3JCMc

Cryo-em structure of the spliceosomal u4/u6.u5 tri-snrnp
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
92
structure length
92
Chain Sequence
MLFFSFFKTLVDQEVVVELKNDIEIKGTLQSVDQFLNLKLDNISCTDEKKYPHLGSVRNIFIRGSTVRYVYLNKNMVDTNLLQDATRREVMT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pre-mRNA-splicing factor 8
publication title The 3.8 angstrom structure of the U4/U6.U5 tri-snRNP: Insights into spliceosome assembly and catalysis
pubmed doi rcsb
molecule tags Transcription
total genus 14
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2015-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
c PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3jcmc00
2DZ9A 5GANe 4PJOC 4M78C 5LJ3h 1BIAA 1H641 2I2LA 3JB9H 4M7DE 1I81A 5LJ3e 3V7RA 4M7DF 4XTYA 5GMKh 5GMKl 5GAOr 3SWNB 3BW1A 5GAMf 5GMKe 4RCBA 5LJ5j 3PGGA 1D3BA 4EMGA 2E64A 4M77D 4M7DC 2DJZA 3JCMV 4F7UB 4OP0A 5GAN2 5LJ5h 1TH7A 5GAOp 5GAN7 4XQ3A 2YLBA 5LJ5e 1WQWA 5GANf 5GMKi 4C8QG 2YHTA 4M77A 4NOYA 3JB9J 3RKWA 4M75D 4X9CA 4J6XA 4M7AD 3QSUA 1N9SA 1MGQA 2DZCA 1WQ7A 4MMKA 5GAN4 3JB9I 1KQ2A 3QO3A 3INZA 3JCMh 4XU3A 1U1SA 3QHSA 3V8LA 3JCMe 4M75A 4XTZA 4M7AA 2RB6A 1BIBA 5LJ5f 3V8JA 4RCCA 2DXUA 5CAIA 4N0AA 4C8QA 1I4K1 4M77G 4XU0A 5GAN5 4JUVA 3RKXA 3JCMc 4EMKB 4QVCA 3EFSA 3SB2A 2E1HA 4PJOB 2E41A 4M78B 4XU2A 1U1TA 2VC8A 3M4GA 4M75G 3JCMf 1N9RA 5GAOl 3RERA 3FJPA 4M77E 1HXDA 4M7AG 4PJOD 4M78D 1M8VA 4M77F 2QTXA 2YLCA 4DQ2A 3JCMP 4JRKA 2DTHA 3SWNA 4X9DA 4M7DB 1LOJA 4JLIA 4J5YA 2DVEA 2RD1A 2VXFA 3RESA 5GMKm 3BFMA 4A54A 4M77C 4M75E 4M7AE 4F7UA 4M7DD 4M75F 5GAN6 5GANh 4M7AF 4XU1A 3JCMQ 4C8QE 5GAMg 4C8QF 1WPYA 5LJ3d 3L1AA 1B34B 4M75C 3V7SA 4M7AC 2FYKA 1WNLA 2RA2A 2VXEA 5GAOn 3RUXA 4C92B 5GAN3 4M78G 4N0AC 5DY9A 4C8QC 4QVDA 5GANg 4F7UG 1Y96B 2E65A 2K57A 4EMHA 4C92D 4Y91A 5I21A 5LJ3g 3L2ZA 4J6WA 5GAOq 4MMLA 3FIFA 3JB9D 1JRIA 4J6YA 3HSBA 4HA8A 3EFRA 4XTXA 2FB7A 3V7CA 4NL2A 2EAYA 4EMKA 3JCMW 4XTVA 5GAMd 3VU3C 4F7UE 1I8FA 3QUIA 4F7UF 4PJOA 4M78A 5LJ5g 3RKYA 1D3BB 3SWNC 3FB9A 1I5LA 5GMKj 3JCMX 3JCMJ 3JCMb 2RM4A 5GANd 5GAOm 1HK9A 4M77B 2ZGWA 5GAN8 4M7DA 4WF2A 3RIRA 2EJ9A 3HFNA 2HNIA 4C92G 3JCMg 2DEQA 4V2SA 2E10A 1LJOA 3JB9G 4HT9A 4JRIA 4A53A 4PJOG 3V8KA 1YCYA 2DTOA 2EWNA 4NL3A 2EJGA 4HT8A 1JBMA 2DXTA 3BY7A 4M75B 2DKGA 4M7AB 5GAMj 2JN0A 4XTWA 3GIBA 5LJ5d 4C92E 2EJFA 1B34A 1KQ1A 5LJ3f 2CGHA 2DTIA 4C92F 4C8QB 5GAMh 4M7DG 4PJOE 1M5Q1 4M78E 4C92A 5GAMe 3JB9F 1X01A 4PNOA 4XTUA 4PJOF 4M78F 4C8QD 5GANj 1Y96A 4C92C 2Y90A 3HFOA 4EMKC 5LJ3j 3BDUA 3AHUA 3JCMd 1LNXA
chains in the Genus database with same CATH superfamily
5KYWB 2HDAA 1QQJA 3TCJA 4QQGA 2ZAEA 3CD6Q 4B6MA 1ZSZB 3OYJA 5GAMf 2JTEA 1UG1A 2KGTA 1G5VA 4M77D 2JZ2A 2F69A 4C8QG 3HRSA 2DK3A 1KIKA 2X3XD 3GF5A 4M75D 1GCPA 1Z9QA 5GAN4 2D8HA 1M2OA 1IREB 3CCUQ 4RG8A 2LJ1A 4J9HA 3V8JA 3EGXA 2OTLT 4DBRA 1YIJA 4AFSC 2JM9A 2DF6A 2AZVA 4XU2A 1YI2T 1U1TA 3JRZA 2EBPA 3EG9B 4ELYC 3G71Q 1ZSGA 1EX4A 2JM8A 1RL2A 3P8BB 1K73C 4FSSA 2E6NA 2JS2A 4JZ4A 5D6YA 4XU1A 2MIOA 2F1LA 3H0HA 2MI6A 2D1XA 3MEVA 1TUCA 5LJ3d 3S3OA 4C0FA 4FSXA 3EFOB 5IAYA 3J80E 4C92B 2PUOB 3X26B 2K57A 3MJXA 5LJ3g 4KRTA 1YJ9T 1VQ5Q 2EAYA 1BI3A 3QUIA 3OYNA 4PJOA 4Z02A 4WCIA 2VUBA 2LJ3A 3S3NA 1VQ8A 1OU9A 2RM4A 2KT1A 4XK8E 3ZBDA 4HVUA 2VGNA 4DOVA 2KNBB 1M90C 1UHFA 1X6BA 2EIFA 1MMNA 1WHHA 3FEOA 5GAMj 1B07A 1VQPA 1M5Q1 4QVZA 1PD0A 2LNHB 4B9WA 1NE8A 5GANh 3I5SA 1LVKA 2MK5A 4M78C 1WYXA 1QCNA 5A0LA 3I56T 3PGGA 2E64A 2ATCB 1TH7A 1N8RU 3ULRB 2YLBA 5L23A 5GMKi 4J9DA 3C0CA 2FO0A 1MGQA 4Z88A 2HBPA 3HL8A 1I5OB 2COZA 4XTZA 4AG1C 1ZLMA 2YRVA 1JXMA 2KEAA 2DEUA 4GY5A 4M78B 4RTUA 2DJQA 3OW2A 1D0ZA 3VS3A 2CUDA 2LP5A 2O2OA 2GTOA 4DQ2A 3QIIA 4EPCA 1MMGA 4PKCC 4FYXB 4F14A 4ZN1A 5CO7A 1JEGA 3BFMA 4GBQA 4F17A 1K73U 2KDSA 2X4WA 1G3TA 2RHXA 4KT0E 1NEBA 2YRDA 1IO6A 3G6EQ 1ABOA 1W6XA 5CQYA 4ESRA 2M1HA 2IG0A 3RUXA 1TG0A 3QKJA 4HKEA 3CCJQ 2KVQG 5I21A 4QT7A 3P8DA 3I55A 2V8JA 1MV3A 1VQKT 2R57A 3OYFA 1E6HA 2GBQA 5CKEA 5KYYB 3FB9A 4LD6A 3JCMX 3CCQT 4KH0B 3CCMQ 4RKUE 1YJNT 4ZTJA 1K8AC 4L6V5 2CREA 1D0XA 2NUZA 2GFUA 1M90U 2OTJT 2L3PA 4IURA 4E7LA 4OB0B 4FYYB 8ATCB 1XNIA 2BZXA 3HFOA 4E7JA 1YJWA 3TEEA 5LJ3h 3M0PA 1SHGA 3PVLA 2QEXQ 3QPHA 1W1FA 4LN2A 4A63B 2QK0A 4JZ3A 4OP0A 1Q7YC 3PVQA 3CEYA 2HKQB 5CVIA 1K9MC 1OZ2A 3CCUT 4MMKA 1OZ3A 2JTMA 1D09B 2YXYA 3M0SA 4OF1A 3EG0A 1FXXA 2RH2A 4C5GA 3O8VA 2Y4YA 2VV5A 3EFSA 3C94A 2HSPA 4E7ZA 4OB2B 3JCMf 1KD1C 4M77F 2Z0WA 1PRLC 1I1JA 4A4GA 4M75F 4LNPA 2L3SA 3M9QA 2CSQA 2LZ6B 4JS5A 2FZGB 4CC7A 4WTOB 4E7SA 1VQ4Q 4C8QC 1F1BB 1YHQQ 2E65A 2E70A 1VQ5T 2K9GA 1S72T 4LD9K 1ZA2B 1VQ7Q 1UGQB 3V7CA 3H0IA 2COWA 3CPFA 3CCVT 1AWOA 2EQIA 4ZN3A 1VOMA 1I5LA 2HQXA 3JCMb 2HEQA 2BUDA 1R0CB 5IXBA 2L3QA 2B86A 2DEQA 4FYWB 3M4YA 1K8AU 2L0AA 3LWIA 5LJ5d 4Z89A 1B34A 3RDVA 4C8QB 1M3BA 1TOVA 4EIKA 2EQKA 4RTXA 2EKHA 3CCRA 1H641 5IT9E 4M7DF 3TSZA 5GMKl 2IVWA 2X3WD 3PMTA 3REAB 1WI7A 1ZUYA 2DL4A 1U8RA 1JJ2P 1WQWA 1QVPA 3L2RA 2YHTA 1VQOA 4ZTFA 1UJ0A 3DKMA 3CC4Q 1PC0A 3OYLA 2O01E 2YUQA 5KCHA 1K9MU 2R5MA 5ECAA 4M7AA 4R55A 1K0SA 2K5LA 2DXUA 1BI1A 2DA9A 2EYXA 3WXMB 2LCSA 3M59A 3META 1OPKA 4M77E 2E6ZA 3DLLA 3QYHB 2A08A 3THKA 1V1CA 1KD1U 1SRLA 2QTVA 1VQLA 2X4XA 2LT1A 4M75E 4F7UA 2K2MA 5I22A 3MPUB 1H3HA 2J05A 4J9IA 4RG2A 3NMZC 4GLKA 3V7SA 2PUKB 5D6XA 2QYZA 3CCJT 2OTLQ 1H8KA 1X27A 4C92D 3LX7A 1QWFA 4CC3A 2H3JA 3CBMA 3GLXA 2C0TA 3M5AA 5KYUB 1QVFA 4ELZC 5DLOA 1VQ9T 4LUDA 1WFWA 2K79A 2KRSA 2FZCB 1Q82R 1JXOA 3G4SA 3LGLA 3L2VA 4DBHA 2DO3A 3EGDB 3CBPA 3CCEQ 3A5ZB 5KH6A 4CC4B 1RAIB 2NUPB 4PK4A 1YCYA 3CPWP 1WGSA 4A4FA 3OQ5A 2O9VA 3GNFB 2XD0A 3VS6A 1N5ZA 1QW1A 1EFNA 4FT4A 1YJ9Q 4BE2A 5FWCA 4FM4B 4PJOF 1JJ2S 2DRMA 4OMPA 2D0NA 1UGRB 3X28B 4M7DE 3E2UA 2ZPGB 3V7RA 2EYQA 3L2QA 2GF7A 1K1ZA 4BB7A 2DJZA 2HQHA 2A0FB 3ER0A 2HZYA 1QVGP 1VQMA 4J6XA 4M7AD 1WQ7A 4XU3A 1PSEA 4F04B 1YIJT 3JAME 4E7KA 1BIBA 2SRCA 4HCCA 2KROA 5FWBA 5GAN5 2OX7A 3JCMc 2AKKA 3PIOA 3M0UA 4OGEA 4QVCA 2E41A 1MNEA 2KXCA 2OJ2A 4R0KA 2CDTA 1M30A 1KJWA 4M78D 1EIFA 3ZL7C 2D6FA 1GBRA 1U06A 3UA7A 1T0JA 2GNCA 2DVEA 2LX9A 3A8MB 4IIMA 4JLGA 1SKUB 1KFZA 4PFZA 1G3WA 3CC7A 1T0HA 4OVAA 1Q86R 2FEIA 2A36A 3TU4K 4JJNK 2JMAA 3FC3A 1TWBA 2DMOA 4ZGJB 5FRNA 1VQNA 2DXBA 2G6FX 4J9CA 1G2BA 2LDMA 2CP2A 1D1AA 1QCFA 4BI3A 2JMCA 3EFRA 3CPWS 1VQ8T 5D7UA 1BU1A 1ABQA 1GCQA 1MMAA 1VUBA 4BI4A 5GANd 5IHNA 4QQ6A 4HT9A 1C0MA 2XHCA 3A98A 3M0RA 4RTVA 2EGAA 3HP9A 2MAMA 3VKIA 1AD5A 1ZBJA 4KULA 2YRCA 4PJOE 1YCSB 2XICA 4Z8AA 3UF4A 2MWOA 2PU9B 2Y90A 3EH1A 1QVGS 2VASA 3BDUA 4JRPA 4RMOA 1XQHA 2BTTA 1Q95G 2DZ9A 2SEMA 1E7OA 3CCQQ 5GMKh 5IHIA 1D3BA 4L5GA 3I35A 1PSFA 5I11A 3M55A 3VYGA 3ASKA 5LJ5e 3URGA 3CC4T 1UB4A 1UFFA 2OTJQ 1B3QA 5J26A 3CMAQ 2K4YA 4PJLA 4N0AA 4OMLA 3VS1A 3C4SA 2ROLA 3NTIA 3RBBB 3OBYA 3VYHB 2RK2A 2E4HA 3SB2A 4LXCA 1EZZB 2DILA 5FROA 2YUOA 2X4YA 2KI7A 3NTHA 1HD3A 1H92A 1PRMC 3MEWA 2DTHA 3I9QA 2HD0A 4JLIA 1LOJA 2O4XB 4FL6A 2JW4A 2F2XA 1OX9A 1P92A 2QA4A 1JQQA 5GAMg 1G83A 4JJDA 3I55T 2RQWA 1M27C 4J9FA 2XU8A 1Y96B 1M2VB 1W70A 1PKTA 2PVDB 2VVKA 3OYCA 1PD1A 4BDZA 4XTXA 2AHJB 4EMKA 4RTTA 5HCKA 2JS0A 2V8IA 1V76A 1M1GA 3CCET 2XDDA 3OYGA 4DEXA 1M1KU 4A53A 4MZPA 2DX1A 2PNIA 2RQRA 2FVUA 3RNJA 3H41A 2DXTA 1YFNA 3GIBA 2QGFB 5LJ3f 4C92F 1YJWT 1M3AA 2NUTA 1S72Q 2EQJA 3QJYA 4C8QD 3E9GA 3HRUA 2LCCA 3QXEB 3EG2A 3CCVQ 2R5AA 2DL3A 2WSFE 1Y0MA 1RABB 3CCLA 3NHNA 5FRMA 5GAN2 3R6OA 4LDVA 2EVRA 4MZMA 3J81E 3OS1A 2LTOA 3RKWA 3VV0A 3EG3A 2HL3A 2W10A 1PWTA 3QHSA 4DOWA 3VRYA 1VQ6Q 4MDXA 4BDYA 1YITQ 3BDLA 3VJPA 2K3XA 5I2SA 4K11A 3PIPA 1WXUA 5KYXB 1BKBA 4JJBA 2RQVA 2DE0X 2X51A 3RERA 2M51A 4KUIA 2BIVA 4OMMA 4OB1B 2QQSA 3RESA 2DD4A 2RJFA 4M7AF 2A7YA 1KC8R 4MDWA 1UJYA 2HCKA 2QI2A 2VXEA 2MPXC 1MUZA 2DIGA 5CK9A 2CH4A 5GAOq 1W4SA 1NJIC 3NPFA 3X20B 2CZ6B 5IN1A 4F7UF 1OV3A 4TVRA 2BKDN 5FU7C 3SWNC 3PE0A 2RJEA 3OSSC 2GCXA 2RN8A 2VYTA 3S3MA 1NYGA 4E47A 1KK7A 1C6VX 2HNIA 3JB9G 1PNJA 2EWNA 5GJVB 5CIUA 2EJGA 2K5IA 3RMSA 4CC2A 2DETA 2CSIA 1CKBA 3NGPA 4C92E 2EJFA 2DXCA 5GAMh 2RPNA 3CCRT 3G7ZA 2MOXA 3SDZA 2DL7A 3REBB 1VQ9Q 1NM7A 5GANe 2FRYA 5FU7B 3SWNB 1AWWA 5I2MA 4ME7A 1VQOT 3CC2A 4CRIA 5GAOp 3PT9A 2PZ1A 4KBMB 3JB9J 2RHYA 2MMPA 4PFPA 4D6WA 1YI2A 3PMIA 3CMAT 2OAWA 4XAXB 4CI0C 4BY6C 2B8AA 4C0ZA 4LUEA 3QZ9B 1QWEA 4RCCA 5IXFA 5IHKA 5GJWB 3CMEA 2DNUA 1XOVA 5KYWA 1RACB 4HCBA 4AFUC 2QTXA 4QW2A 1AOJA 1ZSZA 3OB9A 3VS7A 3OYAA 5DLQE 4J5YA 1RLQC 5GMKm 1RAHB 4M77C 4M7AE 1GL5A 2KT8A 3M53A 1TSFA 2P0PA 3FLGA 1WPYA 1V29B 1YIJQ 3ZFJA 4M75C 2YWWA 3CXCP 3MEUA 5GAOn 4BY6B 4J7IA 3D7SB 1ZHIA 2M9UA 3LYIA 1Q86C 3GNGA 1QMCA 2KAFA 1WXBA 2EQUA 2ED0A 4XTVA 4F7UE 1NJIU 2EYWA 1N8RR 3EG9A 2RO0A 2CZ1B 3VS2A 1OI1A 4M77B 4DEYA 4BD3A 4BI8B 3JCMg 4DBFA 3F70A 3OBWA 4M75B 1NEGA 3I56A 2YSQA 3NFCA 5J3BA 2ZPFB 3EFOA 1K76A 4O5VA 4IUQA 3RMQA 1AT1B 4C92A 3GP8A 1U5SA 1VQ8Q 3MP8A 4AMCA 1LNXA 1NBEB 2AKLA 2CP5A 4D8KA 1JJ2A 3OS0A 5LJ3e 1AZEA 2EFIA 2CT3A 2C0OA 5CCAA 1K73R 3QJ6A 1VQMT 4M7DC 1SSFA 2X4JA 3X25B 1VQPQ 4N4GA 1TUDA 2KE9A 4FIBA 4J8OA 1K4US 1SHFA 2AK5A 2ENMA 1HSQA 1I0CA 2DM1A 1WJRA 1K9AA 1U1SA 2KSSA 1VQ6T 1Z9ZA 3V8LA 1YITT 3M0QA 5LJ5f 2KYBA 1I4K1 1M3CA 3CCSA 2LCLA 2PVOB 3FDRA 3EGUA 1X6OA 2XDPA 1RAFB 4JDSA 1CSKA 3CXCS 2L8DA 2HSEB 1ARKA 3CC7T 1Q7YU 2RJDA 4X9DA 4M7DB 1VYUA 3VS0A 4A54A 1VQKA 1UDLA 2NYSA 3JCMQ 4IKFA 1SEMA 3LH5A 1QKXA 4NS5A 1SF9A 3M0TA 4P5NA 3OA6A 1GXIE 1DJ7B 3A1PA 1YJNA 4FCYA 2DVJA 1M1FA 2HMAA 5L8RE 2JXBA 2YUPA 4RTYA 1B7TA 4M78A 1UEBA 3CPWA 3EHQA 3A8LB 5LL6S 3ME9A 5C0MA 1YP5A 4KGXB 2CKKA 4JRQA 2RI2A 2FZKB 2EJ9A 4D8DA 3CD6A 3I55Q 1G8XA 2MCNA 2LQKA 4GLMA 3EGXB 4J9EA 5CQXA 4FU6A 2QDLA 1WHJA 4XTUA 1TU0B 2HQEA 3DB3A 5C6SA 4IUPA 2DRKA 4PJOC 3CCUA 2FPEA 1QVGA 3UT1A 5LJ5j 1AHJB 3HRTA 5KYYA 3JCMV 2DL8A 1I07A 4Y28E 2QXFA 1R8OB 3G71A 1OOTA 1A0NB 1YJWQ 6AT1B 2ZPHB 3JCMh 3OYEA 2A37A 3CBOA 1ZBXA 2FRWA 2I0NA 1LPLA 2JOYA 1BB9A 1KQSS 1X2QA 1CKAA 1UE9A 4PJOB 1RAEB 1NZ9A 2VC8A 2X35A 2HKNA 4ZNXA 4OMFB 1WLPB 3C12A 2QA4T 2KRNA 1K8AR 2VWFA 1VQ5A 2RD1A 4RTWA 1E6GA 3H6ZA 3QBYA 3KXTA 3EAEA 2MF2A 4MZTA 2WSEE 4II1A 3JV3A 1FMVA 4JJCA 2CP3A 2JJ9A 3DLMA 3OMGA 4J9BA 2JT4A 1XJWB 1KC8C 3L2ZA 1R0BG 1JRIA 3KFVA 2G3RA 2EKOA 3JCMW 1FX7A 1W2BP 1O75A 5GMKj 3VS4A 1ZX6A 2DLPA 1ACMB 4X1VA 2RI3A 2C06A 1GBQA 1LJOA 1IGUA 4JRIA 3OY9A 1QCOA 3V8KA 2FL7A 5CKBA 2CP7A 3VUZA 2V1QA 2ZPEB 4UC4A 2P0QA 3DB4A 1BCMA 3M54A 4AFZC 3GOXA 3SEMA 3LW5E 1T3SA 3EG1A 1KD1R 4LDXA 3KBGA 1J3TA 5GAOr 5M9OA 2CZ7B 1JB0E 3H9NA 3TVTA 3HPWA 2O9SA 1WA7A 1VQPT 1YWOA 4EMGA 2BE7D 3PTAA 4XQ3A 5GANf 4AG2C 2OI3A 2VGMA 4X9CA 2EW3A 1M4ZA 1KQ2A 3INZA 4E2FB 5IH2A 3CCRQ 1KSWA 2LVMA 2LNVA 4C8QA 4M77G 1SG5A 2PTKA 3MEAA 4JUVA 3RKXA 4KUDK 1NPPA 3G6EA 5J39A 4OB3B 3SD4A 4M75G 1VQOQ 2GFAA 1Q81R 2YLCA 2DYIA 2COYA 5KE2A 1K0XA 2P4RA 4BUGA 5EG2A 2WACA 2K6DA 4BE0A 1HYOA 1BBZA 3L1AA 4JPBW 1D0YA 1VIFA 2ECZA 4LE9A 3A8OB 1W2BS 2V26A 1WNLA 3CCMA 5AYFA 2XDBA 2JNGA 2QG9B 1WX6A 3PFSA 4ORZA 3C95A 1UUEA 1VQLQ 1KC8U 2LQWA 2VKNA 5GAMd 5AT1B 2E5QA 2JVVA 1UHCA 4PJNA 2GQIA 1N8RC 2DTOA 2EQMA 2NLUA 4Q5WA 2QEXA 2JN0A 1NLPC 1KQ1A 2CGHA 2DTIA 4M7DG 2KMTA 1KG1A 1X01A 3G4SQ 5GANj 3OYYA 4N4HA 4C92C 3T9NA 2D0QB 3CC2T 1NYFA 2HAXA 2RHZA 1BIAA 5FLXE 5KYUA 4XTYA 4AFQC 3OYBA 4FT2A 5CKFA 5GMKe 4KGVB 2E12A 2E3HA 2F2WA 1OU8A 2YDLA 2MYSA 5HKCA 3EGDA 4J7FA 2EGCA 4NOYA 1NPRA 2PVGB 1WHLA 1JU5C 4PLLA 3UATA 2NUPA 3I5RA 3EH2A 3ZEHA 1BYMA 4A4HA 3CMET 4ATOA 1WHKA 2HBWA 1PKSA 3UDCA 1VQ4A 3M4GA 5GAOl 2CS7A 1FWZA 1HXDA 1VQMQ 1YHQA 2O31A 4LDYA 1QP2A 2E5KA 4YTLA 1IZ6A 1VQ7A 4M7DD 3VUBA 2EYZA 1UGSB 3E19A 4FW2A 2E3IA 1B34B 2JTFA 4M7AC 3G1JA 4IUTA 2KQWA 5HK0A 5DY9A 4R56A 3EHRA 4IIOA 1VA7A 2EGEA 2GQVA 5FW9A 2D8JA 2KR3A 3CC7Q 1AVZC 3RKYA 2IPOB 2QASA 1OX8A 2M0YA 3OYKA 1HK9A 2K5FA 1VQNQ 2ZGWA 4DA4A 1WDXA 4PJOG 2CYZB 2C0IA 2DBMA 4KH1B 1ZA1B 2DFUA 4M7AB 1UECA 1GRIA 4VUBA 1KHIA 4M78F 2NWMA 3CC4A 5LJ3j 1YN8A 1X2KA 1OULA 2I2LA 3QDFA 2RF0A 2RHIA 3BW1A 4ZGDB 1RLPC 2V8KA 1FMWA 2PQWA 2M16A 1Q82C 4F7UB 7AT1B 1G3SA 2R58A 2QQBA 2QGGA 2DZCA 1WZOA 1O9SA 4C5IA 4X34A 2OAUA 2RI5A 2F2VA 3GBQA 3CCST 2DD5A 5HY6A 2XKOC 2RB6A 2JUFA 3P8HA 1OQKA 4XU0A 2DL5A 3QWYA 1OPLA 3NTKA 1HJDA 1X75C 2KK4A 2L89A 2ESWA 2OTLA 1AWJA 4PJOD 3JCMP 1M1KR 1Y71A 3CXCA 1BI0A 2H8HA 4OMQA 3TREA 1NG2A 2XK0A 3OYHA 3OW2P 1G3YA 2MWPA 1D1BA 2LX7A 1YWPA 2RA2A 2WSCE 3CCEA 4QKUA 3UA6A 4QVDA 3M58A 2RHUA 5CR2A 3WVDB 1VQLT 2BZ8A 3JB9D 3HSBA 4KGZB 3QZ5B 2FB7A 1SSHA 3RR6A 3IQLA 3S6WA 2QA4Q 1UGVA 1BI2A 1YNZA 1IRXA 1YJ9A 1X69A 2ZPBB 3CD6T 3JCMJ 3U23A 5GAN8 2DPPB 2O4XA 4WF2A 1WXTA 2P0KA 1X6GA 4F16A 4PLIA 3OSVA 2J06A 4NL3A 1TXQA 2DKGA 1OYXA 2KRMA 2L2PA 3G4ST 5GAMe 4M78E 2LJ0A 2CP0A 1Y07A 4OGCA 1ZUKA 1Y96A 3HKSA 1M2VA 3A8HB 5CKDA 3JCMd 3LLRA 3JB9H 3QWXX 1GCQC 1RADB 2DAQA 4PL6A 3UWNA 2CZ0B 3OYMA 2H3EB 1BK2A 4RCBA 2ZPIB 2K3YA 3G71T 3Q1JA 2O88A 3VS5A 3HTRA 1Q82U 2FPDA 4O6JA 3OS2A 2GGRA 3QSUA 2ZZDA 1N9SA 2A3LA 2J6FA 3TQ7P 2AT1B 1QKWA 2A28A 3CCLQ 3OW2S 1M8MA 1C1AA 2QDYB 2RK1A 1RAGB 2LRQA 1PM3A 4JS4A 1N9RA 1KQSA 1M8VA 3OMCA 3HHTB 3LH0A 2K2VA 2J6KA 5CKHA 3LGFA 5GAN6 1Q81C 2LQ8A 2YT6A 3BE3A 4C8QF 2J6OA 2QQRA 4FW1A 1PCXA 2DYBA 4N0AC 1VYVA 3FRNA 2FG0A 2KBTA 3SFMA 4MMLA 4HA8A 2ED1A 4C0DC 1IB8A 1N27A 1AEYA 4LDUA 5KYXA 1RAAB 1QLYA 5LJ5g 1D3BB 2CP6A 1M90R 3E9FA 3TSWA 1VQNT 1KQSP 1X43A 1VIEA 2GTJA 1ZQ1A 4C92G 3CCQA 4M4ZA 1JO8A 4HT8A 4Y92A 2J7IA 3QG1A 3R6NA 4N4IA 1Q86U 2AZSA 2M02A 4HCZA 2KYMA 2OTJA 2XI9A 3KUFA 4LDWA 4EMKC 2L5QA 4C0DB 2IIMA 4A4KA 1PHTA 1I81A 3QYGB 3CMAA 2XIDA 1TTHB 2RNAA 1WJQA 1PG5B 4RTZA 5DM7R 1TUGB 4HVVA 2KXDA 3QDRB 4HXJA 4J83A 5GAN7 4QQDA 3MHXA 4ANJA 1WJSA 2LQNA 2F5TX 2DIQA 3JB9I 5A0GA 1VYTA 3G6ET 4BACA 3CC2Q 1NJIR 4EMKB 1S1NA 1N6AA 1SRMA 1MMDA 2EPDA 9ATCB 1U3OA 2HL5C 4M7AG 2ZCFB 4IUVA 1YI2Q 2DBKA 3LWHA 2BZYA 4JRKA 3SWNA 2W0ZA 4A4EA 2DERA 2VB6A 3MO8A 3H8ZA 1IHWA 3VRZA 3CCMT 1OEBA 1WHMA 1Y7XA 4C8QE 2XMFA 3CMEQ 1KHCA 1Q81U 2FYKA 2NUTB 2CT4A 5GAN3 4M78G 3OS5A 4F7UG 4EMHA 3MCAB 4Y91A 1W2BA 4J6WA 2EYYA 1T3LA 5KYNA 4C0GA 2RMOA 2RQUA 1SPKA 1IGQA 3L2WA 1RUWA 1I8FA 8AT1B 1S72A 1WHGA 2RJCA 2QQAA 3OYIA 1YBYA 3CCVA 3MP6A 2QEXT 1QVFP 2BE9B 3HFNA 3L42A 4E6RA 2K7AA 3M57A 3H0FA 5D6WA 4RUGA 4J9GA 1ZUUA 4E7IA 1UTIA 1JBMA 4HVWA 4XTWA 5EC7A 4PFOA 2LC4A 1M9SA 3JB9F 2FPFA 1FMKA 2AIRB 3OYDA 3X24B 2CH4W 1Q7YR 4C5EA 5KE3A 1IHVA 1VQ6A 1XTDA 3N5BB 2CUBA 2FHDA 1YITA 5KCOA 2QAZA 1K9MR 3I56Q 2L3RA 3SHWA 3AT1B 1GFDA 5LJ5h 3JSCA 4M77A 4BE1A 3UPUA 1R77A 3GPLA 2RQTA 3M56A 1WIEA 3QO3A 4C5HA 3JCMe 4M75A 2XG8D 4IUUA 3CCLT 2K3BA 1VQ4T 5CAIA 3E1SA 4OMOA 1YHQT 2LMJA 2E1HA 2KY9A 5FU6C 1D1CA 3MP1A 1VQ7T 1MNDA 3FJPA 2M0OA 2D9TA 5HK3A 2P4TA 3O5ZA 3CQTA 2LT4A 1AWXA 2VXFA 2Y4XA 1NLOC 3FJ5A 4OMNA 4L59A 3CCSQ 1M1KC 1RI9A 2ABLA 4PJMA 5A2QE 2ROTA 2X9HA 3WVEB 5GANg 4AT1B 3L2UA 1QVFS 4B9XA 3FIFA 4J6YA 5A0DA 1AZGB 3CCJA 1TS9A 4EDUA 4NL2A 1VQKQ 5FU6B 3VU3C 4ZGEB 1ZSZC 2P84A 1UGPB 1BCOA 4FYVB 4HCKA 5GAOm 1VQ9A 1RI0A 1YJNQ 4M7DA 3RIRA 2F5KA 2QQ9A 1MV0B 2V1RA 4V2SA 2E10A 4PJJA 1MHNA 3A8GB 1H3ZA 2YUNA 4E7HA 1Y57A 1LCKA 3BY7A 1IXDA 1GFCA 1QP3A 3MKDA 4DBQA 4PNOA 3PNWC 3J7AF 1FYNA 3AHUA
chains in the Genus database with same CATH topology
1UGRB 1JJ2A 3X28B 2I2LA 3OS0A 4M7DE 3TCJA 2ZPGB 4QQGA 5LJ3e 3V7RA 2EFIA 2EYQA 3OYJA 3L2QA 2RHIA 2GF7A 3BW1A 5GAMf 4ZGDB 5CCAA 1G5VA 3QJ6A 2V8KA 2PQWA 2M16A 4M77D 1SSFA 2DJZA 3ER0A 2JZ2A 2X4JA 3X25B 4BB7A 4F7UB 1Q82C 1G3SA 4N4GA 4FIBA 4J8OA 2R58A 2F69A 4C8QG 3HRSA 2DK3A 2QQBA 3GF5A 4M75D 1VQMA 4J6XA 4M7AD 2DZCA 5GAN4 1WJRA 1O9SA 1WQ7A 4C5IA 1IREB 4X34A 2OAUA 2RI5A 1U1SA 2KSSA 1PSEA 2DD5A 4RG8A 4XU3A 5HY6A 2XKOC 3V8LA 3CCST 1YIJT 2RB6A 1YITT 3JAME 4E7KA 2JUFA 3P8HA 1BIBA 5LJ5f 3V8JA 4HCCA 1I4K1 4XU0A 5GAN5 2OTLT 3CCSA 3JCMc 2LCLA 2PVOB 3PIOA 4OGEA 3FDRA 3NTKA 1YIJA 1X6OA 4QVCA 1X75C 2XDPA 2E41A 4JDSA 2KK4A 4XU2A 3CXCS 2L89A 1U1TA 2L8DA 3JRZA 1YI2T 4ELYC 2OTLA 4PJOD 4M78D 1EIFA 3JCMP 2D6FA 3CC7T 1Y71A 1Q7YU 2RJDA 3CXCA 1BI0A 4X9DA 3TREA 1RL2A 4M7DB 3P8BB 2DVEA 1K73C 2E6NA 2LX9A 2XK0A 3A8MB 4A54A 3OYHA 1VQKA 4JLGA 1G3YA 5D6YA 4XU1A 1G3WA 3JCMQ 3CC7A 4IKFA 2MWPA 2MI6A 4OVAA 3MEVA 3TU4K 5LJ3d 3S3OA 4C0FA 4JJNK 4NS5A 4FSXA 4P5NA 3OA6A 2RA2A 3FC3A 5IAYA 4ZGJB 3J80E 1DJ7B 4C92B 1QVGS 2WSCE 5FRNA 2DXBA 2PUOB 3X26B 4QVDA 3CCEA 1YJNA 3M58A 1VQNA 1M1FA 2RHUA 5CR2A 2LDMA 2K57A 3WVDB 1VQLT 5LJ3g 5L8RE 4BI3A 3JB9D 1YJ9T 3HSBA 3QZ5B 3EFRA 3CPWS 2FB7A 1VQ8T 2EAYA 1BI3A 3S6WA 3QUIA 3OYNA 1BI2A 4M78A 4PJOA 4Z02A 1YJ9A 1UEBA 3CPWA 2ZPBB 2VUBA 1VUBA 3A8LB 3CD6T 3JCMJ 5LL6S 3ME9A 4BI4A 5C0MA 3S3NA 1VQ8A 2RM4A 5GANd 2CKKA 4XK8E 3ZBDA 4JRQA 5GAN8 2DPPB 2RI2A 2O4XA 4QQ6A 4WF2A 2EJ9A 2P0KA 2VGNA 4DOVA 4PLIA 1M90C 4HT9A 3CD6A 3OSVA 4NL3A 2EIFA 2XHCA 3FEOA 5GAMj 2DKGA 1OYXA 3HP9A 2LQKA 2MAMA 1VQPA 3VKIA 4KULA 5CQXA 3G4ST 4FU6A 4PJOE 1M5Q1 2XICA 4M78E 4QVZA 5GAMe 4XTUA 1Y07A 4OGCA 2MWOA 1Y96A 2PU9B 3HKSA 2HQEA 2Y90A 3A8HB 3DB3A 3BDUA 4B9WA 1NE8A 4IUPA 5C6SA 5CKDA 3JCMd 5GANh 4RMOA 4JRPA 1XQHA 3LLRA 2DZ9A 4PJOC 4M78C 3CCUA 3JB9H 2DAQA 5GMKh 5A0LA 1QVGA 4PL6A 3UWNA 2CZ0B 3UT1A 3OYMA 3I56T 4RCBA 5LJ5j 2ZPIB 3PGGA 1AHJB 1D3BA 2K3YA 3HRTA 2E64A 4L5GA 3Q1JA 1PSFA 3JCMV 3G71T 1TH7A 1N8RU 3M55A 3VYGA 3ASKA 4Y28E 2YLBA 2QXFA 5LJ5e 1Q82U 5GMKi 1R8OB 3URGA 3CC4T 1UB4A 4O6JA 3G71A 3OS2A 3QSUA 2ZZDA 1N9SA 1MGQA 2A3LA 2ZPHB 3JCMh 2HBPA 3HL8A 3OYEA 5J26A 4XTZA 3CBOA 1VQMT 1ZBXA 2K4YA 4N0AA 3OW2S 2JOYA 3C4SA 2YRVA 3NTIA 2QDYB 2RK1A 3OBYA 1KQSS 2LRQA 3VYHB 2RK2A 3SB2A 4PJOB 4GY5A 4M78B 3OW2A 1NZ9A 5FROA 2VC8A 2X35A 4JS4A 1N9RA 1KQSA 2X4YA 4OMFB 1M8VA 3NTHA 3C12A 4DQ2A 3QIIA 3OMCA 3MEWA 2QA4T 4EPCA 2DTHA 4PKCC 3HHTB 3LH0A 4ZN1A 2HD0A 1LOJA 2K2VA 2O4XB 4FL6A 2RD1A 4JLIA 5CO7A 1VQ5A 3BFMA 5CKHA 3LGFA 3H6ZA 3QBYA 3KXTA 3EAEA 5GAN6 1K73U 2MF2A 2KDSA 1P92A 2X4WA 2WSEE 1G3TA 2RHXA 4KT0E 2LQ8A 4II1A 4MZTA 2QA4A 1Q81C 5GAMg 4C8QF 5CQYA 2QQRA 3DLMA 3I55T 2M1HA 3OMGA 2IG0A 3RUXA 3QKJA 4N0AC 2XU8A 4HKEA 1Y96B 2KVQG 5I21A 1KC8C 3FRNA 1GXIE 3P8DA 3L2ZA 3SFMA 4MMLA 2PVDB 2V8JA 3I55A 1JRIA 3OYCA 1VQKT 2R57A 4HA8A 4XTXA 2AHJB 3OYFA 4C0DC 2G3RA 4BDZA 2EKOA 3JCMW 1N27A 4EMKA 1FX7A 4LDUA 2V8IA 5CKEA 5LJ5g 1D3BB 3FB9A 3E9FA 1O75A 4LD6A 5GMKj 3JCMX 3CCQT 1VQNT 1M1GA 3CCET 1VIEA 1YJNT 4RKUE 4ZTJA 1ZQ1A 2RI3A 1K8AC 2C06A 4C92G 4L6V5 2XDDA 3OYGA 1M1KU 1LJOA 4JRIA 4A53A 3OY9A 4MZPA 3CCQA 3V8KA 2FVUA 2GFUA 4HT8A 2FL7A 1M90U 2OTJT 2DXTA 3QG1A 5CKBA 3GIBA 3VUZA 4IURA 5LJ3f 2ZPEB 4N4IA 4C92F 1YJWT 1Q86U 2EQJA 4E7LA 3QJYA 4OB0B 4UC4A 4HCZA 2OTJA 2P0QA 4C8QD 3DB4A 3E9GA 1XNIA 2XI9A 3HRUA 2LCCA 3M54A 3HFOA 3KUFA 3QXEB 4LDWA 2L5QA 4EMKC 3GOXA 4E7JA 1YJWA 4C0DB 2R5AA 3TEEA 5LJ3h 3LW5E 4A4KA 3QYGB 1I81A 3CMAA 4LDXA 2XIDA 3KBGA 1WJQA 5GAOr 5M9OA 5DM7R 2CZ7B 1JB0E 2WSFE 3HPWA 3CCLA 1VQPT 4EMGA 3QPHA 3QDRB 5FRMA 4OP0A 5GAN2 3R6OA 4J83A 1Q7YC 3PTAA 5GAN7 4XQ3A 3CEYA 4LDVA 4QQDA 5GANf 4MZMA 5CVIA 3J81E 3MHXA 3OS1A 2LTOA 2VGMA 1WJSA 3RKWA 4X9CA 2F5TX 3VV0A 1OZ2A 3CCUT 4MMKA 1K9MC 1OZ3A 1M4ZA 2DIQA 2JTMA 5A0GA 3JB9I 3INZA 1KQ2A 3QHSA 4OF1A 4DOWA 3G6ET 2LVMA 1FXXA 4MDXA 2LNVA 2RH2A 3O8VA 4C5GA 4BACA 4BDYA 4C8QA 4M77G 3BDLA 4JUVA 3MEAA 2K3XA 3RKXA 3VJPA 2Y4YA 1NPPA 5I2SA 4KUDK 4EMKB 3PIPA 3G6EA 1N6AA 5J39A 2VV5A 3EFSA 3C94A 4OB3B 1BKBA 3SD4A 4OB2B 4M75G 3JCMf 3RERA 4M7AG 2GFAA 4KUIA 2ZCFB 4IUVA 1KD1C 4M77F 2BIVA 3LWHA 2YLCA 4JRKA 4OB1B 2QQSA 3SWNA 3RESA 2DD4A 4A4EA 5KE2A 4A4GA 3MO8A 3H8ZA 2RJFA 3CCMT 4M75F 4M7AF 4BUGA 5EG2A 2A7YA 1Y7XA 2WACA 3M9QA 4C8QE 4BE0A 4JS5A 4MDWA 3L1AA 1KHCA 1VIFA 1Q81U 3A8OB 2FYKA 2QI2A 1WNLA 2VXEA 3CCMA 1W2BS 5AYFA 2XDBA 5GAN3 4M78G 3OS5A 4C8QC 2DIGA 2JNGA 5CK9A 4F7UG 2E65A 4EMHA 3PFSA 3MCAB 2E70A 4Y91A 5GAOq 1W2BA 4J6WA 1VQ5T 3C95A 1S72T 1W4SA 1KC8U 4C0GA 1NJIC 4LD9K 3X20B 1UGQB 3V7CA 3L2WA 3CPFA 5GAMd 3CCVT 1I8FA 2CZ6B 5IN1A 2E5QA 4F7UF 4ZN3A 1S72A 4TVRA 2BKDN 5FU7C 3SWNC 1I5LA 2RJEA 2HQXA 2JVVA 2QQAA 2RJCA 3JCMb 3OYIA 3OSSC 1YBYA 2GCXA 2VYTA 3MP6A 3CCVA 3S3MA 2BUDA 2QEXT 4E47A 3HFNA 2HNIA 3L42A 1N8RC 2DEQA 3M57A 5D6WA 3JB9G 3M4YA 1K8AU 2DTOA 2EQMA 2NLUA 2EWNA 4Q5WA 2EJGA 2K5IA 5CIUA 4E7IA 1JBMA 3RMSA 2QEXA 2JN0A 3LWIA 4XTWA 5LJ5d 2LC4A 2EJFA 4C92E 1B34A 1KQ1A 2DXCA 2CGHA 2DTIA 5GAMh 4C8QB 1M9SA 4M7DG 2KMTA 3CCRT 3JB9F 3G7ZA 1KG1A 1X01A 5GANj 3SDZA 3OYYA 4N4HA 4C92C 3OYDA 3T9NA 2D0QB 3X24B 3CC2T 2EQKA 2HAXA 5GANe 2RHZA 1BIAA 1H641 5FLXE 3CCRA 4C5EA 5KE3A 5IT9E 4M7DF 4XTYA 5GMKl 1XTDA 1VQ6A 3N5BB 3OYBA 5FU7B 3SWNB 4FT2A 2FHDA 5CKFA 5GMKe 2IVWA 1YITA 3PMTA 4ME7A 2E12A 5I2MA 5KCOA 1VQOT 3CC2A 2L3RA 4CRIA 5GAOp 5LJ5h 3PT9A 5HKCA 1U8RA 4J7FA 1WQWA 1QVPA 3L2RA 3JSCA 2YHTA 4KBMB 4M77A 4NOYA 1NPRA 2PVGB 2RHYA 4BE1A 2MMPA 3UPUA 3JB9J 4ZTFA 3DKMA 4D6WA 1YI2A 3GPLA 4PLLA 3M56A 2O01E 3OYLA 3PMIA 3ZEHA 3QO3A 3CMAT 4C5HA 5KCHA 1BYMA 4A4HA 4XAXB 4CI0C 2R5MA 3JCMe 4M75A 4BY6C 3CMET 1K9MU 4R55A 2B8AA 2XG8D 4C0ZA 4IUUA 3CCLT 4M7AA 4M7DC 2K5LA 3QZ9B 4ATOA 4RCCA 2DXUA 1BI1A 5CAIA 3E1SA 1VQ4T 1YHQT 3CMEA 3WXMB 3UDCA 2E1HA 2KY9A 5FU6C 3M59A 1VQ4A 3M4GA 1XOVA 5GAOl 3META 3MP1A 1VQ7T 2CS7A 3FJPA 1FWZA 1HXDA 2M0OA 2D9TA 4M77E 1YHQA 1VQ6T 4HCBA 2QTXA 2E6ZA 4LDYA 1QP2A 4QW2A 5HK3A 3OYAA 3DLLA 3OB9A 2P4TA 3QYHB 1VQOA 1KD1U 1VQLA 5DLQE 4J5YA 2LT4A 2VXFA 5GMKm 4YTLA 2X4XA 1IZ6A 2LT1A 2Y4XA 4M75E 4M77C 1VQ7A 4M7AE 4F7UA 4M7DD 3M53A 3VUBA 4L59A 2P0PA 3FLGA 1M1KC 4RG2A 1UGSB 3E19A 1WPYA 1V29B 4GLKA 1B34B 4M75C 2JTFA 3V7SA 3ZFJA 4M7AC 2PUKB 5D6XA 3MEUA 5GAOn 4BY6B 5A2QE 4J7IA 4IUTA 2KQWA 5HK0A 5DY9A 4R56A 3CCJT 3WVEB 5GANg 1ZHIA 2M9UA 3LYIA 3L2UA 1QVFS 4C92D 1Q86C 3LX7A 3GNGA 4B9XA 3FIFA 2H3JA 2GQVA 4J6YA 5A0DA 3CBMA 2KAFA 3CCJA 2EQUA 3GLXA 3M5AA 4EDUA 1QVFA 4NL2A 4ELZC 4XTVA 5FU6B 5DLOA 3VU3C 4F7UE 1VQ9T 1NJIU 4ZGEB 3RKYA 1UGPB 2RO0A 3G4SA 3LGLA 3L2VA 2CZ1B 5GAOm 3OYKA 2DO3A 1HK9A 2K5FA 1VQ9A 3CBPA 1OI1A 4M77B 1RI0A 2ZGWA 4M7DA 3A5ZB 3RIRA 2F5KA 2QQ9A 4BD3A 4BI8B 3JCMg 5KH6A 4DA4A 4V2SA 2E10A 4PJOG 1YCYA 1MHNA 3A8GB 1WGSA 2CYZB 3F70A 4A4FA 3OQ5A 4E7HA 3OBWA 1H3ZA 3BY7A 3GNFB 4M75B 4M7AB 2XD0A 3I56A 1QW1A 3NFCA 5J3BA 1QP3A 4VUBA 2ZPFB 4FT4A 4O5VA 1KHIA 4IUQA 3RMQA 4C92A 3GP8A 4BE2A 4FM4B 4PNOA 4PJOF 1JJ2S 4M78F 3PNWC 3CC4A 3J7AF 5LJ3j 3AHUA 3MP8A 1LNXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DZ9 A;  5GAN e;  4PJO C;  4M78 C;  5LJ3 h;  1BIA A;  1H64 1;  2I2L A;  3JB9 H;  4M7D E;  1I81 A;  5LJ3 e;  3V7R A;  4M7D F;  4XTY A;  5GMK h;  5GMK l;  5GAO r;  3SWN B;  3BW1 A;  5GAM f;  5GMK e;  4RCB A;  5LJ5 j;  3PGG A;  1D3B A;  4EMG A;  2E64 A;  4M77 D;  4M7D C;  2DJZ A;  3JCM V;  4F7U B;  4OP0 A;  5GAN 2;  5LJ5 h;  1TH7 A;  5GAO p;  5GAN 7;  4XQ3 A;  2YLB A;  5LJ5 e;  1WQW A;  5GAN f;  5GMK i;  4C8Q G;  2YHT A;  4M77 A;  4NOY A;  3JB9 J;  3RKW A;  4M75 D;  4X9C A;  4J6X A;  4M7A D;  3QSU A;  1N9S A;  1MGQ A;  2DZC A;  1WQ7 A;  4MMK A;  5GAN 4;  3JB9 I;  1KQ2 A;  3QO3 A;  3INZ A;  3JCM h;  4XU3 A;  1U1S A;  3QHS A;  3V8L A;  3JCM e;  4M75 A;  4XTZ A;  4M7A A;  2RB6 A;  1BIB A;  5LJ5 f;  3V8J A;  4RCC A;  2DXU A;  5CAI A;  4N0A A;  4C8Q A;  1I4K 1;  4M77 G;  4XU0 A;  5GAN 5;  4JUV A;  3RKX A;  3JCM c;  4EMK B;  4QVC A;  3EFS A;  3SB2 A;  2E1H A;  4PJO B;  2E41 A;  4M78 B;  4XU2 A;  1U1T A;  2VC8 A;  3M4G A;  4M75 G;  3JCM f;  1N9R A;  5GAO l;  3RER A;  3FJP A;  4M77 E;  1HXD A;  4M7A G;  4PJO D;  4M78 D;  1M8V A;  4M77 F;  2QTX A;  2YLC A;  4DQ2 A;  3JCM P;  4JRK A;  2DTH A;  3SWN A;  4X9D A;  4M7D B;  1LOJ A;  4JLI A;  4J5Y A;  2DVE A;  2RD1 A;  2VXF A;  3RES A;  5GMK m;  3BFM A;  4A54 A;  4M77 C;  4M75 E;  4M7A E;  4F7U A;  4M7D D;  4M75 F;  5GAN 6;  5GAN h;  4M7A F;  4XU1 A;  3JCM Q;  4C8Q E;  5GAM g;  4C8Q F;  1WPY A;  5LJ3 d;  3L1A A;  1B34 B;  4M75 C;  3V7S A;  4M7A C;  2FYK A;  1WNL A;  2RA2 A;  2VXE A;  5GAO n;  3RUX A;  4C92 B;  5GAN 3;  4M78 G;  4N0A C;  5DY9 A;  4C8Q C;  4QVD A;  5GAN g;  4F7U G;  1Y96 B;  2E65 A;  2K57 A;  4EMH A;  4C92 D;  4Y91 A;  5I21 A;  5LJ3 g;  3L2Z A;  4J6W A;  5GAO q;  4MML A;  3FIF A;  3JB9 D;  1JRI A;  4J6Y A;  3HSB A;  4HA8 A;  3EFR A;  4XTX A;  2FB7 A;  3V7C A;  4NL2 A;  2EAY A;  4EMK A;  3JCM W;  4XTV A;  5GAM d;  3VU3 C;  4F7U E;  1I8F A;  3QUI A;  4F7U F;  4PJO A;  4M78 A;  5LJ5 g;  3RKY A;  1D3B B;  3SWN C;  3FB9 A;  1I5L A;  5GMK j;  3JCM X;  3JCM J;  3JCM b;  2RM4 A;  5GAN d;  5GAO m;  1HK9 A;  4M77 B;  2ZGW A;  5GAN 8;  4M7D A;  4WF2 A;  3RIR A;  2EJ9 A;  3HFN A;  2HNI A;  4C92 G;  3JCM g;  2DEQ A;  4V2S A;  2E10 A;  1LJO A;  3JB9 G;  4HT9 A;  4JRI A;  4A53 A;  4PJO G;  3V8K A;  1YCY A;  2DTO A;  2EWN A;  4NL3 A;  2EJG A;  4HT8 A;  1JBM A;  2DXT A;  3BY7 A;  4M75 B;  2DKG A;  4M7A B;  5GAM j;  2JN0 A;  4XTW A;  3GIB A;  5LJ5 d;  4C92 E;  2EJF A;  1B34 A;  1KQ1 A;  5LJ3 f;  2CGH A;  2DTI A;  4C92 F;  4C8Q B;  5GAM h;  4M7D G;  4PJO E;  1M5Q 1;  4M78 E;  4C92 A;  5GAM e;  3JB9 F;  1X01 A;  4PNO A;  4XTU A;  4PJO F;  4M78 F;  4C8Q D;  5GAN j;  1Y96 A;  4C92 C;  2Y90 A;  3HFO A;  4EMK C;  5LJ3 j;  3BDU A;  3AHU A;  3JCM d;  1LNX A; 
#chains in the Genus database with same CATH topology
 5KYW B;  2HDA A;  1QQJ A;  3TCJ A;  4QQG A;  2ZAE A;  3CD6 Q;  4B6M A;  1ZSZ B;  3OYJ A;  5GAM f;  2JTE A;  1UG1 A;  2KGT A;  1G5V A;  4M77 D;  2JZ2 A;  2F69 A;  4C8Q G;  3HRS A;  2DK3 A;  1KIK A;  2X3X D;  3GF5 A;  4M75 D;  1GCP A;  1Z9Q A;  5GAN 4;  2D8H A;  1M2O A;  1IRE B;  3CCU Q;  4RG8 A;  2LJ1 A;  4J9H A;  3V8J A;  3EGX A;  2OTL T;  4DBR A;  1YIJ A;  4AFS C;  2JM9 A;  2DF6 A;  2AZV A;  4XU2 A;  1YI2 T;  1U1T A;  3JRZ A;  2EBP A;  3EG9 B;  4ELY C;  3G71 Q;  1ZSG A;  1EX4 A;  2JM8 A;  1RL2 A;  3P8B B;  1K73 C;  4FSS A;  2E6N A;  2JS2 A;  4JZ4 A;  5D6Y A;  4XU1 A;  2MIO A;  2F1L A;  3H0H A;  2MI6 A;  2D1X A;  3MEV A;  1TUC A;  5LJ3 d;  3S3O A;  4C0F A;  4FSX A;  3EFO B;  5IAY A;  3J80 E;  4C92 B;  2PUO B;  3X26 B;  2K57 A;  3MJX A;  5LJ3 g;  4KRT A;  1YJ9 T;  1VQ5 Q;  2EAY A;  1BI3 A;  3QUI A;  3OYN A;  4PJO A;  4Z02 A;  4WCI A;  2VUB A;  2LJ3 A;  3S3N A;  1VQ8 A;  1OU9 A;  2RM4 A;  2KT1 A;  4XK8 E;  3ZBD A;  4HVU A;  2VGN A;  4DOV A;  2KNB B;  1M90 C;  1UHF A;  1X6B A;  2EIF A;  1MMN A;  1WHH A;  3FEO A;  5GAM j;  1B07 A;  1VQP A;  1M5Q 1;  4QVZ A;  1PD0 A;  2LNH B;  4B9W A;  1NE8 A;  5GAN h;  3I5S A;  1LVK A;  2MK5 A;  4M78 C;  1WYX A;  1QCN A;  5A0L A;  3I56 T;  3PGG A;  2E64 A;  2ATC B;  1TH7 A;  1N8R U;  3ULR B;  2YLB A;  5L23 A;  5GMK i;  4J9D A;  3C0C A;  2FO0 A;  1MGQ A;  4Z88 A;  2HBP A;  3HL8 A;  1I5O B;  2COZ A;  4XTZ A;  4AG1 C;  1ZLM A;  2YRV A;  1JXM A;  2KEA A;  2DEU A;  4GY5 A;  4M78 B;  4RTU A;  2DJQ A;  3OW2 A;  1D0Z A;  3VS3 A;  2CUD A;  2LP5 A;  2O2O A;  2GTO A;  4DQ2 A;  3QII A;  4EPC A;  1MMG A;  4PKC C;  4FYX B;  4F14 A;  4ZN1 A;  5CO7 A;  1JEG A;  3BFM A;  4GBQ A;  4F17 A;  1K73 U;  2KDS A;  2X4W A;  1G3T A;  2RHX A;  4KT0 E;  1NEB A;  2YRD A;  1IO6 A;  3G6E Q;  1ABO A;  1W6X A;  5CQY A;  4ESR A;  2M1H A;  2IG0 A;  3RUX A;  1TG0 A;  3QKJ A;  4HKE A;  3CCJ Q;  2KVQ G;  5I21 A;  4QT7 A;  3P8D A;  3I55 A;  2V8J A;  1MV3 A;  1VQK T;  2R57 A;  3OYF A;  1E6H A;  2GBQ A;  5CKE A;  5KYY B;  3FB9 A;  4LD6 A;  3JCM X;  3CCQ T;  4KH0 B;  3CCM Q;  4RKU E;  1YJN T;  4ZTJ A;  1K8A C;  4L6V 5;  2CRE A;  1D0X A;  2NUZ A;  2GFU A;  1M90 U;  2OTJ T;  2L3P A;  4IUR A;  4E7L A;  4OB0 B;  4FYY B;  8ATC B;  1XNI A;  2BZX A;  3HFO A;  4E7J A;  1YJW A;  3TEE A;  5LJ3 h;  3M0P A;  1SHG A;  3PVL A;  2QEX Q;  3QPH A;  1W1F A;  4LN2 A;  4A63 B;  2QK0 A;  4JZ3 A;  4OP0 A;  1Q7Y C;  3PVQ A;  3CEY A;  2HKQ B;  5CVI A;  1K9M C;  1OZ2 A;  3CCU T;  4MMK A;  1OZ3 A;  2JTM A;  1D09 B;  2YXY A;  3M0S A;  4OF1 A;  3EG0 A;  1FXX A;  2RH2 A;  4C5G A;  3O8V A;  2Y4Y A;  2VV5 A;  3EFS A;  3C94 A;  2HSP A;  4E7Z A;  4OB2 B;  3JCM f;  1KD1 C;  4M77 F;  2Z0W A;  1PRL C;  1I1J A;  4A4G A;  4M75 F;  4LNP A;  2L3S A;  3M9Q A;  2CSQ A;  2LZ6 B;  4JS5 A;  2FZG B;  4CC7 A;  4WTO B;  4E7S A;  1VQ4 Q;  4C8Q C;  1F1B B;  1YHQ Q;  2E65 A;  2E70 A;  1VQ5 T;  2K9G A;  1S72 T;  4LD9 K;  1ZA2 B;  1VQ7 Q;  1UGQ B;  3V7C A;  3H0I A;  2COW A;  3CPF A;  3CCV T;  1AWO A;  2EQI A;  4ZN3 A;  1VOM A;  1I5L A;  2HQX A;  3JCM b;  2HEQ A;  2BUD A;  1R0C B;  5IXB A;  2L3Q A;  2B86 A;  2DEQ A;  4FYW B;  3M4Y A;  1K8A U;  2L0A A;  3LWI A;  5LJ5 d;  4Z89 A;  1B34 A;  3RDV A;  4C8Q B;  1M3B A;  1TOV A;  4EIK A;  2EQK A;  4RTX A;  2EKH A;  3CCR A;  1H64 1;  5IT9 E;  4M7D F;  3TSZ A;  5GMK l;  2IVW A;  2X3W D;  3PMT A;  3REA B;  1WI7 A;  1ZUY A;  2DL4 A;  1U8R A;  1JJ2 P;  1WQW A;  1QVP A;  3L2R A;  2YHT A;  1VQO A;  4ZTF A;  1UJ0 A;  3DKM A;  3CC4 Q;  1PC0 A;  3OYL A;  2O01 E;  2YUQ A;  5KCH A;  1K9M U;  2R5M A;  5ECA A;  4M7A A;  4R55 A;  1K0S A;  2K5L A;  2DXU A;  1BI1 A;  2DA9 A;  2EYX A;  3WXM B;  2LCS A;  3M59 A;  3MET A;  1OPK A;  4M77 E;  2E6Z A;  3DLL A;  3QYH B;  2A08 A;  3THK A;  1V1C A;  1KD1 U;  1SRL A;  2QTV A;  1VQL A;  2X4X A;  2LT1 A;  4M75 E;  4F7U A;  2K2M A;  5I22 A;  3MPU B;  1H3H A;  2J05 A;  4J9I A;  4RG2 A;  3NMZ C;  4GLK A;  3V7S A;  2PUK B;  5D6X A;  2QYZ A;  3CCJ T;  2OTL Q;  1H8K A;  1X27 A;  4C92 D;  3LX7 A;  1QWF A;  4CC3 A;  2H3J A;  3CBM A;  3GLX A;  2C0T A;  3M5A A;  5KYU B;  1QVF A;  4ELZ C;  5DLO A;  1VQ9 T;  4LUD A;  1WFW A;  2K79 A;  2KRS A;  2FZC B;  1Q82 R;  1JXO A;  3G4S A;  3LGL A;  3L2V A;  4DBH A;  2DO3 A;  3EGD B;  3CBP A;  3CCE Q;  3A5Z B;  5KH6 A;  4CC4 B;  1RAI B;  2NUP B;  4PK4 A;  1YCY A;  3CPW P;  1WGS A;  4A4F A;  3OQ5 A;  2O9V A;  3GNF B;  2XD0 A;  3VS6 A;  1N5Z A;  1QW1 A;  1EFN A;  4FT4 A;  1YJ9 Q;  4BE2 A;  5FWC A;  4FM4 B;  4PJO F;  1JJ2 S;  2DRM A;  4OMP A;  2D0N A;  1UGR B;  3X28 B;  4M7D E;  3E2U A;  2ZPG B;  3V7R A;  2EYQ A;  3L2Q A;  2GF7 A;  1K1Z A;  4BB7 A;  2DJZ A;  2HQH A;  2A0F B;  3ER0 A;  2HZY A;  1QVG P;  1VQM A;  4J6X A;  4M7A D;  1WQ7 A;  4XU3 A;  1PSE A;  4F04 B;  1YIJ T;  3JAM E;  4E7K A;  1BIB A;  2SRC A;  4HCC A;  2KRO A;  5FWB A;  5GAN 5;  2OX7 A;  3JCM c;  2AKK A;  3PIO A;  3M0U A;  4OGE A;  4QVC A;  2E41 A;  1MNE A;  2KXC A;  2OJ2 A;  4R0K A;  2CDT A;  1M30 A;  1KJW A;  4M78 D;  1EIF A;  3ZL7 C;  2D6F A;  1GBR A;  1U06 A;  3UA7 A;  1T0J A;  2GNC A;  2DVE A;  2LX9 A;  3A8M B;  4IIM A;  4JLG A;  1SKU B;  1KFZ A;  4PFZ A;  1G3W A;  3CC7 A;  1T0H A;  4OVA A;  1Q86 R;  2FEI A;  2A36 A;  3TU4 K;  4JJN K;  2JMA A;  3FC3 A;  1TWB A;  2DMO A;  4ZGJ B;  5FRN A;  1VQN A;  2DXB A;  2G6F X;  4J9C A;  1G2B A;  2LDM A;  2CP2 A;  1D1A A;  1QCF A;  4BI3 A;  2JMC A;  3EFR A;  3CPW S;  1VQ8 T;  5D7U A;  1BU1 A;  1ABQ A;  1GCQ A;  1MMA A;  1VUB A;  4BI4 A;  5GAN d;  5IHN A;  4QQ6 A;  4HT9 A;  1C0M A;  2XHC A;  3A98 A;  3M0R A;  4RTV A;  2EGA A;  3HP9 A;  2MAM A;  3VKI A;  1AD5 A;  1ZBJ A;  4KUL A;  2YRC A;  4PJO E;  1YCS B;  2XIC A;  4Z8A A;  3UF4 A;  2MWO A;  2PU9 B;  2Y90 A;  3EH1 A;  1QVG S;  2VAS A;  3BDU A;  4JRP A;  4RMO A;  1XQH A;  2BTT A;  1Q95 G;  2DZ9 A;  2SEM A;  1E7O A;  3CCQ Q;  5GMK h;  5IHI A;  1D3B A;  4L5G A;  3I35 A;  1PSF A;  5I11 A;  3M55 A;  3VYG A;  3ASK A;  5LJ5 e;  3URG A;  3CC4 T;  1UB4 A;  1UFF A;  2OTJ Q;  1B3Q A;  5J26 A;  3CMA Q;  2K4Y A;  4PJL A;  4N0A A;  4OML A;  3VS1 A;  3C4S A;  2ROL A;  3NTI A;  3RBB B;  3OBY A;  3VYH B;  2RK2 A;  2E4H A;  3SB2 A;  4LXC A;  1EZZ B;  2DIL A;  5FRO A;  2YUO A;  2X4Y A;  2KI7 A;  3NTH A;  1HD3 A;  1H92 A;  1PRM C;  3MEW A;  2DTH A;  3I9Q A;  2HD0 A;  4JLI A;  1LOJ A;  2O4X B;  4FL6 A;  2JW4 A;  2F2X A;  1OX9 A;  1P92 A;  2QA4 A;  1JQQ A;  5GAM g;  1G83 A;  4JJD A;  3I55 T;  2RQW A;  1M27 C;  4J9F A;  2XU8 A;  1Y96 B;  1M2V B;  1W70 A;  1PKT A;  2PVD B;  2VVK A;  3OYC A;  1PD1 A;  4BDZ A;  4XTX A;  2AHJ B;  4EMK A;  4RTT A;  5HCK A;  2JS0 A;  2V8I A;  1V76 A;  1M1G A;  3CCE T;  2XDD A;  3OYG A;  4DEX A;  1M1K U;  4A53 A;  4MZP A;  2DX1 A;  2PNI A;  2RQR A;  2FVU A;  3RNJ A;  3H41 A;  2DXT A;  1YFN A;  3GIB A;  2QGF B;  5LJ3 f;  4C92 F;  1YJW T;  1M3A A;  2NUT A;  1S72 Q;  2EQJ A;  3QJY A;  4C8Q D;  3E9G A;  3HRU A;  2LCC A;  3QXE B;  3EG2 A;  3CCV Q;  2R5A A;  2DL3 A;  2WSF E;  1Y0M A;  1RAB B;  3CCL A;  3NHN A;  5FRM A;  5GAN 2;  3R6O A;  4LDV A;  2EVR A;  4MZM A;  3J81 E;  3OS1 A;  2LTO A;  3RKW A;  3VV0 A;  3EG3 A;  2HL3 A;  2W10 A;  1PWT A;  3QHS A;  4DOW A;  3VRY A;  1VQ6 Q;  4MDX A;  4BDY A;  1YIT Q;  3BDL A;  3VJP A;  2K3X A;  5I2S A;  4K11 A;  3PIP A;  1WXU A;  5KYX B;  1BKB A;  4JJB A;  2RQV A;  2DE0 X;  2X51 A;  3RER A;  2M51 A;  4KUI A;  2BIV A;  4OMM A;  4OB1 B;  2QQS A;  3RES A;  2DD4 A;  2RJF A;  4M7A F;  2A7Y A;  1KC8 R;  4MDW A;  1UJY A;  2HCK A;  2QI2 A;  2VXE A;  2MPX C;  1MUZ A;  2DIG A;  5CK9 A;  2CH4 A;  5GAO q;  1W4S A;  1NJI C;  3NPF A;  3X20 B;  2CZ6 B;  5IN1 A;  4F7U F;  1OV3 A;  4TVR A;  2BKD N;  5FU7 C;  3SWN C;  3PE0 A;  2RJE A;  3OSS C;  2GCX A;  2RN8 A;  2VYT A;  3S3M A;  1NYG A;  4E47 A;  1KK7 A;  1C6V X;  2HNI A;  3JB9 G;  1PNJ A;  2EWN A;  5GJV B;  5CIU A;  2EJG A;  2K5I A;  3RMS A;  4CC2 A;  2DET A;  2CSI A;  1CKB A;  3NGP A;  4C92 E;  2EJF A;  2DXC A;  5GAM h;  2RPN A;  3CCR T;  3G7Z A;  2MOX A;  3SDZ A;  2DL7 A;  3REB B;  1VQ9 Q;  1NM7 A;  5GAN e;  2FRY A;  5FU7 B;  3SWN B;  1AWW A;  5I2M A;  4ME7 A;  1VQO T;  3CC2 A;  4CRI A;  5GAO p;  3PT9 A;  2PZ1 A;  4KBM B;  3JB9 J;  2RHY A;  2MMP A;  4PFP A;  4D6W A;  1YI2 A;  3PMI A;  3CMA T;  2OAW A;  4XAX B;  4CI0 C;  4BY6 C;  2B8A A;  4C0Z A;  4LUE A;  3QZ9 B;  1QWE A;  4RCC A;  5IXF A;  5IHK A;  5GJW B;  3CME A;  2DNU A;  1XOV A;  5KYW A;  1RAC B;  4HCB A;  4AFU C;  2QTX A;  4QW2 A;  1AOJ A;  1ZSZ A;  3OB9 A;  3VS7 A;  3OYA A;  5DLQ E;  4J5Y A;  1RLQ C;  5GMK m;  1RAH B;  4M77 C;  4M7A E;  1GL5 A;  2KT8 A;  3M53 A;  1TSF A;  2P0P A;  3FLG A;  1WPY A;  1V29 B;  1YIJ Q;  3ZFJ A;  4M75 C;  2YWW A;  3CXC P;  3MEU A;  5GAO n;  4BY6 B;  4J7I A;  3D7S B;  1ZHI A;  2M9U A;  3LYI A;  1Q86 C;  3GNG A;  1QMC A;  2KAF A;  1WXB A;  2EQU A;  2ED0 A;  4XTV A;  4F7U E;  1NJI U;  2EYW A;  1N8R R;  3EG9 A;  2RO0 A;  2CZ1 B;  3VS2 A;  1OI1 A;  4M77 B;  4DEY A;  4BD3 A;  4BI8 B;  3JCM g;  4DBF A;  3F70 A;  3OBW A;  4M75 B;  1NEG A;  3I56 A;  2YSQ A;  3NFC A;  5J3B A;  2ZPF B;  3EFO A;  1K76 A;  4O5V A;  4IUQ A;  3RMQ A;  1AT1 B;  4C92 A;  3GP8 A;  1U5S A;  1VQ8 Q;  3MP8 A;  4AMC A;  1LNX A;  1NBE B;  2AKL A;  2CP5 A;  4D8K A;  1JJ2 A;  3OS0 A;  5LJ3 e;  1AZE A;  2EFI A;  2CT3 A;  2C0O A;  5CCA A;  1K73 R;  3QJ6 A;  1VQM T;  4M7D C;  1SSF A;  2X4J A;  3X25 B;  1VQP Q;  4N4G A;  1TUD A;  2KE9 A;  4FIB A;  4J8O A;  1K4U S;  1SHF A;  2AK5 A;  2ENM A;  1HSQ A;  1I0C A;  2DM1 A;  1WJR A;  1K9A A;  1U1S A;  2KSS A;  1VQ6 T;  1Z9Z A;  3V8L A;  1YIT T;  3M0Q A;  5LJ5 f;  2KYB A;  1I4K 1;  1M3C A;  3CCS A;  2LCL A;  2PVO B;  3FDR A;  3EGU A;  1X6O A;  2XDP A;  1RAF B;  4JDS A;  1CSK A;  3CXC S;  2L8D A;  2HSE B;  1ARK A;  3CC7 T;  1Q7Y U;  2RJD A;  4X9D A;  4M7D B;  1VYU A;  3VS0 A;  4A54 A;  1VQK A;  1UDL A;  2NYS A;  3JCM Q;  4IKF A;  1SEM A;  3LH5 A;  1QKX A;  4NS5 A;  1SF9 A;  3M0T A;  4P5N A;  3OA6 A;  1GXI E;  1DJ7 B;  3A1P A;  1YJN A;  4FCY A;  2DVJ A;  1M1F A;  2HMA A;  5L8R E;  2JXB A;  2YUP A;  4RTY A;  1B7T A;  4M78 A;  1UEB A;  3CPW A;  3EHQ A;  3A8L B;  5LL6 S;  3ME9 A;  5C0M A;  1YP5 A;  4KGX B;  2CKK A;  4JRQ A;  2RI2 A;  2FZK B;  2EJ9 A;  4D8D A;  3CD6 A;  3I55 Q;  1G8X A;  2MCN A;  2LQK A;  4GLM A;  3EGX B;  4J9E A;  5CQX A;  4FU6 A;  2QDL A;  1WHJ A;  4XTU A;  1TU0 B;  2HQE A;  3DB3 A;  5C6S A;  4IUP A;  2DRK A;  4PJO C;  3CCU A;  2FPE A;  1QVG A;  3UT1 A;  5LJ5 j;  1AHJ B;  3HRT A;  5KYY A;  3JCM V;  2DL8 A;  1I07 A;  4Y28 E;  2QXF A;  1R8O B;  3G71 A;  1OOT A;  1A0N B;  1YJW Q;  6AT1 B;  2ZPH B;  3JCM h;  3OYE A;  2A37 A;  3CBO A;  1ZBX A;  2FRW A;  2I0N A;  1LPL A;  2JOY A;  1BB9 A;  1KQS S;  1X2Q A;  1CKA A;  1UE9 A;  4PJO B;  1RAE B;  1NZ9 A;  2VC8 A;  2X35 A;  2HKN A;  4ZNX A;  4OMF B;  1WLP B;  3C12 A;  2QA4 T;  2KRN A;  1K8A R;  2VWF A;  1VQ5 A;  2RD1 A;  4RTW A;  1E6G A;  3H6Z A;  3QBY A;  3KXT A;  3EAE A;  2MF2 A;  4MZT A;  2WSE E;  4II1 A;  3JV3 A;  1FMV A;  4JJC A;  2CP3 A;  2JJ9 A;  3DLM A;  3OMG A;  4J9B A;  2JT4 A;  1XJW B;  1KC8 C;  3L2Z A;  1R0B G;  1JRI A;  3KFV A;  2G3R A;  2EKO A;  3JCM W;  1FX7 A;  1W2B P;  1O75 A;  5GMK j;  3VS4 A;  1ZX6 A;  2DLP A;  1ACM B;  4X1V A;  2RI3 A;  2C06 A;  1GBQ A;  1LJO A;  1IGU A;  4JRI A;  3OY9 A;  1QCO A;  3V8K A;  2FL7 A;  5CKB A;  2CP7 A;  3VUZ A;  2V1Q A;  2ZPE B;  4UC4 A;  2P0Q A;  3DB4 A;  1BCM A;  3M54 A;  4AFZ C;  3GOX A;  3SEM A;  3LW5 E;  1T3S A;  3EG1 A;  1KD1 R;  4LDX A;  3KBG A;  1J3T A;  5GAO r;  5M9O A;  2CZ7 B;  1JB0 E;  3H9N A;  3TVT A;  3HPW A;  2O9S A;  1WA7 A;  1VQP T;  1YWO A;  4EMG A;  2BE7 D;  3PTA A;  4XQ3 A;  5GAN f;  4AG2 C;  2OI3 A;  2VGM A;  4X9C A;  2EW3 A;  1M4Z A;  1KQ2 A;  3INZ A;  4E2F B;  5IH2 A;  3CCR Q;  1KSW A;  2LVM A;  2LNV A;  4C8Q A;  4M77 G;  1SG5 A;  2PTK A;  3MEA A;  4JUV A;  3RKX A;  4KUD K;  1NPP A;  3G6E A;  5J39 A;  4OB3 B;  3SD4 A;  4M75 G;  1VQO Q;  2GFA A;  1Q81 R;  2YLC A;  2DYI A;  2COY A;  5KE2 A;  1K0X A;  2P4R A;  4BUG A;  5EG2 A;  2WAC A;  2K6D A;  4BE0 A;  1HYO A;  1BBZ A;  3L1A A;  4JPB W;  1D0Y A;  1VIF A;  2ECZ A;  4LE9 A;  3A8O B;  1W2B S;  2V26 A;  1WNL A;  3CCM A;  5AYF A;  2XDB A;  2JNG A;  2QG9 B;  1WX6 A;  3PFS A;  4ORZ A;  3C95 A;  1UUE A;  1VQL Q;  1KC8 U;  2LQW A;  2VKN A;  5GAM d;  5AT1 B;  2E5Q A;  2JVV A;  1UHC A;  4PJN A;  2GQI A;  1N8R C;  2DTO A;  2EQM A;  2NLU A;  4Q5W A;  2QEX A;  2JN0 A;  1NLP C;  1KQ1 A;  2CGH A;  2DTI A;  4M7D G;  2KMT A;  1KG1 A;  1X01 A;  3G4S Q;  5GAN j;  3OYY A;  4N4H A;  4C92 C;  3T9N A;  2D0Q B;  3CC2 T;  1NYF A;  2HAX A;  2RHZ A;  1BIA A;  5FLX E;  5KYU A;  4XTY A;  4AFQ C;  3OYB A;  4FT2 A;  5CKF A;  5GMK e;  4KGV B;  2E12 A;  2E3H A;  2F2W A;  1OU8 A;  2YDL A;  2MYS A;  5HKC A;  3EGD A;  4J7F A;  2EGC A;  4NOY A;  1NPR A;  2PVG B;  1WHL A;  1JU5 C;  4PLL A;  3UAT A;  2NUP A;  3I5R A;  3EH2 A;  3ZEH A;  1BYM A;  4A4H A;  3CME T;  4ATO A;  1WHK A;  2HBW A;  1PKS A;  3UDC A;  1VQ4 A;  3M4G A;  5GAO l;  2CS7 A;  1FWZ A;  1HXD A;  1VQM Q;  1YHQ A;  2O31 A;  4LDY A;  1QP2 A;  2E5K A;  4YTL A;  1IZ6 A;  1VQ7 A;  4M7D D;  3VUB A;  2EYZ A;  1UGS B;  3E19 A;  4FW2 A;  2E3I A;  1B34 B;  2JTF A;  4M7A C;  3G1J A;  4IUT A;  2KQW A;  5HK0 A;  5DY9 A;  4R56 A;  3EHR A;  4IIO A;  1VA7 A;  2EGE A;  2GQV A;  5FW9 A;  2D8J A;  2KR3 A;  3CC7 Q;  1AVZ C;  3RKY A;  2IPO B;  2QAS A;  1OX8 A;  2M0Y A;  3OYK A;  1HK9 A;  2K5F A;  1VQN Q;  2ZGW A;  4DA4 A;  1WDX A;  4PJO G;  2CYZ B;  2C0I A;  2DBM A;  4KH1 B;  1ZA1 B;  2DFU A;  4M7A B;  1UEC A;  1GRI A;  4VUB A;  1KHI A;  4M78 F;  2NWM A;  3CC4 A;  5LJ3 j;  1YN8 A;  1X2K A;  1OUL A;  2I2L A;  3QDF A;  2RF0 A;  2RHI A;  3BW1 A;  4ZGD B;  1RLP C;  2V8K A;  1FMW A;  2PQW A;  2M16 A;  1Q82 C;  4F7U B;  7AT1 B;  1G3S A;  2R58 A;  2QQB A;  2QGG A;  2DZC A;  1WZO A;  1O9S A;  4C5I A;  4X34 A;  2OAU A;  2RI5 A;  2F2V A;  3GBQ A;  3CCS T;  2DD5 A;  5HY6 A;  2XKO C;  2RB6 A;  2JUF A;  3P8H A;  1OQK A;  4XU0 A;  2DL5 A;  3QWY A;  1OPL A;  3NTK A;  1HJD A;  1X75 C;  2KK4 A;  2L89 A;  2ESW A;  2OTL A;  1AWJ A;  4PJO D;  3JCM P;  1M1K R;  1Y71 A;  3CXC A;  1BI0 A;  2H8H A;  4OMQ A;  3TRE A;  1NG2 A;  2XK0 A;  3OYH A;  3OW2 P;  1G3Y A;  2MWP A;  1D1B A;  2LX7 A;  1YWP A;  2RA2 A;  2WSC E;  3CCE A;  4QKU A;  3UA6 A;  4QVD A;  3M58 A;  2RHU A;  5CR2 A;  3WVD B;  1VQL T;  2BZ8 A;  3JB9 D;  3HSB A;  4KGZ B;  3QZ5 B;  2FB7 A;  1SSH A;  3RR6 A;  3IQL A;  3S6W A;  2QA4 Q;  1UGV A;  1BI2 A;  1YNZ A;  1IRX A;  1YJ9 A;  1X69 A;  2ZPB B;  3CD6 T;  3JCM J;  3U23 A;  5GAN 8;  2DPP B;  2O4X A;  4WF2 A;  1WXT A;  2P0K A;  1X6G A;  4F16 A;  4PLI A;  3OSV A;  2J06 A;  4NL3 A;  1TXQ A;  2DKG A;  1OYX A;  2KRM A;  2L2P A;  3G4S T;  5GAM e;  4M78 E;  2LJ0 A;  2CP0 A;  1Y07 A;  4OGC A;  1ZUK A;  1Y96 A;  3HKS A;  1M2V A;  3A8H B;  5CKD A;  3JCM d;  3LLR A;  3JB9 H;  3QWX X;  1GCQ C;  1RAD B;  2DAQ A;  4PL6 A;  3UWN A;  2CZ0 B;  3OYM A;  2H3E B;  1BK2 A;  4RCB A;  2ZPI B;  2K3Y A;  3G71 T;  3Q1J A;  2O88 A;  3VS5 A;  3HTR A;  1Q82 U;  2FPD A;  4O6J A;  3OS2 A;  2GGR A;  3QSU A;  2ZZD A;  1N9S A;  2A3L A;  2J6F A;  3TQ7 P;  2AT1 B;  1QKW A;  2A28 A;  3CCL Q;  3OW2 S;  1M8M A;  1C1A A;  2QDY B;  2RK1 A;  1RAG B;  2LRQ A;  1PM3 A;  4JS4 A;  1N9R A;  1KQS A;  1M8V A;  3OMC A;  3HHT B;  3LH0 A;  2K2V A;  2J6K A;  5CKH A;  3LGF A;  5GAN 6;  1Q81 C;  2LQ8 A;  2YT6 A;  3BE3 A;  4C8Q F;  2J6O A;  2QQR A;  4FW1 A;  1PCX A;  2DYB A;  4N0A C;  1VYV A;  3FRN A;  2FG0 A;  2KBT A;  3SFM A;  4MML A;  4HA8 A;  2ED1 A;  4C0D C;  1IB8 A;  1N27 A;  1AEY A;  4LDU A;  5KYX A;  1RAA B;  1QLY A;  5LJ5 g;  1D3B B;  2CP6 A;  1M90 R;  3E9F A;  3TSW A;  1VQN T;  1KQS P;  1X43 A;  1VIE A;  2GTJ A;  1ZQ1 A;  4C92 G;  3CCQ A;  4M4Z A;  1JO8 A;  4HT8 A;  4Y92 A;  2J7I A;  3QG1 A;  3R6N A;  4N4I A;  1Q86 U;  2AZS A;  2M02 A;  4HCZ A;  2KYM A;  2OTJ A;  2XI9 A;  3KUF A;  4LDW A;  4EMK C;  2L5Q A;  4C0D B;  2IIM A;  4A4K A;  1PHT A;  1I81 A;  3QYG B;  3CMA A;  2XID A;  1TTH B;  2RNA A;  1WJQ A;  1PG5 B;  4RTZ A;  5DM7 R;  1TUG B;  4HVV A;  2KXD A;  3QDR B;  4HXJ A;  4J83 A;  5GAN 7;  4QQD A;  3MHX A;  4ANJ A;  1WJS A;  2LQN A;  2F5T X;  2DIQ A;  3JB9 I;  5A0G A;  1VYT A;  3G6E T;  4BAC A;  3CC2 Q;  1NJI R;  4EMK B;  1S1N A;  1N6A A;  1SRM A;  1MMD A;  2EPD A;  9ATC B;  1U3O A;  2HL5 C;  4M7A G;  2ZCF B;  4IUV A;  1YI2 Q;  2DBK A;  3LWH A;  2BZY A;  4JRK A;  3SWN A;  2W0Z A;  4A4E A;  2DER A;  2VB6 A;  3MO8 A;  3H8Z A;  1IHW A;  3VRZ A;  3CCM T;  1OEB A;  1WHM A;  1Y7X A;  4C8Q E;  2XMF A;  3CME Q;  1KHC A;  1Q81 U;  2FYK A;  2NUT B;  2CT4 A;  5GAN 3;  4M78 G;  3OS5 A;  4F7U G;  4EMH A;  3MCA B;  4Y91 A;  1W2B A;  4J6W A;  2EYY A;  1T3L A;  5KYN A;  4C0G A;  2RMO A;  2RQU A;  1SPK A;  1IGQ A;  3L2W A;  1RUW A;  1I8F A;  8AT1 B;  1S72 A;  1WHG A;  2RJC A;  2QQA A;  3OYI A;  1YBY A;  3CCV A;  3MP6 A;  2QEX T;  1QVF P;  2BE9 B;  3HFN A;  3L42 A;  4E6R A;  2K7A A;  3M57 A;  3H0F A;  5D6W A;  4RUG A;  4J9G A;  1ZUU A;  4E7I A;  1UTI A;  1JBM A;  4HVW A;  4XTW A;  5EC7 A;  4PFO A;  2LC4 A;  1M9S A;  3JB9 F;  2FPF A;  1FMK A;  2AIR B;  3OYD A;  3X24 B;  2CH4 W;  1Q7Y R;  4C5E A;  5KE3 A;  1IHV A;  1VQ6 A;  1XTD A;  3N5B B;  2CUB A;  2FHD A;  1YIT A;  5KCO A;  2QAZ A;  1K9M R;  3I56 Q;  2L3R A;  3SHW A;  3AT1 B;  1GFD A;  5LJ5 h;  3JSC A;  4M77 A;  4BE1 A;  3UPU A;  1R77 A;  3GPL A;  2RQT A;  3M56 A;  1WIE A;  3QO3 A;  4C5H A;  3JCM e;  4M75 A;  2XG8 D;  4IUU A;  3CCL T;  2K3B A;  1VQ4 T;  5CAI A;  3E1S A;  4OMO A;  1YHQ T;  2LMJ A;  2E1H A;  2KY9 A;  5FU6 C;  1D1C A;  3MP1 A;  1VQ7 T;  1MND A;  3FJP A;  2M0O A;  2D9T A;  5HK3 A;  2P4T A;  3O5Z A;  3CQT A;  2LT4 A;  1AWX A;  2VXF A;  2Y4X A;  1NLO C;  3FJ5 A;  4OMN A;  4L59 A;  3CCS Q;  1M1K C;  1RI9 A;  2ABL A;  4PJM A;  5A2Q E;  2ROT A;  2X9H A;  3WVE B;  5GAN g;  4AT1 B;  3L2U A;  1QVF S;  4B9X A;  3FIF A;  4J6Y A;  5A0D A;  1AZG B;  3CCJ A;  1TS9 A;  4EDU A;  4NL2 A;  1VQK Q;  5FU6 B;  3VU3 C;  4ZGE B;  1ZSZ C;  2P84 A;  1UGP B;  1BCO A;  4FYV B;  4HCK A;  5GAO m;  1VQ9 A;  1RI0 A;  1YJN Q;  4M7D A;  3RIR A;  2F5K A;  2QQ9 A;  1MV0 B;  2V1R A;  4V2S A;  2E10 A;  4PJJ A;  1MHN A;  3A8G B;  1H3Z A;  2YUN A;  4E7H A;  1Y57 A;  1LCK A;  3BY7 A;  1IXD A;  1GFC A;  1QP3 A;  3MKD A;  4DBQ A;  4PNO A;  3PNW C;  3J7A F;  1FYN A;  3AHU A; 
#chains in the Genus database with same CATH homology
 1UGR B;  1JJ2 A;  3X28 B;  2I2L A;  3OS0 A;  4M7D E;  3TCJ A;  2ZPG B;  4QQG A;  5LJ3 e;  3V7R A;  2EFI A;  2EYQ A;  3OYJ A;  3L2Q A;  2RHI A;  2GF7 A;  3BW1 A;  5GAM f;  4ZGD B;  5CCA A;  1G5V A;  3QJ6 A;  2V8K A;  2PQW A;  2M16 A;  4M77 D;  1SSF A;  2DJZ A;  3ER0 A;  2JZ2 A;  2X4J A;  3X25 B;  4BB7 A;  4F7U B;  1Q82 C;  1G3S A;  4N4G A;  4FIB A;  4J8O A;  2R58 A;  2F69 A;  4C8Q G;  3HRS A;  2DK3 A;  2QQB A;  3GF5 A;  4M75 D;  1VQM A;  4J6X A;  4M7A D;  2DZC A;  5GAN 4;  1WJR A;  1O9S A;  1WQ7 A;  4C5I A;  1IRE B;  4X34 A;  2OAU A;  2RI5 A;  1U1S A;  2KSS A;  1PSE A;  2DD5 A;  4RG8 A;  4XU3 A;  5HY6 A;  2XKO C;  3V8L A;  3CCS T;  1YIJ T;  2RB6 A;  1YIT T;  3JAM E;  4E7K A;  2JUF A;  3P8H A;  1BIB A;  5LJ5 f;  3V8J A;  4HCC A;  1I4K 1;  4XU0 A;  5GAN 5;  2OTL T;  3CCS A;  3JCM c;  2LCL A;  2PVO B;  3PIO A;  4OGE A;  3FDR A;  3NTK A;  1YIJ A;  1X6O A;  4QVC A;  1X75 C;  2XDP A;  2E41 A;  4JDS A;  2KK4 A;  4XU2 A;  3CXC S;  2L89 A;  1U1T A;  2L8D A;  3JRZ A;  1YI2 T;  4ELY C;  2OTL A;  4PJO D;  4M78 D;  1EIF A;  3JCM P;  2D6F A;  3CC7 T;  1Y71 A;  1Q7Y U;  2RJD A;  3CXC A;  1BI0 A;  4X9D A;  3TRE A;  1RL2 A;  4M7D B;  3P8B B;  2DVE A;  1K73 C;  2E6N A;  2LX9 A;  2XK0 A;  3A8M B;  4A54 A;  3OYH A;  1VQK A;  4JLG A;  1G3Y A;  5D6Y A;  4XU1 A;  1G3W A;  3JCM Q;  3CC7 A;  4IKF A;  2MWP A;  2MI6 A;  4OVA A;  3MEV A;  3TU4 K;  5LJ3 d;  3S3O A;  4C0F A;  4JJN K;  4NS5 A;  4FSX A;  4P5N A;  3OA6 A;  2RA2 A;  3FC3 A;  5IAY A;  4ZGJ B;  3J80 E;  1DJ7 B;  4C92 B;  1QVG S;  2WSC E;  5FRN A;  2DXB A;  2PUO B;  3X26 B;  4QVD A;  3CCE A;  1YJN A;  3M58 A;  1VQN A;  1M1F A;  2RHU A;  5CR2 A;  2LDM A;  2K57 A;  3WVD B;  1VQL T;  5LJ3 g;  5L8R E;  4BI3 A;  3JB9 D;  1YJ9 T;  3HSB A;  3QZ5 B;  3EFR A;  3CPW S;  2FB7 A;  1VQ8 T;  2EAY A;  1BI3 A;  3S6W A;  3QUI A;  3OYN A;  1BI2 A;  4M78 A;  4PJO A;  4Z02 A;  1YJ9 A;  1UEB A;  3CPW A;  2ZPB B;  2VUB A;  1VUB A;  3A8L B;  3CD6 T;  3JCM J;  5LL6 S;  3ME9 A;  4BI4 A;  5C0M A;  3S3N A;  1VQ8 A;  2RM4 A;  5GAN d;  2CKK A;  4XK8 E;  3ZBD A;  4JRQ A;  5GAN 8;  2DPP B;  2RI2 A;  2O4X A;  4QQ6 A;  4WF2 A;  2EJ9 A;  2P0K A;  2VGN A;  4DOV A;  4PLI A;  1M90 C;  4HT9 A;  3CD6 A;  3OSV A;  4NL3 A;  2EIF A;  2XHC A;  3FEO A;  5GAM j;  2DKG A;  1OYX A;  3HP9 A;  2LQK A;  2MAM A;  1VQP A;  3VKI A;  4KUL A;  5CQX A;  3G4S T;  4FU6 A;  4PJO E;  1M5Q 1;  2XIC A;  4M78 E;  4QVZ A;  5GAM e;  4XTU A;  1Y07 A;  4OGC A;  2MWO A;  1Y96 A;  2PU9 B;  3HKS A;  2HQE A;  2Y90 A;  3A8H B;  3DB3 A;  3BDU A;  4B9W A;  1NE8 A;  4IUP A;  5C6S A;  5CKD A;  3JCM d;  5GAN h;  4RMO A;  4JRP A;  1XQH A;  3LLR A;  2DZ9 A;  4PJO C;  4M78 C;  3CCU A;  3JB9 H;  2DAQ A;  5GMK h;  5A0L A;  1QVG A;  4PL6 A;  3UWN A;  2CZ0 B;  3UT1 A;  3OYM A;  3I56 T;  4RCB A;  5LJ5 j;  2ZPI B;  3PGG A;  1AHJ B;  1D3B A;  2K3Y A;  3HRT A;  2E64 A;  4L5G A;  3Q1J A;  1PSF A;  3JCM V;  3G71 T;  1TH7 A;  1N8R U;  3M55 A;  3VYG A;  3ASK A;  4Y28 E;  2YLB A;  2QXF A;  5LJ5 e;  1Q82 U;  5GMK i;  1R8O B;  3URG A;  3CC4 T;  1UB4 A;  4O6J A;  3G71 A;  3OS2 A;  3QSU A;  2ZZD A;  1N9S A;  1MGQ A;  2A3L A;  2ZPH B;  3JCM h;  2HBP A;  3HL8 A;  3OYE A;  5J26 A;  4XTZ A;  3CBO A;  1VQM T;  1ZBX A;  2K4Y A;  4N0A A;  3OW2 S;  2JOY A;  3C4S A;  2YRV A;  3NTI A;  2QDY B;  2RK1 A;  3OBY A;  1KQS S;  2LRQ A;  3VYH B;  2RK2 A;  3SB2 A;  4PJO B;  4GY5 A;  4M78 B;  3OW2 A;  1NZ9 A;  5FRO A;  2VC8 A;  2X35 A;  4JS4 A;  1N9R A;  1KQS A;  2X4Y A;  4OMF B;  1M8V A;  3NTH A;  3C12 A;  4DQ2 A;  3QII A;  3OMC A;  3MEW A;  2QA4 T;  4EPC A;  2DTH A;  4PKC C;  3HHT B;  3LH0 A;  4ZN1 A;  2HD0 A;  1LOJ A;  2K2V A;  2O4X B;  4FL6 A;  2RD1 A;  4JLI A;  5CO7 A;  1VQ5 A;  3BFM A;  5CKH A;  3LGF A;  3H6Z A;  3QBY A;  3KXT A;  3EAE A;  5GAN 6;  1K73 U;  2MF2 A;  2KDS A;  1P92 A;  2X4W A;  2WSE E;  1G3T A;  2RHX A;  4KT0 E;  2LQ8 A;  4II1 A;  4MZT A;  2QA4 A;  1Q81 C;  5GAM g;  4C8Q F;  5CQY A;  2QQR A;  3DLM A;  3I55 T;  2M1H A;  3OMG A;  2IG0 A;  3RUX A;  3QKJ A;  4N0A C;  2XU8 A;  4HKE A;  1Y96 B;  2KVQ G;  5I21 A;  1KC8 C;  3FRN A;  1GXI E;  3P8D A;  3L2Z A;  3SFM A;  4MML A;  2PVD B;  2V8J A;  3I55 A;  1JRI A;  3OYC A;  1VQK T;  2R57 A;  4HA8 A;  4XTX A;  2AHJ B;  3OYF A;  4C0D C;  2G3R A;  4BDZ A;  2EKO A;  3JCM W;  1N27 A;  4EMK A;  1FX7 A;  4LDU A;  2V8I A;  5CKE A;  5LJ5 g;  1D3B B;  3FB9 A;  3E9F A;  1O75 A;  4LD6 A;  5GMK j;  3JCM X;  3CCQ T;  1VQN T;  1M1G A;  3CCE T;  1VIE A;  1YJN T;  4RKU E;  4ZTJ A;  1ZQ1 A;  2RI3 A;  1K8A C;  2C06 A;  4C92 G;  4L6V 5;  2XDD A;  3OYG A;  1M1K U;  1LJO A;  4JRI A;  4A53 A;  3OY9 A;  4MZP A;  3CCQ A;  3V8K A;  2FVU A;  2GFU A;  4HT8 A;  2FL7 A;  1M90 U;  2OTJ T;  2DXT A;  3QG1 A;  5CKB A;  3GIB A;  3VUZ A;  4IUR A;  5LJ3 f;  2ZPE B;  4N4I A;  4C92 F;  1YJW T;  1Q86 U;  2EQJ A;  4E7L A;  3QJY A;  4OB0 B;  4UC4 A;  4HCZ A;  2OTJ A;  2P0Q A;  4C8Q D;  3DB4 A;  3E9G A;  1XNI A;  2XI9 A;  3HRU A;  2LCC A;  3M54 A;  3HFO A;  3KUF A;  3QXE B;  4LDW A;  2L5Q A;  4EMK C;  3GOX A;  4E7J A;  1YJW A;  4C0D B;  2R5A A;  3TEE A;  5LJ3 h;  3LW5 E;  4A4K A;  3QYG B;  1I81 A;  3CMA A;  4LDX A;  2XID A;  3KBG A;  1WJQ A;  5GAO r;  5M9O A;  5DM7 R;  2CZ7 B;  1JB0 E;  2WSF E;  3HPW A;  3CCL A;  1VQP T;  4EMG A;  3QPH A;  3QDR B;  5FRM A;  4OP0 A;  5GAN 2;  3R6O A;  4J83 A;  1Q7Y C;  3PTA A;  5GAN 7;  4XQ3 A;  3CEY A;  4LDV A;  4QQD A;  5GAN f;  4MZM A;  5CVI A;  3J81 E;  3MHX A;  3OS1 A;  2LTO A;  2VGM A;  1WJS A;  3RKW A;  4X9C A;  2F5T X;  3VV0 A;  1OZ2 A;  3CCU T;  4MMK A;  1K9M C;  1OZ3 A;  1M4Z A;  2DIQ A;  2JTM A;  5A0G A;  3JB9 I;  3INZ A;  1KQ2 A;  3QHS A;  4OF1 A;  4DOW A;  3G6E T;  2LVM A;  1FXX A;  4MDX A;  2LNV A;  2RH2 A;  3O8V A;  4C5G A;  4BAC A;  4BDY A;  4C8Q A;  4M77 G;  3BDL A;  4JUV A;  3MEA A;  2K3X A;  3RKX A;  3VJP A;  2Y4Y A;  1NPP A;  5I2S A;  4KUD K;  4EMK B;  3PIP A;  3G6E A;  1N6A A;  5J39 A;  2VV5 A;  3EFS A;  3C94 A;  4OB3 B;  1BKB A;  3SD4 A;  4OB2 B;  4M75 G;  3JCM f;  3RER A;  4M7A G;  2GFA A;  4KUI A;  2ZCF B;  4IUV A;  1KD1 C;  4M77 F;  2BIV A;  3LWH A;  2YLC A;  4JRK A;  4OB1 B;  2QQS A;  3SWN A;  3RES A;  2DD4 A;  4A4E A;  5KE2 A;  4A4G A;  3MO8 A;  3H8Z A;  2RJF A;  3CCM T;  4M75 F;  4M7A F;  4BUG A;  5EG2 A;  2A7Y A;  1Y7X A;  2WAC A;  3M9Q A;  4C8Q E;  4BE0 A;  4JS5 A;  4MDW A;  3L1A A;  1KHC A;  1VIF A;  1Q81 U;  3A8O B;  2FYK A;  2QI2 A;  1WNL A;  2VXE A;  3CCM A;  1W2B S;  5AYF A;  2XDB A;  5GAN 3;  4M78 G;  3OS5 A;  4C8Q C;  2DIG A;  2JNG A;  5CK9 A;  4F7U G;  2E65 A;  4EMH A;  3PFS A;  3MCA B;  2E70 A;  4Y91 A;  5GAO q;  1W2B A;  4J6W A;  1VQ5 T;  3C95 A;  1S72 T;  1W4S A;  1KC8 U;  4C0G A;  1NJI C;  4LD9 K;  3X20 B;  1UGQ B;  3V7C A;  3L2W A;  3CPF A;  5GAM d;  3CCV T;  1I8F A;  2CZ6 B;  5IN1 A;  2E5Q A;  4F7U F;  4ZN3 A;  1S72 A;  4TVR A;  2BKD N;  5FU7 C;  3SWN C;  1I5L A;  2RJE A;  2HQX A;  2JVV A;  2QQA A;  2RJC A;  3JCM b;  3OYI A;  3OSS C;  1YBY A;  2GCX A;  2VYT A;  3MP6 A;  3CCV A;  3S3M A;  2BUD A;  2QEX T;  4E47 A;  3HFN A;  2HNI A;  3L42 A;  1N8R C;  2DEQ A;  3M57 A;  5D6W A;  3JB9 G;  3M4Y A;  1K8A U;  2DTO A;  2EQM A;  2NLU A;  2EWN A;  4Q5W A;  2EJG A;  2K5I A;  5CIU A;  4E7I A;  1JBM A;  3RMS A;  2QEX A;  2JN0 A;  3LWI A;  4XTW A;  5LJ5 d;  2LC4 A;  2EJF A;  4C92 E;  1B34 A;  1KQ1 A;  2DXC A;  2CGH A;  2DTI A;  5GAM h;  4C8Q B;  1M9S A;  4M7D G;  2KMT A;  3CCR T;  3JB9 F;  3G7Z A;  1KG1 A;  1X01 A;  5GAN j;  3SDZ A;  3OYY A;  4N4H A;  4C92 C;  3OYD A;  3T9N A;  2D0Q B;  3X24 B;  3CC2 T;  2EQK A;  2HAX A;  5GAN e;  2RHZ A;  1BIA A;  1H64 1;  5FLX E;  3CCR A;  4C5E A;  5KE3 A;  5IT9 E;  4M7D F;  4XTY A;  5GMK l;  1XTD A;  1VQ6 A;  3N5B B;  3OYB A;  5FU7 B;  3SWN B;  4FT2 A;  2FHD A;  5CKF A;  5GMK e;  2IVW A;  1YIT A;  3PMT A;  4ME7 A;  2E12 A;  5I2M A;  5KCO A;  1VQO T;  3CC2 A;  2L3R A;  4CRI A;  5GAO p;  5LJ5 h;  3PT9 A;  5HKC A;  1U8R A;  4J7F A;  1WQW A;  1QVP A;  3L2R A;  3JSC A;  2YHT A;  4KBM B;  4M77 A;  4NOY A;  1NPR A;  2PVG B;  2RHY A;  4BE1 A;  2MMP A;  3UPU A;  3JB9 J;  4ZTF A;  3DKM A;  4D6W A;  1YI2 A;  3GPL A;  4PLL A;  3M56 A;  2O01 E;  3OYL A;  3PMI A;  3ZEH A;  3QO3 A;  3CMA T;  4C5H A;  5KCH A;  1BYM A;  4A4H A;  4XAX B;  4CI0 C;  2R5M A;  3JCM e;  4M75 A;  4BY6 C;  3CME T;  1K9M U;  4R55 A;  2B8A A;  2XG8 D;  4C0Z A;  4IUU A;  3CCL T;  4M7A A;  4M7D C;  2K5L A;  3QZ9 B;  4ATO A;  4RCC A;  2DXU A;  1BI1 A;  5CAI A;  3E1S A;  1VQ4 T;  1YHQ T;  3CME A;  3WXM B;  3UDC A;  2E1H A;  2KY9 A;  5FU6 C;  3M59 A;  1VQ4 A;  3M4G A;  1XOV A;  5GAO l;  3MET A;  3MP1 A;  1VQ7 T;  2CS7 A;  3FJP A;  1FWZ A;  1HXD A;  2M0O A;  2D9T A;  4M77 E;  1YHQ A;  1VQ6 T;  4HCB A;  2QTX A;  2E6Z A;  4LDY A;  1QP2 A;  4QW2 A;  5HK3 A;  3OYA A;  3DLL A;  3OB9 A;  2P4T A;  3QYH B;  1VQO A;  1KD1 U;  1VQL A;  5DLQ E;  4J5Y A;  2LT4 A;  2VXF A;  5GMK m;  4YTL A;  2X4X A;  1IZ6 A;  2LT1 A;  2Y4X A;  4M75 E;  4M77 C;  1VQ7 A;  4M7A E;  4F7U A;  4M7D D;  3M53 A;  3VUB A;  4L59 A;  2P0P A;  3FLG A;  1M1K C;  4RG2 A;  1UGS B;  3E19 A;  1WPY A;  1V29 B;  4GLK A;  1B34 B;  4M75 C;  2JTF A;  3V7S A;  3ZFJ A;  4M7A C;  2PUK B;  5D6X A;  3MEU A;  5GAO n;  4BY6 B;  5A2Q E;  4J7I A;  4IUT A;  2KQW A;  5HK0 A;  5DY9 A;  4R56 A;  3CCJ T;  3WVE B;  5GAN g;  1ZHI A;  2M9U A;  3LYI A;  3L2U A;  1QVF S;  4C92 D;  1Q86 C;  3LX7 A;  3GNG A;  4B9X A;  3FIF A;  2H3J A;  2GQV A;  4J6Y A;  5A0D A;  3CBM A;  2KAF A;  3CCJ A;  2EQU A;  3GLX A;  3M5A A;  4EDU A;  1QVF A;  4NL2 A;  4ELZ C;  4XTV A;  5FU6 B;  5DLO A;  3VU3 C;  4F7U E;  1VQ9 T;  1NJI U;  4ZGE B;  3RKY A;  1UGP B;  2RO0 A;  3G4S A;  3LGL A;  3L2V A;  2CZ1 B;  5GAO m;  3OYK A;  2DO3 A;  1HK9 A;  2K5F A;  1VQ9 A;  3CBP A;  1OI1 A;  4M77 B;  1RI0 A;  2ZGW A;  4M7D A;  3A5Z B;  3RIR A;  2F5K A;  2QQ9 A;  4BD3 A;  4BI8 B;  3JCM g;  5KH6 A;  4DA4 A;  4V2S A;  2E10 A;  4PJO G;  1YCY A;  1MHN A;  3A8G B;  1WGS A;  2CYZ B;  3F70 A;  4A4F A;  3OQ5 A;  4E7H A;  3OBW A;  1H3Z A;  3BY7 A;  3GNF B;  4M75 B;  4M7A B;  2XD0 A;  3I56 A;  1QW1 A;  3NFC A;  5J3B A;  1QP3 A;  4VUB A;  2ZPF B;  4FT4 A;  4O5V A;  1KHI A;  4IUQ A;  3RMQ A;  4C92 A;  3GP8 A;  4BE2 A;  4FM4 B;  4PNO A;  4PJO F;  1JJ2 S;  4M78 F;  3PNW C;  3CC4 A;  3J7A F;  5LJ3 j;  3AHU A;  3MP8 A;  1LNX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...