3JCMb

Cryo-em structure of the spliceosomal u4/u6.u5 tri-snrnp
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
65
structure length
65
Chain Sequence
ATLKDYLNKRVVIIKVDGECLIASLNGFDKNTNLFITNVFNRISKEFICKAQLLRGSEIALVGLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The 3.8 angstrom structure of the U4/U6.U5 tri-snRNP: Insights into spliceosome assembly and catalysis
pubmed doi rcsb
molecule tags Transcription
molecule keywords Pre-mRNA-splicing factor 8
total genus 11
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2015-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
b PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3jcmb00
3V7SA 2FB7A 1M5Q1 1JRIA 3JB9F 3BY7A 1WQ7A 4C8QA 2E65A 1Y96B 3RUXA 4PJOD 4C92F 4M78D 2E1HA 2VXFA 4M75F 3JCMX 5GAN7 3JB9D 4X9CA 4MMLA 3AHUA 5LJ5f 1H641 4PJOA 4PJOG 1D3BA 4PJOF 4N0AC 2DJZA 2DTIA 2I2LA 4M77B 4M75D 4XTWA 5LJ5e 5GAN3 5GAOr 3V8JA 4PJOC 5GMKh 3BW1A 3JCMe 4J5YA 5LJ3j 3JCMc 2VXEA 5LJ5d 3HFOA 4N0AA 2VC8A 3JCMV 3JCMd 5LJ5j 4C8QG 5GAMh 1TH7A 5GANg 3PGGA 3QSUA 5GANj 3JCMg 3SB2A 3RKWA 1LJOA 4M7DD 4F7UE 5GMKm 5LJ5g 4QVCA 2DVEA 3L1AA 2EJFA 4XTYA 4M7DA 5LJ3g 3JB9J 4M7DF 4J6XA 4M75B 4M77D 2Y90A 1B34A 2DXTA 4XU0A 4M75E 4QVDA 3FB9A 3RKYA 5LJ3e 5GAN2 5GANf 5GAN5 1I81A 2YLBA 4XU2A 4MMKA 1Y96A 2E64A 4M7AD 3INZA 3JCMf 5GAMf 4M77G 5GAOn 4OP0A 1N9RA 5GANe 4M78E 4F7UA 4PJOB 1M8VA 5GAOm 2EJ9A 4XTVA 1BIBA 5GANd 3QUIA 5GAMe 1U1TA 2ZGWA 1BIAA 2RM4A 5GMKl 1YCYA 3FIFA 4XQ3A 4XU1A 3RESA 1HK9A 2RD1A 3SWNC 4EMKA 5GAMj 4PNOA 4WF2A 4HA8A 3HSBA 3HFNA 4A54A 4C92G 1B34B 4A53A 4M7AB 5DY9A 3EFSA 4J6WA 3SWNA 4EMKC 4M78A 3JCMP 4M7AG 3BFMA 4M75C 4M78F 3V8KA 2DEQA 4XTZA 2EWNA 1WPYA 5GMKi 4M78C 4C92C 1X01A 1WNLA 4M75A 3V7RA 4V2SA 1LOJA 2FYKA 4M78B 5GAOp 4C8QF 4M7DB 2DZ9A 4PJOE 4C92A 3FJPA 5GAMg 2E10A 5GANh 2QTXA 5GAOl 4J6YA 4F7UB 5CAIA 2DKGA 4C8QD 5GAN6 2YHTA 5I21A 5GAOq 3JB9G 5LJ3h 3RERA 4M77C 5GMKj 1I8FA 1U1SA 4JRIA 2DTHA 4M75G 4NL2A 2K57A 2DXUA 4M77A 1N9SA 5LJ3d 4RCBA 4JLIA 3GIBA 4JRKA 4M77F 4EMHA 2EAYA 4JUVA 3V8LA 1LNXA 1HXDA 2EJGA 3RKXA 4HT9A 3EFRA 4C8QB 2RB6A 4Y91A 4C8QE 3QO3A 3JCMh 5GMKe 5GAMd 3JCMW 5LJ5h 3JCMb 4HT8A 2CGHA 4XTUA 4F7UF 2JN0A 5GAN8 2HNIA 2YLCA 4F7UG 1I4K1 5GAN4 4M7DC 3JCMQ 2DZCA 2RA2A 3BDUA 3JB9H 4DQ2A 3L2ZA 5LJ3f 3RIRA 4M7AF 1MGQA 4M7AE 1D3BB 4M7DG 4M78G 4M7AA 4NOYA 3V7CA 3VU3C 4X9DA 4NL3A 1JBMA 4XTXA 3M4GA 3QHSA 3JB9I 4M7AC 4RCCA 4XU3A 1I5LA 4EMGA 4M77E 1WQWA 3SWNB 1KQ1A 4M7DE 1KQ2A 2DTOA 3JCMJ 4C92E 4C8QC 4C92D 4C92B 2E41A 4EMKB
chains in the Genus database with same CATH superfamily
4D8KA 2RJCA 3S6WA 5D7UA 2GF7A 4M75F 3JB9D 4X9CA 1VQ6A 2X3XD 2DTIA 2I2LA 5HKCA 1UDLA 3M5AA 4BI8B 4FW2A 4N0AA 3CCQQ 4E7ZA 3PGGA 3Q1JA 2NUPB 1UECA 2EJFA 3I56A 3OYJA 2RQWA 5KYUA 3PIPA 2QK0A 4M77D 1FMKA 3FB9A 4J83A 5KYWB 1K9MU 1M2VB 2NUTA 2XHCA 2EQJA 1S72Q 2DL7A 4IUTA 3QIIA 4PJOB 2E70A 2A36A 3R6NA 4BB7A 1KJWA 4JJBA 1PKSA 4HA8A 5DY9A 4CC3A 1G8XA 1VQ8Q 1H3HA 2DEQA 1WPYA 1K8AC 2RH2A 3CMAA 3LWHA 4J7FA 2E3IA 3EHQA 4NS5A 1I07A 1VQMA 1Q7YR 2PUKB 2V26A 1M30A 1QVGS 2DXUA 2ZPEB 3G7ZA 3CCEA 4JJNK 2MIOA 2QDLA 3CEYA 2GQIA 2PZ1A 3OYBA 1VQ4A 3IQLA 4CC7A 3G1JA 4JPBW 5C6SA 4J9DA 1YJWA 1W6XA 1PKTA 2QQBA 5A0GA 1LVKA 3M53A 1AOJA 1WJRA 2X4WA 2JS2A 4M7AE 1H92A 1K1ZA 4YTLA 1X43A 1IREB 3VS7A 4QT7A 3J80E 2PNIA 1KQ2A 2GGRA 1GCQA 1M1GA 2RJEA 3QWXX 4ZTFA 2YRVA 3GF5A 4C92D 1VQLQ 1NPRA 1QVFS 1G83A 2AK5A 2QQSA 3AT1B 1I0CA 2RHXA 2X35A 1KG1A 2PTKA 3JCMg 1QCOA 2XDBA 2CP0A 2LT1A 3ZL7C 2C0IA 2LQWA 2J6KA 4AG1C 3VS4A 1VQ7Q 1WHKA 3UDCA 3P8HA 3A8LB 1NYGA 1TG0A 1S72A 4XU2A 3H0FA 4KRTA 1AZGB 1Q86U 2LT4A 1OYXA 5GANe 2COYA 3CCRA 1BIBA 3I56Q 3RDVA 1D0XA 4XQ3A 4XU1A 5CKBA 2WSEE 2BZYA 2P84A 1BCMA 3HSBA 2LQNA 4J8OA 4C92G 1B34B 3NTKA 3EFSA 4M7AG 5GJVB 2BZXA 3CD6Q 1WNLA 2MAMA 3S3OA 1X27A 4QQ6A 2I0NA 4RTZA 2MYSA 1YWPA 3C95A 1U1SA 4M75G 1QP3A 2DETA 2V8JA 2VVKA 1SG5A 2VV5A 2MF2A 1AWWA 3CCMA 2CT3A 1OU9A 3QO3A 4C0DB 4F04B 4HT8A 1KQSP 2MPXC 4ZNXA 5FU6C 2RA2A 1YHQT 2J06A 3M0QA 4ZGJB 2K5IA 4M7DG 1UJYA 1YJWQ 3RNJA 1KC8C 1PHTA 4JJCA 3EG0A 1A0NB 1WHJA 2BTTA 2HMAA 1ZSZB 3X26B 3P8DA 1EFNA 4M7DE 2O01E 4MZTA 2A3LA 4C8QC 4E7IA 1GBRA 1UFFA 1E6GA 1H3ZA 2HQXA 3L2UA 1MMGA 3MO8A 4LDYA 2DF6A 4BDYA 3E9FA 4PFPA 4CI0C 1KIKA 4DEXA 3JCMd 1T3SA 3M57A 4C8QG 2QXFA 3HHTB 1BI2A 4QW2A 2EFIA 2CDTA 2DVEA 1XTDA 5KE2A 4J6XA 2HD0A 1QLYA 2M51A 3HKSA 1Y96A 8AT1B 2HCKA 3DKMA 2E6ZA 3UWNA 3C0CA 4OB0B 2E4HA 2QYZA 1QVFP 4Y92A 2P4RA 1QW1A 3G4ST 4AFZC 1M1KU 4WCIA 3CC4Q 2JMCA 1PSEA 4LE9A 4KBMB 3GPLA 3OS1A 5IHNA 2KSSA 3PFSA 1AWOA 1B3QA 4EMKC 1JXMA 1IZ6A 2ENMA 2QDYB 3PMTA 3M54A 2MI6A 2F1LA 2EYWA 1K0SA 1B07A 2M1HA 4UC4A 2XKOC 3CMEQ 5CKFA 1HJDA 2JW4A 2DK3A 2RJFA 4OMNA 1VQ7A 4LN2A 3L2WA 2H3JA 1OULA 1T3LA 1W2BA 1IGQA 1D1CA 2OAWA 3EG9A 4DOWA 2RB6A 2KRSA 2LJ3A 5GAMd 3A1PA 2L2PA 5LJ5h 2MWOA 5HCKA 3ER0A 1I4K1 1B7TA 2COWA 1AT1B 3JCMQ 2DJQA 2RQUA 2ED0A 1QKWA 2MMPA 1VA7A 2RQTA 3RBBB 3VS1A 4ZGDB 3OYMA 1KD1C 3V7CA 2DM1A 3I56T 4PKCC 2FZKB 2VUBA 3CBPA 1ZUYA 1SHFA 4PJOD 2VXFA 1SHGA 3OYHA 3L42A 4N0AC 3E2UA 1M90C 3CCUQ 3BW1A 2VC8A 2FPFA 2V1QA 4LD9K 5GANj 4DBRA 5FWBA 4XTYA 1I5OB 2AZSA 1IO6A 3A8OB 3TREA 2PQWA 4M7AD 1XNIA 2QQRA 3M9QA 4IUUA 4F7UA 2EYQA 1X75C 1ZA2B 1HK9A 2RD1A 2LCLA 2QEXT 1NLOC 3REBB 4FSSA 3JCMP 2JT4A 3OYKA 1D1BA 4M78C 4ZTJA 4RG8A 1LOJA 1K4US 4M7DB 1WZOA 2DRMA 3UT1A 2F2VA 1QCNA 1YHQQ 3JSCA 4IIMA 1VQ6Q 3T9NA 1VQOA 1XJWB 1QP2A 1YBYA 2LCSA 5KYYA 1SSHA 1ZX6A 2YUPA 1IHWA 2IIMA 2VB6A 5GMKe 3CCJA 1Y7XA 1SRLA 2V8KA 3MHXA 1ZSZA 3TU4K 1RAAB 3J81E 4JLGA 4M78G 1UGRB 1ZSZC 2L89A 4J7IA 4XTXA 3G71Q 1Q86R 1CSKA 4DBFA 3I55T 3SFMA 2L3QA 3CC4T 2ATCB 4IURA 4ELYC 1QQJA 3M59A 3CXCA 1WQ7A 3MP1A 5AT1B 3RUXA 1VQNA 5IAYA 3JCMX 2FG0A 4Y28E 2JXBA 2ROLA 1UUEA 2DPPB 2O4XB 2PVOB 2DD4A 3M58A 2O9VA 4KGXB 4X1VA 2LJ0A 4F7UE 5LJ3g 1NYFA 3EG9B 3VV0A 2X9HA 1YJ9T 3E1SA 4XU0A 4TVRA 7AT1B 1RADB 2E64A 1GL5A 4M77G 1R8OB 4RG2A 2D8JA 2HKQB 1GBQA 3LW5E 5GMKl 4BE1A 2JOYA 3FIFA 2FL7A 3RESA 1TTHB 2JJ9A 2CSQA 3SWNA 3A8GB 4EIKA 3BFMA 5J3BA 3G6EA 3VS6A 4KGVB 2M0YA 4Z8AA 1OU8A 4C92A 3EGDA 3LH5A 4LDUA 3EGDB 2HSPA 4F7UB 5I21A 3NPFA 4E47A 3CCLQ 1E7OA 1VUBA 2R5MA 1RI0A 2W10A 3CCUT 3QYGB 3F70A 3G71A 2LJ1A 1RAGB 3H6ZA 1V1CA 1U06A 4F7UG 4LUDA 2IVWA 1R0BG 2HBWA 4DQ2A 5J39A 3CCJQ 2FZGB 4ORZA 1U5SA 4X9DA 4XU3A 5D6YA 1QVGP 1T0HA 1MMNA 2DD5A 2YRDA 2YXYA 2QGFB 1GRIA 1O9SA 1D0ZA 2E65A 1WJQA 2KAFA 5CK9A 2YSQA 1M4ZA 4M75D 3KXTA 2AKKA 2D0QB 3HFOA 3JCMV 2DL3A 1Q86C 1KK7A 4M7DD 3RKWA 4KULA 2A08A 3HL8A 3CCLT 1Y57A 1BCOA 4BD3A 1B34A 2DXTA 3M0PA 5C0MA 5GAMf 4M78E 4PJLA 2R5AA 3CPFA 5GANd 4AG2C 3A5ZB 4PK4A 2KYMA 1OZ2A 2KEAA 4N4GA 3HRTA 3MP6A 1ZLMA 2DRKA 5CQXA 4MZPA 2QASA 2EPDA 2EYZA 2DA9A 4MDWA 3H41A 4RKUE 4FYVB 1UEBA 2P0PA 4XAXB 2E10A 1VQ9Q 1TUCA 3VS5A 5GAN6 5FU6B 5CAIA 4K11A 5IT9E 3RERA 1G5VA 1YJNT 1M27C 5A0LA 3S3MA 4RCBA 1YI2T 3FEOA 1EZZB 3V8LA 1PC0A 2M16A 1VQKT 3M0SA 1YCSB 1YNZA 3JCMW 3CCVT 5GAN8 3RR6A 4DBHA 1VYVA 3CCEQ 2JUFA 4PJMA 1MGQA 2X4YA 1VQ4T 1X6OA 2KROA 2ZPGB 1JB0E 2GQVA 3SWNB 4ZN1A 2KBTA 2DYBA 2EW3A 1SSFA 1M90R 4AFQC 2QA4A 2X4JA 3WVDB 2DX1A 1M2VA 2NUTB 4C92F 1IRXA 1Z9ZA 5LJ5e 3UF4A 4AMCA 5LJ3j 5LJ5d 3H9NA 2YWWA 1XQHA 2KYBA 3OYYA 4RTUA 2G6FX 3LGLA 2QEXQ 1X6BA 4FT2A 1VQOQ 3CPWS 3OYCA 1WJSA 5KCHA 1I81A 2YLBA 1KQSS 2EYYA 1FMWA 1G3TA 2QA4T 4PFOA 3CCQA 2ZCFB 2EBPA 3VS3A 4BE2A 4FSXA 4X34A 5IXBA 1KSWA 2RN8A 3L2VA 3OYDA 1I1JA 2JMAA 4M7AB 1WXUA 2RNAA 2GFAA 1PSFA 4OMMA 2DL4A 1Q82C 3CCMT 2FRWA 3QYHB 3PE0A 3QWYA 2DL5A 1H8KA 2DZ9A 5GAMg 3OYAA 2BKDN 2DXBA 2W0ZA 1YJ9A 1K73C 3S3NA 1LCKA 1VQPQ 1YIJQ 1M9SA 1JU5C 2KRMA 1WFWA 1N9SA 5KYXB 3HRSA 2HAXA 5KH6A 1E6HA 3RMQA 4IUQA 1Q82U 2Y4YA 4Y91A 1ARKA 3JCMh 1UGPB 4JZ3A 4E7SA 1IB8A 3X20B 5IHKA 1YJNA 3JB9H 3L2ZA 2XICA 4M7AF 4HCCA 3QDFA 3X28B 2O4XA 1OX9A 3P8BB 4NL3A 2DERA 1UTIA 3QZ5B 4E2FB 2GTJA 4AFUC 1ACMB 3URGA 1FYNA 4EMKB 1YI2A 5GJWB 3JB9F 4LDXA 4B9XA 4RTXA 2HSEB 2P4TA 3AHUA 1VQ5T 2J6OA 3CCMQ 1GCPA 1VQ8A 1YIJA 1MV0B 3EAEA 1Z9QA 5GAMh 4E7HA 2E3HA 4J9FA 4M4ZA 4C5IA 2CZ6B 1AHJB 2KR3A 4PLIA 5EG2A 3LLRA 1N5ZA 3OW2P 4B9WA 3A8MB 4GY5A 1YITA 1ZBJA 2L3RA 1U8RA 2FVUA 4J9HA 4A4GA 5GAMe 2AHJB 3KFVA 3SDZA 4D6WA 2ABLA 2JM9A 3OQ5A 5GAMj 2WSFE 1KQSA 2DVJA 4XTZA 1RAIB 2A28A 3G71T 1TWBA 1NJIU 4ME7A 4KH1B 2XK0A 3DLMA 3CCQT 3G4SQ 5FRNA 2A37A 2QTXA 3ASKA 4N4HA 5GAOq 2DKGA 2JNGA 3EGXB 5ECAA 5FWCA 1NPPA 4DBQA 1HYOA 5LL6S 1TXQA 5LJ3d 2NYSA 4OF1A 2YT6A 3SHWA 2ESWA 1HXDA 2RHUA 3J7AF 1OPLA 4OMLA 2P0QA 1UGQB 1VYUA 3FRNA 3HTRA 4C0DC 3N5BB 3OMCA 1VQ7T 2FPDA 1VQLA 1D3BB 2RQRA 1VIFA 1K76A 1AWXA 3M4YA 3CXCS 1KHIA 1Y07A 2OI3A 4JRQA 1RUWA 4PJNA 1QKXA 2EQMA 4HVWA 3U23A 4C92B 3V7SA 3PT9A 2KXDA 2FEIA 4CC2A 1PG5B 1ZHIA 2A0FB 1Y96B 2K5LA 1V76A 3E19A 2EYXA 1YJWT 2O88A 4PJOF 5J26A 4DA4A 2KXCA 1WI7A 4FYYB 3CMAQ 5GMKh 4J5YA 2DBMA 5I22A 1PCXA 3NGPA 3EG2A 1X2QA 2PVDB 5GMKm 5KYYB 4QVCA 2ZPBB 3JB9J 3NMZC 2Y90A 4QVDA 2OTJT 4LNPA 5GAN2 5CKEA 5FW9A 3OS2A 3INZA 2SEMA 1RL2A 4RTTA 2CP3A 2OTLQ 2CSIA 1OEBA 3I55Q 1KHCA 3I5RA 2DO3A 4PJJA 2A7YA 3CD6A 1VQPT 3LH0A 1VQNQ 1TSFA 4CC4B 2DYIA 4M78A 2LTOA 2XU8A 3MPUB 2KK4A 4HXJA 1K8AR 1YN8A 3KBGA 4GLKA 2F5TX 2QEXA 3MEUA 4C8QD 2YHTA 1M2OA 1NG2A 2CP6A 5GMKj 2DTHA 4IKFA 3META 1W1FA 4KUDK 4P5NA 4M77F 1ZA1B 1M1KC 3QZ9B 3SEMA 4JUVA 1W70A 3VS0A 4ATOA 3NTIA 1PRMC 2F5KA 1NM7A 1VOMA 1RLQC 5DLQE 3NFCA 2DZCA 5HY6A 1JJ2P 1OX8A 4RUGA 5KE3A 4BI4A 2OTJQ 4E7LA 1AZEA 3NHNA 1AVZC 2ZZDA 2NUZA 3EFOA 2K3YA 5CKDA 2CREA 4RTVA 3PMIA 3KUFA 2YUOA 2R58A 2BE9B 2YDLA 2FB7A 5EC7A 3DB3A 3CMET 1YHQA 2H8HA 5DM7R 4PJOA 1K9AA 4PJOG 3GOXA 5CR2A 2BIVA 1RI9A 2DJZA 1X6GA 2WACA 1K9MR 3MEVA 3FJ5A 3CCSQ 2XDPA 5I11A 4C0GA 1PD0A 3QSUA 3ZEHA 1LJOA 3G6EQ 1N8RC 2PVGB 2R57A 3RKYA 5D6WA 2LC4A 2D1XA 4AFSC 1AEYA 1NEGA 1G3WA 1W2BP 2F69A 4FT4A 1U3OA 2DBKA 2DL8A 3CBOA 3DB4A 2CUBA 2EJ9A 1Q82R 3THKA 4FW1A 2CUDA 2ZPHB 2LX9A 5CCAA 3SWNC 2EKHA 4A53A 3L2QA 1Q7YU 2JTMA 2K6DA 2PUOB 2XDDA 2J05A 8ATCB 3VKIA 3OYLA 1GFDA 3X24B 3OBWA 3CCSA 4QKUA 4M78B 4OMPA 1BK2A 4KT0E 1PNJA 4L6V5 2DILA 2CT4A 4J6YA 2D0NA 2AT1B 5FU7B 3CC2Q 1M3AA 1QVPA 4M77C 4Q5WA 4FM4B 3LWIA 1FWZA 4NL2A 2FO0A 2K57A 1QVFA 2XMFA 3CD6T 1QMCA 1WHLA 3RKXA 4EPCA 5I2MA 1NE8A 3MJXA 3OSSC 4QVZA 1KC8U 2K3BA 2ZPIB 2JN0A 1YIJT 4A4HA 3CMEA 3OYGA 2C0OA 1VQ8T 4OB1B 2M02A 3M56A 4M7AC 1NEBA 3SD4A 1F1BB 3I5SA 3NTHA 4R56A 3OS5A 3MEAA 3EFOB 2NLUA 1RAHB 2M9UA 4LD6A 3MEWA 2D6FA 2CP5A 4OB3B 4RTYA 1UGSB 1H641 4J9CA 1YFNA 2D9TA 3QBYA 3REAB 5KYNA 2L3PA 4C0FA 2RHIA 5LJ5g 2LRQA 4HCBA 3A8HB 4BY6C 4HCKA 4M75B 1ZSGA 1VQ5Q 1VQMT 2JVVA 2DAQA 3I55A 3PVQA 2OTLA 1SRMA 1M8VA 1PD1A 3H8ZA 1VQ9T 4EMKA 1CKAA 4WF2A 4Z88A 4ELZC 1JJ2A 1BBZA 3LGFA 1OQKA 1SKUB 4II1A 3LYIA 2KVQG 2FYKA 3OA6A 1VQLT 3FJPA 1BB9A 4FYXB 4OB2B 2O2OA 3EGUA 5HK3A 2X4XA 2LZ6B 5DLOA 1VQ4Q 1WIEA 1LPLA 2AKLA 4EMHA 1ZUKA 3CCST 4QQDA 3EHRA 5A0DA 3OW2A 1FX7A 1ABQA 1VQPA 4PL6A 1O75A 1HD3A 3OY9A 3G6ET 2KMTA 2VYTA 1VYTA 1BYMA 2X51A 4NOYA 2O9SA 1RLPC 4LUEA 6AT1B 4C5EA 3M4GA 1GCQC 2QGGA 4OGEA 1KQ1A 1JXOA 3A98A 1M1FA 2RMOA 2RI3A 2E41A 3QDRB 3BY7A 2CZ7B 2JS0A 4BUGA 1YWOA 4KUIA 3QG1A 2L8DA 4J9GA 2OTJA 3G4SA 1UHCA 4C5GA 1KFZA 1R77A 1Q81U 5GAOr 3JCMe 5FRMA 2KT1A 2OTLT 1TUGB 2DFUA 1IGUA 3EG1A 5IN1A 5GANg 3HP9A 1UG1A 4RMOA 4Z02A 2YUNA 2YRCA 4PFZA 1ABOA 3MP8A 4AT1B 2K7AA 1GXIE 4ZN3A 1BI3A 3PIOA 4MMKA 3JCMf 2OAUA 4IUPA 1OV3A 1PM3A 4ZGEB 3OYNA 4XTVA 2RM4A 2LNHB 3QJYA 1N27A 1BI0A 1FXXA 4C5HA 2ZPFB 2K79A 1OPKA 3GP8A 2E5KA 4M78F 3RMSA 3V8KA 1TS9A 2LNVA 1UE9A 5GAOp 1G3YA 1Q81R 1AWJA 1WX6A 2FRYA 1CKBA 3OB9A 3ZFJA 1W2BS 2DE0X 2EIFA 4A63B 4BE0A 3EG3A 1I8FA 1D1AA 3VRZA 3ZBDA 3CMAT 3GIBA 2CP7A 4JRKA 1R0CB 2KDSA 1NJIR 4F14A 2E12A 4FCYA 2KT8A 1WXBA 3GBQA 2DEUA 3JCMb 4R55A 3C94A 2LDMA 4IIOA 1M3BA 3TEEA 2GCXA 1YJNQ 1QWFA 1VQMQ 2ECZA 1JBMA 3QHSA 4RCCA 2CH4A 1I5LA 1C0MA 2JTFA 2IPOB 3TSWA 2ZAEA 3CC7T 5GAN7 3C4SA 2KE9A 1YJ9Q 2HKNA 4A4FA 4MDXA 4PJOC 3OSVA 2DIGA 1UJ0A 2K9GA 1TU0B 3ULRB 1RAFB 3JV3A 3E9GA 1N8RR 3L1AA 3H0IA 4KH0B 4HKEA 3WVEB 1UGVA 5LJ3e 3PNWC 3VUBA 3BE3A 5FLXE 2VWFA 5FU7C 3UATA 1PRLC 1K9MC 4N4IA 2C0TA 4CRIA 2ZGWA 1TOVA 3CPWA 3EH1A 1BU1A 1Y0MA 2BE7D 4PNOA 1MNDA 2KRNA 3I35A 2EQUA 9ATCB 2VGNA 1SPKA 2GNCA 1NBEB 1BI1A 2LQKA 3VUZA 1C6VX 5I2SA 4C92C 1X01A 1JEGA 2LMJA 1WGSA 2L5QA 2MWPA 3VJPA 1JQQA 2F2XA 4A4KA 3QJ6A 2LQ8A 4JRIA 1WA7A 2FPEA 4OMFB 2B8AA 4DOVA 1M1KR 2MCNA 1VIEA 1KD1U 2CGHA 2AZVA 2G3RA 2GTOA 2K4YA 1DJ7B 4FIBA 2DLPA 5KYXA 4M7AA 3CC2A 5CQYA 3VU3C 1OZ3A 3JB9I 5A2QE 2P0KA 3EGXA 1JO8A 4J9EA 1ZUUA 3TQ7P 4JRPA 4C92E 1RACB 1KD1R 5GAOm 4O5VA 2COZA 3CCVA 4JS4A 2JM8A 3GNGA 4LXCA 2E1HA 4D8DA 3VYHB 5LJ5f 1D09B 3QXEB 1JJ2S 2Z0WA 5GAN3 1VQ9A 4M77B 3GLXA 3X25B 1QVGA 1TUDA 1MMDA 1WHMA 2IG0A 2JZ2A 4VUBA 3O5ZA 3SB2A 5M9OA 1N8RU 1QWEA 2JTEA 1MMAA 3TSZA 2F2WA 3CC7A 4PLLA 2D8HA 3OMGA 2LVMA 4WTOB 4B6MA 3UPUA 2VKNA 1ZQ1A 5L23A 1NJIC 1K0XA 2EGEA 2ROTA 1MNEA 2K3XA 3JRZA 3M0UA 4LDVA 4E7JA 3M0RA 4HVVA 4A54A 3CCJT 5CO7A 2KY9A 2CYZB 2RI2A 1BKBA 2J6FA 3CCRQ 4JDSA 2EWNA 4RTWA 1Q81C 2B86A 2RI5A 1P92A 4HVUA 5GANh 3LX7A 2CKKA 1X69A 1EX4A 2DIQA 3FDRA 2XG8D 4KGZB 3QKJA 2K5FA 1WXTA 5KYWA 3M55A 2EAYA 3CQTA 2MK5A 3EH2A 1OI1A 3MKDA 2QA4Q 3EFRA 4C8QB 1SEMA 2CS7A 2QQAA 2O31A 2GBQA 3D7SB 5GAN4 1M3CA 2YLCA 4IUVA 3PTAA 3BDUA 4HCZA 3RIRA 5LJ3f 2K2MA 1C1AA 1PWTA 3QPHA 2V8IA 5HK0A 1MUZA 2EGAA 4M77E 1WQWA 2ED1A 2E5QA 3JCMJ 2E6NA 2RO0A 2MOXA 1KC8R 5CIUA 3JAME 1JRIA 4JS5A 5L8RE 3CXCP 3CCLA 4FL6A 2HQEA 3CC2T 2CZ1B 3CCRT 4E6RA 4R0KA 4XTWA 3FLGA 3V8JA 1EIFA 2XIDA 4L59A 4JJDA 2VXEA 5LJ5j 3HPWA 3UA6A 3TCJA 1MV3A 1N6AA 4MZMA 2OX7A 5AYFA 2EKOA 2XD0A 4M7DA 2K2VA 1T0JA 2AIRB 5D6XA 4M7DF 4A4EA 5IXFA 5GAOn 4M7DC 1AD5A 5GANf 4GLMA 4J9BA 1IHVA 1N9RA 2QQ9A 1VQKQ 2RK2A 2LX7A 3BDLA 2SRCA 1Q95G 1VQ5A 1YCYA 3CCVQ 3O8VA 2PU9B 2HBPA 2HZYA 3OYEA 3HFNA 4J6WA 3OYFA 4J9IA 2X3WD 4M75C 5FROA 1S72T 2H3EB 2RHYA 2EQIA 4M75A 1X2KA 4OMOA 2DXCA 2EGCA 4PJOE 2WSCE 1K8AU 1SF9A 2RF0A 4LDWA 4L5GA 2L0AA 1YITT 1YP5A 1G2BA 4F17A 2CZ0B 1FMVA 5LJ3h 4BI3A 2V1RA 3OW2S 2YUQA 3C12A 4EDUA 2CH4W 2KI7A 2EVRA 2EJGA 4HT9A 5KYUB 3R6OA 4C8QE 2FHDA 1ZBXA 4F7UF 1M90U 3OYIA 2RK1A 2J7IA 1VQOT 5CVIA 2KNBB 3DLLA 2HQHA 4C0ZA 3FC3A 1K73R 1QCFA 1D0YA 1VQNT 1IXDA 2M0OA 3TVTA 1HSQA 2DTOA 2HL3A 3H0HA 1WYXA 1G3SA 1M5Q1 4ANJA 4C8QA 4ESRA 1K73U 4M78D 2NWMA 5IH2A 4MMLA 4OGCA 1D3BA 1V29B 2VASA 5IHIA 2BUDA 3JCMc 3ME9A 3L2RA 1TH7A 1UB4A 4OMQA 1WHGA 1YITQ 4DEYA 3CC4A 2QAZA 1WLPB 1NLPC 4O6JA 2EQKA 1Q7YC 3CC7Q 1VQ6T 2RHZA 5GAN5 4M75E 3OS0A 4OP0A 2XI9A 2KGTA 2HEQA 3QUIA 2NUPA 1U1TA 1BIAA 2HL5C 3CCET 2OJ2A 1VQKA 2QTVA 4XK8E 2Y4XA 4F16A 1XOVA 4OVAA 2RQVA 3MCAB 4BACA 1YI2Q 5GMKi 4BY6B 1M8MA 2LP5A 2DMOA 1UHFA 2DNUA 3V7RA 3CCUA 3UA7A 4V2SA 1OOTA 2RPNA 2C06A 4C8QF 2BZ8A 2QI2A 2RJDA 1GFCA 2LCCA 5GAOl 4E7KA 3PVLA 3JB9G 1RABB 2FZCB 2VGMA 2KQWA 3CPWP 2HDAA 5CKHA 4M77A 3WXMB 1W4SA 4JLIA 3VYGA 2QG9B 2L3SA 1LNXA 3M0TA 1J3TA 1Y71A 3CBMA 4Z89A 1WHHA 1RAEB 3OBYA 1MHNA 2CP2A 3VRYA 1NZ9A 1S1NA 3I9QA 4XTUA 2HNIA 3HRUA 4BDZA 1WDXA 4FYWB 5KCOA 4JZ4A 2GFUA 4GBQA 4QQGA 4EMGA 3VS2A 4FU6A 3GNFB
chains in the Genus database with same CATH topology
3V7SA 3PT9A 3M59A 2RJCA 3S6WA 3CXCA 1WQ7A 1ZHIA 3MP1A 1Y96B 2GF7A 2K5LA 3RUXA 3E19A 1VQNA 5IAYA 3CC7T 4M75F 3JCMX 5GAN7 4Y28E 4X9CA 3JB9D 1YJWT 3C4SA 1VQ6A 4PJOF 2DPPB 5J26A 2DTIA 2I2LA 4A4FA 5HKCA 4DA4A 4MDXA 4PJOC 2O4XB 2PVOB 2DD4A 3M5AA 5GMKh 4J5YA 4BI8B 3M58A 3OSVA 2DIGA 4N0AA 3PGGA 3Q1JA 2PVDB 3E9GA 4F7UE 5GMKm 4QVCA 3L1AA 2EJFA 5LJ3g 3I56A 3OYJA 2ZPBB 4HKEA 3JB9J 3VV0A 3PIPA 4M77D 2Y90A 3WVEB 4QVDA 5LJ3e 3E1SA 4XU0A 1YJ9T 3FB9A 4TVRA 2OTJT 5GAN2 3PNWC 3VUBA 4J83A 5CKEA 3OS2A 2E64A 1K9MU 2XHCA 2EQJA 3INZA 4M77G 5FLXE 1R8OB 4IUTA 3QIIA 1RL2A 4RG2A 4PJOB 5FU7C 2E70A 1K9MC 4N4IA 4BB7A 4CRIA 2ZGWA 3LW5E 5GMKl 3CPWA 2JOYA 4BE1A 3FIFA 1KHCA 2FL7A 2DO3A 3RESA 2A7YA 4PNOA 3CD6A 4HA8A 1VQPT 2EQUA 3A8GB 5DY9A 2VGNA 3LH0A 3SWNA 4M78A 2LTOA 1BI1A 3BFMA 5J3BA 2LQKA 2XU8A 3VUZA 3G6EA 2DEQA 2KK4A 1WPYA 5I2SA 4C92C 1X01A 1K8AC 2RH2A 3CMAA 3LWHA 4J7FA 1WGSA 4C92A 4NS5A 2L5QA 4LDUA 3KBGA 2MWPA 4GLKA 2F5TX 3VJPA 2QEXA 4F7UB 3MEUA 4C8QD 2YHTA 5I21A 1VQMA 4E47A 2PUKB 4A4KA 5GMKj 3QJ6A 2LQ8A 4JRIA 2DTHA 1VUBA 2DXUA 3META 1QVGS 4IKFA 2R5MA 2ZPEB 3G7ZA 3CCEA 1RI0A 4P5NA 4C92B 4JJNK 4KUDK 3CCUT 3QYGB 4M77F 4OMFB 1M1KC 3CEYA 3OYBA 3QZ9B 1VQ4A 3F70A 4JUVA 2B8AA 3G71A 4DOVA 4ATOA 5C6SA 3NTIA 1YJWA 3H6ZA 2F5KA 1VIEA 2QQBA 5A0GA 1KD1U 2CGHA 2G3RA 3M53A 4F7UG 2K4YA 2IVWA 5DLQE 3NFCA 1DJ7B 2DZCA 5HY6A 4DQ2A 4FIBA 1WJRA 2X4WA 5KE3A 5J39A 4M7AE 4BI4A 4YTLA 4M7AA 3CC2A 4E7LA 1IREB 5CQYA 3VU3C 4X9DA 1OZ3A 2ZZDA 3JB9I 4XU3A 5D6YA 5A2QE 2P0KA 2K3YA 5CKDA 3J80E 2DD5A 1KQ2A 3PMIA 4JRPA 1M1GA 2RJEA 3KUFA 2R58A 4C92E 4ZTFA 2YRVA 3GF5A 4C92D 5GAOm 1NPRA 2FB7A 4O5VA 1QVFS 3CCVA 1O9SA 2E65A 4JS4A 1WJQA 2QQSA 3DB3A 3GNGA 2KAFA 2E1HA 5DM7R 3CMET 1YHQA 3VYHB 5CK9A 5LJ5f 4PJOA 3QXEB 4PJOG 3GOXA 5CR2A 1JJ2S 1M4ZA 2BIVA 2DJZA 5GAN3 1VQ9A 4M77B 4M75D 3KXTA 2WACA 3GLXA 3X25B 1QVGA 2D0QB 2RHXA 2X35A 3MEVA 3HFOA 3JCMV 1Q86C 2XDPA 4C0GA 1KG1A 3QSUA 2IG0A 2JZ2A 4VUBA 3RKWA 1LJOA 4KULA 3SB2A 3JCMg 3ZEHA 5M9OA 1N8RU 3HL8A 2XDBA 2LT1A 3CCLT 3CC7A 4BD3A 1N8RC 4PLLA 3UDCA 1B34A 2DXTA 2PVGB 2R57A 3A8LB 3P8HA 3RKYA 5D6WA 1S72A 4XU2A 2LC4A 3OMGA 5C0MA 1G3WA 5GAMf 1Q86U 2LVMA 2F69A 2LT4A 4FT4A 1OYXA 5GANe 3UPUA 3CBOA 4M78E 3DB4A 2R5AA 3CPFA 2EJ9A 1ZQ1A 3CCRA 1BIBA 5GANd 2ZPHB 1NJIC 3A5ZB 4XQ3A 2LX9A 4XU1A 5CKBA 5CCAA 2WSEE 1OZ2A 3SWNC 3JRZA 2K3XA 4LDVA 4E7JA 3HSBA 4N4GA 4J8OA 4A54A 4C92G 1B34B 3HRTA 3NTKA 4A53A 3L2QA 3CCJT 3MP6A 3EFSA 1Q7YU 5CQXA 5CO7A 2KY9A 2JTMA 2PUOB 2CYZB 2RI2A 1BKBA 2XDDA 4M7AG 3VKIA 3OYLA 4MZPA 4JDSA 3X24B 2EWNA 3OBWA 3CCSA 1WNLA 1Q81C 2MAMA 3S3OA 4MDWA 2RI5A 4M78B 1P92A 4RKUE 1UEBA 2P0PA 4XAXB 4KT0E 2E10A 5GANh 3LX7A 4L6V5 4QQ6A 4J6YA 5CAIA 5GAN6 5FU6B 2CKKA 5FU7B 1QVPA 5IT9E 4M77C 2DIQA 3FDRA 4FM4B 4Q5WA 3C95A 1U1SA 3LWIA 3RERA 1G5VA 1FWZA 4M75G 2XG8D 2K57A 4NL2A 1YJNT 5A0LA 1QP3A 3S3MA 3QKJA 1QVFA 2V8JA 4RCBA 1YI2T 2K5FA 3CD6T 3FEOA 3M55A 2EAYA 2VV5A 2MF2A 3V8LA 3CCMA 3RKXA 4EPCA 1OI1A 2M16A 1VQKT 3EFRA 4C8QB 5I2MA 1NE8A 2CS7A 4C0DB 3QO3A 2QQAA 3JCMW 3OSSC 4QVZA 4HT8A 1KC8U 3CCVT 5GAN8 2ZPIB 2JN0A 5GAN4 2YLCA 1YIJT 4IUVA 2JUFA 2RA2A 3BDUA 5FU6C 4A4HA 4HCZA 3RIRA 5LJ3f 4ZGJB 3PTAA 2K5IA 1MGQA 2X4YA 4M7DG 3CMEA 1VQ4T 1KC8C 1X6OA 3OYGA 3QPHA 4OB1B 1VQ8T 2V8IA 3M56A 2ZPGB 1JB0E 4M7AC 5HK0A 3X26B 4M77E 2GQVA 3P8DA 1WQWA 3SWNB 3SD4A 4ZN1A 4M7DE 2O01E 2E5QA 3NTHA 4R56A 2E6NA 2RO0A 3JCMJ 4MZTA 2A3LA 4C8QC 3OS5A 4E7IA 5CIUA 1SSFA 2QA4A 3JAME 2X4JA 1JRIA 3MEAA 3WVDB 2NLUA 4JS5A 2M9UA 5L8RE 3CCLA 4FL6A 2HQEA 3MEWA 4LD6A 4C92F 3CC2T 2D6FA 4OB3B 1UGSB 2CZ1B 3CCRT 1H641 1H3ZA 2D9TA 2HQXA 3L2UA 3MO8A 4LDYA 3QBYA 4BDYA 3E9FA 4XTWA 5LJ5e 3FLGA 3V8JA 1EIFA 2XIDA 4L59A 5LJ3j 4CI0C 2VXEA 5LJ5d 3JCMd 3M57A 4C8QG 5LJ5j 2QXFA 3HHTB 1BI2A 3HPWA 1XQHA 4QW2A 3TCJA 1N6AA 2EFIA 3OYYA 4MZMA 4C0FA 2RHIA 5AYFA 5LJ5g 2LRQA 2EKOA 2DVEA 4HCBA 2XD0A 4M7DA 2K2VA 3A8HB 4BY6C 1XTDA 1YHQT 3LGLA 5D6XA 4M7DF 5KE2A 4FT2A 2HD0A 4J6XA 4M75B 4A4EA 3OYCA 5GAOn 1WJSA 3HKSA 5KCHA 3CPWS 4M7DC 5GANf 1VQMT 2YLBA 1I81A 2JVVA 2DAQA 1Y96A 3I55A 1KQSS 2OTLA 1G3TA 1N9RA 3DKMA 2E6ZA 2QQ9A 3UWNA 2QA4T 2RK2A 1M8VA 4OB0B 3CCQA 3BDLA 2ZCFB 1QW1A 3G4ST 4BE2A 3H8ZA 1VQ5A 1YCYA 4FSXA 4X34A 1VQ9T 3O8VA 2PU9B 2HBPA 1M1KU 1PSEA 4EMKA 4KBMB 3OYEA 4WF2A 3L2VA 4ELZC 3GPLA 3OYDA 3HFNA 3OS1A 2KSSA 3PFSA 4M7AB 4J6WA 1JJ2A 3LGFA 4EMKC 1IZ6A 3OYFA 2QDYB 4M75C 5FROA 2GFAA 1PSFA 4II1A 1S72T 2RHYA 1Q82C 3PMTA 3M54A 2MI6A 3LYIA 3QYHB 4M75A 3CCMT 2KVQG 2DXCA 2FYKA 4PJOE 2DZ9A 4ELYC 3OA6A 1VQLT 2WSCE 3FJPA 2BKDN 2DXBA 5GAMg 3OYAA 1K8AU 4LDWA 2M1HA 4L5GA 4UC4A 2XKOC 4OB2B 1YITT 1YJ9A 1K73C 3S3NA 2CZ0B 5LJ3h 5CKFA 1M9SA 5HK3A 2X4XA 4BI3A 3OW2S 2DK3A 2RJFA 5DLOA 1VQ7A 3L2WA 1N9SA 3C12A 4EDUA 4EMHA 3HRSA 2HAXA 2H3JA 3RMQA 4QQDA 4IUQA 5KH6A 3CCST 1W2BA 1Q82U 2EJGA 2Y4YA 4HT9A 4DOWA 2RB6A 1FX7A 4Y91A 3R6OA 5A0DA 4C8QE 3OW2A 1VQPA 2FHDA 3JCMh 1UGPB 5GAMd 4PL6A 5LJ5h 1ZBXA 1O75A 2MWOA 4F7UF 1M90U 3X20B 3ER0A 3OY9A 1I4K1 3OYIA 3JCMQ 3G6ET 2RK1A 1YJNA 3JB9H 1VQOT 3L2ZA 5CVIA 2XICA 2KMTA 3DLLA 4M7AF 4C0ZA 3FC3A 2MMPA 2VYTA 4HCCA 1VQNT 3X28B 1BYMA 2O4XA 4ZGDB 4NOYA 3OYMA 1KD1C 3V7CA 2M0OA 3P8BB 4NL3A 4C5EA 3M4GA 4OGEA 3QZ5B 1KQ1A 3I56T 4PKCC 2DTOA 2VUBA 1M1FA 3URGA 2RI3A 2E41A 4EMKB 1YI2A 1G3SA 1M5Q1 3QDRB 3JB9F 3CBPA 4LDXA 3BY7A 4B9XA 4C8QA 2CZ7B 4PJOD 1K73U 4BUGA 2P4TA 4M78D 2VXFA 4KUIA 3QG1A 3AHUA 3OYHA 4MMLA 4OGCA 2L8DA 2OTJA 3L42A 3G4SA 1VQ5T 1D3BA 4C5GA 4N0AC 1M90C 1V29B 1Q81U 1VQ8A 5GAOr 1YIJA 3JCMe 3BW1A 5FRMA 4M7DD 2BUDA 3EAEA 3JCMc 3ME9A 2VC8A 2OTLT 3L2RA 5GAMh 1TH7A 5IN1A 5GANg 4E7HA 1UB4A 4LD9K 3HP9A 5GANj 3CC4A 4RMOA 4C5IA 4O6JA 4XTYA 2CZ6B 4Z02A 1AHJB 2EQKA 3MP8A 4PLIA 1Q7YC 1VQ6T 5EG2A 2RHZA 3LLRA 1GXIE 5GAN5 3A8OB 4M75E 3TREA 4ZN3A 1BI3A 3OS0A 2PQWA 4B9WA 3PIOA 4M7AD 1XNIA 2QQRA 3M9QA 4MMKA 3JCMf 3A8MB 2OAUA 4GY5A 4IUUA 4IUPA 4OP0A 2XI9A 1YITA 4F7UA 2L3RA 1U8RA 4ZGEB 3OYNA 2EYQA 1X75C 2FVUA 4XTVA 3QUIA 4A4GA 5GAMe 1U1TA 1BIAA 2AHJB 2RM4A 3QJYA 3SDZA 1N27A 3CCET 4D6WA 1HK9A 1BI0A 1FXXA 2RD1A 4C5HA 3OQ5A 5GAMj 2ZPFB 1VQKA 2WSFE 4XK8E 2LCLA 2QEXT 2Y4XA 3GP8A 1XOVA 3JCMP 4OVAA 3MCAB 4M78F 4BACA 3RMSA 3OYKA 3V8KA 1KQSA 4XTZA 5GMKi 4BY6B 3G71T 4M78C 2LNVA 4ZTJA 3V7RA 3CCUA 4RG8A 1NJIU 1LOJA 5GAOp 2C06A 4V2SA 4C8QF 1G3YA 4M7DB 4ME7A 2QI2A 2XK0A 3DLMA 3CCQT 5FRNA 2RJDA 3OB9A 2QTXA 3ZFJA 3ASKA 2LCCA 4N4HA 3UT1A 5GAOl 4E7KA 1W2BS 2EIFA 5GAOq 2DKGA 2JNGA 3JB9G 4BE0A 1NPPA 2VGMA 1I8FA 2KQWA 3JSCA 3T9NA 3ZBDA 1VQOA 5CKHA 4M77A 1QP2A 5LL6S 5LJ3d 1YBYA 3WXMB 1W4SA 4JLIA 3CMAT 3GIBA 4JRKA 3VYGA 4OF1A 2KDSA 1LNXA 1HXDA 1Y71A 2E12A 3CBMA 2RHUA 3J7AF 3OBYA 1MHNA 5GMKe 3CCJA 1NZ9A 1Y7XA 2P0QA 1UGQB 2V8KA 3JCMb 3FRNA 4R55A 3C94A 2LDMA 4XTUA 4C0DC 3N5BB 2HNIA 3OMCA 1VQ7T 3HRUA 3MHXA 3TEEA 2GCXA 1D3BB 4BDZA 3J81E 3TU4K 1VQLA 4JLGA 4M78G 1VIFA 3M4YA 5KCOA 1UGRB 2L89A 1JBMA 1KHIA 1Y07A 2GFUA 3QHSA 4J7IA 4XTXA 3CXCS 4RCCA 4QQGA 1I5LA 4EMGA 4JRQA 4FU6A 3I55T 3SFMA 2EQMA 3CC4T 4IURA 2JTFA 3GNFB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V7S A;  2FB7 A;  1M5Q 1;  1JRI A;  3JB9 F;  3BY7 A;  1WQ7 A;  4C8Q A;  2E65 A;  1Y96 B;  3RUX A;  4PJO D;  4C92 F;  4M78 D;  2E1H A;  2VXF A;  4M75 F;  3JCM X;  5GAN 7;  3JB9 D;  4X9C A;  4MML A;  3AHU A;  5LJ5 f;  1H64 1;  4PJO A;  4PJO G;  1D3B A;  4PJO F;  4N0A C;  2DJZ A;  2DTI A;  2I2L A;  4M77 B;  4M75 D;  4XTW A;  5LJ5 e;  5GAN 3;  5GAO r;  3V8J A;  4PJO C;  5GMK h;  3BW1 A;  3JCM e;  4J5Y A;  5LJ3 j;  3JCM c;  2VXE A;  5LJ5 d;  3HFO A;  4N0A A;  2VC8 A;  3JCM V;  3JCM d;  5LJ5 j;  4C8Q G;  5GAM h;  1TH7 A;  5GAN g;  3PGG A;  3QSU A;  5GAN j;  3JCM g;  3SB2 A;  3RKW A;  1LJO A;  4M7D D;  4F7U E;  5GMK m;  5LJ5 g;  4QVC A;  2DVE A;  3L1A A;  2EJF A;  4XTY A;  4M7D A;  5LJ3 g;  3JB9 J;  4M7D F;  4J6X A;  4M75 B;  4M77 D;  2Y90 A;  1B34 A;  2DXT A;  4XU0 A;  4M75 E;  4QVD A;  3FB9 A;  3RKY A;  5LJ3 e;  5GAN 2;  5GAN f;  5GAN 5;  1I81 A;  2YLB A;  4XU2 A;  4MMK A;  1Y96 A;  2E64 A;  4M7A D;  3INZ A;  3JCM f;  5GAM f;  4M77 G;  5GAO n;  4OP0 A;  1N9R A;  5GAN e;  4M78 E;  4F7U A;  4PJO B;  1M8V A;  5GAO m;  2EJ9 A;  4XTV A;  1BIB A;  5GAN d;  3QUI A;  5GAM e;  1U1T A;  2ZGW A;  1BIA A;  2RM4 A;  5GMK l;  1YCY A;  3FIF A;  4XQ3 A;  4XU1 A;  3RES A;  1HK9 A;  2RD1 A;  3SWN C;  4EMK A;  5GAM j;  4PNO A;  4WF2 A;  4HA8 A;  3HSB A;  3HFN A;  4A54 A;  4C92 G;  1B34 B;  4A53 A;  4M7A B;  5DY9 A;  3EFS A;  4J6W A;  3SWN A;  4EMK C;  4M78 A;  3JCM P;  4M7A G;  3BFM A;  4M75 C;  4M78 F;  3V8K A;  2DEQ A;  4XTZ A;  2EWN A;  1WPY A;  5GMK i;  4M78 C;  4C92 C;  1X01 A;  1WNL A;  4M75 A;  3V7R A;  4V2S A;  1LOJ A;  2FYK A;  4M78 B;  5GAO p;  4C8Q F;  4M7D B;  2DZ9 A;  4PJO E;  4C92 A;  3FJP A;  5GAM g;  2E10 A;  5GAN h;  2QTX A;  5GAO l;  4J6Y A;  4F7U B;  5CAI A;  2DKG A;  4C8Q D;  5GAN 6;  2YHT A;  5I21 A;  5GAO q;  3JB9 G;  5LJ3 h;  3RER A;  4M77 C;  5GMK j;  1I8F A;  1U1S A;  4JRI A;  2DTH A;  4M75 G;  4NL2 A;  2K57 A;  2DXU A;  4M77 A;  1N9S A;  5LJ3 d;  4RCB A;  4JLI A;  3GIB A;  4JRK A;  4M77 F;  4EMH A;  2EAY A;  4JUV A;  3V8L A;  1LNX A;  1HXD A;  2EJG A;  3RKX A;  4HT9 A;  3EFR A;  4C8Q B;  2RB6 A;  4Y91 A;  4C8Q E;  3QO3 A;  3JCM h;  5GMK e;  5GAM d;  3JCM W;  5LJ5 h;  3JCM b;  4HT8 A;  2CGH A;  4XTU A;  4F7U F;  2JN0 A;  5GAN 8;  2HNI A;  2YLC A;  4F7U G;  1I4K 1;  5GAN 4;  4M7D C;  3JCM Q;  2DZC A;  2RA2 A;  3BDU A;  3JB9 H;  4DQ2 A;  3L2Z A;  5LJ3 f;  3RIR A;  4M7A F;  1MGQ A;  4M7A E;  1D3B B;  4M7D G;  4M78 G;  4M7A A;  4NOY A;  3V7C A;  3VU3 C;  4X9D A;  4NL3 A;  1JBM A;  4XTX A;  3M4G A;  3QHS A;  3JB9 I;  4M7A C;  4RCC A;  4XU3 A;  1I5L A;  4EMG A;  4M77 E;  1WQW A;  3SWN B;  1KQ1 A;  4M7D E;  1KQ2 A;  2DTO A;  3JCM J;  4C92 E;  4C8Q C;  4C92 D;  4C92 B;  2E41 A;  4EMK B; 
#chains in the Genus database with same CATH topology
 4D8K A;  2RJC A;  3S6W A;  5D7U A;  2GF7 A;  4M75 F;  3JB9 D;  4X9C A;  1VQ6 A;  2X3X D;  2DTI A;  2I2L A;  5HKC A;  1UDL A;  3M5A A;  4BI8 B;  4FW2 A;  4N0A A;  3CCQ Q;  4E7Z A;  3PGG A;  3Q1J A;  2NUP B;  1UEC A;  2EJF A;  3I56 A;  3OYJ A;  2RQW A;  5KYU A;  3PIP A;  2QK0 A;  4M77 D;  1FMK A;  3FB9 A;  4J83 A;  5KYW B;  1K9M U;  1M2V B;  2NUT A;  2XHC A;  2EQJ A;  1S72 Q;  2DL7 A;  4IUT A;  3QII A;  4PJO B;  2E70 A;  2A36 A;  3R6N A;  4BB7 A;  1KJW A;  4JJB A;  1PKS A;  4HA8 A;  5DY9 A;  4CC3 A;  1G8X A;  1VQ8 Q;  1H3H A;  2DEQ A;  1WPY A;  1K8A C;  2RH2 A;  3CMA A;  3LWH A;  4J7F A;  2E3I A;  3EHQ A;  4NS5 A;  1I07 A;  1VQM A;  1Q7Y R;  2PUK B;  2V26 A;  1M30 A;  1QVG S;  2DXU A;  2ZPE B;  3G7Z A;  3CCE A;  4JJN K;  2MIO A;  2QDL A;  3CEY A;  2GQI A;  2PZ1 A;  3OYB A;  1VQ4 A;  3IQL A;  4CC7 A;  3G1J A;  4JPB W;  5C6S A;  4J9D A;  1YJW A;  1W6X A;  1PKT A;  2QQB A;  5A0G A;  1LVK A;  3M53 A;  1AOJ A;  1WJR A;  2X4W A;  2JS2 A;  4M7A E;  1H92 A;  1K1Z A;  4YTL A;  1X43 A;  1IRE B;  3VS7 A;  4QT7 A;  3J80 E;  2PNI A;  1KQ2 A;  2GGR A;  1GCQ A;  1M1G A;  2RJE A;  3QWX X;  4ZTF A;  2YRV A;  3GF5 A;  4C92 D;  1VQL Q;  1NPR A;  1QVF S;  1G83 A;  2AK5 A;  2QQS A;  3AT1 B;  1I0C A;  2RHX A;  2X35 A;  1KG1 A;  2PTK A;  3JCM g;  1QCO A;  2XDB A;  2CP0 A;  2LT1 A;  3ZL7 C;  2C0I A;  2LQW A;  2J6K A;  4AG1 C;  3VS4 A;  1VQ7 Q;  1WHK A;  3UDC A;  3P8H A;  3A8L B;  1NYG A;  1TG0 A;  1S72 A;  4XU2 A;  3H0F A;  4KRT A;  1AZG B;  1Q86 U;  2LT4 A;  1OYX A;  5GAN e;  2COY A;  3CCR A;  1BIB A;  3I56 Q;  3RDV A;  1D0X A;  4XQ3 A;  4XU1 A;  5CKB A;  2WSE E;  2BZY A;  2P84 A;  1BCM A;  3HSB A;  2LQN A;  4J8O A;  4C92 G;  1B34 B;  3NTK A;  3EFS A;  4M7A G;  5GJV B;  2BZX A;  3CD6 Q;  1WNL A;  2MAM A;  3S3O A;  1X27 A;  4QQ6 A;  2I0N A;  4RTZ A;  2MYS A;  1YWP A;  3C95 A;  1U1S A;  4M75 G;  1QP3 A;  2DET A;  2V8J A;  2VVK A;  1SG5 A;  2VV5 A;  2MF2 A;  1AWW A;  3CCM A;  2CT3 A;  1OU9 A;  3QO3 A;  4C0D B;  4F04 B;  4HT8 A;  1KQS P;  2MPX C;  4ZNX A;  5FU6 C;  2RA2 A;  1YHQ T;  2J06 A;  3M0Q A;  4ZGJ B;  2K5I A;  4M7D G;  1UJY A;  1YJW Q;  3RNJ A;  1KC8 C;  1PHT A;  4JJC A;  3EG0 A;  1A0N B;  1WHJ A;  2BTT A;  2HMA A;  1ZSZ B;  3X26 B;  3P8D A;  1EFN A;  4M7D E;  2O01 E;  4MZT A;  2A3L A;  4C8Q C;  4E7I A;  1GBR A;  1UFF A;  1E6G A;  1H3Z A;  2HQX A;  3L2U A;  1MMG A;  3MO8 A;  4LDY A;  2DF6 A;  4BDY A;  3E9F A;  4PFP A;  4CI0 C;  1KIK A;  4DEX A;  3JCM d;  1T3S A;  3M57 A;  4C8Q G;  2QXF A;  3HHT B;  1BI2 A;  4QW2 A;  2EFI A;  2CDT A;  2DVE A;  1XTD A;  5KE2 A;  4J6X A;  2HD0 A;  1QLY A;  2M51 A;  3HKS A;  1Y96 A;  8AT1 B;  2HCK A;  3DKM A;  2E6Z A;  3UWN A;  3C0C A;  4OB0 B;  2E4H A;  2QYZ A;  1QVF P;  4Y92 A;  2P4R A;  1QW1 A;  3G4S T;  4AFZ C;  1M1K U;  4WCI A;  3CC4 Q;  2JMC A;  1PSE A;  4LE9 A;  4KBM B;  3GPL A;  3OS1 A;  5IHN A;  2KSS A;  3PFS A;  1AWO A;  1B3Q A;  4EMK C;  1JXM A;  1IZ6 A;  2ENM A;  2QDY B;  3PMT A;  3M54 A;  2MI6 A;  2F1L A;  2EYW A;  1K0S A;  1B07 A;  2M1H A;  4UC4 A;  2XKO C;  3CME Q;  5CKF A;  1HJD A;  2JW4 A;  2DK3 A;  2RJF A;  4OMN A;  1VQ7 A;  4LN2 A;  3L2W A;  2H3J A;  1OUL A;  1T3L A;  1W2B A;  1IGQ A;  1D1C A;  2OAW A;  3EG9 A;  4DOW A;  2RB6 A;  2KRS A;  2LJ3 A;  5GAM d;  3A1P A;  2L2P A;  5LJ5 h;  2MWO A;  5HCK A;  3ER0 A;  1I4K 1;  1B7T A;  2COW A;  1AT1 B;  3JCM Q;  2DJQ A;  2RQU A;  2ED0 A;  1QKW A;  2MMP A;  1VA7 A;  2RQT A;  3RBB B;  3VS1 A;  4ZGD B;  3OYM A;  1KD1 C;  3V7C A;  2DM1 A;  3I56 T;  4PKC C;  2FZK B;  2VUB A;  3CBP A;  1ZUY A;  1SHF A;  4PJO D;  2VXF A;  1SHG A;  3OYH A;  3L42 A;  4N0A C;  3E2U A;  1M90 C;  3CCU Q;  3BW1 A;  2VC8 A;  2FPF A;  2V1Q A;  4LD9 K;  5GAN j;  4DBR A;  5FWB A;  4XTY A;  1I5O B;  2AZS A;  1IO6 A;  3A8O B;  3TRE A;  2PQW A;  4M7A D;  1XNI A;  2QQR A;  3M9Q A;  4IUU A;  4F7U A;  2EYQ A;  1X75 C;  1ZA2 B;  1HK9 A;  2RD1 A;  2LCL A;  2QEX T;  1NLO C;  3REB B;  4FSS A;  3JCM P;  2JT4 A;  3OYK A;  1D1B A;  4M78 C;  4ZTJ A;  4RG8 A;  1LOJ A;  1K4U S;  4M7D B;  1WZO A;  2DRM A;  3UT1 A;  2F2V A;  1QCN A;  1YHQ Q;  3JSC A;  4IIM A;  1VQ6 Q;  3T9N A;  1VQO A;  1XJW B;  1QP2 A;  1YBY A;  2LCS A;  5KYY A;  1SSH A;  1ZX6 A;  2YUP A;  1IHW A;  2IIM A;  2VB6 A;  5GMK e;  3CCJ A;  1Y7X A;  1SRL A;  2V8K A;  3MHX A;  1ZSZ A;  3TU4 K;  1RAA B;  3J81 E;  4JLG A;  4M78 G;  1UGR B;  1ZSZ C;  2L89 A;  4J7I A;  4XTX A;  3G71 Q;  1Q86 R;  1CSK A;  4DBF A;  3I55 T;  3SFM A;  2L3Q A;  3CC4 T;  2ATC B;  4IUR A;  4ELY C;  1QQJ A;  3M59 A;  3CXC A;  1WQ7 A;  3MP1 A;  5AT1 B;  3RUX A;  1VQN A;  5IAY A;  3JCM X;  2FG0 A;  4Y28 E;  2JXB A;  2ROL A;  1UUE A;  2DPP B;  2O4X B;  2PVO B;  2DD4 A;  3M58 A;  2O9V A;  4KGX B;  4X1V A;  2LJ0 A;  4F7U E;  5LJ3 g;  1NYF A;  3EG9 B;  3VV0 A;  2X9H A;  1YJ9 T;  3E1S A;  4XU0 A;  4TVR A;  7AT1 B;  1RAD B;  2E64 A;  1GL5 A;  4M77 G;  1R8O B;  4RG2 A;  2D8J A;  2HKQ B;  1GBQ A;  3LW5 E;  5GMK l;  4BE1 A;  2JOY A;  3FIF A;  2FL7 A;  3RES A;  1TTH B;  2JJ9 A;  2CSQ A;  3SWN A;  3A8G B;  4EIK A;  3BFM A;  5J3B A;  3G6E A;  3VS6 A;  4KGV B;  2M0Y A;  4Z8A A;  1OU8 A;  4C92 A;  3EGD A;  3LH5 A;  4LDU A;  3EGD B;  2HSP A;  4F7U B;  5I21 A;  3NPF A;  4E47 A;  3CCL Q;  1E7O A;  1VUB A;  2R5M A;  1RI0 A;  2W10 A;  3CCU T;  3QYG B;  3F70 A;  3G71 A;  2LJ1 A;  1RAG B;  3H6Z A;  1V1C A;  1U06 A;  4F7U G;  4LUD A;  2IVW A;  1R0B G;  2HBW A;  4DQ2 A;  5J39 A;  3CCJ Q;  2FZG B;  4ORZ A;  1U5S A;  4X9D A;  4XU3 A;  5D6Y A;  1QVG P;  1T0H A;  1MMN A;  2DD5 A;  2YRD A;  2YXY A;  2QGF B;  1GRI A;  1O9S A;  1D0Z A;  2E65 A;  1WJQ A;  2KAF A;  5CK9 A;  2YSQ A;  1M4Z A;  4M75 D;  3KXT A;  2AKK A;  2D0Q B;  3HFO A;  3JCM V;  2DL3 A;  1Q86 C;  1KK7 A;  4M7D D;  3RKW A;  4KUL A;  2A08 A;  3HL8 A;  3CCL T;  1Y57 A;  1BCO A;  4BD3 A;  1B34 A;  2DXT A;  3M0P A;  5C0M A;  5GAM f;  4M78 E;  4PJL A;  2R5A A;  3CPF A;  5GAN d;  4AG2 C;  3A5Z B;  4PK4 A;  2KYM A;  1OZ2 A;  2KEA A;  4N4G A;  3HRT A;  3MP6 A;  1ZLM A;  2DRK A;  5CQX A;  4MZP A;  2QAS A;  2EPD A;  2EYZ A;  2DA9 A;  4MDW A;  3H41 A;  4RKU E;  4FYV B;  1UEB A;  2P0P A;  4XAX B;  2E10 A;  1VQ9 Q;  1TUC A;  3VS5 A;  5GAN 6;  5FU6 B;  5CAI A;  4K11 A;  5IT9 E;  3RER A;  1G5V A;  1YJN T;  1M27 C;  5A0L A;  3S3M A;  4RCB A;  1YI2 T;  3FEO A;  1EZZ B;  3V8L A;  1PC0 A;  2M16 A;  1VQK T;  3M0S A;  1YCS B;  1YNZ A;  3JCM W;  3CCV T;  5GAN 8;  3RR6 A;  4DBH A;  1VYV A;  3CCE Q;  2JUF A;  4PJM A;  1MGQ A;  2X4Y A;  1VQ4 T;  1X6O A;  2KRO A;  2ZPG B;  1JB0 E;  2GQV A;  3SWN B;  4ZN1 A;  2KBT A;  2DYB A;  2EW3 A;  1SSF A;  1M90 R;  4AFQ C;  2QA4 A;  2X4J A;  3WVD B;  2DX1 A;  1M2V A;  2NUT B;  4C92 F;  1IRX A;  1Z9Z A;  5LJ5 e;  3UF4 A;  4AMC A;  5LJ3 j;  5LJ5 d;  3H9N A;  2YWW A;  1XQH A;  2KYB A;  3OYY A;  4RTU A;  2G6F X;  3LGL A;  2QEX Q;  1X6B A;  4FT2 A;  1VQO Q;  3CPW S;  3OYC A;  1WJS A;  5KCH A;  1I81 A;  2YLB A;  1KQS S;  2EYY A;  1FMW A;  1G3T A;  2QA4 T;  4PFO A;  3CCQ A;  2ZCF B;  2EBP A;  3VS3 A;  4BE2 A;  4FSX A;  4X34 A;  5IXB A;  1KSW A;  2RN8 A;  3L2V A;  3OYD A;  1I1J A;  2JMA A;  4M7A B;  1WXU A;  2RNA A;  2GFA A;  1PSF A;  4OMM A;  2DL4 A;  1Q82 C;  3CCM T;  2FRW A;  3QYH B;  3PE0 A;  3QWY A;  2DL5 A;  1H8K A;  2DZ9 A;  5GAM g;  3OYA A;  2BKD N;  2DXB A;  2W0Z A;  1YJ9 A;  1K73 C;  3S3N A;  1LCK A;  1VQP Q;  1YIJ Q;  1M9S A;  1JU5 C;  2KRM A;  1WFW A;  1N9S A;  5KYX B;  3HRS A;  2HAX A;  5KH6 A;  1E6H A;  3RMQ A;  4IUQ A;  1Q82 U;  2Y4Y A;  4Y91 A;  1ARK A;  3JCM h;  1UGP B;  4JZ3 A;  4E7S A;  1IB8 A;  3X20 B;  5IHK A;  1YJN A;  3JB9 H;  3L2Z A;  2XIC A;  4M7A F;  4HCC A;  3QDF A;  3X28 B;  2O4X A;  1OX9 A;  3P8B B;  4NL3 A;  2DER A;  1UTI A;  3QZ5 B;  4E2F B;  2GTJ A;  4AFU C;  1ACM B;  3URG A;  1FYN A;  4EMK B;  1YI2 A;  5GJW B;  3JB9 F;  4LDX A;  4B9X A;  4RTX A;  2HSE B;  2P4T A;  3AHU A;  1VQ5 T;  2J6O A;  3CCM Q;  1GCP A;  1VQ8 A;  1YIJ A;  1MV0 B;  3EAE A;  1Z9Q A;  5GAM h;  4E7H A;  2E3H A;  4J9F A;  4M4Z A;  4C5I A;  2CZ6 B;  1AHJ B;  2KR3 A;  4PLI A;  5EG2 A;  3LLR A;  1N5Z A;  3OW2 P;  4B9W A;  3A8M B;  4GY5 A;  1YIT A;  1ZBJ A;  2L3R A;  1U8R A;  2FVU A;  4J9H A;  4A4G A;  5GAM e;  2AHJ B;  3KFV A;  3SDZ A;  4D6W A;  2ABL A;  2JM9 A;  3OQ5 A;  5GAM j;  2WSF E;  1KQS A;  2DVJ A;  4XTZ A;  1RAI B;  2A28 A;  3G71 T;  1TWB A;  1NJI U;  4ME7 A;  4KH1 B;  2XK0 A;  3DLM A;  3CCQ T;  3G4S Q;  5FRN A;  2A37 A;  2QTX A;  3ASK A;  4N4H A;  5GAO q;  2DKG A;  2JNG A;  3EGX B;  5ECA A;  5FWC A;  1NPP A;  4DBQ A;  1HYO A;  5LL6 S;  1TXQ A;  5LJ3 d;  2NYS A;  4OF1 A;  2YT6 A;  3SHW A;  2ESW A;  1HXD A;  2RHU A;  3J7A F;  1OPL A;  4OML A;  2P0Q A;  1UGQ B;  1VYU A;  3FRN A;  3HTR A;  4C0D C;  3N5B B;  3OMC A;  1VQ7 T;  2FPD A;  1VQL A;  1D3B B;  2RQR A;  1VIF A;  1K76 A;  1AWX A;  3M4Y A;  3CXC S;  1KHI A;  1Y07 A;  2OI3 A;  4JRQ A;  1RUW A;  4PJN A;  1QKX A;  2EQM A;  4HVW A;  3U23 A;  4C92 B;  3V7S A;  3PT9 A;  2KXD A;  2FEI A;  4CC2 A;  1PG5 B;  1ZHI A;  2A0F B;  1Y96 B;  2K5L A;  1V76 A;  3E19 A;  2EYX A;  1YJW T;  2O88 A;  4PJO F;  5J26 A;  4DA4 A;  2KXC A;  1WI7 A;  4FYY B;  3CMA Q;  5GMK h;  4J5Y A;  2DBM A;  5I22 A;  1PCX A;  3NGP A;  3EG2 A;  1X2Q A;  2PVD B;  5GMK m;  5KYY B;  4QVC A;  2ZPB B;  3JB9 J;  3NMZ C;  2Y90 A;  4QVD A;  2OTJ T;  4LNP A;  5GAN 2;  5CKE A;  5FW9 A;  3OS2 A;  3INZ A;  2SEM A;  1RL2 A;  4RTT A;  2CP3 A;  2OTL Q;  2CSI A;  1OEB A;  3I55 Q;  1KHC A;  3I5R A;  2DO3 A;  4PJJ A;  2A7Y A;  3CD6 A;  1VQP T;  3LH0 A;  1VQN Q;  1TSF A;  4CC4 B;  2DYI A;  4M78 A;  2LTO A;  2XU8 A;  3MPU B;  2KK4 A;  4HXJ A;  1K8A R;  1YN8 A;  3KBG A;  4GLK A;  2F5T X;  2QEX A;  3MEU A;  4C8Q D;  2YHT A;  1M2O A;  1NG2 A;  2CP6 A;  5GMK j;  2DTH A;  4IKF A;  3MET A;  1W1F A;  4KUD K;  4P5N A;  4M77 F;  1ZA1 B;  1M1K C;  3QZ9 B;  3SEM A;  4JUV A;  1W70 A;  3VS0 A;  4ATO A;  3NTI A;  1PRM C;  2F5K A;  1NM7 A;  1VOM A;  1RLQ C;  5DLQ E;  3NFC A;  2DZC A;  5HY6 A;  1JJ2 P;  1OX8 A;  4RUG A;  5KE3 A;  4BI4 A;  2OTJ Q;  4E7L A;  1AZE A;  3NHN A;  1AVZ C;  2ZZD A;  2NUZ A;  3EFO A;  2K3Y A;  5CKD A;  2CRE A;  4RTV A;  3PMI A;  3KUF A;  2YUO A;  2R58 A;  2BE9 B;  2YDL A;  2FB7 A;  5EC7 A;  3DB3 A;  3CME T;  1YHQ A;  2H8H A;  5DM7 R;  4PJO A;  1K9A A;  4PJO G;  3GOX A;  5CR2 A;  2BIV A;  1RI9 A;  2DJZ A;  1X6G A;  2WAC A;  1K9M R;  3MEV A;  3FJ5 A;  3CCS Q;  2XDP A;  5I11 A;  4C0G A;  1PD0 A;  3QSU A;  3ZEH A;  1LJO A;  3G6E Q;  1N8R C;  2PVG B;  2R57 A;  3RKY A;  5D6W A;  2LC4 A;  2D1X A;  4AFS C;  1AEY A;  1NEG A;  1G3W A;  1W2B P;  2F69 A;  4FT4 A;  1U3O A;  2DBK A;  2DL8 A;  3CBO A;  3DB4 A;  2CUB A;  2EJ9 A;  1Q82 R;  3THK A;  4FW1 A;  2CUD A;  2ZPH B;  2LX9 A;  5CCA A;  3SWN C;  2EKH A;  4A53 A;  3L2Q A;  1Q7Y U;  2JTM A;  2K6D A;  2PUO B;  2XDD A;  2J05 A;  8ATC B;  3VKI A;  3OYL A;  1GFD A;  3X24 B;  3OBW A;  3CCS A;  4QKU A;  4M78 B;  4OMP A;  1BK2 A;  4KT0 E;  1PNJ A;  4L6V 5;  2DIL A;  2CT4 A;  4J6Y A;  2D0N A;  2AT1 B;  5FU7 B;  3CC2 Q;  1M3A A;  1QVP A;  4M77 C;  4Q5W A;  4FM4 B;  3LWI A;  1FWZ A;  4NL2 A;  2FO0 A;  2K57 A;  1QVF A;  2XMF A;  3CD6 T;  1QMC A;  1WHL A;  3RKX A;  4EPC A;  5I2M A;  1NE8 A;  3MJX A;  3OSS C;  4QVZ A;  1KC8 U;  2K3B A;  2ZPI B;  2JN0 A;  1YIJ T;  4A4H A;  3CME A;  3OYG A;  2C0O A;  1VQ8 T;  4OB1 B;  2M02 A;  3M56 A;  4M7A C;  1NEB A;  3SD4 A;  1F1B B;  3I5S A;  3NTH A;  4R56 A;  3OS5 A;  3MEA A;  3EFO B;  2NLU A;  1RAH B;  2M9U A;  4LD6 A;  3MEW A;  2D6F A;  2CP5 A;  4OB3 B;  4RTY A;  1UGS B;  1H64 1;  4J9C A;  1YFN A;  2D9T A;  3QBY A;  3REA B;  5KYN A;  2L3P A;  4C0F A;  2RHI A;  5LJ5 g;  2LRQ A;  4HCB A;  3A8H B;  4BY6 C;  4HCK A;  4M75 B;  1ZSG A;  1VQ5 Q;  1VQM T;  2JVV A;  2DAQ A;  3I55 A;  3PVQ A;  2OTL A;  1SRM A;  1M8V A;  1PD1 A;  3H8Z A;  1VQ9 T;  4EMK A;  1CKA A;  4WF2 A;  4Z88 A;  4ELZ C;  1JJ2 A;  1BBZ A;  3LGF A;  1OQK A;  1SKU B;  4II1 A;  3LYI A;  2KVQ G;  2FYK A;  3OA6 A;  1VQL T;  3FJP A;  1BB9 A;  4FYX B;  4OB2 B;  2O2O A;  3EGU A;  5HK3 A;  2X4X A;  2LZ6 B;  5DLO A;  1VQ4 Q;  1WIE A;  1LPL A;  2AKL A;  4EMH A;  1ZUK A;  3CCS T;  4QQD A;  3EHR A;  5A0D A;  3OW2 A;  1FX7 A;  1ABQ A;  1VQP A;  4PL6 A;  1O75 A;  1HD3 A;  3OY9 A;  3G6E T;  2KMT A;  2VYT A;  1VYT A;  1BYM A;  2X51 A;  4NOY A;  2O9S A;  1RLP C;  4LUE A;  6AT1 B;  4C5E A;  3M4G A;  1GCQ C;  2QGG A;  4OGE A;  1KQ1 A;  1JXO A;  3A98 A;  1M1F A;  2RMO A;  2RI3 A;  2E41 A;  3QDR B;  3BY7 A;  2CZ7 B;  2JS0 A;  4BUG A;  1YWO A;  4KUI A;  3QG1 A;  2L8D A;  4J9G A;  2OTJ A;  3G4S A;  1UHC A;  4C5G A;  1KFZ A;  1R77 A;  1Q81 U;  5GAO r;  3JCM e;  5FRM A;  2KT1 A;  2OTL T;  1TUG B;  2DFU A;  1IGU A;  3EG1 A;  5IN1 A;  5GAN g;  3HP9 A;  1UG1 A;  4RMO A;  4Z02 A;  2YUN A;  2YRC A;  4PFZ A;  1ABO A;  3MP8 A;  4AT1 B;  2K7A A;  1GXI E;  4ZN3 A;  1BI3 A;  3PIO A;  4MMK A;  3JCM f;  2OAU A;  4IUP A;  1OV3 A;  1PM3 A;  4ZGE B;  3OYN A;  4XTV A;  2RM4 A;  2LNH B;  3QJY A;  1N27 A;  1BI0 A;  1FXX A;  4C5H A;  2ZPF B;  2K79 A;  1OPK A;  3GP8 A;  2E5K A;  4M78 F;  3RMS A;  3V8K A;  1TS9 A;  2LNV A;  1UE9 A;  5GAO p;  1G3Y A;  1Q81 R;  1AWJ A;  1WX6 A;  2FRY A;  1CKB A;  3OB9 A;  3ZFJ A;  1W2B S;  2DE0 X;  2EIF A;  4A63 B;  4BE0 A;  3EG3 A;  1I8F A;  1D1A A;  3VRZ A;  3ZBD A;  3CMA T;  3GIB A;  2CP7 A;  4JRK A;  1R0C B;  2KDS A;  1NJI R;  4F14 A;  2E12 A;  4FCY A;  2KT8 A;  1WXB A;  3GBQ A;  2DEU A;  3JCM b;  4R55 A;  3C94 A;  2LDM A;  4IIO A;  1M3B A;  3TEE A;  2GCX A;  1YJN Q;  1QWF A;  1VQM Q;  2ECZ A;  1JBM A;  3QHS A;  4RCC A;  2CH4 A;  1I5L A;  1C0M A;  2JTF A;  2IPO B;  3TSW A;  2ZAE A;  3CC7 T;  5GAN 7;  3C4S A;  2KE9 A;  1YJ9 Q;  2HKN A;  4A4F A;  4MDX A;  4PJO C;  3OSV A;  2DIG A;  1UJ0 A;  2K9G A;  1TU0 B;  3ULR B;  1RAF B;  3JV3 A;  3E9G A;  1N8R R;  3L1A A;  3H0I A;  4KH0 B;  4HKE A;  3WVE B;  1UGV A;  5LJ3 e;  3PNW C;  3VUB A;  3BE3 A;  5FLX E;  2VWF A;  5FU7 C;  3UAT A;  1PRL C;  1K9M C;  4N4I A;  2C0T A;  4CRI A;  2ZGW A;  1TOV A;  3CPW A;  3EH1 A;  1BU1 A;  1Y0M A;  2BE7 D;  4PNO A;  1MND A;  2KRN A;  3I35 A;  2EQU A;  9ATC B;  2VGN A;  1SPK A;  2GNC A;  1NBE B;  1BI1 A;  2LQK A;  3VUZ A;  1C6V X;  5I2S A;  4C92 C;  1X01 A;  1JEG A;  2LMJ A;  1WGS A;  2L5Q A;  2MWP A;  3VJP A;  1JQQ A;  2F2X A;  4A4K A;  3QJ6 A;  2LQ8 A;  4JRI A;  1WA7 A;  2FPE A;  4OMF B;  2B8A A;  4DOV A;  1M1K R;  2MCN A;  1VIE A;  1KD1 U;  2CGH A;  2AZV A;  2G3R A;  2GTO A;  2K4Y A;  1DJ7 B;  4FIB A;  2DLP A;  5KYX A;  4M7A A;  3CC2 A;  5CQY A;  3VU3 C;  1OZ3 A;  3JB9 I;  5A2Q E;  2P0K A;  3EGX A;  1JO8 A;  4J9E A;  1ZUU A;  3TQ7 P;  4JRP A;  4C92 E;  1RAC B;  1KD1 R;  5GAO m;  4O5V A;  2COZ A;  3CCV A;  4JS4 A;  2JM8 A;  3GNG A;  4LXC A;  2E1H A;  4D8D A;  3VYH B;  5LJ5 f;  1D09 B;  3QXE B;  1JJ2 S;  2Z0W A;  5GAN 3;  1VQ9 A;  4M77 B;  3GLX A;  3X25 B;  1QVG A;  1TUD A;  1MMD A;  1WHM A;  2IG0 A;  2JZ2 A;  4VUB A;  3O5Z A;  3SB2 A;  5M9O A;  1N8R U;  1QWE A;  2JTE A;  1MMA A;  3TSZ A;  2F2W A;  3CC7 A;  4PLL A;  2D8H A;  3OMG A;  2LVM A;  4WTO B;  4B6M A;  3UPU A;  2VKN A;  1ZQ1 A;  5L23 A;  1NJI C;  1K0X A;  2EGE A;  2ROT A;  1MNE A;  2K3X A;  3JRZ A;  3M0U A;  4LDV A;  4E7J A;  3M0R A;  4HVV A;  4A54 A;  3CCJ T;  5CO7 A;  2KY9 A;  2CYZ B;  2RI2 A;  1BKB A;  2J6F A;  3CCR Q;  4JDS A;  2EWN A;  4RTW A;  1Q81 C;  2B86 A;  2RI5 A;  1P92 A;  4HVU A;  5GAN h;  3LX7 A;  2CKK A;  1X69 A;  1EX4 A;  2DIQ A;  3FDR A;  2XG8 D;  4KGZ B;  3QKJ A;  2K5F A;  1WXT A;  5KYW A;  3M55 A;  2EAY A;  3CQT A;  2MK5 A;  3EH2 A;  1OI1 A;  3MKD A;  2QA4 Q;  3EFR A;  4C8Q B;  1SEM A;  2CS7 A;  2QQA A;  2O31 A;  2GBQ A;  3D7S B;  5GAN 4;  1M3C A;  2YLC A;  4IUV A;  3PTA A;  3BDU A;  4HCZ A;  3RIR A;  5LJ3 f;  2K2M A;  1C1A A;  1PWT A;  3QPH A;  2V8I A;  5HK0 A;  1MUZ A;  2EGA A;  4M77 E;  1WQW A;  2ED1 A;  2E5Q A;  3JCM J;  2E6N A;  2RO0 A;  2MOX A;  1KC8 R;  5CIU A;  3JAM E;  1JRI A;  4JS5 A;  5L8R E;  3CXC P;  3CCL A;  4FL6 A;  2HQE A;  3CC2 T;  2CZ1 B;  3CCR T;  4E6R A;  4R0K A;  4XTW A;  3FLG A;  3V8J A;  1EIF A;  2XID A;  4L59 A;  4JJD A;  2VXE A;  5LJ5 j;  3HPW A;  3UA6 A;  3TCJ A;  1MV3 A;  1N6A A;  4MZM A;  2OX7 A;  5AYF A;  2EKO A;  2XD0 A;  4M7D A;  2K2V A;  1T0J A;  2AIR B;  5D6X A;  4M7D F;  4A4E A;  5IXF A;  5GAO n;  4M7D C;  1AD5 A;  5GAN f;  4GLM A;  4J9B A;  1IHV A;  1N9R A;  2QQ9 A;  1VQK Q;  2RK2 A;  2LX7 A;  3BDL A;  2SRC A;  1Q95 G;  1VQ5 A;  1YCY A;  3CCV Q;  3O8V A;  2PU9 B;  2HBP A;  2HZY A;  3OYE A;  3HFN A;  4J6W A;  3OYF A;  4J9I A;  2X3W D;  4M75 C;  5FRO A;  1S72 T;  2H3E B;  2RHY A;  2EQI A;  4M75 A;  1X2K A;  4OMO A;  2DXC A;  2EGC A;  4PJO E;  2WSC E;  1K8A U;  1SF9 A;  2RF0 A;  4LDW A;  4L5G A;  2L0A A;  1YIT T;  1YP5 A;  1G2B A;  4F17 A;  2CZ0 B;  1FMV A;  5LJ3 h;  4BI3 A;  2V1R A;  3OW2 S;  2YUQ A;  3C12 A;  4EDU A;  2CH4 W;  2KI7 A;  2EVR A;  2EJG A;  4HT9 A;  5KYU B;  3R6O A;  4C8Q E;  2FHD A;  1ZBX A;  4F7U F;  1M90 U;  3OYI A;  2RK1 A;  2J7I A;  1VQO T;  5CVI A;  2KNB B;  3DLL A;  2HQH A;  4C0Z A;  3FC3 A;  1K73 R;  1QCF A;  1D0Y A;  1VQN T;  1IXD A;  2M0O A;  3TVT A;  1HSQ A;  2DTO A;  2HL3 A;  3H0H A;  1WYX A;  1G3S A;  1M5Q 1;  4ANJ A;  4C8Q A;  4ESR A;  1K73 U;  4M78 D;  2NWM A;  5IH2 A;  4MML A;  4OGC A;  1D3B A;  1V29 B;  2VAS A;  5IHI A;  2BUD A;  3JCM c;  3ME9 A;  3L2R A;  1TH7 A;  1UB4 A;  4OMQ A;  1WHG A;  1YIT Q;  4DEY A;  3CC4 A;  2QAZ A;  1WLP B;  1NLP C;  4O6J A;  2EQK A;  1Q7Y C;  3CC7 Q;  1VQ6 T;  2RHZ A;  5GAN 5;  4M75 E;  3OS0 A;  4OP0 A;  2XI9 A;  2KGT A;  2HEQ A;  3QUI A;  2NUP A;  1U1T A;  1BIA A;  2HL5 C;  3CCE T;  2OJ2 A;  1VQK A;  2QTV A;  4XK8 E;  2Y4X A;  4F16 A;  1XOV A;  4OVA A;  2RQV A;  3MCA B;  4BAC A;  1YI2 Q;  5GMK i;  4BY6 B;  1M8M A;  2LP5 A;  2DMO A;  1UHF A;  2DNU A;  3V7R A;  3CCU A;  3UA7 A;  4V2S A;  1OOT A;  2RPN A;  2C06 A;  4C8Q F;  2BZ8 A;  2QI2 A;  2RJD A;  1GFC A;  2LCC A;  5GAO l;  4E7K A;  3PVL A;  3JB9 G;  1RAB B;  2FZC B;  2VGM A;  2KQW A;  3CPW P;  2HDA A;  5CKH A;  4M77 A;  3WXM B;  1W4S A;  4JLI A;  3VYG A;  2QG9 B;  2L3S A;  1LNX A;  3M0T A;  1J3T A;  1Y71 A;  3CBM A;  4Z89 A;  1WHH A;  1RAE B;  3OBY A;  1MHN A;  2CP2 A;  3VRY A;  1NZ9 A;  1S1N A;  3I9Q A;  4XTU A;  2HNI A;  3HRU A;  4BDZ A;  1WDX A;  4FYW B;  5KCO A;  4JZ4 A;  2GFU A;  4GBQ A;  4QQG A;  4EMG A;  3VS2 A;  4FU6 A;  3GNF B; 
#chains in the Genus database with same CATH homology
 3V7S A;  3PT9 A;  3M59 A;  2RJC A;  3S6W A;  3CXC A;  1WQ7 A;  1ZHI A;  3MP1 A;  1Y96 B;  2GF7 A;  2K5L A;  3RUX A;  3E19 A;  1VQN A;  5IAY A;  3CC7 T;  4M75 F;  3JCM X;  5GAN 7;  4Y28 E;  4X9C A;  3JB9 D;  1YJW T;  3C4S A;  1VQ6 A;  4PJO F;  2DPP B;  5J26 A;  2DTI A;  2I2L A;  4A4F A;  5HKC A;  4DA4 A;  4MDX A;  4PJO C;  2O4X B;  2PVO B;  2DD4 A;  3M5A A;  5GMK h;  4J5Y A;  4BI8 B;  3M58 A;  3OSV A;  2DIG A;  4N0A A;  3PGG A;  3Q1J A;  2PVD B;  3E9G A;  4F7U E;  5GMK m;  4QVC A;  3L1A A;  2EJF A;  5LJ3 g;  3I56 A;  3OYJ A;  2ZPB B;  4HKE A;  3JB9 J;  3VV0 A;  3PIP A;  4M77 D;  2Y90 A;  3WVE B;  4QVD A;  5LJ3 e;  3E1S A;  4XU0 A;  1YJ9 T;  3FB9 A;  4TVR A;  2OTJ T;  5GAN 2;  3PNW C;  3VUB A;  4J83 A;  5CKE A;  3OS2 A;  2E64 A;  1K9M U;  2XHC A;  2EQJ A;  3INZ A;  4M77 G;  5FLX E;  1R8O B;  4IUT A;  3QII A;  1RL2 A;  4RG2 A;  4PJO B;  5FU7 C;  2E70 A;  1K9M C;  4N4I A;  4BB7 A;  4CRI A;  2ZGW A;  3LW5 E;  5GMK l;  3CPW A;  2JOY A;  4BE1 A;  3FIF A;  1KHC A;  2FL7 A;  2DO3 A;  3RES A;  2A7Y A;  4PNO A;  3CD6 A;  4HA8 A;  1VQP T;  2EQU A;  3A8G B;  5DY9 A;  2VGN A;  3LH0 A;  3SWN A;  4M78 A;  2LTO A;  1BI1 A;  3BFM A;  5J3B A;  2LQK A;  2XU8 A;  3VUZ A;  3G6E A;  2DEQ A;  2KK4 A;  1WPY A;  5I2S A;  4C92 C;  1X01 A;  1K8A C;  2RH2 A;  3CMA A;  3LWH A;  4J7F A;  1WGS A;  4C92 A;  4NS5 A;  2L5Q A;  4LDU A;  3KBG A;  2MWP A;  4GLK A;  2F5T X;  3VJP A;  2QEX A;  4F7U B;  3MEU A;  4C8Q D;  2YHT A;  5I21 A;  1VQM A;  4E47 A;  2PUK B;  4A4K A;  5GMK j;  3QJ6 A;  2LQ8 A;  4JRI A;  2DTH A;  1VUB A;  2DXU A;  3MET A;  1QVG S;  4IKF A;  2R5M A;  2ZPE B;  3G7Z A;  3CCE A;  1RI0 A;  4P5N A;  4C92 B;  4JJN K;  4KUD K;  3CCU T;  3QYG B;  4M77 F;  4OMF B;  1M1K C;  3CEY A;  3OYB A;  3QZ9 B;  1VQ4 A;  3F70 A;  4JUV A;  2B8A A;  3G71 A;  4DOV A;  4ATO A;  5C6S A;  3NTI A;  1YJW A;  3H6Z A;  2F5K A;  1VIE A;  2QQB A;  5A0G A;  1KD1 U;  2CGH A;  2G3R A;  3M53 A;  4F7U G;  2K4Y A;  2IVW A;  5DLQ E;  3NFC A;  1DJ7 B;  2DZC A;  5HY6 A;  4DQ2 A;  4FIB A;  1WJR A;  2X4W A;  5KE3 A;  5J39 A;  4M7A E;  4BI4 A;  4YTL A;  4M7A A;  3CC2 A;  4E7L A;  1IRE B;  5CQY A;  3VU3 C;  4X9D A;  1OZ3 A;  2ZZD A;  3JB9 I;  4XU3 A;  5D6Y A;  5A2Q E;  2P0K A;  2K3Y A;  5CKD A;  3J80 E;  2DD5 A;  1KQ2 A;  3PMI A;  4JRP A;  1M1G A;  2RJE A;  3KUF A;  2R58 A;  4C92 E;  4ZTF A;  2YRV A;  3GF5 A;  4C92 D;  5GAO m;  1NPR A;  2FB7 A;  4O5V A;  1QVF S;  3CCV A;  1O9S A;  2E65 A;  4JS4 A;  1WJQ A;  2QQS A;  3DB3 A;  3GNG A;  2KAF A;  2E1H A;  5DM7 R;  3CME T;  1YHQ A;  3VYH B;  5CK9 A;  5LJ5 f;  4PJO A;  3QXE B;  4PJO G;  3GOX A;  5CR2 A;  1JJ2 S;  1M4Z A;  2BIV A;  2DJZ A;  5GAN 3;  1VQ9 A;  4M77 B;  4M75 D;  3KXT A;  2WAC A;  3GLX A;  3X25 B;  1QVG A;  2D0Q B;  2RHX A;  2X35 A;  3MEV A;  3HFO A;  3JCM V;  1Q86 C;  2XDP A;  4C0G A;  1KG1 A;  3QSU A;  2IG0 A;  2JZ2 A;  4VUB A;  3RKW A;  1LJO A;  4KUL A;  3SB2 A;  3JCM g;  3ZEH A;  5M9O A;  1N8R U;  3HL8 A;  2XDB A;  2LT1 A;  3CCL T;  3CC7 A;  4BD3 A;  1N8R C;  4PLL A;  3UDC A;  1B34 A;  2DXT A;  2PVG B;  2R57 A;  3A8L B;  3P8H A;  3RKY A;  5D6W A;  1S72 A;  4XU2 A;  2LC4 A;  3OMG A;  5C0M A;  1G3W A;  5GAM f;  1Q86 U;  2LVM A;  2F69 A;  2LT4 A;  4FT4 A;  1OYX A;  5GAN e;  3UPU A;  3CBO A;  4M78 E;  3DB4 A;  2R5A A;  3CPF A;  2EJ9 A;  1ZQ1 A;  3CCR A;  1BIB A;  5GAN d;  2ZPH B;  1NJI C;  3A5Z B;  4XQ3 A;  2LX9 A;  4XU1 A;  5CKB A;  5CCA A;  2WSE E;  1OZ2 A;  3SWN C;  3JRZ A;  2K3X A;  4LDV A;  4E7J A;  3HSB A;  4N4G A;  4J8O A;  4A54 A;  4C92 G;  1B34 B;  3HRT A;  3NTK A;  4A53 A;  3L2Q A;  3CCJ T;  3MP6 A;  3EFS A;  1Q7Y U;  5CQX A;  5CO7 A;  2KY9 A;  2JTM A;  2PUO B;  2CYZ B;  2RI2 A;  1BKB A;  2XDD A;  4M7A G;  3VKI A;  3OYL A;  4MZP A;  4JDS A;  3X24 B;  2EWN A;  3OBW A;  3CCS A;  1WNL A;  1Q81 C;  2MAM A;  3S3O A;  4MDW A;  2RI5 A;  4M78 B;  1P92 A;  4RKU E;  1UEB A;  2P0P A;  4XAX B;  4KT0 E;  2E10 A;  5GAN h;  3LX7 A;  4L6V 5;  4QQ6 A;  4J6Y A;  5CAI A;  5GAN 6;  5FU6 B;  2CKK A;  5FU7 B;  1QVP A;  5IT9 E;  4M77 C;  2DIQ A;  3FDR A;  4FM4 B;  4Q5W A;  3C95 A;  1U1S A;  3LWI A;  3RER A;  1G5V A;  1FWZ A;  4M75 G;  2XG8 D;  2K57 A;  4NL2 A;  1YJN T;  5A0L A;  1QP3 A;  3S3M A;  3QKJ A;  1QVF A;  2V8J A;  4RCB A;  1YI2 T;  2K5F A;  3CD6 T;  3FEO A;  3M55 A;  2EAY A;  2VV5 A;  2MF2 A;  3V8L A;  3CCM A;  3RKX A;  4EPC A;  1OI1 A;  2M16 A;  1VQK T;  3EFR A;  4C8Q B;  5I2M A;  1NE8 A;  2CS7 A;  4C0D B;  3QO3 A;  2QQA A;  3JCM W;  3OSS C;  4QVZ A;  4HT8 A;  1KC8 U;  3CCV T;  5GAN 8;  2ZPI B;  2JN0 A;  5GAN 4;  2YLC A;  1YIJ T;  4IUV A;  2JUF A;  2RA2 A;  3BDU A;  5FU6 C;  4A4H A;  4HCZ A;  3RIR A;  5LJ3 f;  4ZGJ B;  3PTA A;  2K5I A;  1MGQ A;  2X4Y A;  4M7D G;  3CME A;  1VQ4 T;  1KC8 C;  1X6O A;  3OYG A;  3QPH A;  4OB1 B;  1VQ8 T;  2V8I A;  3M56 A;  2ZPG B;  1JB0 E;  4M7A C;  5HK0 A;  3X26 B;  4M77 E;  2GQV A;  3P8D A;  1WQW A;  3SWN B;  3SD4 A;  4ZN1 A;  4M7D E;  2O01 E;  2E5Q A;  3NTH A;  4R56 A;  2E6N A;  2RO0 A;  3JCM J;  4MZT A;  2A3L A;  4C8Q C;  3OS5 A;  4E7I A;  5CIU A;  1SSF A;  2QA4 A;  3JAM E;  2X4J A;  1JRI A;  3MEA A;  3WVD B;  2NLU A;  4JS5 A;  2M9U A;  5L8R E;  3CCL A;  4FL6 A;  2HQE A;  3MEW A;  4LD6 A;  4C92 F;  3CC2 T;  2D6F A;  4OB3 B;  1UGS B;  2CZ1 B;  3CCR T;  1H64 1;  1H3Z A;  2D9T A;  2HQX A;  3L2U A;  3MO8 A;  4LDY A;  3QBY A;  4BDY A;  3E9F A;  4XTW A;  5LJ5 e;  3FLG A;  3V8J A;  1EIF A;  2XID A;  4L59 A;  5LJ3 j;  4CI0 C;  2VXE A;  5LJ5 d;  3JCM d;  3M57 A;  4C8Q G;  5LJ5 j;  2QXF A;  3HHT B;  1BI2 A;  3HPW A;  1XQH A;  4QW2 A;  3TCJ A;  1N6A A;  2EFI A;  3OYY A;  4MZM A;  4C0F A;  2RHI A;  5AYF A;  5LJ5 g;  2LRQ A;  2EKO A;  2DVE A;  4HCB A;  2XD0 A;  4M7D A;  2K2V A;  3A8H B;  4BY6 C;  1XTD A;  1YHQ T;  3LGL A;  5D6X A;  4M7D F;  5KE2 A;  4FT2 A;  2HD0 A;  4J6X A;  4M75 B;  4A4E A;  3OYC A;  5GAO n;  1WJS A;  3HKS A;  5KCH A;  3CPW S;  4M7D C;  5GAN f;  1VQM T;  2YLB A;  1I81 A;  2JVV A;  2DAQ A;  1Y96 A;  3I55 A;  1KQS S;  2OTL A;  1G3T A;  1N9R A;  3DKM A;  2E6Z A;  2QQ9 A;  3UWN A;  2QA4 T;  2RK2 A;  1M8V A;  4OB0 B;  3CCQ A;  3BDL A;  2ZCF B;  1QW1 A;  3G4S T;  4BE2 A;  3H8Z A;  1VQ5 A;  1YCY A;  4FSX A;  4X34 A;  1VQ9 T;  3O8V A;  2PU9 B;  2HBP A;  1M1K U;  1PSE A;  4EMK A;  4KBM B;  3OYE A;  4WF2 A;  3L2V A;  4ELZ C;  3GPL A;  3OYD A;  3HFN A;  3OS1 A;  2KSS A;  3PFS A;  4M7A B;  4J6W A;  1JJ2 A;  3LGF A;  4EMK C;  1IZ6 A;  3OYF A;  2QDY B;  4M75 C;  5FRO A;  2GFA A;  1PSF A;  4II1 A;  1S72 T;  2RHY A;  1Q82 C;  3PMT A;  3M54 A;  2MI6 A;  3LYI A;  3QYH B;  4M75 A;  3CCM T;  2KVQ G;  2DXC A;  2FYK A;  4PJO E;  2DZ9 A;  4ELY C;  3OA6 A;  1VQL T;  2WSC E;  3FJP A;  2BKD N;  2DXB A;  5GAM g;  3OYA A;  1K8A U;  4LDW A;  2M1H A;  4L5G A;  4UC4 A;  2XKO C;  4OB2 B;  1YIT T;  1YJ9 A;  1K73 C;  3S3N A;  2CZ0 B;  5LJ3 h;  5CKF A;  1M9S A;  5HK3 A;  2X4X A;  4BI3 A;  3OW2 S;  2DK3 A;  2RJF A;  5DLO A;  1VQ7 A;  3L2W A;  1N9S A;  3C12 A;  4EDU A;  4EMH A;  3HRS A;  2HAX A;  2H3J A;  3RMQ A;  4QQD A;  4IUQ A;  5KH6 A;  3CCS T;  1W2B A;  1Q82 U;  2EJG A;  2Y4Y A;  4HT9 A;  4DOW A;  2RB6 A;  1FX7 A;  4Y91 A;  3R6O A;  5A0D A;  4C8Q E;  3OW2 A;  1VQP A;  2FHD A;  3JCM h;  1UGP B;  5GAM d;  4PL6 A;  5LJ5 h;  1ZBX A;  1O75 A;  2MWO A;  4F7U F;  1M90 U;  3X20 B;  3ER0 A;  3OY9 A;  1I4K 1;  3OYI A;  3JCM Q;  3G6E T;  2RK1 A;  1YJN A;  3JB9 H;  1VQO T;  3L2Z A;  5CVI A;  2XIC A;  2KMT A;  3DLL A;  4M7A F;  4C0Z A;  3FC3 A;  2MMP A;  2VYT A;  4HCC A;  1VQN T;  3X28 B;  1BYM A;  2O4X A;  4ZGD B;  4NOY A;  3OYM A;  1KD1 C;  3V7C A;  2M0O A;  3P8B B;  4NL3 A;  4C5E A;  3M4G A;  4OGE A;  3QZ5 B;  1KQ1 A;  3I56 T;  4PKC C;  2DTO A;  2VUB A;  1M1F A;  3URG A;  2RI3 A;  2E41 A;  4EMK B;  1YI2 A;  1G3S A;  1M5Q 1;  3QDR B;  3JB9 F;  3CBP A;  4LDX A;  3BY7 A;  4B9X A;  4C8Q A;  2CZ7 B;  4PJO D;  1K73 U;  4BUG A;  2P4T A;  4M78 D;  2VXF A;  4KUI A;  3QG1 A;  3AHU A;  3OYH A;  4MML A;  4OGC A;  2L8D A;  2OTJ A;  3L42 A;  3G4S A;  1VQ5 T;  1D3B A;  4C5G A;  4N0A C;  1M90 C;  1V29 B;  1Q81 U;  1VQ8 A;  5GAO r;  1YIJ A;  3JCM e;  3BW1 A;  5FRM A;  4M7D D;  2BUD A;  3EAE A;  3JCM c;  3ME9 A;  2VC8 A;  2OTL T;  3L2R A;  5GAM h;  1TH7 A;  5IN1 A;  5GAN g;  4E7H A;  1UB4 A;  4LD9 K;  3HP9 A;  5GAN j;  3CC4 A;  4RMO A;  4C5I A;  4O6J A;  4XTY A;  2CZ6 B;  4Z02 A;  1AHJ B;  2EQK A;  3MP8 A;  4PLI A;  1Q7Y C;  1VQ6 T;  5EG2 A;  2RHZ A;  3LLR A;  1GXI E;  5GAN 5;  3A8O B;  4M75 E;  3TRE A;  4ZN3 A;  1BI3 A;  3OS0 A;  2PQW A;  4B9W A;  3PIO A;  4M7A D;  1XNI A;  2QQR A;  3M9Q A;  4MMK A;  3JCM f;  3A8M B;  2OAU A;  4GY5 A;  4IUU A;  4IUP A;  4OP0 A;  2XI9 A;  1YIT A;  4F7U A;  2L3R A;  1U8R A;  4ZGE B;  3OYN A;  2EYQ A;  1X75 C;  2FVU A;  4XTV A;  3QUI A;  4A4G A;  5GAM e;  1U1T A;  1BIA A;  2AHJ B;  2RM4 A;  3QJY A;  3SDZ A;  1N27 A;  3CCE T;  4D6W A;  1HK9 A;  1BI0 A;  1FXX A;  2RD1 A;  4C5H A;  3OQ5 A;  5GAM j;  2ZPF B;  1VQK A;  2WSF E;  4XK8 E;  2LCL A;  2QEX T;  2Y4X A;  3GP8 A;  1XOV A;  3JCM P;  4OVA A;  3MCA B;  4M78 F;  4BAC A;  3RMS A;  3OYK A;  3V8K A;  1KQS A;  4XTZ A;  5GMK i;  4BY6 B;  3G71 T;  4M78 C;  2LNV A;  4ZTJ A;  3V7R A;  3CCU A;  4RG8 A;  1NJI U;  1LOJ A;  5GAO p;  2C06 A;  4V2S A;  4C8Q F;  1G3Y A;  4M7D B;  4ME7 A;  2QI2 A;  2XK0 A;  3DLM A;  3CCQ T;  5FRN A;  2RJD A;  3OB9 A;  2QTX A;  3ZFJ A;  3ASK A;  2LCC A;  4N4H A;  3UT1 A;  5GAO l;  4E7K A;  1W2B S;  2EIF A;  5GAO q;  2DKG A;  2JNG A;  3JB9 G;  4BE0 A;  1NPP A;  2VGM A;  1I8F A;  2KQW A;  3JSC A;  3T9N A;  3ZBD A;  1VQO A;  5CKH A;  4M77 A;  1QP2 A;  5LL6 S;  5LJ3 d;  1YBY A;  3WXM B;  1W4S A;  4JLI A;  3CMA T;  3GIB A;  4JRK A;  3VYG A;  4OF1 A;  2KDS A;  1LNX A;  1HXD A;  1Y71 A;  2E12 A;  3CBM A;  2RHU A;  3J7A F;  3OBY A;  1MHN A;  5GMK e;  3CCJ A;  1NZ9 A;  1Y7X A;  2P0Q A;  1UGQ B;  2V8K A;  3JCM b;  3FRN A;  4R55 A;  3C94 A;  2LDM A;  4XTU A;  4C0D C;  3N5B B;  2HNI A;  3OMC A;  1VQ7 T;  3HRU A;  3MHX A;  3TEE A;  2GCX A;  1D3B B;  4BDZ A;  3J81 E;  3TU4 K;  1VQL A;  4JLG A;  4M78 G;  1VIF A;  3M4Y A;  5KCO A;  1UGR B;  2L89 A;  1JBM A;  1KHI A;  1Y07 A;  2GFU A;  3QHS A;  4J7I A;  4XTX A;  3CXC S;  4RCC A;  4QQG A;  1I5L A;  4EMG A;  4JRQ A;  4FU6 A;  3I55 T;  3SFM A;  2EQM A;  3CC4 T;  4IUR A;  2JTF A;  3GNF B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...