A;  3SWN B;  1GBR A;  2IIM A;  3VS6 A;  1Q86 U;  3OA6 A;  4MZT A;  4PJO B;  1UDL A;  4M78 B;  3TCJ A;  3OYF A;  3CPF A;  4F7U G;  1OZ2 A;  1WLP B;  2DVE A;  1YJN T;  1X6O A;  2GQI A;  2Z0W A;  1GFD A;  3CC4 Q;  2VYT A;  4C0G A;  1OYX A;  3OS2 A;  1F1B B;  5EG2 A;  1NEB A;  4OMF B;  1BI2 A;  1HXD A;  2HD0 A;  4FSX A;  2YRV A;  1SEM A;  1YI2 Q;  3NTI A;  3PGG A;  3QII A;  2HKN A;  2DLP A;  1D0X A;  4BI3 A;  2P84 A;  3C4S A;  3V7C A;  2DL7 A;  1MMD A;  2O31 A;  2C0I A;  4AG2 C;  3OYL A;  4HT8 A;  1WXU A;  1BCM A;  3LLR A;  5CKH A;  2JXB A;  1VQ7 T;  4FT4 A;  3JCM f;  4KH0 B;  3CXC A;  3MPU B;  4CC7 A;  5CQX A;  4HXJ A;  1K9M U;  1KQ2 A;  4C8Q E;  4BB7 A;  3J81 E;  2EGA A;  1ZA1 B;  4B6M A;  2QEX T;  1ZSG A;  2C0T A;  2EJ9 A;  2K79 A;  2DVJ A;  3NHN A;  1QP3 A;  2KMT A;  2RJD A;  1IGU A;  1YIT T;  4N4H A;  1X69 A;  1WZO A;  2K2V A;  1TTH B;  2A37 A;  3PIO A;  4E7H A;  4KUI A;  3F70 A;  1Q81 R;  3QG1 A;  3E9G A;  1OX9 A;  1Q82 R;  4C5G A;  1SHG A;  1WNL A;  2DK3 A;  2QQ9 A;  3SEM A;  3J7A F;  3A8H B;  5FRN A;  2DXT A;  1W70 A;  1GCP A;  4P5N A;  2RQW A;  2RO0 A;  3EG1 A;  4KGZ B;  4ZGE B;  2IVW A;  3I56 Q;  1Q7Y R;  3CCS A;  1VQN T;  2DNU A;  3OMC A;  3JCM h;  2RHI A;  2JZ2 A;  2ABL A;  5GAM f;  3LGF A;  3TVT A;  1KQ1 A;  3VS1 A;  2L3S A;  2PTK A;  1KQS S;  4C0F A;  5GAN j;  2CP7 A;  2K9G A;  3CCJ Q;  3G71 Q;  2CRE A;  2M02 A;  1Y96 A;  2ENM A;  4M78 D;  4J6X A;  1Q86 C;  4RG8 A;  5GAN e;  1N8R R;  2DIL A;  2RHZ A;  3X26 B;  3V8K A;  2RPN A;  3RKX A;  3SWN A;  3M0Q A;  3VV0 A;  4Y92 A;  2ZZD A;  3CC4 T;  2BZ8 A;  5GMK i;  2ZGW A;  1YCS B;  5IXB A;  3SFM A;  1PG5 B;  4OML A;  2X9H A;  2VAS A;  1M90 R;  1M3A A;  1CSK A;  1YI2 T;  3BDL A;  3EG9 B;  2QAS A;  3VUB A;  1QKW A;  1T3L A;  4M75 A;  4M77 A;  4QVC A;  1SSH A;  4EMK A;  3QHS A;  2E70 A;  2BUD A;  2DJQ A;  4PJL A;  4M7A D;  1M8V A;  1K9M C;  5IAY A;  2BZY A;  3OW2 A;  2MCN A;  1YFN A;  2KSS A;  1I5O B;  2YHT A;  3VRZ A;  3RNJ A;  1D0Z A;  1NPR A;  3JCM V;  1UEC A;  2QGG A;  3OYM A;  3FLG A;  1JJ2 A;  1VQ8 A;  2KBT A;  4C92 A;  2HQH A;  4RTW A;  4RTX A;  2FG0 A;  4LDY A;  2OAW A;  2JMC A;  4HT9 A;  1U8R A;  3BY7 A;  2LNH B;  2PUK B;  2E5K A;  4KGV B;  2FHD A;  1U3O A;  1PD0 A;  1KK7 A;  5J3B A;  2EYQ A;  1KHC A;  2OTJ A;  2OX7 A;  1VQL A;  2OAU A;  2QG9 B;  1B3Q A;  1SKU B;  4PJO E;  2LP5 A;  3FEO A;  4M78 E;  2EQU A;  5GMK h;  3EGD A;  3I56 T;  4J7F A;  2MIO A;  4M75 G;  1FWZ A;  5KYU A;  4M77 G;  3FRN A;  3M59 A;  4RTU A;  1YP5 A;  3OYY A;  2AK5 A;  1TXQ A;  3OY9 A;  1WIE A;  1EIF A;  1T3S A;  3EHQ A;  3RIR A;  3OYC A;  3ZL7 C;  1X6G A;  4LDW A;  3RUX A;  3MEA A;  5GAN 8;  1Z9Q A;  4M77 E;  2A0F B;  3CCJ T;  1GBQ A;  3G71 T;  3INZ A;  3VU3 C;  2RA2 A;  1G83 A;  2L2P A;  3VS7 A;  4ZN3 A;  3X24 B;  3M0P A;  2RHY A;  4C92 G;  5GAM j;  2WSC E;  3EFO A;  2V8K A;  4XTW A;  2KQW A;  2AHJ B;  2CH4 W;  1ZUK A;  3D7S B;  4N0A A;  2KYB A;  5HCK A;  4XTV A;  4J9I A;  5GAM e;  2E1H A;  1JBM A;  2XIC A;  4A4G A;  1K73 U;  3RES A;  5GAN 3;  2XID A;  2EYY A;  4FYY B;  4OB3 B;  1M2O A;  3UF4 A;  5LJ3 j;  3A8O B;  1FMK A;  2GQV A;  2D6F A;  2DRM A;  3EG9 A;  4ANJ A;  2SEM A;  3M57 A;  3GNG A;  1YJ9 A;  2LZ6 B;  2CSI A;  3CME Q;  1TUD A;  4Y28 E;  9ATC B;  3JCM X;  4M7D A;  3QYH B;  2JT4 A;  2XKO C;  2YT6 A;  4JS5 A;  3X25 B;  1QKX A;  2LMJ A;  1UHF A;  2XDB A;  2R5M A;  3MP8 A;  1K8A R;  5HK0 A;  2KI7 A;  2K3X A;  1LPL A;  3MKD A;  2JMA A;  2Y90 A;  1B34 B;  4MML A;  1U1T A;  3CBP A;  6AT1 B;  3VRY A;  2J6F A;  3CCV Q;  2GTO A;  4PNO A;  1TU0 B;  2RK2 A;  3N5B B;  4ESR A;  2L0A A;  5LL6 S;  1UE9 A;  1LVK A;  3JSC A;  3PFS A;  4MDW A;  1U1S A;  2DIG A;  2RQT A;  5CR2 A;  2DIQ A;  1X6B A;  2HZY A;  2M16 A;  3OYB A;  4E7K A;  1VUB A;  2DAQ A;  2RK1 A;  3I55 Q;  2WSE E;  4J7I A;  3PMI A;  1FXX A;  5IXF A;  2E6Z A;  4OVA A;  1ABQ A;  1M1F A;  4ORZ A;  1BCO A;  2YWW A;  2MMP A;  3JRZ A;  4QVD A;  2QQA A;  4J9B A;  1JO8 A;  1RAB B;  3CMA A;  2DO3 A;  1AT1 B;  3PT9 A;  1G3W A;  1TSF A;  4JRQ A;  3RKW A;  1WDX A;  4F17 A;  3EH1 A;  2FRY A;  4MZP A;  4OGE A;  4M7D G;  4BDZ A;  1PNJ A;  3CCR Q;  1BI0 A;  1WJQ A;  4PK4 A;  2JJ9 A;  3RDV A;  2YLC A;  5L23 A;  4X9C A;  3KBG A;  1KHI A;  3UWN A;  1QVF A;  2DYI A;  2E12 A;  4OB2 B;  1UB4 A;  1G8X A;  5GAN g;  5GAN d;  1QCN A;  5FU6 C;  4XU1 A;  4J5Y A;  4XTZ A;  1WPY A;  2J6K A;  4B9W A;  4XU0 A;  2CZ0 B;  3SHW A;  2LNV A;  3MET A;  1K73 C;  3L42 A;  3MEU A;  3TEE A;  2DXU A;  4OMP A;  1SRM A;  4M75 F;  3V7R A;  1JRI A;  2D0Q B;  1PRL C;  1AVZ C;  3OBW A;  3NTH A;  3CBM A;  2LJ1 A;  2HEQ A;  3DLM A;  3RBB B;  2BZX A;  5D6W A;  3CME T;  1KG1 A;  3SWN C;  2EJF A;  1YJW Q;  1CKB A;  5ECA A;  3LH5 A;  4VUB A;  1VQM Q;  4J9H A;  3H0I A;  4PJO C;  2F69 A;  5KYN A;  3TRE A;  5KH6 A;  1YHQ A;  2OTL A;  1NZ9 A;  3VKI A;  4C92 F;  4N4I A;  5KYY B;  2QAZ A;  1VQO A;  2KGT A;  3CCV T;  4ZN1 A;  1M1K R;  2DD4 A;  1Y71 A;  1AWO A;  4LN2 A;  3QYG B;  2M0O A;  2LCS A;  1D1A A;  5L8R E;  3HP9 A;  4Q5W A;  4BUG A;  2R57 A;  5FRM A;  2XK0 A;  1NYG A;  1YNZ A;  1B7T A;  2YRD A;  2G3R A;  3BE3 A;  3CCM Q;  3CCL A;  2ROT A;  5J39 A;  4M75 C;  3VS4 A;  4M77 C;  5KCH A;  1BI3 A;  3I55 T;  4EMK C;  1JQQ A;  4N4G A;  1PSF A;  5EC7 A;  2RI3 A;  5LJ5 d;  5LJ5 g;  2K57 A;  2D8H A;  1VOM A;  4XQ3 A;  1VQ5 Q;  2A7Y A;  3NMZ C;  3ULR B;  1OU8 A;  1HK9 A;  2C06 A;  1VQ5 A;  1M2V B;  4TVR A;  2EQJ A;  1UFF A;  3JCM c;  2FZC B;  5DY9 A;  3OW2 P;  8AT1 B;  5CO7 A;  4DOW A;  4C8Q A;  3G4S Q;  3G6E A;  2K3Y A;  4GLK A;  2AKL A;  3HKS A;  3HTR A;  3CCR T;  2CT4 A;  2YUN A;  1PKT A;  4ZGJ B;  4FL6 A;  3G4S A;  1IO6 A;  1VQ6 Q;  1UHC A;  4Z88 A;  4R56 A;  5HKC A;  4E47 A;  5HY6 A;  1AOJ A;  4JUV A;  1JJ2 P;  3NFC A;  2D1X A;  3NGP A;  3EG3 A;  2DF6 A;  2YLB A;  1VIF A;  4PJN A;  5KYX B;  4J8O A;  1RAI B;  1WJR A;  2XU8 A;  1SF9 A;  1D3B A;  1QMC A;  1M27 C;  4ZNX A;  1ZA2 B;  2B8A A;  1X27 A;  4J6Y A;  3EGX A;  3CCE A;  3HRT A;  4C0D B;  1KD1 R;  1VQK A;  2YSQ A;  3JCM P;  1RAE B;  1NE8 A;  2DEQ A;  1WQW A;  5HK3 A;  1G3T A;  4LUD A;  2A36 A;  2DL4 A;  2VKN A;  1IB8 A;  1UJ0 A;  1YWP A;  2V8J A;  3MHX A;  1WQ7 A;  4OP0 A;  1BB9 A;  2FYK A;  4AMC A;  1SPK A;  4RUG A;  1WJS A;  1W2B P;  4M7D F;  2RHU A;  2GBQ A;  1P92 A;  5I22 A;  1MND A;  1DJ7 B;  2BIV A;  3RMQ A;  4M4Z A;  3LW5 E;  2PVG B;  4NL2 A;  1LJO A;  3OB9 A; 
#chains in the Genus database with same CATH homology
 3PMT A;  3A8L B;  5CAI A;  2PVD B;  3LGL A;  4M75 A;  2JVV A;  5CKE A;  5GMK m;  5LJ3 d;  4M77 A;  4QVC A;  5LJ3 g;  5GAO q;  3L2U A;  1YJW T;  3CC2 T;  4UC4 A;  2P0P A;  3HRS A;  1VQM T;  4EMK A;  3QHS A;  3CC7 A;  4M78 C;  2E70 A;  3A8G B;  4EMG A;  3LWH A;  3OYD A;  2RHX A;  2BUD A;  4BE1 A;  3LH0 A;  1JB0 E;  4QVZ A;  3CCU T;  2RI2 A;  5LJ3 e;  3M55 A;  5GAO m;  4M7A D;  1M8V A;  3C12 A;  3E9F A;  5IAY A;  4N0A C;  3OW2 A;  3OYE A;  1K9M C;  2E10 A;  4LDV A;  3JCM b;  1N9R A;  1O75 A;  3L2R A;  3CC2 A;  2L5Q A;  2KSS A;  3CME A;  1B34 A;  2ZPF B;  3QDR B;  3CPW S;  1M5Q 1;  2YHT A;  1UEB A;  4OGC A;  4M7A B;  3T9N A;  2KY9 A;  2XDD A;  4JRP A;  1M4Z A;  2EWN A;  5GMK l;  3HSB A;  3HRU A;  1NPR A;  2MI6 A;  3TU4 K;  3JCM V;  1N8R U;  4A4E A;  5CCA A;  4JS4 A;  1VQ7 A;  3CCM T;  5GAN 6;  2KAF A;  3ASK A;  3FLG A;  5CVI A;  3OYM A;  1JJ2 A;  1VQ8 A;  4BY6 B;  4II1 A;  3URG A;  5FU7 B;  4C92 A;  1KQS A;  2QQR A;  1KD1 U;  5GAO l;  4LDY A;  1KC8 U;  3OS5 A;  3CCV A;  4ME7 A;  4HT9 A;  4NL2 A;  1U8R A;  3BY7 A;  2PUK B;  4FT2 A;  1BIA A;  2RJF A;  3RMS A;  3JCM d;  3JCM g;  3CMA T;  3AHU A;  2FHD A;  3RKY A;  4NS5 A;  2QEX A;  4M7D C;  5J3B A;  1VQ5 T;  2QQS A;  4C8Q G;  4XTY A;  2EYQ A;  1KHC A;  2H3J A;  3DLL A;  2OTJ A;  2WSF E;  4NL3 A;  3QXE B;  3CCQ T;  4HCB A;  1MHN A;  3S6W A;  4R55 A;  5KCO A;  1VQL A;  2OAU A;  4IUP A;  3C94 A;  1M90 U;  5J26 A;  1YIT A;  2DPP B;  2GFU A;  1VQ9 A;  4PJO E;  2MF2 A;  3FEO A;  4M78 E;  3I55 A;  2EQU A;  2A3L A;  5GMK h;  4X9D A;  3JB9 G;  2LX9 A;  1K73 C;  1AHJ B;  3FDR A;  3I56 T;  3P8D A;  2QI2 A;  4J7F A;  4C8Q D;  5FU6 B;  2Y4X A;  4M7A C;  4M75 G;  1FWZ A;  4OB1 B;  2RJE A;  4M77 G;  5DLQ E;  5GAN f;  2KDS A;  3QBY A;  4LDX A;  3FRN A;  3LWI A;  2P0K A;  3M59 A;  4HKE A;  3A5Z B;  1UGP B;  4A53 A;  1VQ6 T;  3EFR A;  1ZBX A;  3OYY A;  3P8H A;  4C8Q B;  5A0G A;  2QDY B;  2XDP A;  1S72 A;  4BY6 C;  4E7J A;  1YCY A;  3L2Z A;  3OY9 A;  3CXC S;  1BIB A;  5C6S A;  3S3M A;  1EIF A;  1XNI A;  2LTO A;  2RD1 A;  4WF2 A;  4Z02 A;  3RIR A;  3OYC A;  4M78 F;  2QTX A;  3JCM W;  3CBO A;  4LDW A;  3RUX A;  2IG0 A;  3Q1J A;  3MEA A;  5GAN 8;  4M77 E;  3FC3 A;  2GCX A;  3UPU A;  3GPL A;  2DXB A;  5GAO r;  2MWO A;  3CCJ T;  1M1K C;  3G71 T;  3L2W A;  2HAX A;  5GAN 5;  4OB0 B;  2XHC A;  1W4S A;  3INZ A;  5LJ5 h;  3S3O A;  1YIJ T;  3CD6 T;  2LCC A;  1VQN A;  2RH2 A;  3VU3 C;  3CCR A;  1BI1 A;  2RA2 A;  1LNX A;  3GNF B;  1VQP T;  3JB9 I;  1QP2 A;  4ZN3 A;  4XTU A;  3X24 B;  1K8A U;  2RHY A;  1D3B B;  1Y96 B;  2LT1 A;  2DTO A;  4FIB A;  3JB9 J;  2M1H A;  3WVD B;  3RER A;  4M7D E;  4C92 G;  2E65 A;  4EMH A;  5GAN 7;  4PLL A;  2JNG A;  4PJO A;  4XTX A;  5GAM j;  2WSC E;  3PNW C;  4M78 A;  2V8K A;  5GAM d;  5GAM g;  4XTW A;  4XK8 E;  1Q81 C;  2KQW A;  2XI9 A;  3DB4 A;  1NPP A;  2FB7 A;  3OSS C;  2AHJ B;  2MAM A;  2V8I A;  3EFS A;  1Q82 C;  2DXC A;  4N0A A;  1OZ3 A;  3BFM A;  4XTV A;  3UDC A;  5GAM e;  2E1H A;  4JLI A;  1JBM A;  4YTL A;  2XIC A;  1BKB A;  3P8B B;  4A4G A;  1K73 U;  3RES A;  3HFO A;  5GAN 3;  4PKC C;  4EPC A;  2PQW A;  2XID A;  2M9U A;  2X35 A;  1N6A A;  4FM4 B;  3BDU A;  3M5A A;  3JB9 D;  1O9S A;  3CEY A;  5C0M A;  1YJN A;  1QVG S;  2DD5 A;  4OB3 B;  1VIE A;  2VGM A;  2NLU A;  5GAN h;  5GAN 4;  5GAO p;  1Q7Y C;  2VGN A;  3LX7 A;  3CC4 A;  4M75 D;  5LJ3 j;  2CZ1 B;  3A8O B;  3FIF A;  3GLX A;  3NTK A;  2ZPI B;  2QA4 A;  2JUF A;  3J80 E;  1X01 A;  2GQV A;  3E1S A;  1YHQ T;  2OTL T;  2PU9 B;  4BAC A;  2D6F A;  2JOY A;  4C0D C;  5GAN 2;  3FJP A;  2JTF A;  3M57 A;  4KT0 E;  4F7U E;  3GNG A;  3SB2 A;  4M7A F;  3MCA B;  1YJ9 A;  4QW2 A;  1QVF S;  2DZ9 A;  2FVU A;  2VC8 A;  4M75 B;  4XU3 A;  1VQO T;  4E7L A;  5KE3 A;  1IRE B;  4M77 B;  4Y28 E;  4DOV A;  1N27 A;  4XU2 A;  4EMK B;  4NOY A;  3JCM X;  4M7D A;  2EKO A;  2LC4 A;  2XKO C;  3QYH B;  4CRI A;  2XD0 A;  1YI2 A;  4JS5 A;  3OS1 A;  3X25 B;  2EJG A;  4L5G A;  3L1A A;  4C0Z A;  3DKM A;  2WAC A;  2EFI A;  2ZPH B;  4O6J A;  5KE2 A;  2XDB A;  2R5M A;  4BE0 A;  2LVM A;  3MP8 A;  3L2Q A;  3CCL T;  5HK0 A;  5I2M A;  5LJ5 f;  3OSV A;  1YJW A;  2K3X A;  1XQH A;  1VQM A;  2EIF A;  2Y90 A;  4MML A;  1B34 B;  1N8R C;  4KUL A;  4PLI A;  3QKJ A;  4F7U F;  1VQ4 T;  3JB9 H;  1U1T A;  3CBP A;  2QXF A;  4JLG A;  4PNO A;  4M7A A;  4C92 D;  2R58 A;  2X4Y A;  5CKB A;  1KD1 C;  2RK2 A;  3OYI A;  3N5B B;  4ELZ C;  1KC8 C;  2L3R A;  4ATO A;  5LL6 S;  4PJO G;  1PSE A;  2EAY A;  3BW1 A;  4M78 G;  1ZQ1 A;  2P4T A;  3OYK A;  2LT4 A;  3HHT B;  3JSC A;  4C92 B;  3PFS A;  4BD3 A;  4MDW A;  1U1S A;  2DIG A;  5AYF A;  5LJ3 h;  5CR2 A;  2DIQ A;  4RCC A;  4IUQ A;  1G3Y A;  1V29 B;  3JCM Q;  3OYB A;  2M16 A;  5DM7 R;  5GAO n;  4E7K A;  1VUB A;  2DAQ A;  2RK1 A;  2X4W A;  3GF5 A;  3QJY A;  5FRO A;  3VUZ A;  3JCM e;  3PIP A;  2WSE E;  3OQ5 A;  4J7I A;  2I2L A;  4F7U A;  3CCM A;  1M90 C;  1IZ6 A;  3PMI A;  1FX7 A;  1FXX A;  1I81 A;  4MDX A;  2K5F A;  3UT1 A;  3CCS T;  1RI0 A;  4RCB A;  2E6Z A;  4C8Q F;  3G6E T;  3M4G A;  4OVA A;  1M1F A;  1UGR B;  2D9T A;  2ZPG B;  1G5V A;  4ZGD B;  2MMP A;  3JRZ A;  3MP1 A;  4QVD A;  2QQA A;  4OF1 A;  2DTI A;  4J83 A;  3G4S T;  5CIU A;  3HPW A;  1LOJ A;  3CMA A;  3O8V A;  2DO3 A;  2LQK A;  2QQB A;  4RG2 A;  2PUO B;  3PT9 A;  1G3W A;  4IKF A;  3GOX A;  4JRQ A;  3RKW A;  1W2B A;  2RJC A;  1XOV A;  5FU7 C;  4C5H A;  2K4Y A;  4MZP A;  2KVQ G;  4OGE A;  2E6N A;  4X34 A;  3OYA A;  3OYJ A;  5IT9 E;  1QVG A;  3S3N A;  4BI4 A;  1N9S A;  4M7D G;  3OW2 S;  4BDZ A;  1I5L A;  2EQK A;  1NJI U;  1BI0 A;  1M9S A;  1Q7Y U;  1WJQ A;  3SD4 A;  3I56 A;  4C92 C;  5DLO A;  2E5Q A;  3CCE T;  2F5K A;  1UGS B;  2YLC A;  4XAX B;  5M9O A;  4MZM A;  4X9C A;  3KBG A;  4LD9 K;  1KHI A;  2MWP A;  3UWN A;  2GFA A;  3X28 B;  4A4F A;  4E7I A;  4B9X A;  1VQK T;  1QVF A;  1VQ6 A;  2E12 A;  4M7A G;  4OB2 B;  2RI5 A;  2CYZ B;  2O4X A;  3HL8 A;  1YBY A;  3QSU A;  2R5A A;  1UB4 A;  5GAN d;  5GAN g;  3GIB A;  1X75 C;  1M1G A;  2ZPB B;  5FU6 C;  4BI8 B;  4PJO D;  4HCZ A;  3SWN B;  4XU1 A;  4J5Y A;  3CPW A;  2CZ6 B;  4XTZ A;  2VV5 A;  1Q86 U;  1WPY A;  3CCJ A;  3G71 A;  4B9W A;  2FL7 A;  4RMO A;  1YIJ A;  4XU0 A;  2CZ0 B;  4MZT A;  3OA6 A;  3CD6 A;  3GP8 A;  2DTH A;  4C8Q C;  3QZ9 B;  4PJO B;  4M7A E;  4M78 B;  3TCJ A;  2LNV A;  4KBM B;  3M53 A;  2ZPE B;  3MET A;  3SDZ A;  2VXF A;  3CPF A;  3L42 A;  2CKK A;  5LJ3 f;  1H64 1;  3MEU A;  4F7U G;  3TEE A;  2DXU A;  1OZ2 A;  5D6X A;  3JB9 F;  3H6Z A;  2DVE A;  2HQE A;  1YJN T;  1X6O A;  5IN1 A;  1R8O B;  4DA4 A;  2VYT A;  3V8J A;  4M75 F;  3V7R A;  1JRI A;  3VJP A;  2D0Q B;  4C0G A;  2VUB A;  1OYX A;  4JDS A;  2QA4 T;  4V2S A;  3OS2 A;  3OBW A;  4J6W A;  4HCC A;  2JN0 A;  3NTH A;  3CBM A;  4M77 D;  2K5I A;  4L59 A;  3ZBD A;  3CC7 T;  5EG2 A;  4QQG A;  3DLM A;  3KUF A;  4OMF B;  4LD6 A;  1BI2 A;  1Y7X A;  1HXD A;  2HD0 A;  4FSX A;  2YRV A;  3V8L A;  3JAM E;  2CS7 A;  3NTI A;  5D6W A;  3PGG A;  3QII A;  4DQ2 A;  4IUV A;  3CME T;  4BI3 A;  2X4X A;  3C4S A;  3QO3 A;  3V7C A;  5I2S A;  3OYL A;  4M7D D;  1KG1 A;  4HT8 A;  3QZ5 B;  3SWN C;  4CI0 C;  2LQ8 A;  2Y4Y A;  2EJF A;  2EQM A;  4VUB A;  5GAM h;  3V7S A;  2KK4 A;  2XG8 D;  3LLR A;  4M7D B;  5CKH A;  1VQ7 T;  4PJO C;  2F69 A;  1GXI E;  4FT4 A;  3TRE A;  5A0D A;  5KH6 A;  3JCM J;  3C95 A;  1YHQ A;  1VQ8 T;  2OTL A;  4A54 A;  3JCM f;  1NZ9 A;  3VKI A;  4C92 F;  1RL2 A;  2L89 A;  4N4I A;  3CXC A;  4BDY A;  5CQX A;  5GMK j;  1VQO A;  3CCU A;  3CCV T;  1K9M U;  1KQ2 A;  4ZN1 A;  4C8Q E;  4BB7 A;  3J81 E;  2DD4 A;  2DJZ A;  3OYH A;  4A4K A;  2BKD N;  3M4Y A;  4L6V 5;  3WXM B;  3EAE A;  3QYG B;  4GY5 A;  2QEX T;  2M0O A;  5L8R E;  5GMK e;  3HP9 A;  4Q5W A;  3A8M B;  3H8Z A;  4BUG A;  5CK9 A;  4ZTJ A;  2OTJ T;  2EJ9 A;  2R57 A;  2E64 A;  5FRM A;  1QP3 A;  2XK0 A;  4PL6 A;  1VQL T;  2G3R A;  2KMT A;  1I8F A;  3CCL A;  2VXE A;  2P0Q A;  2RJD A;  5J39 A;  4IUT A;  4M75 C;  1SSF A;  4N4H A;  1YIT T;  1VQ9 T;  4M77 C;  3VYH B;  5KCH A;  1BI3 A;  2K2V A;  2RB6 A;  3I55 T;  1TH7 A;  1VQ4 A;  4EMK C;  1QVP A;  4N4G A;  5CQY A;  3M9Q A;  3PIO A;  1PSF A;  1WGS A;  4KUI A;  5A0L A;  4E7H A;  3F70 A;  5LJ5 j;  2RI3 A;  3QG1 A;  5LJ5 g;  5LJ5 d;  3ZEH A;  2K57 A;  3E9G A;  4C5G A;  2JTM A;  3KXT A;  4F7U B;  3FB9 A;  2HQX A;  4XQ3 A;  2A7Y A;  1WNL A;  3QPH A;  2DK3 A;  2QQ9 A;  4EDU A;  3J7A F;  3A8H B;  1HK9 A;  4O5V A;  5FRN A;  1Y07 A;  2DXT A;  5LJ5 e;  1S72 T;  2C06 A;  1VQ5 A;  1BYM A;  4P5N A;  2RO0 A;  3CCQ A;  4TVR A;  4C5I A;  2PVO B;  5CKF A;  2EQJ A;  3MEV A;  4MMK A;  4ZGE B;  2RM4 A;  3MO8 A;  3JCM c;  2LRQ A;  5DY9 A;  4D6W A;  3OYG A;  2IVW A;  3OYN A;  4ZTF A;  3CCS A;  4QQD A;  3LYI A;  5CO7 A;  1NJI C;  4DOW A;  4C8Q A;  3G6E A;  2K3Y A;  3HKS A;  1UGQ B;  1ZHI A;  4GLK A;  3CCR T;  1VQN T;  3MEW A;  5D6Y A;  2CGH A;  3DB3 A;  2DKG A;  4LDU A;  4ZGJ B;  3OMC A;  4FL6 A;  4IUR A;  3JCM h;  3G4S A;  1H3Z A;  2RHI A;  2JZ2 A;  3OYF A;  4R56 A;  3M56 A;  1MGQ A;  4E47 A;  3WVE B;  4IUU A;  5GAM f;  5HKC A;  3LGF A;  1K8A C;  3ME9 A;  2DZC A;  5HY6 A;  2LDM A;  1KQ1 A;  4JUV A;  3HFN A;  3NFC A;  1OI1 A;  4RKU E;  3ER0 A;  4ELY C;  4JJN K;  1JJ2 S;  1KQS S;  2GF7 A;  3E19 A;  4PJO F;  2YLB A;  4C0F A;  5GAN j;  1VIF A;  3OS0 A;  1XTD A;  3M54 A;  4J8O A;  3X20 B;  1WJR A;  2XU8 A;  4M75 E;  2K5L A;  3OBY A;  1D3B A;  1Y96 A;  3QUI A;  4M78 D;  4QQ6 A;  2L8D A;  4J6X A;  1M1K U;  1Q86 C;  4KUD K;  2O4X B;  4RG8 A;  2B8A A;  5GAN e;  4J6Y A;  5FLX E;  3R6O A;  3CCE A;  2RHZ A;  4JRK A;  3X26 B;  3V8K A;  4JRI A;  1VQP A;  3HRT A;  4C0D B;  3M58 A;  3RKX A;  2O01 E;  3SWN A;  1QW1 A;  4Y91 A;  1I4K 1;  2LCL A;  1VQK A;  3VV0 A;  3JCM P;  1NE8 A;  2DEQ A;  3OMG A;  1WQW A;  5HK3 A;  1G3T A;  2ZZD A;  2HBP A;  1G3S A;  3CC4 T;  4M77 F;  5GMK i;  3G7Z A;  2V8J A;  3MHX A;  3VYG A;  1Q81 U;  2ZGW A;  2E41 A;  1WQ7 A;  4OP0 A;  3ZFJ A;  5CKD A;  3PTA A;  2FYK A;  2F5T X;  1Q82 U;  1WJS A;  3SFM A;  5A2Q E;  1YJ9 T;  4A4H A;  2HNI A;  4C92 E;  1W2B S;  2CZ7 B;  4FU6 A;  4HA8 A;  3L2V A;  4M7D F;  2ZCF B;  2RHU A;  5I21 A;  4BE2 A;  1P92 A;  1YI2 T;  1DJ7 B;  2BIV A;  3BDL A;  3RMQ A;  3LW5 E;  2X4J A;  3QJ6 A;  4C5E A;  3VUB A;  2PVG B;  1Y71 A;  3MP6 A;  1LJO A;  3OB9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...