3JCMc

Cryo-em structure of the spliceosomal u4/u6.u5 tri-snrnp
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
92
structure length
92
Chain Sequence
b'MLFFSFFKTLVDQEVVVELKNDIEIKGTLQSVDQFLNLKLDNISCTDEKKYPHLGSVRNIFIRGSTVRYVYLNKNMVDTNLLQDATRREVMT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pre-mRNA-splicing factor 8
publication title The 3.8 angstrom structure of the U4/U6.U5 tri-snRNP: Insights into spliceosome assembly and catalysis
pubmed doi rcsb
molecule tags Transcription
total genus 14
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2015-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
c PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3jcmc00
3HFNA 3RKXA 5GAOn 4M7AD 4C92C 4XU3A 1HK9A 5I21A 5GAN3 4C8QA 3JCMc 4QVDA 4PJOD 4M77D 5LJ5h 5LJ3d 5DY9A 3V8LA 5LJ5j 4F7UA 5GAN7 3JB9D 4NL2A 1LNXA 3JCMP 2YLBA 4M77F 3QUIA 4MMKA 3FJPA 4M75G 4C92D 3JCMV 4F7UF 1U1SA 1KQ2A 3RKYA 5GAMd 4XTYA 2EAYA 3JCMQ 3SWNA 2DVEA 4C92B 3HSBA 4X9CA 5GAMh 3JCMW 1I5LA 1N9SA 4M77C 3QO3A 4XTWA 3SB2A 5GMKm 4M7DF 3HFOA 2FYKA 4MMLA 4NOYA 2DXTA 2K57A 4A54A 4M75E 1N9RA 4QVCA 2DZCA 3JB9H 1TH7A 4EMHA 3JCMh 5LJ3e 2E65A 5LJ5d 4M78B 2YLCA 2E10A 1LJOA 4NL3A 1WQWA 4XU0A 4M7AG 4M75A 4DQ2A 4M7DC 3SWNC 4M7AB 4N0AA 2RM4A 3JCMX 4C8QF 4PNOA 4X9DA 4PJOB 4M77B 5GANe 5GAOr 3L1AA 4XTVA 3JB9G 4EMKA 5GAOq 5GMKi 4M78E 3EFSA 5GMKe 3QHSA 5CAIA 3JB9J 3BY7A 4C92G 1KQ1A 1D3BA 3JB9I 4OP0A 5GAN8 5GAOm 4HA8A 4M7DD 4M7AE 1H641 1WPYA 5LJ3f 5LJ3g 3L2ZA 2E1HA 4C8QC 4PJOE 2I2LA 3BDUA 5GAN2 4M7DB 2YHTA 2VXFA 2DTIA 3EFRA 3INZA 4RCCA 4EMGA 1JBMA 4N0AC 4J6XA 1M5Q1 1U1TA 3BW1A 3JCMd 1BIAA 4M78G 3V8JA 1B34B 5GANg 5GANf 2DEQA 4EMKC 1M8VA 4C92E 1Y96B 2EJ9A 4JRKA 4C8QD 3V7SA 4J6YA 3FIFA 4HT8A 3QSUA 4Y91A 2DJZA 4PJOG 4M77G 1WNLA 2EJFA 2FB7A 2E41A 3PGGA 2DXUA 4RCBA 2VC8A 3V7CA 3FB9A 1JRIA 4C8QB 4M75F 3GIBA 3JCMJ 5GAMe 2JN0A 4XTZA 4F7UB 2VXEA 5GANj 1WQ7A 4J6WA 4WF2A 4EMKB 4A53A 3RUXA 2DTOA 3RKWA 5GMKj 2EJGA 4JLIA 4M78A 4M7DG 4XU1A 1HXDA 3JCMe 4M77E 4M75C 3JCMb 4J5YA 3SWNB 4F7UE 4XQ3A 2RB6A 4M78F 2E64A 5LJ5e 4M7AA 5GAOl 4XTUA 5GAOp 5GAN4 4PJOA 2CGHA 1MGQA 2DKGA 4M77A 5GAMf 2QTXA 5GAMg 2DZ9A 3RESA 3V7RA 3AHUA 4M7AF 5GMKl 5LJ3h 2RD1A 4M7DE 4M75D 4PJOF 4C8QG 5LJ3j 2DTHA 4JRIA 3VU3C 2RA2A 4M78C 4C92A 3JB9F 3RIRA 1I8FA 4JUVA 5GANd 3JCMf 3JCMg 4F7UG 4M75B 3RERA 2HNIA 4XTXA 3BFMA 4M7DA 2EWNA 5GAN5 4C92F 5GANh 4M7AC 5LJ5f 5LJ5g 4V2SA 1I4K1 4PJOC 2Y90A 5GMKh 5GAMj 1B34A 5GAN6 4XU2A 3M4GA 4M78D 2ZGWA 1Y96A 4C8QE 4HT9A 3V8KA 1LOJA 1YCYA 1I81A 1X01A 1D3BB 1BIBA
chains in the Genus database with same CATH superfamily
4IUPA 2ED0A 4HKEA 3JCMc 2HCKA 1ARKA 3G4ST 1ZQ1A 1C0MA 1YIJT 1UEBA 3JSCA 1WJQA 1OZ3A 3QYHB 3ZEHA 3CC4T 3NGPA 2O4XA 4E7JA 3I56Q 4QW2A 3G71A 1RI0A 1V76A 2VYTA 3DKMA 2E10A 1T0JA 2R5MA 3OSVA 4XU0A 3OYLA 2D0NA 5D6YA 2VGMA 1YJ9T 2KMTA 3JCMX 4D8DA 5KCOA 2CT4A 5GANe 3CCRQ 1KIKA 4EMKA 5GMKi 1P92A 5FRMA 1VIEA 2QQSA 2CREA 2KY9A 1HJDA 5IHNA 2CKKA 1QLYA 3EFOB 1VQ6A 3GBQA 1D1BA 2F69A 4PFZA 2K2MA 5GANg 4RTYA 2EYZA 1M3AA 4ZGJB 2E6ZA 4PJOG 4LNPA 2EJFA 2VASA 3PGGA 2E41A 1K9MU 1RUWA 2CSIA 2NWMA 3LLRA 2OX7A 2LCSA 2K2VA 1ZSZA 1GBQA 1M90U 2XHCA 2GTOA 3META 2ZAEA 5CQYA 4BE2A 1YITA 3VS7A 1UE9A 3EHQA 1MGQA 3EG0A 1VQ5T 3QBYA 3TREA 1IHVA 1UHCA 4C8QG 3RIRA 4C5IA 4JUVA 1VQLA 4XTXA 2OAWA 1LCKA 2Y90A 2M0OA 1VQOQ 1OU9A 5L8RE 1YJNT 3EH1A 3V8KA 1I81A 4PLIA 5HY6A 1BU1A 5FU7B 5GAOn 2RPNA 2X35A 2V8IA 4ELZC 3X28B 5LJ5h 2XKOC 5LJ5j 3JB9D 3ER0A 4M75G 4F7UF 3JCMV 4Z8AA 4XAXB 4B9XA 5CKFA 2LQ8A 1Q7YU 1V1CA 2GF7A 3CCUA 2DIGA 1XOVA 2JT4A 1NYGA 5LJ3e 5D7UA 1TTHB 2VUBA 1K8AC 2D9TA 4DQ2A 3SWNC 5KYXB 4PNOA 5GAOr 2M1HA 4A4GA 3ZFJA 5CQXA 3JB9J 2EGAA 1FMWA 3RDVA 1RAGB 4QKUA 5DM7R 3L42A 5LJ3g 3OYJA 2QA4A 3KBGA 2EGCA 1QVGA 3NTHA 2YHTA 2W0ZA 3V8JA 2MYSA 3FRNA 2HQEA 4FYYB 3M56A 1YHQQ 2O9SA 2KXCA 2OTLQ 3E19A 3CCQQ 2L5QA 4R56A 3RMQA 2PUOB 1NJIU 1VQNA 4IUUA 2DX1A 1Y7XA 3M0PA 5KYNA 2PUKB 2LQWA 4EMKB 2ED1A 2K6DA 4LDVA 5FU6B 4M78A 4J9GA 1YI2T 3PTAA 5CKBA 1SF9A 1YJWQ 3MHXA 1IREB 2LC4A 2CGHA 1TSFA 2RD1A 2DL8A 2BE9B 5L23A 2ZPBB 2CUDA 1WJSA 2QAZA 2K7AA 3OW2S 1KFZA 1JJ2A 1UGQB 2XICA 4XU2A 2R58A 3M4GA 4C8QE 1QWEA 4BUGA 1BCOA 5HCKA 2DRKA 1SG5A 4QVDA 2AT1B 2NLUA 4VUBA 4PJOD 4FYVB 1H3HA 2LQKA 2Y4YA 3UPUA 1MMDA 3I56A 1RABB 2KVQG 1K73U 1D09B 2B8AA 2G6FX 3REBB 3A8OB 2HDAA 3SEMA 2DVEA 2DERA 4FT4A 1MMNA 2X4WA 3QYGB 4O6JA 1PKTA 2LCCA 3OS0A 4M75E 5CCAA 1TOVA 2R57A 2EIFA 2LP5A 3THKA 1O75A 2RJCA 3CCEQ 2GFUA 3CBOA 3CCRT 3PIOA 2AZVA 2QQRA 2X4XA 4M7DD 2DK3A 3R6NA 2P0KA 4J9HA 1KC8U 2QDYB 3A5ZB 4LDUA 5A0GA 2LJ3A 2DYIA 4PJJA 1I1JA 3OYAA 2QEXQ 2AK5A 4LUDA 3M58A 1VQ8A 3QDRB 2GNCA 2V8JA 1T0HA 2P0QA 4J9BA 1M4ZA 1SRLA 4OVAA 5FW9A 3CC2A 1YP5A 4OMPA 4J8OA 1QVGP 2JJ9A 2K5LA 1H8KA 2E3HA 3SDZA 3I55A 2ESWA 2L8DA 2J05A 3MP6A 3KUFA 5GAN4 3LH5A 3QG1A 1I07A 2BTTA 3CCST 1VQOA 4B6MA 1MV0B 3FLGA 3CCJT 2CH4W 3OYDA 3HPWA 2DD5A 4V2SA 1N6AA 2VVKA 4PLLA 1RLPC 3OS5A 2EKHA 1NG2A 1D3BB 4Z88A 3CQTA 3GP8A 2DXBA 2L3QA 5I21A 4OMLA 1X69A 3PMIA 1VQ7Q 5DY9A 2RMOA 1CKBA 3G7ZA 4NL2A 2QGFB 4LDWA 4ZGDB 3R6OA 4J9EA 2LQNA 2DO3A 3RKYA 1JJ2P 4XTYA 2O9VA 1VQ9Q 2FPDA 1QKXA 3P8DA 3LWIA 1MV3A 1Q81R 1BI2A 3EG9B 1QVFA 5D6WA 2O31A 2CYZB 4M4ZA 1Q86R 2JTMA 5HKCA 1YNZA 4OB0B 2A7YA 2KR3A 4F17A 2J6KA 2RI3A 2HEQA 2XDPA 1UECA 2MF2A 2CZ0B 2OTJA 1YHQA 1FXXA 4UC4A 2DTIA 1ZLMA 2CZ1B 4C5GA 3JCMd 1SHGA 1OULA 2V1QA 4BE1A 1Y96B 3C12A 4A4FA 2OTLT 1M90C 3CCQT 3ME9A 1NLOC 2DL7A 2B86A 4KUDK 1H3ZA 4IIOA 3PVQA 5EC7A 4KUIA 1ZUUA 3VJPA 5GMKj 2LNHB 4XU1A 2RQRA 1D1CA 3EAEA 3SWNB 1W2BS 1F1BB 4M78F 2KROA 4PJOA 2FG0A 2ZPGB 3RMSA 2KRSA 4HVVA 4ESRA 5FU7C 3VU3C 1G5VA 2RA2A 3O5ZA 3JCMf 4Y28E 1D0XA 4LN2A 5GAN5 3G6ET 4QT7A 2D1XA 1YCYA 3M54A 3JCMP 4M7AD 2G3RA 2JUFA 4L59A 4C8QA 1JEGA 1EFNA 1PSFA 5DLOA 1JB0E 3G1JA 4HCCA 4AFSC 1UTIA 2LJ1A 4C92D 1OX9A 3EG3A 2VV5A 1OEBA 5CKEA 5GAMh 3CCEA 2YT6A 3ULRB 4XTWA 1NZ9A 2EW3A 2Y4XA 8ATCB 3L2QA 1VQLQ 3M53A 1UGPB 3H9NA 3HRSA 4M75A 5KE2A 4N0AA 3PNWC 3CCLT 1YFNA 4M77B 2NUPB 1AWJA 4E7HA 5CAIA 2QEXA 1C6VX 1X43A 3BY7A 1M3CA 1VQ4A 2E1HA 3UATA 1QVFP 2I2LA 2X4JA 5IAYA 2LZ6B 2M51A 1QCOA 3D7SB 4EMKC 3S3NA 5FU6C 5GJWB 2L3RA 4JS4A 2V26A 2F2VA 5KYWB 2X9HA 1W4SA 2DJQA 2DIQA 2QI2A 3QJYA 1A0NB 2L3PA 3DLLA 1N8RU 3QXEB 5GJVB 2EJGA 4MDXA 2A08A 2YDLA 5ECAA 1KHCA 3VRZA 3MP8A 5A0DA 4JRIA 1ZSZC 3JB9F 4BDZA 1S72Q 2QASA 3CMAT 2FRWA 1X6OA 3QKJA 2P0PA 5I11A 1HD3A 5CKHA 3CCVT 5C0MA 1FYNA 1K73C 3EGUA 3OYMA 1VQNQ 1N27A 2DLPA 3P8BB 3RKXA 2LNVA 2A37A 2PVGB 2J6OA 2GBQA 1VQ9A 2QQAA 1S1NA 1M1GA 2EQUA 1GFDA 4M77F 4HVWA 1TU0B 1QCFA 1M30A 1WIEA 2RQTA 4C0ZA 1WFWA 3A8GB 2F2WA 1T3LA 3EGXA 3I35A 2MWPA 3FC3A 4FYWB 3E1SA 2K3YA 3SHWA 2KRNA 4OMOA 1ACMB 1RL2A 1TXQA 1PD0A 1KC8C 1H92A 1OPLA 2E5KA 1R77A 3KXTA 2F2XA 2XDDA 2YUOA 3PE0A 3VUZA 4LDYA 2XDBA 1WPYA 1X6BA 4RG8A 3OW2A 3URGA 2JM8A 5GAN2 4M7DB 1BBZA 1VQPT 1VIFA 3BW1A 1YWPA 5GANf 4L5GA 2VGNA 1B7TA 2HKQB 3OQ5A 1TG0A 4X1VA 3G71T 4IUVA 3OMGA 4PFOA 1BKBA 1UUEA 2M0YA 4ZTFA 3DB4A 3SD4A 4F7UB 1E7OA 3OMCA 3CBPA 3X24B 4A4KA 2F5KA 1U3OA 3ASKA 3CPWS 2QXFA 2JS2A 2FPEA 3TVTA 1PG5B 4JS5A 2ABLA 3GPLA 4M7AA 1G3TA 4KGZB 1X2QA 3RESA 1MNEA 3GLXA 4PJOF 2OAUA 1VQ6T 2JW4A 1MMAA 4M78C 4C92A 5IHKA 1I8FA 1OQKA 4ZNXA 1VQ8Q 2K9GA 4PFPA 1WXUA 4QVZA 3HFNA 3LGLA 2MK5A 3CC2Q 1TUGB 2GTJA 5LJ3d 4AFQC 4LUEA 4E7KA 2EKOA 2X4YA 1YITT 2W10A 3I55Q 1OX8A 3CPFA 5HK3A 4E7ZA 3VS5A 3JCMQ 3M4YA 2PZ1A 3ZBDA 1OV3A 2DF6A 3UWNA 4D8KA 2NUZA 1AZGB 4A63B 4M7DF 3J7AF 3H6ZA 4B9WA 4J83A 4EMHA 3RNJA 1KK7A 3MP1A 4OMMA 2QG9B 3E2UA 1YJNA 2L0AA 1WHLA 4Q5WA 1QKWA 3CD6A 2BKDN 2AKLA 5GAOm 2E6NA 5LJ3f 2DVJA 3CBMA 2RJDA 3VS0A 1GCQA 2VXFA 4EMGA 2KT8A 1BYMA 4RTZA 5CO7A 1M8VA 1O9SA 1Q81C 1J3TA 1M2OA 4BB7A 3CCUT 2CP6A 4DBHA 2BIVA 2DD4A 3JCMJ 2FHDA 2JVVA 2O01E 1KD1R 3GIBA 2FEIA 3CCMA 2P4RA 3X26B 3OW2P 3M55A 4J6WA 2O2OA 2SRCA 3QWYA 2C0OA 2YRDA 2FL7A 2O4XB 4NS5A 2DA9A 4PL6A 1S72A 5GAOp 2QTXA 2OTJQ 2DZ9A 2QA4T 1QQJA 3C0CA 4J9FA 3H0HA 1Z9QA 1OU8A 2CSQA 4ATOA 5I2SA 1QW1A 3OYIA 5J26A 1G3SA 2COYA 4RTVA 2F5TX 4DBRA 1VQNT 1PRLC 2RF0A 3CMET 5KH6A 2KK4A 2HKNA 1M9SA 2NUTA 5GAN7 1GCPA 1PD1A 4JPBW 2XG8D 4E7LA 1YI2A 3MEWA 5IT9E 3EGDA 1RACB 5GAMd 5FRNA 1AEYA 2RQUA 4C92B 2CZ6B 1WHGA 4M77C 3SB2A 5GMKm 3FDRA 2FYKA 2M02A 4LDXA 1Q95G 1N9RA 1WHMA 3JB9H 1N5ZA 1ZSZB 4E47A 1W2BA 1X2KA 3OYNA 1UFFA 4ELYC 2RM4A 2J06A 2X3XD 2FO0A 2RO0A 1SPKA 3RBBB 2LT1A 5C6SA 2YUPA 4JJDA 1Z9ZA 1HSQA 3I56T 3VKIA 1JBMA 2LVMA 1Y71A 2HSPA 4P5NA 2LTOA 1N8RC 1SKUB 4C8QD 1K0XA 3TQ7P 2RJFA 4C0DB 3O8VA 2FB7A 3NPFA 1NPRA 2VC8A 2KGTA 1FMVA 5GAMe 1NLPC 3T9NA 5GANj 4N4GA 1WJRA 4IUQA 2QGGA 4F7UE 5FWBA 2E64A 1SSHA 2WSFE 3J81E 1R8OB 5GAMg 1VUBA 1G3YA 1VQ4Q 3V7RA 4M7AF 2CP3A 4M75D 9ATCB 1K76A 3MEVA 2DNUA 1PRMC 3RERA 2EWNA 2C06A 4C92F 4EPCA 2QTVA 4PJOC 2COWA 5GAN6 5CK9A 4N4HA 1NPPA 3F70A 3CC2T 1B3QA 2GFAA 2ZPHB 2J7IA 2CP5A 2K79A 2L89A 2ZZDA 3I55T 4OMFB 1WXTA 2CP0A 2V1RA 2HBWA 2HL5C 2PVOB 1VQOT 4BDYA 4KBMB 1C1AA 4NOYA 2F1LA 2KRMA 4Y92A 3CCJA 4M78B 4FCYA 1JO8A 3I9QA 4M7DC 5AYFA 2PNIA 1UB4A 3NFCA 4OB1B 2GGRA 3LH0A 1WHHA 2OI3A 3JB9I 4JRQA 4DA4A 4HA8A 3UA6A 3PIPA 4RUGA 1K1ZA 2RHIA 4DBFA 3QDFA 3A98A 3BE3A 5EG2A 4A4EA 1AVZC 2MMPA 3VS2A 4N0AC 1BK2A 1M5Q1 1W2BP 3RR6A 2CP7A 5J39A 2KSSA 3PFSA 4CC7A 1UDLA 2CS7A 3DB3A 2D0QB 4J7FA 3QWXX 3VYHB 3MEUA 2WSCE 5M9OA 3TSWA 1TWBA 4XTZA 2O88A 2JMAA 1FX7A 3CC7Q 1UJYA 4CC2A 3TU4K 2YRVA 2DL5A 1SSFA 2ZPIB 4RKUE 1K8AR 1RLQC 3REAB 2R5AA 2OJ2A 1JU5C 2OTJT 2I0NA 4BI4A 2RNAA 1YHQT 4IIMA 3G4SQ 2E12A 5IHIA 3OS1A 1WLPB 3CC4Q 2X3WD 2ROTA 2AZSA 4FYXB 5GMKh 1Q81U 1B34A 3JRZA 3OYCA 1RADB 2ECZA 2AIRB 1YJWT 1X01A 1Q86U 1Q82R 3MPUB 2DRMA 1EZZB 2QDLA 2RHYA 1YJ9Q 2DFUA 3OA6A 2DYBA 3QUIA 3M0UA 1KQ2A 3OYGA 2LX9A 3E9FA 2LRQA 1V29B 5FWCA 4DBQA 1BB9A 1M8MA 4FL6A 4LE9A 4II1A 1VQKA 3M0RA 1M1KR 4J9IA 1IB8A 1W70A 4RG2A 5LJ5d 3CPWA 2C0TA 3A8LB 5FROA 4D6WA 2HSEB 4PJLA 1VYUA 1PWTA 1HYOA 2PVDB 1E6HA 2SEMA 1GFCA 2HZYA 1CSKA 5I2MA 3INZA 3EFRA 2RI5A 3CCET 4J6YA 1PHTA 4Y91A 4JZ4A 1K4US 4F16A 4C0GA 2K3XA 3QZ9B 2YUQA 1IGUA 3M9QA 2KEAA 5HK0A 1AZEA 2EPDA 3M5AA 1YJNQ 3A8HB 5LJ5e 2QEXT 5GAOl 3CD6Q 2D6FA 1VQ4T 3UDCA 3AHUA 3WVDB 1YBYA 3AT1B 5J3BA 3C94A 1VQMA 3EFOA 3NTKA 3CXCA 4M7AC 5LJ5g 2JOYA 2DXCA 1ABQA 4Z89A 2HQHA 3VUBA 1ZBXA 2XMFA 4C92C 4XU3A 3CCMQ 4HVUA 2H8HA 2KYBA 4FW1A 1U1SA 2DPPB 2VB6A 1WA7A 3BDLA 4PKCC 4MZMA 1QP2A 4JRPA 4FSXA 2X51A 2YLCA 1TS9A 1VQ7T 3JAME 3OS2A 2KQWA 4PJOB 2JZ2A 3JB9G 4XTVA 2XD0A 4M78E 4C0DC 1VQ9T 1FMKA 1H641 3L2ZA 3MJXA 2QQ9A 1WHKA 3BDUA 8AT1B 2RI2A 1ABOA 1YI2Q 2KNBB 5FLXE 3CPWP 3L2WA 4C5EA 1XQHA 2DEQA 2MPXC 3Q1JA 2EJ9A 5DLQE 3CC7A 3V7SA 3FIFA 3L2UA 4M77G 1WYXA 4C8QB 1ZUYA 3OSSC 3TSZA 3HHTB 3VV0A 3MEAA 2RK1A 4OGCA 4FIBA 3OYEA 4WF2A 2DTOA 1ZA2B 3QIIA 2BZYA 3G4SA 1YIJA 2XK0A 1LPLA 3JCMb 5CIUA 5KYXA 2IG0A 3WXMB 2EYXA 3VS3A 3CC4A 2DKGA 1UHFA 2XU8A 1OPKA 4A4HA 2MOXA 1VQPA 1KJWA 1QP3A 1U5SA 1PKSA 3NTIA 3MO8A 1K9MR 4M75B 1M1FA 2K5IA 3QPHA 2JMCA 3ZL7C 1AOJA 1YJ9A 2NYSA 2P84A 4AFZC 1M90R 4PJNA 1BIBA 3LW5E 4HCBA 1JXMA 3PT9A 3C95A 4GY5A 2A3LA 4IURA 2HAXA 1MMGA 1G8XA 3FJPA 3CXCP 2BZ8A 2YRCA 5I22A 1DJ7B 1PM3A 4OMQA 2EAYA 1PC0A 1I5LA 4K11A 3GOXA 3M59A 1TUCA 1KG1A 1SHFA 3HFOA 4MMLA 2VKNA 4KT0E 4WTOB 4LD6A 4FM4B 4QVCA 4C0FA 4HCZA 3JCMh 2E65A 2RHZA 4NL3A 1WQWA 4BI8B 4ANJA 1M27C 2KYMA 2MAMA 1KQSA 4XK8E 4C8QF 2EQKA 5AT1B 5GAOq 2IPOB 3QHSA 2FRYA 5GAN8 1VQ5A 3VRYA 4ORZA 2RH2A 2DL4A 5KCHA 2Z0WA 1Q7YR 4QQ6A 1IRXA 1VQLT 1BIAA 3L2RA 4LD9K 4JRKA 2K5FA 2AHJB 4OF1A 1M2VA 3CCSQ 3HTRA 1NE8A 4HT8A 1AWWA 2E5QA 2JS0A 2LJ0A 3CXCS 3V7CA 1QCNA 3PVLA 4M75F 1RAHB 1EIFA 2E70A 2H3EB 3CCJQ 2IVWA 4CC4B 5KYUA 4DEXA 3RUXA 5IXFA 4JLIA 3H0IA 4M7DG 3EGXB 4M77E 4FU6A 3X20B 2RB6A 3CD6T 4RTUA 1VYTA 2DL3A 3P8HA 4BACA 4AMCA 2KDSA 1Q86C 1GL5A 4LXCA 3M0TA 4F7UG 2HNIA 1NJIR 3HRTA 3S3MA 3EHRA 1IZ6A 2MI6A 4HT9A 2HD0A 3CCMT 1QMCA 4WCIA 3NMZC 5GAN3 3FEOA 4M77D 4GLMA 2VWFA 3QZ5B 4ZN1A 1LNXA 2HQXA 2C0IA 1S72T 2EFIA 2KI7A 2H3JA 4KH1B 1WXBA 3JCMW 4OGEA 1N9SA 4EIKA 2K57A 2ATCB 4DOWA 5A2QE 3VS1A 1LJOA 2J6FA 3TCJA 2M9UA 4M7AB 1Q82C 1CKAA 4JJBA 4BY6C 1KD1U 3L1AA 4EDUA 3CMEA 1K73R 5GMKe 1W6XA 3WVEB 1D3BA 4OP0A 1VOMA 1AT1B 3LGFA 4PJOE 4RCCA 3HKSA 2KE9A 4F04B 2EQJA 3N5BB 1SRMA 1KQSP 1ZUKA 1LVKA 7AT1B 1M1KC 4E6RA 2DJZA 2RK2A 1WNLA 4AT1B 2GQIA 3DLMA 1VQKQ 2FPFA 2DAQA 3EG9A 1YCSB 4J9CA 3G6EQ 4MZTA 1JQQA 4JDSA 1KC8R 4OB3B 1NBEB 2KT1A 4J5YA 1UGVA 4XQ3A 2RHUA 3OB9A 4XTUA 2HMAA 5GAMf 2RHXA 4CI0C 4RTWA 3OYFA 1AD5A 2EYQA 4M7DE 1ZBJA 2LDMA 1M2VB 2CUBA 2HBPA 4JJCA 1WGSA 2ROLA 5GANh 2JXBA 3KFVA 3MCAB 1D0ZA 3OYKA 1Y96A 3CCRA 5KYUB 2GQVA 2DE0X 1HK9A 4O5VA 1KQSS 1Y57A 3V8LA 1K0SA 2AKKA 2YLBA 3CCLQ 3NHNA 4MMKA 1WHJA 4ZTJA 2A36A 1VQ8T 3SWNA 1UJ0A 4R0KA 1D1AA 2A28A 5LL6S 4L6V5 2EQIA 2LMJA 2HL3A 4DEYA 3SFMA 4FW2A 2DXTA 4A54A 1VQMQ 3M0SA 1X27A 3OYBA 2ZPEB 3E9GA 4M7AG 2DETA 2D8HA 1G2BA 2PTKA 4X9DA 6AT1B 4J7IA 4CC3A 1MNDA 3EH2A 3A1PA 2KBTA 1IO6A 2LCLA 3OBYA 4C92G 1B07A 2PQWA 3CCSA 2COZA 4C8QC 4E7IA 1OZ2A 1U1TA 2M16A 1I5OB 2WACA 1U06A 1AWOA 1WDXA 3HP9A 1KHIA 2PU9B 3TEEA 2JM9A 1YN8A 3QSUA 2DEUA 1RAFB 2DXUA 1R0BG 3CEYA 2NUTB 3CMAQ 1U8RA 1GRIA 3EGDB 3CCVQ 2CT3A 1HXDA 1K9AA 3VYGA 4M75C 3VS4A 4GLKA 4CRIA 1IGQA 4RTXA 3S3OA 4M77A 1RAEB 1AWXA 2NUPA 1KSWA 2BE7D 5LJ3h 5LJ3j 1R0CB 3A8MB 3LX7A 2P4TA 3BFMA 2JTFA 2DM1A 1QVGS 4JZ3A 1I4K1 2K4YA 1RAAB 1LOJA 1G83A 1OYXA 4JLGA 1G3WA 5CR2A 1IXDA 2YUNA 4BI3A 5KYWA 3LYIA 2FVUA 2DILA 4R55A 1W1FA 5KE3A 3LWHA 1SEMA 2YWWA 3S6WA 3GF5A 1YIJQ 2DMOA 4QQDA 1GBRA 3UF4A 2EVRA 1BI1A 1PSEA 3HSBA 4X9CA 2OTLA 1K9MC 3CCQA 2RQVA 1VQPQ 4OB2B 2QQBA 2DZCA 3GNFB 3HRUA 4IUTA 5KYYA 1WX6A 1WI7A 2FZKB 1XTDA 3PMTA 1RAIB 3G71Q 3OYHA 2ZPFB 4C5HA 1YJWA 2QYZA 2RN8A 3EFSA 3IQLA 1JJ2S 1GXIE 1OI1A 4M7AE 1EX4A 2RQWA 1K8AU 4KRTA 3MKDA 2FZGB 3FJ5A 4M78G 2EGEA 1ZX6A 3M0QA 2GCXA 4C92E 3QJ6A 4J9DA 2DBMA 2EYYA 1M3BA 1QVPA 2FZCB 3G6EA 1AHJB 5IXBA 1VQ6Q 4N4IA 4RCBA 3FB9A 1MUZA 1VQKT 2KXDA 2JN0A 1XNIA 2VXEA 1T3SA 2CDTA 4HXJA 1BI0A 4RMOA 5IH2A 1WZOA 5CVIA 4A53A 4MDWA 3RKWA 4KH0B 1NEGA 3JCMe 1Q82U 1MHNA 2CH4A 2KAFA 4BY6B 2D8JA 3EG2A 1Q7YC 3X25B 3H0FA 2E3IA 3C4SA 1VQ5Q 2YXYA 4E2FB 1TUDA 1YITQ 2DTHA 2ENMA 5A0LA 2EQMA 3JCMg 4KULA 4DOVA 1BCMA 4M7DA 1UGSB 4PK4A 5LJ5f 2EYWA 4IKFA 5GAMj 1N8RR 2BZXA 4ME7A 2EBPA 3CCLA 4FSSA 3L2VA 1M1KU 2MWOA 4JJNK 4YTLA 4KGVB 3J80E 2BUDA 2MCNA 1PNJA 1E6GA 4AG2C 3UA7A 2E4HA 4F7UA 3UT1A 3I5RA 1X75C 2DBKA 1FWZA 3QO3A 1NJIC 5IN1A 1KD1C 1Y0MA 1VQMT 3GNGA 1TH7A 1UG1A 4GBQA 4TVRA 2A0FB 4E7SA 1IHWA 2LT4A 2JTEA 3CCUQ 2MIOA 1X6GA 3HL8A 4ZGEB 1BI3A 4QQGA 2IIMA 1KQ1A 4OMNA 2XIDA 1JXOA 1VA7A 1Y07A 3M57A 4HCKA 1YWOA 1I0CA 4J6XA 1B34B 2YSQA 3EG1A 3CMAA 2V8KA 2QA4Q 3CCVA 2ZCFB 2WSEE 5KYYB 1QWFA 4BD3A 1PCXA 4BE0A 1XJWB 3JV3A 1JRIA 2QK0A 2L3SA 1UGRB 2L2PA 1WQ7A 3H8ZA 3OYYA 2LX7A 1VQ7A 1QVFS 2JNGA 4Z02A 4AFUC 1ZA1B 1RI9A 4ZN3A 1VYVA 4AG1C 2K3BA 5CKDA 3CMEQ 2CZ7B 3U23A 4FT2A 1NM7A 3OBWA 1NEBA 5D6XA 5GMKl 2RJEA 1NYFA 3VS6A 4RTTA 3OY9A 5GANd 4F14A 1ZSGA 1GCQC 2CP2A 4PJMA 1ZHIA 3CC7T 1OOTA 4X34A 3I5SA 4KGXB 1D0YA 4M78D 2ZGWA 3H41A 4MZPA 2XI9A
chains in the Genus database with same CATH topology
4IUPA 2HD0A 3CCMT 3CC2T 4M7AD 5GAN3 4HKEA 2G3RA 2JUFA 4L59A 3FEOA 3JCMc 4C8QA 4M77D 2GFAA 2ZPHB 3G4ST 1ZQ1A 1PSFA 3QZ5B 5DLOA 1JB0E 1LNXA 2HQXA 4ZN1A 4HCCA 1YIJT 1UEBA 2L89A 2ZZDA 3I55T 4OMFB 4C92D 1S72T 2EFIA 3JSCA 2H3JA 1WJQA 1OZ3A 2VV5A 3QYHB 3ZEHA 3CC4T 2O4XA 4E7JA 5CKEA 2PVOB 5GAMh 3JCMW 3CCEA 4OGEA 1VQOT 1N9SA 4QW2A 4BDYA 4KBMB 4XTWA 3G71A 1RI0A 1NZ9A 2Y4XA 4NOYA 2K57A 3L2QA 4DOWA 3CCJA 3M53A 1UGPB 4M78B 2VYTA 3DKMA 5A2QE 2E10A 1LJOA 2R5MA 3HRSA 3OSVA 4XU0A 3OYLA 4M75A 4M7DC 5D6YA 5AYFA 3TCJA 2VGMA 2M9UA 1YJ9T 5KE2A 2KMTA 4N0AA 3PNWC 4M7AB 3CCLT 4BY6C 3JCMX 1Q82C 5KCOA 4M77B 5GANe 1KD1U 3L1AA 1UB4A 4EDUA 3NFCA 4EMKA 5GMKi 1P92A 4OB1B 3LH0A 3CMEA 5GMKe 1VIEA 5CAIA 2QEXA 4E7HA 5FRMA 2QQSA 3BY7A 3WVEB 3JB9I 1D3BA 2KY9A 4OP0A 4JRQA 4HA8A 4DA4A 1VQ4A 2CKKA 3PIPA 2E1HA 3LGFA 4PJOE 2I2LA 2X4JA 2RHIA 4RCCA 4A4EA 5IAYA 5EG2A 3HKSA 1VQ6A 2MMPA 4N0AC 1M5Q1 2EQJA 2F69A 5GANg 4EMKC 5J39A 3S3NA 3N5BB 2KSSA 5FU6C 3PFSA 2CS7A 3DB3A 2D0QB 4J7FA 4ZGJB 2L3RA 4JS4A 1M1KC 3VYHB 2E6ZA 2DJZA 3MEUA 2RK2A 4PJOG 1WNLA 2EJFA 2WSCE 2E41A 3PGGA 5M9OA 1K9MU 1W4SA 2DIQA 2QI2A 3DLMA 3QJYA 3LLRA 4XTZA 2DAQA 1FX7A 3DLLA 1N8RU 2K2VA 3QXEB 4MZTA 3TU4K 1M90U 2EJGA 4JDSA 4MDXA 2XHCA 2YRVA 3META 1SSFA 2ZPIB 4OB3B 4RKUE 5CQYA 4BE2A 1YITA 4J5YA 2R5AA 4XQ3A 2RHUA 1KHCA 3OB9A 4XTUA 2OTJT 1MGQA 4BI4A 5GAMf 2RHXA 4CI0C 1VQ5T 1YHQT 3MP8A 3QBYA 3OYFA 2EYQA 3TREA 5A0DA 4M7DE 4C8QG 2E12A 2LDMA 4JRIA 3JB9F 3RIRA 3OS1A 2HBPA 4JUVA 4C5IA 1VQLA 4BDZA 4XTXA 3CMAT 1WGSA 1X6OA 3QKJA 5GANh 2P0PA 5CKHA 2Y90A 5C0MA 2M0OA 1B34A 5GMKh 3CCVT 1Q81U 1K73C 3MCAB 3JRZA 5L8RE 3OYKA 1Y96A 3OYCA 1YJNT 3V8KA 3CCRA 1I81A 1X01A 3OYMA 1YJWT 1Q86U 2GQVA 1N27A 4PLIA 3P8BB 5FU7B 5HY6A 3RKXA 5GAOn 2LNVA 2PVGB 1HK9A 2X35A 4O5VA 2V8IA 1VQ9A 4ELZC 3X28B 5LJ5h 1KQSS 2RHYA 2XKOC 3V8LA 5LJ5j 3JB9D 2QQAA 2YLBA 3ER0A 1M1GA 2EQUA 3OA6A 4M77F 3QUIA 4MMKA 4M75G 4F7UF 3JCMV 4C0ZA 1KQ2A 4ZTJA 3A8GB 4XAXB 4B9XA 3OYGA 5CKFA 2LX9A 2LQ8A 3SWNA 1VQ8T 3E9FA 2LRQA 2MWPA 3FC3A 3E1SA 1V29B 1Q7YU 2K3YA 5LL6S 4L6V5 1RL2A 2GF7A 3SFMA 3CCUA 2DXTA 2DIGA 4FL6A 4A54A 1XOVA 4II1A 1VQKA 4RG2A 5LJ3e 5LJ5d 3CPWA 3OYBA 2ZPEB 1KC8C 2VUBA 3E9GA 4M7AG 3A8LB 5FROA 1K8AC 2D9TA 4D6WA 4DQ2A 3KXTA 3SWNC 2XDDA 4PNOA 4X9DA 3VUZA 3GIBA 5GAOr 4J7IA 2M1HA 4A4GA 4LDYA 2PVDB 3ZFJA 5CQXA 2LCLA 3JB9J 3OBYA 4C92G 2XDBA 5DM7R 3L42A 5I2MA 1WPYA 5LJ3g 3OYJA 2QA4A 2PQWA 3CCSA 3KBGA 4C8QC 4RG8A 3OW2A 3URGA 4E7IA 1QVGA 5GAN2 3NTHA 4M7DB 2YHTA 3INZA 3EFRA 1VQPT 1OZ2A 2RI5A 1VIFA 1U1TA 2M16A 3BW1A 3V8JA 2WACA 5GANf 4L5GA 2VGNA 3FRNA 3OQ5A 2HQEA 3HP9A 1KHIA 2PU9B 3M56A 3TEEA 3CCET 4J6YA 3G71T 3E19A 3QSUA 4Y91A 2L5QA 4IUVA 3OMGA 1BKBA 4R56A 2DXUA 2PUOB 3RMQA 1NJIU 1VQNA 4C0GA 4ZTFA 2K3XA 4IUUA 3CEYA 3QZ9B 1Y7XA 3DB4A 3M9QA 3SD4A 4F7UB 3OMCA 3CBPA 3X24B 1U8RA 2PUKB 5HK0A 4EMKB 4A4KA 2F5KA 4LDVA 5FU6B 4M78A 3M5AA 1HXDA 3ASKA 1YI2T 3VYGA 3CPWS 2QXFA 4M75C 5CKBA 3PTAA 4GLKA 3MHXA 1IREB 3A8HB 4JS5A 4CRIA 5LJ5e 3GPLA 2QEXT 5GAOl 4M7AA 1G3TA 2LC4A 2D6FA 3S3OA 2CGHA 4M77A 1VQ4T 3UDCA 3RESA 3AHUA 5LJ3h 2RD1A 3WVDB 3GLXA 4PJOF 1YBYA 2OAUA 1VQ6T 5LJ3j 5J3BA 4M78C 4C92A 3C94A 1I8FA 3A8MB 1VQMA 3LX7A 2P4TA 2ZPBB 3NTKA 1WJSA 3BFMA 3CXCA 2JTFA 3OW2S 4M7AC 1QVGS 5LJ5g 2JOYA 1I4K1 1JJ2A 1UGQB 2DXCA 2XICA 2K4YA 4XU2A 2R58A 3M4GA 4C8QE 1LOJA 4QVZA 4BUGA 3VUBA 1OYXA 3HFNA 1ZBXA 3LGLA 4JLGA 1G3WA 4C92C 4XU3A 5CR2A 4BI3A 4QVDA 2NLUA 3LYIA 4VUBA 4PJOD 2FVUA 5LJ3d 2LQKA 2Y4YA 4R55A 3UPUA 4E7KA 1VQKT 5KE3A 3LWHA 3I56A 2KVQG 3JCMP 2EKOA 2X4YA 3S6WA 1K73U 1YITT 3GF5A 2B8AA 1U1SA 3CPFA 4QQDA 5HK3A 2DPPB 3JCMQ 3A8OB 3M4YA 1BI1A 1PSEA 2DVEA 3ZBDA 3HSBA 4X9CA 4FT4A 3BDLA 4PKCC 3UWNA 4MZMA 1K9MC 2OTLA 3CCQA 4M7DF 2X4WA 3QYGB 1QP2A 4O6JA 4JRPA 3J7AF 2LCCA 4OB2B 3OS0A 3H6ZA 4M75E 4B9WA 5CCAA 4FSXA 2QQBA 2DZCA 3GNFB 2R57A 4J83A 4EMHA 3HRUA 2EIFA 4IUTA 2YLCA 3MP1A 1O75A 2RJCA 1VQ7T 1XTDA 3JAME 2GFUA 3PMTA 3CBOA 3OS2A 3OYHA 1YJNA 3CCRT 2KQWA 2ZPFB 4Q5WA 4C5HA 2JZ2A 3PIOA 3JB9G 1YJWA 4XTVA 2OTLT 2XD0A 4PJOB 4M78E 3EFSA 1GXIE 1JJ2S 3CD6A 2BKDN 2QQRA 4C0DC 1VQ9T 1OI1A 2X4XA 4M7DD 5GAOm 2DK3A 2E6NA 2P0KA 1KC8U 1H641 5LJ3f 4M7AE 2QDYB 3A5ZB 3L2ZA 3CBMA 2RJDA 4LDUA 1K8AU 2QQ9A 3BDUA 2RI2A 5A0GA 2VXFA 4EMGA 5FLXE 1BYMA 3L2WA 4C5EA 3OYAA 4M78G 3M58A 1XQHA 2DEQA 5CO7A 1O9SA 2GCXA 3QDRB 3Q1JA 4C92E 2EJ9A 1Q81C 5DLQE 3QJ6A 1VQ8A 3CC7A 3V7SA 1QVPA 2V8JA 3FIFA 3G6EA 1AHJB 3L2UA 4BB7A 4M77G 3CCUT 2P0QA 4N4IA 4RCBA 4C8QB 1M4ZA 2BIVA 3FB9A 3OSSC 3VV0A 3HHTB 2DD4A 3MEAA 2FHDA 2JVVA 2JN0A 2O01E 2RK1A 3JCMJ 4OVAA 3CCMA 3X26B 3CC2A 1XNIA 2VXEA 4OGCA 4J8OA 1BI0A 4FIBA 3M55A 4RMOA 3OYEA 4J6WA 4WF2A 5CVIA 4A53A 4MDWA 2DTOA 3QIIA 3RKWA 3G4SA 3JCMe 2K5LA 1YIJA 2XK0A 3SDZA 3JCMb 5CIUA 2L8DA 3I55A 1Q82U 2FL7A 3MP6A 1MHNA 2KAFA 2O4XB 4NS5A 4BY6B 2IG0A 3KUFA 4PL6A 3WXMB 5GAOp 5GAN4 1S72A 3CC4A 2DKGA 3QG1A 1Q7YC 2QTXA 2DZ9A 3X25B 2QA4T 2XU8A 3C4SA 3CCST 4A4HA 1VQOA 1VQPA 1M8VA 2DTHA 1QP3A 3FLGA 3NTIA 5A0LA 3MO8A 2EQMA 3JCMg 4M75B 4KULA 4ATOA 5I2SA 4DOVA 1M1FA 3CCJT 1QW1A 1UGSB 4M7DA 2K5IA 3OYDA 3OYIA 3HPWA 5LJ5f 2DD5A 3QPHA 4IKFA 4V2SA 1N6AA 5GAMj 5J26A 1G3SA 1YJ9A 4PLLA 2F5TX 4ME7A 3CCLA 3L2VA 1VQNT 3OS5A 1M1KU 2MWOA 1D3BB 1BIBA 3LW5E 3GP8A 4JJNK 4YTLA 3CMET 3PT9A 2DXBA 3C95A 5KH6A 2KK4A 3J80E 5I21A 2BUDA 4GY5A 2A3LA 3PMIA 1M9SA 5DY9A 4F7UA 3G7ZA 4IURA 4NL2A 5GAN7 2HAXA 4LDWA 4ZGDB 2XG8D 4E7LA 1YI2A 3MEWA 3FJPA 3R6OA 3UT1A 5IT9E 1X75C 2DO3A 3RKYA 1DJ7B 5GAMd 1FWZA 4XTYA 2EAYA 5FRNA 4C92B 2CZ6B 1I5LA 3GOXA 3M59A 3P8DA 4M77C 3QO3A 3SB2A 5IN1A 5GMKm 1NJIC 1KG1A 3FDRA 3HFOA 2FYKA 3LWIA 1KD1C 4MMLA 4LDXA 4KT0E 1BI2A 1VQMT 1QVFA 4LD6A 5D6WA 2CYZB 1N9RA 4FM4B 4QVCA 4C0FA 3GNGA 4HCZA 1TH7A 2JTMA 3JB9H 3JCMh 4TVRA 2E65A 5HKCA 2RHZA 4E47A 4NL3A 1W2BA 1WQWA 4OB0B 4BI8B 3OYNA 2A7YA 2LT4A 4ELYC 2MAMA 2RM4A 1KQSA 4XK8E 2RI3A 4C8QF 2EQKA 3HL8A 4ZGEB 1BI3A 4QQGA 2XDPA 5GAOq 2RO0A 2MF2A 2CZ0B 2LT1A 3QHSA 5C6SA 2OTJA 1KQ1A 5GAN8 1VQ5A 1YHQA 2XIDA 2RH2A 1Y07A 3M57A 5KCHA 3I56T 1FXXA 4UC4A 4QQ6A 2DTIA 2CZ1B 3VKIA 1JBMA 4C5GA 2LVMA 1Y71A 4J6XA 4P5NA 3JCMd 1VQLT 2LTOA 1BIAA 3L2RA 1B34B 4LD9K 3CMAA 1N8RC 4BE1A 1Y96B 4JRKA 2K5FA 2V8KA 2AHJB 3C12A 4OF1A 4A4FA 4C8QD 4C0DB 2RJFA 3CCQT 1M90C 1NE8A 3ME9A 3CCVA 2ZCFB 4HT8A 2WSEE 3O8VA 4BD3A 2FB7A 1NPRA 2E5QA 4BE0A 2VC8A 3V7CA 3CXCS 1JRIA 4M75F 4KUDK 2E70A 1EIFA 5GAMe 1UGRB 2IVWA 3T9NA 1H3ZA 5GANj 1WQ7A 3H8ZA 3OYYA 4KUIA 1WJRA 4N4GA 1VQ7A 1QVFS 3RUXA 3VJPA 2JNGA 5GMKj 4JLIA 4Z02A 4M7DG 4XU1A 4IUQA 3EAEA 4M77E 4FU6A 4ZN3A 3SWNB 3X20B 4F7UE 1W2BS 5CKDA 2RB6A 3CD6T 4M78F 2E64A 2WSFE 2CZ7B 4FT2A 4PJOA 3J81E 1R8OB 2ZPGB 3OBWA 5GAMg 1VUBA 1G3YA 5D6XA 3V7RA 3P8HA 4HCBA 5GMKl 4BACA 4M7AF 2RJEA 4M75D 3RMSA 2KDSA 1Q86C 5FU7C 3VU3C 3OY9A 1G5VA 2RA2A 3MEVA 5GANd 3JCMf 3RERA 4F7UG 2HNIA 4Y28E 2EWNA 3HRTA 1ZHIA 5GAN5 4C92F 4EPCA 3S3MA 2C06A 3CC7T 4X34A 3G6ET 1IZ6A 4PJOC 5GAN6 5CK9A 2MI6A 2ZGWA 4M78D 4MZPA 4HT9A 1YCYA 2XI9A 3M54A 4N4HA 1NPPA 3F70A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HFN A;  3RKX A;  5GAO n;  4M7A D;  4C92 C;  4XU3 A;  1HK9 A;  5I21 A;  5GAN 3;  4C8Q A;  3JCM c;  4QVD A;  4PJO D;  4M77 D;  5LJ5 h;  5LJ3 d;  5DY9 A;  3V8L A;  5LJ5 j;  4F7U A;  5GAN 7;  3JB9 D;  4NL2 A;  1LNX A;  3JCM P;  2YLB A;  4M77 F;  3QUI A;  4MMK A;  3FJP A;  4M75 G;  4C92 D;  3JCM V;  4F7U F;  1U1S A;  1KQ2 A;  3RKY A;  5GAM d;  4XTY A;  2EAY A;  3JCM Q;  3SWN A;  2DVE A;  4C92 B;  3HSB A;  4X9C A;  5GAM h;  3JCM W;  1I5L A;  1N9S A;  4M77 C;  3QO3 A;  4XTW A;  3SB2 A;  5GMK m;  4M7D F;  3HFO A;  2FYK A;  4MML A;  4NOY A;  2DXT A;  2K57 A;  4A54 A;  4M75 E;  1N9R A;  4QVC A;  2DZC A;  3JB9 H;  1TH7 A;  4EMH A;  3JCM h;  5LJ3 e;  2E65 A;  5LJ5 d;  4M78 B;  2YLC A;  2E10 A;  1LJO A;  4NL3 A;  1WQW A;  4XU0 A;  4M7A G;  4M75 A;  4DQ2 A;  4M7D C;  3SWN C;  4M7A B;  4N0A A;  2RM4 A;  3JCM X;  4C8Q F;  4PNO A;  4X9D A;  4PJO B;  4M77 B;  5GAN e;  5GAO r;  3L1A A;  4XTV A;  3JB9 G;  4EMK A;  5GAO q;  5GMK i;  4M78 E;  3EFS A;  5GMK e;  3QHS A;  5CAI A;  3JB9 J;  3BY7 A;  4C92 G;  1KQ1 A;  1D3B A;  3JB9 I;  4OP0 A;  5GAN 8;  5GAO m;  4HA8 A;  4M7D D;  4M7A E;  1H64 1;  1WPY A;  5LJ3 f;  5LJ3 g;  3L2Z A;  2E1H A;  4C8Q C;  4PJO E;  2I2L A;  3BDU A;  5GAN 2;  4M7D B;  2YHT A;  2VXF A;  2DTI A;  3EFR A;  3INZ A;  4RCC A;  4EMG A;  1JBM A;  4N0A C;  4J6X A;  1M5Q 1;  1U1T A;  3BW1 A;  3JCM d;  1BIA A;  4M78 G;  3V8J A;  1B34 B;  5GAN g;  5GAN f;  2DEQ A;  4EMK C;  1M8V A;  4C92 E;  1Y96 B;  2EJ9 A;  4JRK A;  4C8Q D;  3V7S A;  4J6Y A;  3FIF A;  4HT8 A;  3QSU A;  4Y91 A;  2DJZ A;  4PJO G;  4M77 G;  1WNL A;  2EJF A;  2FB7 A;  2E41 A;  3PGG A;  2DXU A;  4RCB A;  2VC8 A;  3V7C A;  3FB9 A;  1JRI A;  4C8Q B;  4M75 F;  3GIB A;  3JCM J;  5GAM e;  2JN0 A;  4XTZ A;  4F7U B;  2VXE A;  5GAN j;  1WQ7 A;  4J6W A;  4WF2 A;  4EMK B;  4A53 A;  3RUX A;  2DTO A;  3RKW A;  5GMK j;  2EJG A;  4JLI A;  4M78 A;  4M7D G;  4XU1 A;  1HXD A;  3JCM e;  4M77 E;  4M75 C;  3JCM b;  4J5Y A;  3SWN B;  4F7U E;  4XQ3 A;  2RB6 A;  4M78 F;  2E64 A;  5LJ5 e;  4M7A A;  5GAO l;  4XTU A;  5GAO p;  5GAN 4;  4PJO A;  2CGH A;  1MGQ A;  2DKG A;  4M77 A;  5GAM f;  2QTX A;  5GAM g;  2DZ9 A;  3RES A;  3V7R A;  3AHU A;  4M7A F;  5GMK l;  5LJ3 h;  2RD1 A;  4M7D E;  4M75 D;  4PJO F;  4C8Q G;  5LJ3 j;  2DTH A;  4JRI A;  3VU3 C;  2RA2 A;  4M78 C;  4C92 A;  3JB9 F;  3RIR A;  1I8F A;  4JUV A;  5GAN d;  3JCM f;  3JCM g;  4F7U G;  4M75 B;  3RER A;  2HNI A;  4XTX A;  3BFM A;  4M7D A;  2EWN A;  5GAN 5;  4C92 F;  5GAN h;  4M7A C;  5LJ5 f;  5LJ5 g;  4V2S A;  1I4K 1;  4PJO C;  2Y90 A;  5GMK h;  5GAM j;  1B34 A;  5GAN 6;  4XU2 A;  3M4G A;  4M78 D;  2ZGW A;  1Y96 A;  4C8Q E;  4HT9 A;  3V8K A;  1LOJ A;  1YCY A;  1I81 A;  1X01 A;  1D3B B;  1BIB A; 
#chains in the Genus database with same CATH topology
 4IUP A;  2ED0 A;  4HKE A;  3JCM c;  2HCK A;  1ARK A;  3G4S T;  1ZQ1 A;  1C0M A;  1YIJ T;  1UEB A;  3JSC A;  1WJQ A;  1OZ3 A;  3QYH B;  3ZEH A;  3CC4 T;  3NGP A;  2O4X A;  4E7J A;  3I56 Q;  4QW2 A;  3G71 A;  1RI0 A;  1V76 A;  2VYT A;  3DKM A;  2E10 A;  1T0J A;  2R5M A;  3OSV A;  4XU0 A;  3OYL A;  2D0N A;  5D6Y A;  2VGM A;  1YJ9 T;  2KMT A;  3JCM X;  4D8D A;  5KCO A;  2CT4 A;  5GAN e;  3CCR Q;  1KIK A;  4EMK A;  5GMK i;  1P92 A;  5FRM A;  1VIE A;  2QQS A;  2CRE A;  2KY9 A;  1HJD A;  5IHN A;  2CKK A;  1QLY A;  3EFO B;  1VQ6 A;  3GBQ A;  1D1B A;  2F69 A;  4PFZ A;  2K2M A;  5GAN g;  4RTY A;  2EYZ A;  1M3A A;  4ZGJ B;  2E6Z A;  4PJO G;  4LNP A;  2EJF A;  2VAS A;  3PGG A;  2E41 A;  1K9M U;  1RUW A;  2CSI A;  2NWM A;  3LLR A;  2OX7 A;  2LCS A;  2K2V A;  1ZSZ A;  1GBQ A;  1M90 U;  2XHC A;  2GTO A;  3MET A;  2ZAE A;  5CQY A;  4BE2 A;  1YIT A;  3VS7 A;  1UE9 A;  3EHQ A;  1MGQ A;  3EG0 A;  1VQ5 T;  3QBY A;  3TRE A;  1IHV A;  1UHC A;  4C8Q G;  3RIR A;  4C5I A;  4JUV A;  1VQL A;  4XTX A;  2OAW A;  1LCK A;  2Y90 A;  2M0O A;  1VQO Q;  1OU9 A;  5L8R E;  1YJN T;  3EH1 A;  3V8K A;  1I81 A;  4PLI A;  5HY6 A;  1BU1 A;  5FU7 B;  5GAO n;  2RPN A;  2X35 A;  2V8I A;  4ELZ C;  3X28 B;  5LJ5 h;  2XKO C;  5LJ5 j;  3JB9 D;  3ER0 A;  4M75 G;  4F7U F;  3JCM V;  4Z8A A;  4XAX B;  4B9X A;  5CKF A;  2LQ8 A;  1Q7Y U;  1V1C A;  2GF7 A;  3CCU A;  2DIG A;  1XOV A;  2JT4 A;  1NYG A;  5LJ3 e;  5D7U A;  1TTH B;  2VUB A;  1K8A C;  2D9T A;  4DQ2 A;  3SWN C;  5KYX B;  4PNO A;  5GAO r;  2M1H A;  4A4G A;  3ZFJ A;  5CQX A;  3JB9 J;  2EGA A;  1FMW A;  3RDV A;  1RAG B;  4QKU A;  5DM7 R;  3L42 A;  5LJ3 g;  3OYJ A;  2QA4 A;  3KBG A;  2EGC A;  1QVG A;  3NTH A;  2YHT A;  2W0Z A;  3V8J A;  2MYS A;  3FRN A;  2HQE A;  4FYY B;  3M56 A;  1YHQ Q;  2O9S A;  2KXC A;  2OTL Q;  3E19 A;  3CCQ Q;  2L5Q A;  4R56 A;  3RMQ A;  2PUO B;  1NJI U;  1VQN A;  4IUU A;  2DX1 A;  1Y7X A;  3M0P A;  5KYN A;  2PUK B;  2LQW A;  4EMK B;  2ED1 A;  2K6D A;  4LDV A;  5FU6 B;  4M78 A;  4J9G A;  1YI2 T;  3PTA A;  5CKB A;  1SF9 A;  1YJW Q;  3MHX A;  1IRE B;  2LC4 A;  2CGH A;  1TSF A;  2RD1 A;  2DL8 A;  2BE9 B;  5L23 A;  2ZPB B;  2CUD A;  1WJS A;  2QAZ A;  2K7A A;  3OW2 S;  1KFZ A;  1JJ2 A;  1UGQ B;  2XIC A;  4XU2 A;  2R58 A;  3M4G A;  4C8Q E;  1QWE A;  4BUG A;  1BCO A;  5HCK A;  2DRK A;  1SG5 A;  4QVD A;  2AT1 B;  2NLU A;  4VUB A;  4PJO D;  4FYV B;  1H3H A;  2LQK A;  2Y4Y A;  3UPU A;  1MMD A;  3I56 A;  1RAB B;  2KVQ G;  1K73 U;  1D09 B;  2B8A A;  2G6F X;  3REB B;  3A8O B;  2HDA A;  3SEM A;  2DVE A;  2DER A;  4FT4 A;  1MMN A;  2X4W A;  3QYG B;  4O6J A;  1PKT A;  2LCC A;  3OS0 A;  4M75 E;  5CCA A;  1TOV A;  2R57 A;  2EIF A;  2LP5 A;  3THK A;  1O75 A;  2RJC A;  3CCE Q;  2GFU A;  3CBO A;  3CCR T;  3PIO A;  2AZV A;  2QQR A;  2X4X A;  4M7D D;  2DK3 A;  3R6N A;  2P0K A;  4J9H A;  1KC8 U;  2QDY B;  3A5Z B;  4LDU A;  5A0G A;  2LJ3 A;  2DYI A;  4PJJ A;  1I1J A;  3OYA A;  2QEX Q;  2AK5 A;  4LUD A;  3M58 A;  1VQ8 A;  3QDR B;  2GNC A;  2V8J A;  1T0H A;  2P0Q A;  4J9B A;  1M4Z A;  1SRL A;  4OVA A;  5FW9 A;  3CC2 A;  1YP5 A;  4OMP A;  4J8O A;  1QVG P;  2JJ9 A;  2K5L A;  1H8K A;  2E3H A;  3SDZ A;  3I55 A;  2ESW A;  2L8D A;  2J05 A;  3MP6 A;  3KUF A;  5GAN 4;  3LH5 A;  3QG1 A;  1I07 A;  2BTT A;  3CCS T;  1VQO A;  4B6M A;  1MV0 B;  3FLG A;  3CCJ T;  2CH4 W;  3OYD A;  3HPW A;  2DD5 A;  4V2S A;  1N6A A;  2VVK A;  4PLL A;  1RLP C;  3OS5 A;  2EKH A;  1NG2 A;  1D3B B;  4Z88 A;  3CQT A;  3GP8 A;  2DXB A;  2L3Q A;  5I21 A;  4OML A;  1X69 A;  3PMI A;  1VQ7 Q;  5DY9 A;  2RMO A;  1CKB A;  3G7Z A;  4NL2 A;  2QGF B;  4LDW A;  4ZGD B;  3R6O A;  4J9E A;  2LQN A;  2DO3 A;  3RKY A;  1JJ2 P;  4XTY A;  2O9V A;  1VQ9 Q;  2FPD A;  1QKX A;  3P8D A;  3LWI A;  1MV3 A;  1Q81 R;  1BI2 A;  3EG9 B;  1QVF A;  5D6W A;  2O31 A;  2CYZ B;  4M4Z A;  1Q86 R;  2JTM A;  5HKC A;  1YNZ A;  4OB0 B;  2A7Y A;  2KR3 A;  4F17 A;  2J6K A;  2RI3 A;  2HEQ A;  2XDP A;  1UEC A;  2MF2 A;  2CZ0 B;  2OTJ A;  1YHQ A;  1FXX A;  4UC4 A;  2DTI A;  1ZLM A;  2CZ1 B;  4C5G A;  3JCM d;  1SHG A;  1OUL A;  2V1Q A;  4BE1 A;  1Y96 B;  3C12 A;  4A4F A;  2OTL T;  1M90 C;  3CCQ T;  3ME9 A;  1NLO C;  2DL7 A;  2B86 A;  4KUD K;  1H3Z A;  4IIO A;  3PVQ A;  5EC7 A;  4KUI A;  1ZUU A;  3VJP A;  5GMK j;  2LNH B;  4XU1 A;  2RQR A;  1D1C A;  3EAE A;  3SWN B;  1W2B S;  1F1B B;  4M78 F;  2KRO A;  4PJO A;  2FG0 A;  2ZPG B;  3RMS A;  2KRS A;  4HVV A;  4ESR A;  5FU7 C;  3VU3 C;  1G5V A;  2RA2 A;  3O5Z A;  3JCM f;  4Y28 E;  1D0X A;  4LN2 A;  5GAN 5;  3G6E T;  4QT7 A;  2D1X A;  1YCY A;  3M54 A;  3JCM P;  4M7A D;  2G3R A;  2JUF A;  4L59 A;  4C8Q A;  1JEG A;  1EFN A;  1PSF A;  5DLO A;  1JB0 E;  3G1J A;  4HCC A;  4AFS C;  1UTI A;  2LJ1 A;  4C92 D;  1OX9 A;  3EG3 A;  2VV5 A;  1OEB A;  5CKE A;  5GAM h;  3CCE A;  2YT6 A;  3ULR B;  4XTW A;  1NZ9 A;  2EW3 A;  2Y4X A;  8ATC B;  3L2Q A;  1VQL Q;  3M53 A;  1UGP B;  3H9N A;  3HRS A;  4M75 A;  5KE2 A;  4N0A A;  3PNW C;  3CCL T;  1YFN A;  4M77 B;  2NUP B;  1AWJ A;  4E7H A;  5CAI A;  2QEX A;  1C6V X;  1X43 A;  3BY7 A;  1M3C A;  1VQ4 A;  2E1H A;  3UAT A;  1QVF P;  2I2L A;  2X4J A;  5IAY A;  2LZ6 B;  2M51 A;  1QCO A;  3D7S B;  4EMK C;  3S3N A;  5FU6 C;  5GJW B;  2L3R A;  4JS4 A;  2V26 A;  2F2V A;  5KYW B;  2X9H A;  1W4S A;  2DJQ A;  2DIQ A;  2QI2 A;  3QJY A;  1A0N B;  2L3P A;  3DLL A;  1N8R U;  3QXE B;  5GJV B;  2EJG A;  4MDX A;  2A08 A;  2YDL A;  5ECA A;  1KHC A;  3VRZ A;  3MP8 A;  5A0D A;  4JRI A;  1ZSZ C;  3JB9 F;  4BDZ A;  1S72 Q;  2QAS A;  3CMA T;  2FRW A;  1X6O A;  3QKJ A;  2P0P A;  5I11 A;  1HD3 A;  5CKH A;  3CCV T;  5C0M A;  1FYN A;  1K73 C;  3EGU A;  3OYM A;  1VQN Q;  1N27 A;  2DLP A;  3P8B B;  3RKX A;  2LNV A;  2A37 A;  2PVG B;  2J6O A;  2GBQ A;  1VQ9 A;  2QQA A;  1S1N A;  1M1G A;  2EQU A;  1GFD A;  4M77 F;  4HVW A;  1TU0 B;  1QCF A;  1M30 A;  1WIE A;  2RQT A;  4C0Z A;  1WFW A;  3A8G B;  2F2W A;  1T3L A;  3EGX A;  3I35 A;  2MWP A;  3FC3 A;  4FYW B;  3E1S A;  2K3Y A;  3SHW A;  2KRN A;  4OMO A;  1ACM B;  1RL2 A;  1TXQ A;  1PD0 A;  1KC8 C;  1H92 A;  1OPL A;  2E5K A;  1R77 A;  3KXT A;  2F2X A;  2XDD A;  2YUO A;  3PE0 A;  3VUZ A;  4LDY A;  2XDB A;  1WPY A;  1X6B A;  4RG8 A;  3OW2 A;  3URG A;  2JM8 A;  5GAN 2;  4M7D B;  1BBZ A;  1VQP T;  1VIF A;  3BW1 A;  1YWP A;  5GAN f;  4L5G A;  2VGN A;  1B7T A;  2HKQ B;  3OQ5 A;  1TG0 A;  4X1V A;  3G71 T;  4IUV A;  3OMG A;  4PFO A;  1BKB A;  1UUE A;  2M0Y A;  4ZTF A;  3DB4 A;  3SD4 A;  4F7U B;  1E7O A;  3OMC A;  3CBP A;  3X24 B;  4A4K A;  2F5K A;  1U3O A;  3ASK A;  3CPW S;  2QXF A;  2JS2 A;  2FPE A;  3TVT A;  1PG5 B;  4JS5 A;  2ABL A;  3GPL A;  4M7A A;  1G3T A;  4KGZ B;  1X2Q A;  3RES A;  1MNE A;  3GLX A;  4PJO F;  2OAU A;  1VQ6 T;  2JW4 A;  1MMA A;  4M78 C;  4C92 A;  5IHK A;  1I8F A;  1OQK A;  4ZNX A;  1VQ8 Q;  2K9G A;  4PFP A;  1WXU A;  4QVZ A;  3HFN A;  3LGL A;  2MK5 A;  3CC2 Q;  1TUG B;  2GTJ A;  5LJ3 d;  4AFQ C;  4LUE A;  4E7K A;  2EKO A;  2X4Y A;  1YIT T;  2W10 A;  3I55 Q;  1OX8 A;  3CPF A;  5HK3 A;  4E7Z A;  3VS5 A;  3JCM Q;  3M4Y A;  2PZ1 A;  3ZBD A;  1OV3 A;  2DF6 A;  3UWN A;  4D8K A;  2NUZ A;  1AZG B;  4A63 B;  4M7D F;  3J7A F;  3H6Z A;  4B9W A;  4J83 A;  4EMH A;  3RNJ A;  1KK7 A;  3MP1 A;  4OMM A;  2QG9 B;  3E2U A;  1YJN A;  2L0A A;  1WHL A;  4Q5W A;  1QKW A;  3CD6 A;  2BKD N;  2AKL A;  5GAO m;  2E6N A;  5LJ3 f;  2DVJ A;  3CBM A;  2RJD A;  3VS0 A;  1GCQ A;  2VXF A;  4EMG A;  2KT8 A;  1BYM A;  4RTZ A;  5CO7 A;  1M8V A;  1O9S A;  1Q81 C;  1J3T A;  1M2O A;  4BB7 A;  3CCU T;  2CP6 A;  4DBH A;  2BIV A;  2DD4 A;  3JCM J;  2FHD A;  2JVV A;  2O01 E;  1KD1 R;  3GIB A;  2FEI A;  3CCM A;  2P4R A;  3X26 B;  3OW2 P;  3M55 A;  4J6W A;  2O2O A;  2SRC A;  3QWY A;  2C0O A;  2YRD A;  2FL7 A;  2O4X B;  4NS5 A;  2DA9 A;  4PL6 A;  1S72 A;  5GAO p;  2QTX A;  2OTJ Q;  2DZ9 A;  2QA4 T;  1QQJ A;  3C0C A;  4J9F A;  3H0H A;  1Z9Q A;  1OU8 A;  2CSQ A;  4ATO A;  5I2S A;  1QW1 A;  3OYI A;  5J26 A;  1G3S A;  2COY A;  4RTV A;  2F5T X;  4DBR A;  1VQN T;  1PRL C;  2RF0 A;  3CME T;  5KH6 A;  2KK4 A;  2HKN A;  1M9S A;  2NUT A;  5GAN 7;  1GCP A;  1PD1 A;  4JPB W;  2XG8 D;  4E7L A;  1YI2 A;  3MEW A;  5IT9 E;  3EGD A;  1RAC B;  5GAM d;  5FRN A;  1AEY A;  2RQU A;  4C92 B;  2CZ6 B;  1WHG A;  4M77 C;  3SB2 A;  5GMK m;  3FDR A;  2FYK A;  2M02 A;  4LDX A;  1Q95 G;  1N9R A;  1WHM A;  3JB9 H;  1N5Z A;  1ZSZ B;  4E47 A;  1W2B A;  1X2K A;  3OYN A;  1UFF A;  4ELY C;  2RM4 A;  2J06 A;  2X3X D;  2FO0 A;  2RO0 A;  1SPK A;  3RBB B;  2LT1 A;  5C6S A;  2YUP A;  4JJD A;  1Z9Z A;  1HSQ A;  3I56 T;  3VKI A;  1JBM A;  2LVM A;  1Y71 A;  2HSP A;  4P5N A;  2LTO A;  1N8R C;  1SKU B;  4C8Q D;  1K0X A;  3TQ7 P;  2RJF A;  4C0D B;  3O8V A;  2FB7 A;  3NPF A;  1NPR A;  2VC8 A;  2KGT A;  1FMV A;  5GAM e;  1NLP C;  3T9N A;  5GAN j;  4N4G A;  1WJR A;  4IUQ A;  2QGG A;  4F7U E;  5FWB A;  2E64 A;  1SSH A;  2WSF E;  3J81 E;  1R8O B;  5GAM g;  1VUB A;  1G3Y A;  1VQ4 Q;  3V7R A;  4M7A F;  2CP3 A;  4M75 D;  9ATC B;  1K76 A;  3MEV A;  2DNU A;  1PRM C;  3RER A;  2EWN A;  2C06 A;  4C92 F;  4EPC A;  2QTV A;  4PJO C;  2COW A;  5GAN 6;  5CK9 A;  4N4H A;  1NPP A;  3F70 A;  3CC2 T;  1B3Q A;  2GFA A;  2ZPH B;  2J7I A;  2CP5 A;  2K79 A;  2L89 A;  2ZZD A;  3I55 T;  4OMF B;  1WXT A;  2CP0 A;  2V1R A;  2HBW A;  2HL5 C;  2PVO B;  1VQO T;  4BDY A;  4KBM B;  1C1A A;  4NOY A;  2F1L A;  2KRM A;  4Y92 A;  3CCJ A;  4M78 B;  4FCY A;  1JO8 A;  3I9Q A;  4M7D C;  5AYF A;  2PNI A;  1UB4 A;  3NFC A;  4OB1 B;  2GGR A;  3LH0 A;  1WHH A;  2OI3 A;  3JB9 I;  4JRQ A;  4DA4 A;  4HA8 A;  3UA6 A;  3PIP A;  4RUG A;  1K1Z A;  2RHI A;  4DBF A;  3QDF A;  3A98 A;  3BE3 A;  5EG2 A;  4A4E A;  1AVZ C;  2MMP A;  3VS2 A;  4N0A C;  1BK2 A;  1M5Q 1;  1W2B P;  3RR6 A;  2CP7 A;  5J39 A;  2KSS A;  3PFS A;  4CC7 A;  1UDL A;  2CS7 A;  3DB3 A;  2D0Q B;  4J7F A;  3QWX X;  3VYH B;  3MEU A;  2WSC E;  5M9O A;  3TSW A;  1TWB A;  4XTZ A;  2O88 A;  2JMA A;  1FX7 A;  3CC7 Q;  1UJY A;  4CC2 A;  3TU4 K;  2YRV A;  2DL5 A;  1SSF A;  2ZPI B;  4RKU E;  1K8A R;  1RLQ C;  3REA B;  2R5A A;  2OJ2 A;  1JU5 C;  2OTJ T;  2I0N A;  4BI4 A;  2RNA A;  1YHQ T;  4IIM A;  3G4S Q;  2E12 A;  5IHI A;  3OS1 A;  1WLP B;  3CC4 Q;  2X3W D;  2ROT A;  2AZS A;  4FYX B;  5GMK h;  1Q81 U;  1B34 A;  3JRZ A;  3OYC A;  1RAD B;  2ECZ A;  2AIR B;  1YJW T;  1X01 A;  1Q86 U;  1Q82 R;  3MPU B;  2DRM A;  1EZZ B;  2QDL A;  2RHY A;  1YJ9 Q;  2DFU A;  3OA6 A;  2DYB A;  3QUI A;  3M0U A;  1KQ2 A;  3OYG A;  2LX9 A;  3E9F A;  2LRQ A;  1V29 B;  5FWC A;  4DBQ A;  1BB9 A;  1M8M A;  4FL6 A;  4LE9 A;  4II1 A;  1VQK A;  3M0R A;  1M1K R;  4J9I A;  1IB8 A;  1W70 A;  4RG2 A;  5LJ5 d;  3CPW A;  2C0T A;  3A8L B;  5FRO A;  4D6W A;  2HSE B;  4PJL A;  1VYU A;  1PWT A;  1HYO A;  2PVD B;  1E6H A;  2SEM A;  1GFC A;  2HZY A;  1CSK A;  5I2M A;  3INZ A;  3EFR A;  2RI5 A;  3CCE T;  4J6Y A;  1PHT A;  4Y91 A;  4JZ4 A;  1K4U S;  4F16 A;  4C0G A;  2K3X A;  3QZ9 B;  2YUQ A;  1IGU A;  3M9Q A;  2KEA A;  5HK0 A;  1AZE A;  2EPD A;  3M5A A;  1YJN Q;  3A8H B;  5LJ5 e;  2QEX T;  5GAO l;  3CD6 Q;  2D6F A;  1VQ4 T;  3UDC A;  3AHU A;  3WVD B;  1YBY A;  3AT1 B;  5J3B A;  3C94 A;  1VQM A;  3EFO A;  3NTK A;  3CXC A;  4M7A C;  5LJ5 g;  2JOY A;  2DXC A;  1ABQ A;  4Z89 A;  2HQH A;  3VUB A;  1ZBX A;  2XMF A;  4C92 C;  4XU3 A;  3CCM Q;  4HVU A;  2H8H A;  2KYB A;  4FW1 A;  1U1S A;  2DPP B;  2VB6 A;  1WA7 A;  3BDL A;  4PKC C;  4MZM A;  1QP2 A;  4JRP A;  4FSX A;  2X51 A;  2YLC A;  1TS9 A;  1VQ7 T;  3JAM E;  3OS2 A;  2KQW A;  4PJO B;  2JZ2 A;  3JB9 G;  4XTV A;  2XD0 A;  4M78 E;  4C0D C;  1VQ9 T;  1FMK A;  1H64 1;  3L2Z A;  3MJX A;  2QQ9 A;  1WHK A;  3BDU A;  8AT1 B;  2RI2 A;  1ABO A;  1YI2 Q;  2KNB B;  5FLX E;  3CPW P;  3L2W A;  4C5E A;  1XQH A;  2DEQ A;  2MPX C;  3Q1J A;  2EJ9 A;  5DLQ E;  3CC7 A;  3V7S A;  3FIF A;  3L2U A;  4M77 G;  1WYX A;  4C8Q B;  1ZUY A;  3OSS C;  3TSZ A;  3HHT B;  3VV0 A;  3MEA A;  2RK1 A;  4OGC A;  4FIB A;  3OYE A;  4WF2 A;  2DTO A;  1ZA2 B;  3QII A;  2BZY A;  3G4S A;  1YIJ A;  2XK0 A;  1LPL A;  3JCM b;  5CIU A;  5KYX A;  2IG0 A;  3WXM B;  2EYX A;  3VS3 A;  3CC4 A;  2DKG A;  1UHF A;  2XU8 A;  1OPK A;  4A4H A;  2MOX A;  1VQP A;  1KJW A;  1QP3 A;  1U5S A;  1PKS A;  3NTI A;  3MO8 A;  1K9M R;  4M75 B;  1M1F A;  2K5I A;  3QPH A;  2JMC A;  3ZL7 C;  1AOJ A;  1YJ9 A;  2NYS A;  2P84 A;  4AFZ C;  1M90 R;  4PJN A;  1BIB A;  3LW5 E;  4HCB A;  1JXM A;  3PT9 A;  3C95 A;  4GY5 A;  2A3L A;  4IUR A;  2HAX A;  1MMG A;  1G8X A;  3FJP A;  3CXC P;  2BZ8 A;  2YRC A;  5I22 A;  1DJ7 B;  1PM3 A;  4OMQ A;  2EAY A;  1PC0 A;  1I5L A;  4K11 A;  3GOX A;  3M59 A;  1TUC A;  1KG1 A;  1SHF A;  3HFO A;  4MML A;  2VKN A;  4KT0 E;  4WTO B;  4LD6 A;  4FM4 B;  4QVC A;  4C0F A;  4HCZ A;  3JCM h;  2E65 A;  2RHZ A;  4NL3 A;  1WQW A;  4BI8 B;  4ANJ A;  1M27 C;  2KYM A;  2MAM A;  1KQS A;  4XK8 E;  4C8Q F;  2EQK A;  5AT1 B;  5GAO q;  2IPO B;  3QHS A;  2FRY A;  5GAN 8;  1VQ5 A;  3VRY A;  4ORZ A;  2RH2 A;  2DL4 A;  5KCH A;  2Z0W A;  1Q7Y R;  4QQ6 A;  1IRX A;  1VQL T;  1BIA A;  3L2R A;  4LD9 K;  4JRK A;  2K5F A;  2AHJ B;  4OF1 A;  1M2V A;  3CCS Q;  3HTR A;  1NE8 A;  4HT8 A;  1AWW A;  2E5Q A;  2JS0 A;  2LJ0 A;  3CXC S;  3V7C A;  1QCN A;  3PVL A;  4M75 F;  1RAH B;  1EIF A;  2E70 A;  2H3E B;  3CCJ Q;  2IVW A;  4CC4 B;  5KYU A;  4DEX A;  3RUX A;  5IXF A;  4JLI A;  3H0I A;  4M7D G;  3EGX B;  4M77 E;  4FU6 A;  3X20 B;  2RB6 A;  3CD6 T;  4RTU A;  1VYT A;  2DL3 A;  3P8H A;  4BAC A;  4AMC A;  2KDS A;  1Q86 C;  1GL5 A;  4LXC A;  3M0T A;  4F7U G;  2HNI A;  1NJI R;  3HRT A;  3S3M A;  3EHR A;  1IZ6 A;  2MI6 A;  4HT9 A;  2HD0 A;  3CCM T;  1QMC A;  4WCI A;  3NMZ C;  5GAN 3;  3FEO A;  4M77 D;  4GLM A;  2VWF A;  3QZ5 B;  4ZN1 A;  1LNX A;  2HQX A;  2C0I A;  1S72 T;  2EFI A;  2KI7 A;  2H3J A;  4KH1 B;  1WXB A;  3JCM W;  4OGE A;  1N9S A;  4EIK A;  2K57 A;  2ATC B;  4DOW A;  5A2Q E;  3VS1 A;  1LJO A;  2J6F A;  3TCJ A;  2M9U A;  4M7A B;  1Q82 C;  1CKA A;  4JJB A;  4BY6 C;  1KD1 U;  3L1A A;  4EDU A;  3CME A;  1K73 R;  5GMK e;  1W6X A;  3WVE B;  1D3B A;  4OP0 A;  1VOM A;  1AT1 B;  3LGF A;  4PJO E;  4RCC A;  3HKS A;  2KE9 A;  4F04 B;  2EQJ A;  3N5B B;  1SRM A;  1KQS P;  1ZUK A;  1LVK A;  7AT1 B;  1M1K C;  4E6R A;  2DJZ A;  2RK2 A;  1WNL A;  4AT1 B;  2GQI A;  3DLM A;  1VQK Q;  2FPF A;  2DAQ A;  3EG9 A;  1YCS B;  4J9C A;  3G6E Q;  4MZT A;  1JQQ A;  4JDS A;  1KC8 R;  4OB3 B;  1NBE B;  2KT1 A;  4J5Y A;  1UGV A;  4XQ3 A;  2RHU A;  3OB9 A;  4XTU A;  2HMA A;  5GAM f;  2RHX A;  4CI0 C;  4RTW A;  3OYF A;  1AD5 A;  2EYQ A;  4M7D E;  1ZBJ A;  2LDM A;  1M2V B;  2CUB A;  2HBP A;  4JJC A;  1WGS A;  2ROL A;  5GAN h;  2JXB A;  3KFV A;  3MCA B;  1D0Z A;  3OYK A;  1Y96 A;  3CCR A;  5KYU B;  2GQV A;  2DE0 X;  1HK9 A;  4O5V A;  1KQS S;  1Y57 A;  3V8L A;  1K0S A;  2AKK A;  2YLB A;  3CCL Q;  3NHN A;  4MMK A;  1WHJ A;  4ZTJ A;  2A36 A;  1VQ8 T;  3SWN A;  1UJ0 A;  4R0K A;  1D1A A;  2A28 A;  5LL6 S;  4L6V 5;  2EQI A;  2LMJ A;  2HL3 A;  4DEY A;  3SFM A;  4FW2 A;  2DXT A;  4A54 A;  1VQM Q;  3M0S A;  1X27 A;  3OYB A;  2ZPE B;  3E9G A;  4M7A G;  2DET A;  2D8H A;  1G2B A;  2PTK A;  4X9D A;  6AT1 B;  4J7I A;  4CC3 A;  1MND A;  3EH2 A;  3A1P A;  2KBT A;  1IO6 A;  2LCL A;  3OBY A;  4C92 G;  1B07 A;  2PQW A;  3CCS A;  2COZ A;  4C8Q C;  4E7I A;  1OZ2 A;  1U1T A;  2M16 A;  1I5O B;  2WAC A;  1U06 A;  1AWO A;  1WDX A;  3HP9 A;  1KHI A;  2PU9 B;  3TEE A;  2JM9 A;  1YN8 A;  3QSU A;  2DEU A;  1RAF B;  2DXU A;  1R0B G;  3CEY A;  2NUT B;  3CMA Q;  1U8R A;  1GRI A;  3EGD B;  3CCV Q;  2CT3 A;  1HXD A;  1K9A A;  3VYG A;  4M75 C;  3VS4 A;  4GLK A;  4CRI A;  1IGQ A;  4RTX A;  3S3O A;  4M77 A;  1RAE B;  1AWX A;  2NUP A;  1KSW A;  2BE7 D;  5LJ3 h;  5LJ3 j;  1R0C B;  3A8M B;  3LX7 A;  2P4T A;  3BFM A;  2JTF A;  2DM1 A;  1QVG S;  4JZ3 A;  1I4K 1;  2K4Y A;  1RAA B;  1LOJ A;  1G83 A;  1OYX A;  4JLG A;  1G3W A;  5CR2 A;  1IXD A;  2YUN A;  4BI3 A;  5KYW A;  3LYI A;  2FVU A;  2DIL A;  4R55 A;  1W1F A;  5KE3 A;  3LWH A;  1SEM A;  2YWW A;  3S6W A;  3GF5 A;  1YIJ Q;  2DMO A;  4QQD A;  1GBR A;  3UF4 A;  2EVR A;  1BI1 A;  1PSE A;  3HSB A;  4X9C A;  2OTL A;  1K9M C;  3CCQ A;  2RQV A;  1VQP Q;  4OB2 B;  2QQB A;  2DZC A;  3GNF B;  3HRU A;  4IUT A;  5KYY A;  1WX6 A;  1WI7 A;  2FZK B;  1XTD A;  3PMT A;  1RAI B;  3G71 Q;  3OYH A;  2ZPF B;  4C5H A;  1YJW A;  2QYZ A;  2RN8 A;  3EFS A;  3IQL A;  1JJ2 S;  1GXI E;  1OI1 A;  4M7A E;  1EX4 A;  2RQW A;  1K8A U;  4KRT A;  3MKD A;  2FZG B;  3FJ5 A;  4M78 G;  2EGE A;  1ZX6 A;  3M0Q A;  2GCX A;  4C92 E;  3QJ6 A;  4J9D A;  2DBM A;  2EYY A;  1M3B A;  1QVP A;  2FZC B;  3G6E A;  1AHJ B;  5IXB A;  1VQ6 Q;  4N4I A;  4RCB A;  3FB9 A;  1MUZ A;  1VQK T;  2KXD A;  2JN0 A;  1XNI A;  2VXE A;  1T3S A;  2CDT A;  4HXJ A;  1BI0 A;  4RMO A;  5IH2 A;  1WZO A;  5CVI A;  4A53 A;  4MDW A;  3RKW A;  4KH0 B;  1NEG A;  3JCM e;  1Q82 U;  1MHN A;  2CH4 A;  2KAF A;  4BY6 B;  2D8J A;  3EG2 A;  1Q7Y C;  3X25 B;  3H0F A;  2E3I A;  3C4S A;  1VQ5 Q;  2YXY A;  4E2F B;  1TUD A;  1YIT Q;  2DTH A;  2ENM A;  5A0L A;  2EQM A;  3JCM g;  4KUL A;  4DOV A;  1BCM A;  4M7D A;  1UGS B;  4PK4 A;  5LJ5 f;  2EYW A;  4IKF A;  5GAM j;  1N8R R;  2BZX A;  4ME7 A;  2EBP A;  3CCL A;  4FSS A;  3L2V A;  1M1K U;  2MWO A;  4JJN K;  4YTL A;  4KGV B;  3J80 E;  2BUD A;  2MCN A;  1PNJ A;  1E6G A;  4AG2 C;  3UA7 A;  2E4H A;  4F7U A;  3UT1 A;  3I5R A;  1X75 C;  2DBK A;  1FWZ A;  3QO3 A;  1NJI C;  5IN1 A;  1KD1 C;  1Y0M A;  1VQM T;  3GNG A;  1TH7 A;  1UG1 A;  4GBQ A;  4TVR A;  2A0F B;  4E7S A;  1IHW A;  2LT4 A;  2JTE A;  3CCU Q;  2MIO A;  1X6G A;  3HL8 A;  4ZGE B;  1BI3 A;  4QQG A;  2IIM A;  1KQ1 A;  4OMN A;  2XID A;  1JXO A;  1VA7 A;  1Y07 A;  3M57 A;  4HCK A;  1YWO A;  1I0C A;  4J6X A;  1B34 B;  2YSQ A;  3EG1 A;  3CMA A;  2V8K A;  2QA4 Q;  3CCV A;  2ZCF B;  2WSE E;  5KYY B;  1QWF A;  4BD3 A;  1PCX A;  4BE0 A;  1XJW B;  3JV3 A;  1JRI A;  2QK0 A;  2L3S A;  1UGR B;  2L2P A;  1WQ7 A;  3H8Z A;  3OYY A;  2LX7 A;  1VQ7 A;  1QVF S;  2JNG A;  4Z02 A;  4AFU C;  1ZA1 B;  1RI9 A;  4ZN3 A;  1VYV A;  4AG1 C;  2K3B A;  5CKD A;  3CME Q;  2CZ7 B;  3U23 A;  4FT2 A;  1NM7 A;  3OBW A;  1NEB A;  5D6X A;  5GMK l;  2RJE A;  1NYF A;  3VS6 A;  4RTT A;  3OY9 A;  5GAN d;  4F14 A;  1ZSG A;  1GCQ C;  2CP2 A;  4PJM A;  1ZHI A;  3CC7 T;  1OOT A;  4X34 A;  3I5S A;  4KGX B;  1D0Y A;  4M78 D;  2ZGW A;  3H41 A;  4MZP A;  2XI9 A; 
#chains in the Genus database with same CATH homology
 4IUP A;  2HD0 A;  3CCM T;  3CC2 T;  4M7A D;  5GAN 3;  4HKE A;  2G3R A;  2JUF A;  4L59 A;  3FEO A;  3JCM c;  4C8Q A;  4M77 D;  2GFA A;  2ZPH B;  3G4S T;  1ZQ1 A;  1PSF A;  3QZ5 B;  5DLO A;  1JB0 E;  1LNX A;  2HQX A;  4ZN1 A;  4HCC A;  1YIJ T;  1UEB A;  2L89 A;  2ZZD A;  3I55 T;  4OMF B;  4C92 D;  1S72 T;  2EFI A;  3JSC A;  2H3J A;  1WJQ A;  1OZ3 A;  2VV5 A;  3QYH B;  3ZEH A;  3CC4 T;  2O4X A;  4E7J A;  5CKE A;  2PVO B;  5GAM h;  3JCM W;  3CCE A;  4OGE A;  1VQO T;  1N9S A;  4QW2 A;  4BDY A;  4KBM B;  4XTW A;  3G71 A;  1RI0 A;  1NZ9 A;  2Y4X A;  4NOY A;  2K57 A;  3L2Q A;  4DOW A;  3CCJ A;  3M53 A;  1UGP B;  4M78 B;  2VYT A;  3DKM A;  5A2Q E;  2E10 A;  1LJO A;  2R5M A;  3HRS A;  3OSV A;  4XU0 A;  3OYL A;  4M75 A;  4M7D C;  5D6Y A;  5AYF A;  3TCJ A;  2VGM A;  2M9U A;  1YJ9 T;  5KE2 A;  2KMT A;  4N0A A;  3PNW C;  4M7A B;  3CCL T;  4BY6 C;  3JCM X;  1Q82 C;  5KCO A;  4M77 B;  5GAN e;  1KD1 U;  3L1A A;  1UB4 A;  4EDU A;  3NFC A;  4EMK A;  5GMK i;  1P92 A;  4OB1 B;  3LH0 A;  3CME A;  5GMK e;  1VIE A;  5CAI A;  2QEX A;  4E7H A;  5FRM A;  2QQS A;  3BY7 A;  3WVE B;  3JB9 I;  1D3B A;  2KY9 A;  4OP0 A;  4JRQ A;  4HA8 A;  4DA4 A;  1VQ4 A;  2CKK A;  3PIP A;  2E1H A;  3LGF A;  4PJO E;  2I2L A;  2X4J A;  2RHI A;  4RCC A;  4A4E A;  5IAY A;  5EG2 A;  3HKS A;  1VQ6 A;  2MMP A;  4N0A C;  1M5Q 1;  2EQJ A;  2F69 A;  5GAN g;  4EMK C;  5J39 A;  3S3N A;  3N5B B;  2KSS A;  5FU6 C;  3PFS A;  2CS7 A;  3DB3 A;  2D0Q B;  4J7F A;  4ZGJ B;  2L3R A;  4JS4 A;  1M1K C;  3VYH B;  2E6Z A;  2DJZ A;  3MEU A;  2RK2 A;  4PJO G;  1WNL A;  2EJF A;  2WSC E;  2E41 A;  3PGG A;  5M9O A;  1K9M U;  1W4S A;  2DIQ A;  2QI2 A;  3DLM A;  3QJY A;  3LLR A;  4XTZ A;  2DAQ A;  1FX7 A;  3DLL A;  1N8R U;  2K2V A;  3QXE B;  4MZT A;  3TU4 K;  1M90 U;  2EJG A;  4JDS A;  4MDX A;  2XHC A;  2YRV A;  3MET A;  1SSF A;  2ZPI B;  4OB3 B;  4RKU E;  5CQY A;  4BE2 A;  1YIT A;  4J5Y A;  2R5A A;  4XQ3 A;  2RHU A;  1KHC A;  3OB9 A;  4XTU A;  2OTJ T;  1MGQ A;  4BI4 A;  5GAM f;  2RHX A;  4CI0 C;  1VQ5 T;  1YHQ T;  3MP8 A;  3QBY A;  3OYF A;  2EYQ A;  3TRE A;  5A0D A;  4M7D E;  4C8Q G;  2E12 A;  2LDM A;  4JRI A;  3JB9 F;  3RIR A;  3OS1 A;  2HBP A;  4JUV A;  4C5I A;  1VQL A;  4BDZ A;  4XTX A;  3CMA T;  1WGS A;  1X6O A;  3QKJ A;  5GAN h;  2P0P A;  5CKH A;  2Y90 A;  5C0M A;  2M0O A;  1B34 A;  5GMK h;  3CCV T;  1Q81 U;  1K73 C;  3MCA B;  3JRZ A;  5L8R E;  3OYK A;  1Y96 A;  3OYC A;  1YJN T;  3V8K A;  3CCR A;  1I81 A;  1X01 A;  3OYM A;  1YJW T;  1Q86 U;  2GQV A;  1N27 A;  4PLI A;  3P8B B;  5FU7 B;  5HY6 A;  3RKX A;  5GAO n;  2LNV A;  2PVG B;  1HK9 A;  2X35 A;  4O5V A;  2V8I A;  1VQ9 A;  4ELZ C;  3X28 B;  5LJ5 h;  1KQS S;  2RHY A;  2XKO C;  3V8L A;  5LJ5 j;  3JB9 D;  2QQA A;  2YLB A;  3ER0 A;  1M1G A;  2EQU A;  3OA6 A;  4M77 F;  3QUI A;  4MMK A;  4M75 G;  4F7U F;  3JCM V;  4C0Z A;  1KQ2 A;  4ZTJ A;  3A8G B;  4XAX B;  4B9X A;  3OYG A;  5CKF A;  2LX9 A;  2LQ8 A;  3SWN A;  1VQ8 T;  3E9F A;  2LRQ A;  2MWP A;  3FC3 A;  3E1S A;  1V29 B;  1Q7Y U;  2K3Y A;  5LL6 S;  4L6V 5;  1RL2 A;  2GF7 A;  3SFM A;  3CCU A;  2DXT A;  2DIG A;  4FL6 A;  4A54 A;  1XOV A;  4II1 A;  1VQK A;  4RG2 A;  5LJ3 e;  5LJ5 d;  3CPW A;  3OYB A;  2ZPE B;  1KC8 C;  2VUB A;  3E9G A;  4M7A G;  3A8L B;  5FRO A;  1K8A C;  2D9T A;  4D6W A;  4DQ2 A;  3KXT A;  3SWN C;  2XDD A;  4PNO A;  4X9D A;  3VUZ A;  3GIB A;  5GAO r;  4J7I A;  2M1H A;  4A4G A;  4LDY A;  2PVD B;  3ZFJ A;  5CQX A;  2LCL A;  3JB9 J;  3OBY A;  4C92 G;  2XDB A;  5DM7 R;  3L42 A;  5I2M A;  1WPY A;  5LJ3 g;  3OYJ A;  2QA4 A;  2PQW A;  3CCS A;  3KBG A;  4C8Q C;  4RG8 A;  3OW2 A;  3URG A;  4E7I A;  1QVG A;  5GAN 2;  3NTH A;  4M7D B;  2YHT A;  3INZ A;  3EFR A;  1VQP T;  1OZ2 A;  2RI5 A;  1VIF A;  1U1T A;  2M16 A;  3BW1 A;  3V8J A;  2WAC A;  5GAN f;  4L5G A;  2VGN A;  3FRN A;  3OQ5 A;  2HQE A;  3HP9 A;  1KHI A;  2PU9 B;  3M56 A;  3TEE A;  3CCE T;  4J6Y A;  3G71 T;  3E19 A;  3QSU A;  4Y91 A;  2L5Q A;  4IUV A;  3OMG A;  1BKB A;  4R56 A;  2DXU A;  2PUO B;  3RMQ A;  1NJI U;  1VQN A;  4C0G A;  4ZTF A;  2K3X A;  4IUU A;  3CEY A;  3QZ9 B;  1Y7X A;  3DB4 A;  3M9Q A;  3SD4 A;  4F7U B;  3OMC A;  3CBP A;  3X24 B;  1U8R A;  2PUK B;  5HK0 A;  4EMK B;  4A4K A;  2F5K A;  4LDV A;  5FU6 B;  4M78 A;  3M5A A;  1HXD A;  3ASK A;  1YI2 T;  3VYG A;  3CPW S;  2QXF A;  4M75 C;  5CKB A;  3PTA A;  4GLK A;  3MHX A;  1IRE B;  3A8H B;  4JS5 A;  4CRI A;  5LJ5 e;  3GPL A;  2QEX T;  5GAO l;  4M7A A;  1G3T A;  2LC4 A;  2D6F A;  3S3O A;  2CGH A;  4M77 A;  1VQ4 T;  3UDC A;  3RES A;  3AHU A;  5LJ3 h;  2RD1 A;  3WVD B;  3GLX A;  4PJO F;  1YBY A;  2OAU A;  1VQ6 T;  5LJ3 j;  5J3B A;  4M78 C;  4C92 A;  3C94 A;  1I8F A;  3A8M B;  1VQM A;  3LX7 A;  2P4T A;  2ZPB B;  3NTK A;  1WJS A;  3BFM A;  3CXC A;  2JTF A;  3OW2 S;  4M7A C;  1QVG S;  5LJ5 g;  2JOY A;  1I4K 1;  1JJ2 A;  1UGQ B;  2DXC A;  2XIC A;  2K4Y A;  4XU2 A;  2R58 A;  3M4G A;  4C8Q E;  1LOJ A;  4QVZ A;  4BUG A;  3VUB A;  1OYX A;  3HFN A;  1ZBX A;  3LGL A;  4JLG A;  1G3W A;  4C92 C;  4XU3 A;  5CR2 A;  4BI3 A;  4QVD A;  2NLU A;  3LYI A;  4VUB A;  4PJO D;  2FVU A;  5LJ3 d;  2LQK A;  2Y4Y A;  4R55 A;  3UPU A;  4E7K A;  1VQK T;  5KE3 A;  3LWH A;  3I56 A;  2KVQ G;  3JCM P;  2EKO A;  2X4Y A;  3S6W A;  1K73 U;  1YIT T;  3GF5 A;  2B8A A;  1U1S A;  3CPF A;  4QQD A;  5HK3 A;  2DPP B;  3JCM Q;  3A8O B;  3M4Y A;  1BI1 A;  1PSE A;  2DVE A;  3ZBD A;  3HSB A;  4X9C A;  4FT4 A;  3BDL A;  4PKC C;  3UWN A;  4MZM A;  1K9M C;  2OTL A;  3CCQ A;  4M7D F;  2X4W A;  3QYG B;  1QP2 A;  4O6J A;  4JRP A;  3J7A F;  2LCC A;  4OB2 B;  3OS0 A;  3H6Z A;  4M75 E;  4B9W A;  5CCA A;  4FSX A;  2QQB A;  2DZC A;  3GNF B;  2R57 A;  4J83 A;  4EMH A;  3HRU A;  2EIF A;  4IUT A;  2YLC A;  3MP1 A;  1O75 A;  2RJC A;  1VQ7 T;  1XTD A;  3JAM E;  2GFU A;  3PMT A;  3CBO A;  3OS2 A;  3OYH A;  1YJN A;  3CCR T;  2KQW A;  2ZPF B;  4Q5W A;  4C5H A;  2JZ2 A;  3PIO A;  3JB9 G;  1YJW A;  4XTV A;  2OTL T;  2XD0 A;  4PJO B;  4M78 E;  3EFS A;  1GXI E;  1JJ2 S;  3CD6 A;  2BKD N;  2QQR A;  4C0D C;  1VQ9 T;  1OI1 A;  2X4X A;  4M7D D;  5GAO m;  2DK3 A;  2E6N A;  2P0K A;  1KC8 U;  1H64 1;  5LJ3 f;  4M7A E;  2QDY B;  3A5Z B;  3L2Z A;  3CBM A;  2RJD A;  4LDU A;  1K8A U;  2QQ9 A;  3BDU A;  2RI2 A;  5A0G A;  2VXF A;  4EMG A;  5FLX E;  1BYM A;  3L2W A;  4C5E A;  3OYA A;  4M78 G;  3M58 A;  1XQH A;  2DEQ A;  5CO7 A;  1O9S A;  2GCX A;  3QDR B;  3Q1J A;  4C92 E;  2EJ9 A;  1Q81 C;  5DLQ E;  3QJ6 A;  1VQ8 A;  3CC7 A;  3V7S A;  1QVP A;  2V8J A;  3FIF A;  3G6E A;  1AHJ B;  3L2U A;  4BB7 A;  4M77 G;  3CCU T;  2P0Q A;  4N4I A;  4RCB A;  4C8Q B;  1M4Z A;  2BIV A;  3FB9 A;  3OSS C;  3VV0 A;  3HHT B;  2DD4 A;  3MEA A;  2FHD A;  2JVV A;  2JN0 A;  2O01 E;  2RK1 A;  3JCM J;  4OVA A;  3CCM A;  3X26 B;  3CC2 A;  1XNI A;  2VXE A;  4OGC A;  4J8O A;  1BI0 A;  4FIB A;  3M55 A;  4RMO A;  3OYE A;  4J6W A;  4WF2 A;  5CVI A;  4A53 A;  4MDW A;  2DTO A;  3QII A;  3RKW A;  3G4S A;  3JCM e;  2K5L A;  1YIJ A;  2XK0 A;  3SDZ A;  3JCM b;  5CIU A;  2L8D A;  3I55 A;  1Q82 U;  2FL7 A;  3MP6 A;  1MHN A;  2KAF A;  2O4X B;  4NS5 A;  4BY6 B;  2IG0 A;  3KUF A;  4PL6 A;  3WXM B;  5GAO p;  5GAN 4;  1S72 A;  3CC4 A;  2DKG A;  3QG1 A;  1Q7Y C;  2QTX A;  2DZ9 A;  3X25 B;  2QA4 T;  2XU8 A;  3C4S A;  3CCS T;  4A4H A;  1VQO A;  1VQP A;  1M8V A;  2DTH A;  1QP3 A;  3FLG A;  3NTI A;  5A0L A;  3MO8 A;  2EQM A;  3JCM g;  4M75 B;  4KUL A;  4ATO A;  5I2S A;  4DOV A;  1M1F A;  3CCJ T;  1QW1 A;  1UGS B;  4M7D A;  2K5I A;  3OYD A;  3OYI A;  3HPW A;  5LJ5 f;  2DD5 A;  3QPH A;  4IKF A;  4V2S A;  1N6A A;  5GAM j;  5J26 A;  1G3S A;  1YJ9 A;  4PLL A;  2F5T X;  4ME7 A;  3CCL A;  3L2V A;  1VQN T;  3OS5 A;  1M1K U;  2MWO A;  1D3B B;  1BIB A;  3LW5 E;  3GP8 A;  4JJN K;  4YTL A;  3CME T;  3PT9 A;  2DXB A;  3C95 A;  5KH6 A;  2KK4 A;  3J80 E;  5I21 A;  2BUD A;  4GY5 A;  2A3L A;  3PMI A;  1M9S A;  5DY9 A;  4F7U A;  3G7Z A;  4IUR A;  4NL2 A;  5GAN 7;  2HAX A;  4LDW A;  4ZGD B;  2XG8 D;  4E7L A;  1YI2 A;  3MEW A;  3FJP A;  3R6O A;  3UT1 A;  5IT9 E;  1X75 C;  2DO3 A;  3RKY A;  1DJ7 B;  5GAM d;  1FWZ A;  4XTY A;  2EAY A;  5FRN A;  4C92 B;  2CZ6 B;  1I5L A;  3GOX A;  3M59 A;  3P8D A;  4M77 C;  3QO3 A;  3SB2 A;  5IN1 A;  5GMK m;  1NJI C;  1KG1 A;  3FDR A;  3HFO A;  2FYK A;  3LWI A;  1KD1 C;  4MML A;  4LDX A;  4KT0 E;  1BI2 A;  1VQM T;  1QVF A;  4LD6 A;  5D6W A;  2CYZ B;  1N9R A;  4FM4 B;  4QVC A;  4C0F A;  3GNG A;  4HCZ A;  1TH7 A;  2JTM A;  3JB9 H;  3JCM h;  4TVR A;  2E65 A;  5HKC A;  2RHZ A;  4E47 A;  4NL3 A;  1W2B A;  1WQW A;  4OB0 B;  4BI8 B;  3OYN A;  2A7Y A;  2LT4 A;  4ELY C;  2MAM A;  2RM4 A;  1KQS A;  4XK8 E;  2RI3 A;  4C8Q F;  2EQK A;  3HL8 A;  4ZGE B;  1BI3 A;  4QQG A;  2XDP A;  5GAO q;  2RO0 A;  2MF2 A;  2CZ0 B;  2LT1 A;  3QHS A;  5C6S A;  2OTJ A;  1KQ1 A;  5GAN 8;  1VQ5 A;  1YHQ A;  2XID A;  2RH2 A;  1Y07 A;  3M57 A;  5KCH A;  3I56 T;  1FXX A;  4UC4 A;  4QQ6 A;  2DTI A;  2CZ1 B;  3VKI A;  1JBM A;  4C5G A;  2LVM A;  1Y71 A;  4J6X A;  4P5N A;  3JCM d;  1VQL T;  2LTO A;  1BIA A;  3L2R A;  1B34 B;  4LD9 K;  3CMA A;  1N8R C;  4BE1 A;  1Y96 B;  4JRK A;  2K5F A;  2V8K A;  2AHJ B;  3C12 A;  4OF1 A;  4A4F A;  4C8Q D;  4C0D B;  2RJF A;  3CCQ T;  1M90 C;  1NE8 A;  3ME9 A;  3CCV A;  2ZCF B;  4HT8 A;  2WSE E;  3O8V A;  4BD3 A;  2FB7 A;  1NPR A;  2E5Q A;  4BE0 A;  2VC8 A;  3V7C A;  3CXC S;  1JRI A;  4M75 F;  4KUD K;  2E70 A;  1EIF A;  5GAM e;  1UGR B;  2IVW A;  3T9N A;  1H3Z A;  5GAN j;  1WQ7 A;  3H8Z A;  3OYY A;  4KUI A;  1WJR A;  4N4G A;  1VQ7 A;  1QVF S;  3RUX A;  3VJP A;  2JNG A;  5GMK j;  4JLI A;  4Z02 A;  4M7D G;  4XU1 A;  4IUQ A;  3EAE A;  4M77 E;  4FU6 A;  4ZN3 A;  3SWN B;  3X20 B;  4F7U E;  1W2B S;  5CKD A;  2RB6 A;  3CD6 T;  4M78 F;  2E64 A;  2WSF E;  2CZ7 B;  4FT2 A;  4PJO A;  3J81 E;  1R8O B;  2ZPG B;  3OBW A;  5GAM g;  1VUB A;  1G3Y A;  5D6X A;  3V7R A;  3P8H A;  4HCB A;  5GMK l;  4BAC A;  4M7A F;  2RJE A;  4M75 D;  3RMS A;  2KDS A;  1Q86 C;  5FU7 C;  3VU3 C;  3OY9 A;  1G5V A;  2RA2 A;  3MEV A;  5GAN d;  3JCM f;  3RER A;  4F7U G;  2HNI A;  4Y28 E;  2EWN A;  3HRT A;  1ZHI A;  5GAN 5;  4C92 F;  4EPC A;  3S3M A;  2C06 A;  3CC7 T;  4X34 A;  3G6E T;  1IZ6 A;  4PJO C;  5GAN 6;  5CK9 A;  2MI6 A;  2ZGW A;  4M78 D;  4MZP A;  4HT9 A;  1YCY A;  2XI9 A;  3M54 A;  4N4H A;  1NPP A;  3F70 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...