3JCMd

Cryo-em structure of the spliceosomal u4/u6.u5 tri-snrnp
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
77
structure length
77
Chain Sequence
TPLDLLKLNLDERVYIKLRGARTLVGTLQAFDSHCNIVLSDAVETIYQLNNEELSESERRCEMVFIRGDTVTLISTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pre-mRNA-splicing factor 8
publication title The 3.8 angstrom structure of the U4/U6.U5 tri-snRNP: Insights into spliceosome assembly and catalysis
pubmed doi rcsb
molecule tags Transcription
total genus 8
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2015-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
d PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3jcmd00
3QHSA 4XTUA 2DTOA 1N9SA 2DEQA 4PJOG 1WQWA 5GAN2 1TH7A 5GAOl 3JCMW 3JCMg 1M5Q1 4M7DB 2EJGA 2Y90A 4C92B 2HNIA 4Y91A 4M7AB 5LJ5e 4N0AC 3JCMc 3JB9J 2ZGWA 2YLBA 5GANh 3JB9D 4M7DF 4C92F 4M7DC 3BFMA 2VC8A 4JLIA 1U1TA 5GAN8 4C92G 5GMKh 4M7AE 4M7AF 1WQ7A 4NL3A 1LJOA 2DXUA 5GAOp 5GANe 2EWNA 4QVDA 5LJ3j 3INZA 4PJOE 1WNLA 2EJ9A 3JCMh 4PJOD 2DZ9A 3V8KA 4XU1A 2RB6A 2RM4A 4M75B 4M78F 4XQ3A 4F7UE 3JCMP 2I2LA 1X01A 4M78C 3JCMb 4J6XA 1I8FA 3JCMe 4J5YA 1BIBA 3M4GA 5GAMj 4M75F 3SWNA 2DVEA 4M75G 3RKXA 5GAN3 4A54A 3BW1A 5I21A 4J6WA 3RESA 1KQ2A 2DTIA 3V8JA 4F7UA 4M77A 2DJZA 4C8QA 1KQ1A 4XTZA 1MGQA 5LJ3g 1H641 5LJ3f 4XU0A 5LJ3d 4M7DG 5GMKi 1M8VA 1I81A 2CGHA 2DXTA 2EJFA 4M7AG 4M78B 3BY7A 4X9DA 5LJ5j 2JN0A 5GAMg 5GAMf 5GAMd 4EMKA 5GMKe 3SWNC 4M77B 5GMKm 4M78G 4M7AD 2E64A 1LOJA 5LJ3h 3QSUA 2E65A 1LNXA 4EMGA 2E41A 4EMHA 3FJPA 5GANj 3JCMX 3GIBA 2RD1A 2QTXA 3HFNA 4M77F 4F7UF 4M7DD 4C92E 4M7DE 4C92D 2YLCA 1D3BA 1B34A 1HXDA 4M77C 4MMLA 3JCMV 4C8QF 4C8QC 3JCMJ 1BIAA 4XTYA 1N9RA 4WF2A 4XU3A 4PJOA 4XTWA 4DQ2A 5GAMh 3V7RA 4NL2A 2YHTA 4M78E 5DY9A 4M78D 5GAMe 1YCYA 1JRIA 4NOYA 5LJ5g 4A53A 5LJ5f 5LJ5d 5GAOn 5GMKl 2FYKA 3SWNB 4EMKC 4M75E 4C92A 3L1AA 4M75D 3FIFA 4PNOA 5GAN6 3RIRA 1D3BB 2DZCA 5GAN7 3JB9F 4JUVA 2K57A 4JRKA 3JB9G 2DTHA 3EFRA 4PJOB 5GANf 5GANd 3BDUA 2RA2A 4F7UB 3AHUA 4C8QB 4JRIA 4PJOF 1Y96A 1HK9A 4MMKA 2FB7A 5LJ5h 4X9CA 3JCMQ 3HSBA 3JB9H 4PJOC 1WPYA 1JBMA 1I5LA 3JCMf 4M75A 1I4K1 3JCMd 4F7UG 5GAOq 4M77G 3JB9I 5GMKj 5GAOr 3L2ZA 5LJ3e 4C8QG 2VXEA 2E1HA 3V8LA 2DKGA 1U1SA 3SB2A 4EMKB 4C92C 5GAOm 3RERA 4M7AC 4N0AA 2E10A 5CAIA 3RKWA 4HA8A 1Y96B 3HFOA 3FB9A 4RCBA 5GAN4 4HT9A 4V2SA 4M7DA 2VXFA 3RKYA 3V7CA 3QO3A 4M77E 4J6YA 3QUIA 1B34B 4M77D 4XTVA 4M7AA 3V7SA 4C8QE 4C8QD 4QVCA 2EAYA 4OP0A 4RCCA 4XU2A 4HT8A 3PGGA 3VU3C 5GANg 3EFSA 3RUXA 4M75C 5GAN5 4XTXA 4M78A
chains in the Genus database with same CATH superfamily
2DTOA 2DEQA 2JNGA 3G6EA 2EJGA 4AFQC 1C1AA 5IN1A 2QA4A 5D6WA 1Q81U 2KROA 2VC8A 2EVRA 3CEYA 1X69A 2F1LA 1X2KA 1C0MA 2DZ9A 3V8KA 2M0OA 1UJYA 2KSSA 2X3WD 3CCSA 1J3TA 1KIKA 2CSQA 3SEMA 1YJ9A 4RTWA 4IUQA 2LMJA 2L8DA 1CKAA 3CCLT 1M27C 1QWFA 2K3BA 3M56A 1VQKA 3VUZA 7AT1B 4ZTJA 3ZL7C 2M1HA 3SFMA 4O6JA 3C0CA 2DXTA 1RACB 4DBQA 1VQ5T 3MEVA 1AOJA 2VWFA 1HSQA 5FLXE 5GMKe 4HXJA 1AZEA 2EQIA 4OGCA 2E64A 2X4JA 1YITQ 1KQSA 1LNXA 3ZFJA 5GANj 5IHKA 2J6FA 4M77F 4C5HA 2YLCA 3A1PA 3JCMJ 3X26B 3X20B 1G3SA 1KG1A 3TREA 1UDLA 4F14A 3RMSA 2BIVA 4OB1B 1BBZA 3G4SA 3KBGA 2YUNA 5AT1B 2DYIA 1D1BA 2DZCA 2JMAA 2X4WA 1ZUYA 2GQVA 4JUVA 1WX6A 2RJCA 3EGXB 3HTRA 3NGPA 3H8ZA 2KRNA 3M0TA 5CCAA 3CMEQ 4QVZA 4PJOF 4RTZA 3I55Q 1I5LA 4M75A 2LT4A 1GXIE 3R6NA 5LJ3e 4OMPA 4LDUA 3VYGA 1WI7A 3VS3A 4EMKB 1JO8A 2OX7A 3LWHA 2E10A 1KC8U 4LXCA 4E47A 4V2SA 2V8IA 3M5AA 2JM9A 1ZQ1A 3V7SA 1S72Q 1ZUKA 4J7FA 4ATOA 3VRZA 2R5AA 1N9SA 2ROTA 2DAQA 4FCYA 2EPDA 1KHCA 1UGSB 5FRNA 1QQJA 2GTOA 2CZ7B 5CO7A 1NE8A 4C0DC 3E9FA 2FPEA 2KT8A 3T9NA 1Q7YR 2D0NA 4F7UE 1JQQA 3GPLA 4K11A 1OYXA 2QQSA 3G71T 3DB3A 1VQ7T 1SKUB 6AT1B 2K5IA 4C8QA 2R5MA 4JJNK 3NTIA 5GMKi 3SD4A 4PJLA 3GF5A 5IH2A 4KGZB 2V1QA 2K6DA 2PU9B 4F16A 1GCQC 3R6OA 5GMKm 4CC7A 2J05A 4GLMA 3NPFA 2X3XD 3C94A 4PFOA 4PJMA 1VQ9T 4BE1A 4E7KA 2PVGB 2MIOA 3V7RA 2QAZA 1OQKA 3H0FA 1O75A 2DL4A 2COYA 1SPKA 4M78E 2JT4A 3DLLA 1YCYA 2LNHB 2O9VA 2FYKA 2YUQA 2B86A 5GAN6 2HKNA 3JB9F 1VQPQ 2JTEA 3JSCA 4HCKA 2ZPIB 5I22A 3JCMQ 2E1HA 3SB2A 1QCNA 4II1A 3S3MA 2EIFA 2FPFA 1WGSA 2P0PA 3RKWA 5GAN4 2L2PA 3CMEA 2L0AA 1RAGB 4M77D 3M4YA 4A4FA 3I55A 4LUEA 4OP0A 4RCCA 5D6YA 3PGGA 3HPWA 2AZSA 1YJNT 4MZTA 2LP5A 2X4XA 2LC4A 3O8VA 4M7DB 3M0UA 3OS1A 4LN2A 1IHVA 1R0CB 1VQNQ 2DBKA 2DILA 3L2RA 4C92F 2XDDA 4M7DC 1S72A 3OYMA 3EHRA 4PJOD 2DEUA 3JCMP 2OTLQ 3KFVA 1VYUA 2KBTA 4AMCA 2B8AA 5CQXA 1W6XA 3CCMT 5IT9E 1IGUA 2CUDA 1KQ1A 2VV5A 4HCCA 2O88A 1AVZC 3C4SA 2KAFA 3JRZA 3H0HA 4BE2A 4PKCC 2FZGB 1D0XA 2Y4YA 2FL7A 1IO6A 3QSUA 1QKXA 4QQDA 1HYOA 2KK4A 3UATA 3GIBA 4J83A 3JCMV 1YWPA 4XU3A 1UB4A 3OY9A 4ESRA 1BI2A 2VASA 3TEEA 3CCVQ 4AFUC 3E9GA 1FMKA 5D7UA 2XU8A 3OS2A 2EYXA 4L59A 2NUPA 3BDUA 1Q82C 2Y4XA 1TOVA 3LGFA 4QT7A 2C0TA 4F7UG 3MKDA 2NUTB 3L2ZA 2KRMA 3CCLA 2XHCA 3NHNA 3PNWC 1NLOC 1BCMA 1RI9A 2ZAEA 1VQPA 2DIQA 2M16A 5LL6S 2PUOB 1BYMA 3QWXX 1SHFA 4MDXA 1Q81C 2K3XA 1WHLA 4BY6C 4M78A 1EZZB 2EQKA 3A8HB 1M5Q1 1QMCA 2K4YA 4C5GA 1W2BP 1G3WA 4BDYA 3JB9D 3I56Q 5A0GA 2CZ0B 2HQEA 2CT4A 3OW2S 2DE0X 1VQMT 3EG1A 1X01A 4IUTA 1QCOA 1M90C 3OBYA 1ZLMA 4CC2A 4B6MA 4KUDK 1W2BS 1SSFA 1VQNA 2XDBA 2EFIA 1WHHA 1WHKA 3QDRB 1V29B 4QQGA 1F1BB 2DA9A 4Z02A 2KT1A 2DO3A 1MNEA 1NG2A 1OX9A 1T3SA 3GP8A 4XTZA 1CKBA 1MGQA 4GBQA 5LJ3f 4M7DG 1RAIB 2L3PA 4RTUA 1NPPA 2OTLA 2F2XA 3EFOA 5GAMd 3VS4A 2EGEA 2YRCA 2EKHA 4JJBA 3J7AF 1VQLQ 2HBPA 2IG0A 3S6WA 4F04B 4C92D 2DYBA 1D1AA 2RI5A 4XTWA 1H3ZA 2MCNA 1UECA 4LDYA 1VQ4T 3CCJQ 2P0KA 1M1GA 1M3CA 3CCRQ 5LJ5d 1VYVA 1V76A 2DRKA 1OEBA 4PNOA 1IREB 2OI3A 5GAN7 2R58A 3MP6A 2DLPA 2ZPFB 1BK2A 2CYZB 1MNDA 3TQ7P 4KRTA 3AHUA 1HK9A 2G3RA 4HCZA 1W2BA 3OYHA 2DXBA 3CCVA 1WXTA 4FM4B 2DKGA 5CK9A 1MMDA 1BB9A 2XI9A 2M0YA 2BUDA 4JJDA 1OU9A 1FMVA 1ZA2B 2HDAA 3QYHB 1WHJA 2JZ2A 3QUIA 1B34B 1K9AA 2QDLA 2K3YA 3NFCA 1SSHA 1VQ8T 2XDPA 1PRMC 3L42A 4DEXA 2MOXA 4CC4B 4J9CA 4FYVB 4M7AB 4Z8AA 1SHGA 2DMOA 3JCMc 2KXDA 3A5ZB 2KRSA 5KCOA 3G6EQ 2MMPA 3DLMA 3CD6T 2PVDB 2HEQA 5GAOp 1WNLA 1O9SA 2HL3A 2RB6A 3X24B 3X25B 1AWJA 2LQ8A 3CC7Q 3ME9A 1NM7A 3SWNA 3CCET 2ED1A 3BW1A 3I56A 1IRXA 3RESA 2O2OA 2RJDA 2DBMA 1MHNA 2MWPA 4PK4A 2RQWA 1YHQQ 1K76A 1OV3A 1JXMA 3QZ5B 5J26A 5KYUA 4FSSA 3PMIA 2E41A 3FC3A 2LQWA 1UGQB 2P4TA 1Y07A 1PD0A 4DQ2A 2L5QA 2O9SA 4NL2A 5FROA 3CC2T 3BDLA 3A8OB 2HQHA 3NMZC 4M75E 5CKBA 4C92A 1G3YA 1VQLA 2BZXA 1UHFA 2JW4A 2JS2A 3QJYA 1PSEA 1GL5A 1Y96A 1WPYA 1JBMA 1QLYA 2BE9B 4WCIA 3VS2A 3CCJA 5GAOr 3CCRA 1GFCA 1VUBA 2PQWA 1YN8A 5FU7C 4KUIA 1U1SA 1Q86R 1K8AC 5C0MA 4BACA 4E6RA 4FT2A 5D6XA 2K5FA 3VU3C 2QEXT 3UWNA 3EAEA 3CMAT 4M75C 4XTUA 2ENMA 2A08A 1KQSP 4LUDA 5I2SA 2W10A 1TH7A 1EFNA 1LVKA 1K73R 3WVDB 4HVVA 2YRVA 4JLIA 2EBPA 2DXUA 3LW5E 3OYFA 4FW2A 1K9MC 4JS5A 2RM4A 4OMOA 1JJ2A 3JCMb 1KQSS 3JCMe 1RADB 5GAMj 1RI0A 1XTDA 1TUCA 5I21A 1I07A 1UE9A 2DTIA 4Y28E 3MEUA 2DJZA 1GRIA 2RHZA 4KH1B 2KQWA 2MK5A 2DK3A 2V26A 4RG2A 3CC7A 4FYYB 4M7AG 4AFZC 4OMMA 5FU6C 5LJ5j 2QYZA 9ATCB 1B3QA 2YRDA 3S3NA 2JJ9A 2VYTA 4HKEA 2QDYB 2VVKA 4F7UF 3CXCP 3M55A 3CCUQ 1YHQA 4C8QC 4WF2A 2XMFA 2DL7A 2JXBA 2ZPEB 5GAMe 4MZMA 1WJSA 2F2VA 5HK0A 4E7LA 3OYYA 1XOVA 3EFRA 3VV0A 4UC4A 4JZ4A 3QXEB 4HVWA 1PM3A 3OA6A 4ZGDB 1BI1A 2HCKA 3P8BB 4EPCA 3ZBDA 4O5VA 4RG8A 1OZ3A 3FEOA 3QIIA 5FRMA 2QI2A 1KJWA 3OSVA 2NUZA 2W0ZA 4QKUA 2VXFA 4ZGJB 3A8GB 1SF9A 3GNGA 4HT8A 2F69A 2F5TX 2IVWA 3MHXA 1DJ7B 1G8XA 3MO8A 4JLGA 2JMCA 4XTXA 1XJWB 4FT4A 2OAWA 3H6ZA 1UJ0A 1WQWA 3M0SA 4L6V5 2HNIA 4LD6A 2V8JA 2LT1A 2C06A 4M7DF 3OYCA 3FJ5A 2GCXA 5GANe 2EWNA 2H3EB 3JCMh 1BI3A 3AT1B 5CVIA 2P84A 3KXTA 3OYKA 5HCKA 3WXMB 1NBEB 1YNZA 4GY5A 3CXCA 4M75G 2OTJQ 1AWOA 3EG9B 4PFZA 1M1KC 4N4IA 5CKDA 2HBWA 2JUFA 1QCFA 3QYGB 4C0DB 4AG1C 3A98A 1M2VA 8ATCB 5KH6A 1H641 2KE9A 1M8VA 3JAME 1G5VA 4DBFA 5EC7A 2JN0A 2K2VA 3MJXA 1YJWQ 1EX4A 1Q7YC 3L2WA 1VQ6Q 3NTKA 3ASKA 1GBQA 2ED0A 1VQOQ 2GGRA 4CC3A 4J9GA 1ZA1B 1T0HA 5GAMh 2P4RA 3PVQA 4R55A 3NTHA 1K1ZA 2NWMA 5GMKl 1QVGP 1RLQC 5KYYB 2DERA 1AWWA 2JS0A 3CBOA 3CCUA 4F7UB 2FRYA 4M4ZA 2QTVA 4FU6A 3PTAA 5LJ5h 1OZ2A 1UGVA 1HJDA 2RQTA 1WJRA 5J39A 3E19A 1QWEA 4C8QG 4F17A 2VXEA 4FYWB 1KD1R 1OI1A 1MV0B 2A0FB 2R57A 5GAOm 3CCLQ 4HT9A 1B07A 3RKYA 4PFPA 4M77E 2V1RA 2KGTA 2M51A 3GNFB 4XU2A 3THKA 5CKFA 5KYXA 1MV3A 2D8JA 4DBHA 2LTOA 4RTXA 4CI0C 3I5RA 1SRLA 3JV3A 3BE3A 1VQ5Q 3HRUA 1SRMA 4A4HA 2Y90A 3UPUA 1TUGB 2A7YA 2GNCA 3JB9J 5GANh 1D0ZA 5IXFA 5HY6A 3LLRA 4BD3A 5J3BA 2RHYA 4FYXB 4QVDA 4PJOE 2DPPB 3INZA 2KNBB 4M78C 2WSEE 3PIPA 5GAN3 1NPRA 5A0DA 2DJQA 3PFSA 4OGEA 5DLQE 3M9QA 1Q86U 1CSKA 1RAAB 2EGAA 1OX8A 5I2MA 1YI2T 1PKTA 1QKWA 4J9HA 1YIJT 1QVGA 1NJIC 2Z0WA 1M8MA 3H9NA 1KFZA 2OTJA 2LX7A 4EMKA 2JOYA 4WTOB 3QJ6A 1QP3A 4EMGA 4ELYC 3OYLA 4M7DD 3I9QA 1K73U 2CP6A 1N9RA 2IPOB 1RAHB 4X1VA 3EFOB 4JS4A 1NLPC 1ZSZA 2FO0A 1YJWA 1VQ6A 4PL6A 1N8RU 5GAN5 2HD0A 4QQ6A 2DL5A 1VQOA 1S1NA 2DTHA 1JEGA 2KVQG 3HP9A 4JRIA 1PRLC 2KYBA 4XK8E 3JCMf 1Q95G 1X2QA 3JB9I 3PIOA 1ZUUA 3CCQT 1N27A 4N0AA 2VUBA 2WSFE 4RCBA 1M1FA 1VQ7Q 3PMTA 1ZBJA 2PVOB 2RI2A 5L23A 3CC4T 3RUXA 2DNUA 3O5ZA 2X9HA 3FDRA 3JCMg 3M0PA 4A63B 4PJJA 4RUGA 4M7AF 5GAN8 3M54A 3GOXA 2O4XB 2AZVA 1VQ9Q 4RMOA 2EJ9A 1TXQA 2K2MA 2MAMA 4BY6B 4OB3B 1VQ5A 4PJNA 1WHGA 1RLPC 2CH4W 4J5YA 4J9EA 4L5GA 1YFNA 2QK0A 1OOTA 1D09B 2QA4T 2AK5A 1OPKA 1WJQA 4M77A 3M57A 1NYFA 3GBQA 1PSFA 1WFWA 3BY7A 2P0QA 3CCST 5GAMg 3SWNC 2LCLA 4M78G 1YJ9T 1LOJA 3EHQA 5I11A 1JB0E 4EMHA 4C92E 3OQ5A 2JVVA 2MWOA 2GQIA 4PJOA 1VQKT 2QQAA 2RNAA 3LYIA 2X51A 2YHTA 2LNVA 3RR6A 4OMQA 4A4GA 1E6GA 1FMWA 5GAOn 5LJ5g 2IIMA 2HSPA 1M90R 3FRNA 2DL3A 4KT0E 2D8HA 1Z9QA 5C6SA 2GFAA 4MDWA 2JTFA 1M2OA 2RH2A 2KYMA 3EGDA 5GANf 3OYDA 3VS7A 2KEAA 3LH0A 1VIFA 3WVEB 1QW1A 2SRCA 1N6AA 2F2WA 3G4ST 3M0RA 4C92C 1Y57A 2CP7A 3OS5A 1IHWA 1Y96B 2QXFA 2XG8D 3CCMQ 5KCHA 2O01E 3VS1A 5GANg 1KC8C 1D0YA 5HK3A 1R0BG 2ATCB 5FWCA 4JDSA 2QASA 2LX9A 3MEAA 3G71A 2DX1A 1MMNA 1I1JA 5DM7R 4LE9A 1X27A 1FXXA 1VQ7A 2ECZA 4IIOA 2XKOC 1VOMA 2DVJA 2DXCA 2RN8A 1E7OA 1I0CA 1TU0B 3VRYA 1BIBA 2COZA 1RABB 3OBWA 1KD1U 2LVMA 4A54A 1U8RA 2GBQA 1E6HA 1KSWA 1VQ9A 1VYTA 3CPWP 5HKCA 3UT1A 5LJ3d 4XU0A 2NUTA 3QWYA 4HCBA 3J81E 1HXDA 4C8QF 4ZNXA 2FVUA 4M7AD 3CPWS 2H8HA 2XIDA 2LJ3A 2GTJA 5DY9A 1Y7XA 3ER0A 4A53A 2RI3A 1TWBA 1PD1A 2K57A 3JB9G 1JJ2P 2PZ1A 2XK0A 2ZZDA 3OB9A 1YJNA 3LH5A 5GAOq 2A36A 1VQMQ 2RHIA 2J06A 4BB7A 1A0NB 4DOVA 1AT1B 1UG1A 2LQNA 2E6ZA 3RERA 1C6VX 1YBYA 1YITT 1PWTA 4BE0A 2RK2A 2CSIA 4LDXA 4XTVA 1JJ2S 4IKFA 3H0IA 1AEYA 3CBMA 3EFSA 5CKHA 4P5NA 1AWXA 2HZYA 2RHXA 1W70A 5FU7B 1U5SA 4B9XA 3OYNA 2OAUA 3CPWA 3CCMA 2QQ9A 1H3HA 4PLLA 4C92G 3CMET 3L2QA 1K0XA 3I55T 1K0SA 4M75B 3HL8A 4J6XA 3QKJA 1WDXA 2RO0A 4LD9K 4RKUE 2RK1A 4FSXA 1AD5A 1IXDA 3V8JA 4X34A 1M30A 1IGQA 1JU5C 3X28B 1S72T 2ZPGB 2C0OA 2EQUA 2EW3A 2YUOA 1K73C 2DRMA 3Q1JA 1T3LA 1UFFA 2EYWA 2DD5A 1UGRB 4E7HA 2FHDA 1N8RR 1PG5B 3D7SB 1BU1A 1V1CA 2EYZA 4Z89A 3CC4A 2V8KA 3C12A 1QVFA 4MMLA 1B34A 2AKLA 5IAYA 4ZN3A 4RTTA 3ZEHA 2CZ1B 5EG2A 1Q82U 4KBMB 5FU6B 4NOYA 3REBB 1OULA 4AT1B 1MUZA 2HAXA 2MF2A 1Y71A 3TVTA 3CD6Q 4C8QB 1UTIA 2HL5C 3RNJA 1TUDA 1R8OB 5GMKj 4R0KA 2BKDN 4OB2B 3META 4RTVA 5CAIA 4R56A 3CCEQ 1W1FA 5KYWA 4LDVA 2HQXA 2PTKA 4C8QD 4DEYA 1VQMA 1GBRA 3CXCS 2DFUA 2MYSA 3OYIA 2E12A 5GAN2 4PLIA 2DF6A 2GF7A 5LJ5e 1M90U 2YLBA 1VQPT 5KYXB 1D1CA 3TSWA 1GCPA 3UF4A 5LJ3j 2DETA 2I0NA 1RAFB 3LGLA 3OMCA 4M78F 2I2LA 3CC2Q 3M4GA 3EH2A 1M3BA 2K9GA 3RKXA 1UHCA 5GJWB 5CQYA 3VUBA 3VKIA 2EYYA 4J6WA 5KE2A 2EQMA 2RQUA 1I5OB 1P92A 4OF1A 1WXUA 3RMQA 2CP5A 2CUBA 2E70A 1VQ4A 2EJFA 1FYNA 5IHNA 1JXOA 1NZ9A 1VQNT 3JCMX 2RD1A 2NYSA 1X6GA 1D3BA 1WYXA 2RHUA 3DB4A 3P8HA 4XTYA 2X4YA 2QEXQ 3CMAQ 1LCKA 2OTLT 3MCAB 2E3IA 4EMKC 1WHMA 3L1AA 2KMTA 2HSEB 2O31A 3SDZA 2A3LA 1ZSZB 1M1KR 4ORZA 1VQ8A 4MZPA 2WACA 2E6NA 2M02A 2LCSA 1ZSZC 1RUWA 2DD4A 4CRIA 2L3QA 1XQHA 3G7ZA 1IZ6A 1WLPB 4HA8A 3HFOA 3P8DA 3UA6A 3LWIA 2D9TA 3CD6A 1NEGA 3QO3A 1EIFA 1X75C 2YXYA 4E7JA 4E7SA 4IIMA 2MI6A 2ZPBB 2DL8A 3HHTB 2RQVA 2YSQA 5GAOl 3CCVT 3OS0A 4RTYA 3CCEA 1T0JA 4N0AC 4DA4A 1LPLA 1SG5A 2BZ8A 2ZGWA 1KD1C 2CH4A 1BCOA 1ZBXA 4OB0B 2NUPB 3VS0A 5GMKh 2RQRA 1QVGS 3QZ9B 5M9OA 4XU1A 3E1SA 4D8DA 1ZX6A 4QW2A 2AHJB 3CPFA 1X6OA 2DVEA 3UDCA 4AFSC 2PNIA 4C5IA 1YCSB 4ZN1A 2HKQB 1M4ZA 3HRTA 3F70A 2CZ6B 4AG2C 2CGHA 3CC2A 4M78B 1X6BA 1YITA 5GJVB 2XICA 2K7AA 2D0QB 2LJ1A 4M77B 4J8OA 4N4HA 5CKEA 2A28A 5LJ3h 2E65A 2LQKA 3I56T 4M7DE 4J9DA 2M9UA 4KULA 4M77C 2K5LA 3EGXA 1UEBA 1ZSGA 2ABLA 4M78D 1ARKA 2A37A 4BI3A 2COWA 2D6FA 1R77A 2RMOA 2OJ2A 4PJOB 1Y0MA 1B7TA 3U23A 2RA2A 2SEMA 1NEBA 1FX7A 2QEXA 4PJOC 4D8KA 3CMAA 4A4EA 1K8AU 1PKSA 3VYHB 4D6WA 2VGMA 1WIEA 5KYNA 2BTTA 1AHJB 3EGDB 5L8RE 1NJIR 1VQLT 2CREA 4J7IA 1NYGA 3EG9A 2QQBA 3FB9A 5A0LA 3QG1A 2BE7D 1WXBA 2VGNA 1ABOA 4KGVB 1H8KA 3HKSA 3CCJT 2CS7A 3CCRT 1AZGB 1G3TA 4DOWA 2LDMA 4Y91A 1K9MU 4ZGEB 5AYFA 4YTLA 4Q5WA 2QQRA 3EG0A 3BFMA 1ABQA 2EGCA 2L3SA 3G71Q 4C5EA 1LJOA 3RDVA 4JRPA 4E7IA 3L2VA 2K79A 5ECAA 4FW1A 4XQ3A 2ROLA 4ME7A 4ANJA 1GCQA 1UGPB 4HVUA 5IXBA 5KYYA 1KQ2A 4F7UA 1ACMB 2AT1B 5A2QE 3QPHA 2D1XA 2FZCB 1OPLA 1I81A 4KH0B 4LDWA 3HRSA 1M3AA 1Q82R 4VUBA 5GAMf 3REAB 4OVAA 2KXCA 3PVLA 4J9BA 3MP1A 3ULRB 2QTXA 1WZOA 2ZCFB 3HFNA 3G6ET 2E5QA 1M9SA 1HD3A 3VS6A 2G6FX 2C0IA 3CC7T 1U06A 3EG2A 1JRIA 5LJ5f 3H41A 1Z9ZA 3SWNB 1Q81R 2YWWA 3I35A 4OMLA 3OYBA 2YUPA 3OW2P 3IQLA 2CKKA 2H3JA 4BUGA 4MMKA 1YHQT 3JB9H 4X9CA 3HSBA 3URGA 1K4US 3JCMd 1VA7A 4M77G 5KYUB 4LNPA 3OMGA 2FRWA 1YJNQ 2J7IA 2LCCA 3GLXA 2RPNA 1IB8A 2QG9B 3I5SA 1PHTA 4M7DA 1TSFA 3M53A 4KGXB 3MEWA 2CT3A 3EGUA 4QVCA 4DBRA 2EAYA 1WA7A 3A8MB 1YI2Q 3QHSA 2L3RA 2XD0A 3M59A 3N5BB 3A8LB 1G2BA 3FLGA 1YIJQ 4BI4A 4PJOG 2J6OA 4C92B 3OYGA 4OMFB 1U3OA 3S3OA 1ZHIA 8AT1B 1WQ7A 4NL3A 2EKOA 5IHIA 1PCXA 4JJCA 2JM8A 5CIUA 3OYAA 4E2FB 1M1KU 1XNIA 4A4KA 2ZPHB 4M75F 3J80E 3RBBB 1X43A 3TCJA 1Q7YU 5LJ3g 1RAEB 2E5KA 4EDUA 1H92A 1KC8R 3OW2A 1KK7A 3CCQQ 2KI7A 2ESWA 2X35A 2RJEA 1TS9A 1MMAA 2FEIA 4BDZA 4M7AE 3EG3A 1BIAA 1N5ZA 2VKNA 3UA7A 2HMAA 3CC4Q 2FG0A 3EH1A 3RIRA 3M58A 3PE0A 3TU4K 4JRKA 2KDSA 3QDFA 2QGGA 5GANd 4JPBW 2O4XA 2GFUA 3QBYA 3MPUB 1KHIA 1I4K1 1TTHB 4C0FA 3V8LA 2AIRB 4BI8B 3KUFA 4M7AC 1SEMA 2QA4Q 2MPXC 1BKBA 1RL2A 3V7CA 4J6YA 4Z88A 3CCUT 5DLOA 4JRQA 2E3HA 4TVRA 1W4SA 2RF0A 3G1JA 3LX7A 2DM1A 3CBPA 3C95A 2CP2A 1G83A 2E4HA 2VB6A 3CCSQ 3JCMW 5KYWB 1QVFP 3CQTA 1YJ9Q 2EYQA 1U1TA 1TG0A 2BZYA 1VQKQ 1YI2A 3PT9A 1YIJA 2F5KA 1I8FA 2J6KA 3E2UA 5FW9A 2YT6A 1QVFS 4FL6A 4JZ3A 4C0ZA 3VJPA 1NJIU 4GLKA 4IUUA 4N4GA 5CR2A 3VS5A 4IUPA 4C0GA 4J9IA 4ELZC 1PNJA 4X9DA 3G4SQ 1BI0A 1Q86C 2QGFB 1VQ4Q 3FJPA 4XAXB 1GFDA 4B9WA 2LZ6B 1VIEA 2CP0A 1PC0A 2FZKB 1K8AR 2CDTA 4OMNA 2PUKB 3CCQA 2L89A 2YDLA 4IUVA 3DKMA 1YWOA 4NS5A 2OTJT 4M75D 1OU8A 3FIFA 5FWBA 1D3BB 4Y92A 2DIGA 1UUEA 3OYJA 5KE3A 2NLUA 1MMGA 4EIKA 2FPDA 3MP8A 3L2UA 4J9FA 4IURA 2CP3A 1M2VB 2FB7A 4E7ZA 3OYEA 1N8RC 4ZTFA 2JTMA 3SHWA 1QP2A 1QVPA 3OSSC 4FIBA 2WSCE 2RJFA 1FWZA 1YJWT 1VQ8Q 3M0QA 1YP5A 1VQ6T 1K9MR 1VQOT 2LJ0A 3TSZA 4M7AA 4C8QE 2AKKA 2LRQA 2KY9A 2EQJA 2KR3A
chains in the Genus database with same CATH topology
2ZPBB 2DTOA 2XDPA 3L42A 2DEQA 2JNGA 3FDRA 3HHTB 3G6EA 5GAOl 3CCVT 3JCMg 2EJGA 3OS0A 3CCEA 4M7AB 4N0AC 5IN1A 3JCMc 2QA4A 5D6WA 4DA4A 2ZGWA 1Q81U 1KD1C 1ZBXA 2VC8A 4OB0B 3A5ZB 5KCOA 5GMKh 5GAN8 4M7AF 2MMPA 3CEYA 3DLMA 2PVDB 3CD6T 3M54A 3GOXA 2O4XB 5GAOp 1QVGS 4RMOA 3QZ9B 1WNLA 2EJ9A 2DZ9A 3V8KA 2MAMA 4XU1A 1O9SA 2M0OA 2RB6A 3E1SA 3X24B 4BY6B 5M9OA 2KSSA 3X25B 2LQ8A 4OB3B 1VQ5A 3ME9A 3CCSA 4J5YA 4QW2A 2AHJB 3CPFA 4L5GA 1X6OA 3SWNA 2DVEA 1YJ9A 3UDCA 4IUQA 2L8DA 3CCET 3BW1A 3I56A 3CCLT 2QA4T 2XD0A 4C5IA 3RESA 2RJDA 1WJQA 1MHNA 4M77A 3M57A 4ZN1A 3M56A 1M4ZA 2MWPA 1VQKA 3VUZA 3HRTA 3F70A 4ZTJA 2CZ6B 2M1HA 3SFMA 4O6JA 1PSFA 2CGHA 2DXTA 3QZ5B 5J26A 4M78B 1YITA 3CC2A 3BY7A 2P0QA 2XICA 1VQ5T 3MEVA 3CCST 5GAMg 5FLXE 1KQSA 5GMKe 2D0QB 3SWNC 4M77B 4J8OA 4N4HA 2LCLA 4M78G 5CKEA 1YJ9T 1LOJA 2E64A 2X4JA 4OGCA 2E65A 1LNXA 3PMIA 1JB0E 2E41A 2LQKA 5LJ3h 3ZFJA 4EMHA 3I56T 5GANj 4M7DE 4M77F 3FC3A 4C92E 2M9UA 3OQ5A 2JVVA 2MWOA 2YLCA 4KULA 4M77C 4C5HA 3JCMJ 3X26B 3X20B 1UGQB 2P4TA 4PJOA 1Y07A 2K5LA 1VQKT 4DQ2A 1G3SA 1KG1A 2L5QA 2QQAA 3LYIA 3TREA 1UEBA 4NL2A 3RMSA 2BIVA 2YHTA 2LNVA 4OB1B 5FROA 4A4GA 3G4SA 3KBGA 4M78D 3CC2T 3BDLA 4BI3A 5LJ5g 3A8OB 5GAOn 3FRNA 4M75E 5CKBA 4C92A 1G3YA 1VQLA 4KT0E 2D6FA 2DZCA 2X4WA 5C6SA 2GFAA 2GQVA 4JUVA 4MDWA 4PJOB 2RJCA 2JTFA 2RH2A 5GANf 3QJYA 2RA2A 3H8ZA 3OYDA 1PSEA 1BYMA 5CCAA 3LH0A 4QVZA 1FX7A 4PJOF 1VIFA 1Y96A 2QEXA 4PJOC 3CMAA 3WVEB 1WPYA 1JBMA 4A4EA 1QW1A 1K8AU 3VYHB 1I5LA 4M75A 1N6AA 4D6WA 3CCJA 2LT4A 5GAOr 1GXIE 3CCRA 5LJ3e 1VUBA 2VGMA 4LDUA 3G4ST 2PQWA 3VYGA 5FU7C 4KUIA 1AHJB 1U1SA 4EMKB 5L8RE 4C92C 3LWHA 3OS5A 2E10A 1VQLT 1KC8U 4J7IA 1K8AC 1Y96B 2QQBA 3FB9A 2QXFA 4E47A 2V8IA 4V2SA 3M5AA 2XG8D 5C0MA 4BACA 5A0LA 3QG1A 1ZQ1A 4FT2A 5KCHA 2O01E 5D6XA 3V7SA 2K5FA 3VU3C 2QEXT 4J7FA 2VGNA 3EAEA 3UWNA 5GANg 3CMAT 4ATOA 4M75C 1KC8C 2R5AA 3HKSA 4XTUA 5HK3A 3CCJT 1N9SA 2CS7A 3CCRT 5I2SA 2DAQA 1TH7A 1G3TA 4JDSA 2LX9A 3MEAA 3G71A 4DOWA 1KHCA 2LDMA 4Y91A 4ZGEB 5DM7R 1K9MU 1FXXA 5AYFA 1VQ7A 1UGSB 4YTLA 4Q5WA 2QQRA 5FRNA 3WVDB 2YRVA 3BFMA 4JLIA 2XKOC 2CZ7B 5CO7A 1NE8A 4C0DC 3E9FA 4C5EA 1LJOA 2DXCA 2DXUA 3LW5E 4JRPA 4E7IA 3T9NA 3L2VA 3OYFA 1K9MC 4JS5A 2RM4A 4F7UE 4XQ3A 1JJ2A 3JCMb 4ME7A 1KQSS 3JCMe 3GPLA 1BIBA 5GAMj 1OYXA 1RI0A 2QQSA 3OBWA 1XTDA 1UGPB 1KD1U 2LVMA 3G71T 4A54A 1U8RA 3DB3A 5I21A 1VQ7T 1KQ2A 2DTIA 4Y28E 4F7UA 3MEUA 1VQ9A 2DJZA 2K5IA 4C8QA 3QPHA 5A2QE 2RHZA 5HKCA 2R5MA 2KQWA 3UT1A 4JJNK 3NTIA 5LJ3d 2DK3A 4XU0A 5GMKi 4RG2A 3CC7A 1I81A 3SD4A 4M7AG 3GF5A 4LDWA 3HRSA 5FU6C 5LJ5j 2PU9B 4VUBA 5GAMf 3S3NA 3R6OA 4OVAA 5GMKm 2VYTA 4HKEA 2QDYB 3MP1A 2QTXA 2ZCFB 3HFNA 3C94A 4F7UF 3G6ET 2E5QA 4HCBA 3J81E 1HXDA 3M55A 4C8QF 2FVUA 1M9SA 1YHQA 4C8QC 3CPWS 1VQ9T 4M7AD 4BE1A 4WF2A 4E7KA 2PVGB 3V7RA 2XIDA 1O75A 1NJIU 2ZPEB 3CC7T 4M78E 5DY9A 5GAMe 3DLLA 1YCYA 1Y7XA 1JRIA 4MZMA 3ER0A 4A53A 5LJ5f 1WJSA 2RI3A 2FYKA 3SWNB 4HT8A 5HK0A 5GAN6 3JB9F 4E7LA 3OYYA 2K57A 1XOVA 3OYBA 3JB9G 3EFRA 3VV0A 4UC4A 3JSCA 3QXEB 2ZPIB 2CKKA 2H3JA 4BUGA 2XK0A 4MMKA 3JCMQ 2ZZDA 1YHQT 3JB9H 4X9CA 3OB9A 1YJNA 3URGA 3OA6A 3HSBA 3JCMd 4ZGDB 1BI1A 5GAOq 4M77G 4EPCA 3P8BB 2RHIA 3ZBDA 4O5VA 2E1HA 4RG8A 4BB7A 1OZ3A 3FEOA 3QIIA 3OMGA 4DOVA 5FRMA 3SB2A 2QI2A 3OSVA 4II1A 2E6ZA 3S3MA 3RERA 2EIFA 2LCCA 3GLXA 1YBYA 1WGSA 2P0PA 3RKWA 1YITT 5GAN4 4BE0A 2VXFA 4ZGJB 2RK2A 3A8GB 3CMEA 4M7DA 4LDXA 3M53A 4XTVA 3MEWA 4M77D 1JJ2S 3M4YA 4IKFA 3GNGA 4A4FA 3I55A 4QVCA 2EAYA 2F69A 2F5TX 2IVWA 3CBMA 3MHXA 3PGGA 4OP0A 1DJ7B 3HPWA 4RCCA 5D6YA 3EFSA 3MO8A 1YJNT 4JLGA 4MZTA 5CKHA 3A8MB 4XTXA 3QHSA 2L3RA 4FT4A 3M59A 3N5BB 3A8LB 2X4XA 3FLGA 4P5NA 2RHXA 4BI4A 4PJOG 3H6ZA 1WQWA 2LC4A 4L6V5 5FU7B 3O8VA 4B9XA 4M7DB 4C92B 3OYGA 4OMFB 2HNIA 4LD6A 2V8JA 2LT1A 3OS1A 3OYNA 2OAUA 3CPWA 3S3OA 2C06A 3CCMA 4M7DF 1ZHIA 3L2RA 3OYCA 2QQ9A 4C92F 2XDDA 4M7DC 4PLLA 4C92G 1S72A 3OYMA 1WQ7A 4NL3A 3CMET 2GCXA 2EKOA 5GANe 2EWNA 3L2QA 4PJOD 3I55T 3JCMh 1BI3A 5CIUA 4M75B 3OYAA 1M1KU 3HL8A 5CVIA 3KXTA 3JCMP 1XNIA 4A4KA 3OYKA 4J6XA 3QKJA 2ZPHB 3WXMB 4M75F 3J80E 4GY5A 3CXCA 2RO0A 4M75G 4LD9K 4RKUE 2RK1A 2B8AA 4FSXA 1M1KC 5CQXA 5IT9E 3CCMT 4N4IA 3V8JA 4X34A 5CKDA 2JUFA 3TCJA 3QYGB 4C0DB 3X28B 1S72T 1KQ1A 2ZPGB 1Q7YU 5KH6A 2EQUA 1H641 2VV5A 5LJ3g 4HCCA 4EDUA 1K73C 5KE2A 1M8VA 3C4SA 3Q1JA 2KAFA 3JAME 1G5VA 3JRZA 2DD5A 1UGRB 2JN0A 2K2VA 4PKCC 4BE2A 3OW2A 4E7HA 2FHDA 2FL7A 2Y4YA 1Q7YC 3L2WA 2X35A 3NTKA 2RJEA 3QSUA 3ASKA 4QQDA 3CC4A 2KK4A 3GIBA 2V8KA 3C12A 1QVFA 4J83A 4BDZA 4MMLA 1B34A 3JCMV 4M7AE 1BIAA 4XU3A 5IAYA 5GAMh 1UB4A 4ZN3A 3OY9A 3ZEHA 1BI2A 4R55A 2CZ1B 5EG2A 1Q82U 3NTHA 4KBMB 5FU6B 4NOYA 3TEEA 5GMKl 3RIRA 3E9GA 3M58A 3TU4K 4JRKA 2KDSA 2XU8A 2MF2A 2HAXA 1Y71A 3CBOA 3OS2A 3CCUA 4L59A 5GANd 3BDUA 4F7UB 1Q82C 4C8QB 2O4XA 4FU6A 3PTAA 5LJ5h 1OZ2A 2GFUA 2Y4XA 3LGFA 3QBYA 1KHIA 1I4K1 4F7UG 1WJRA 1R8OB 5J39A 3L2ZA 5GMKj 3E19A 2BKDN 2XHCA 2VXEA 4OB2B 4C0FA 3V8LA 4C8QG 4BI8B 3CCLA 1OI1A 2R57A 3PNWC 3VKIA 3KUFA 5GAOm 4M7AC 3META 5CAIA 4R56A 1VQPA 2DIQA 4HT9A 2M16A 5LL6S 4LDVA 1BKBA 1RL2A 2PUOB 4J6YA 4M77E 3RKYA 3V7CA 3CCUT 5DLOA 4MDXA 2HQXA 4JRQA 4C8QD 3GNFB 1Q81C 4XU2A 2K3XA 5CKFA 1VQMA 4TVRA 1W4SA 3CXCS 4BY6C 2LTOA 3LX7A 5GAN5 4M78A 3CBPA 4CI0C 3C95A 3OYIA 2E12A 5GAN2 2EQKA 3A8HB 3HRUA 4PLIA 3JCMW 4A4HA 1M5Q1 4C5GA 2K4YA 2GF7A 2Y90A 5LJ5e 1G3WA 3UPUA 2A7YA 4BDYA 3JB9J 2EYQA 2YLBA 5GANh 3JB9D 1VQPT 5HY6A 1M90U 3LLRA 5A0GA 1U1TA 4BD3A 5J3BA 2RHYA 2CZ0B 4QVDA 5LJ3j 2DPPB 3INZA 4PJOE 1YI2A 2HQEA 3OW2S 3PT9A 1VQMT 1YIJA 3LGLA 3OMCA 4M78F 2I2LA 1X01A 4IUTA 4M78C 2F5KA 1I8FA 3OBYA 1M90C 3M4GA 4KUDK 2OTJT 2WSEE 1W2BS 1SSFA 3PIPA 3RKXA 1QVFS 5GAN3 4FL6A 1NPRA 5A0DA 4C0ZA 1VQNA 2XDBA 2EFIA 3PFSA 5CQYA 3QDRB 3VUBA 1V29B 4OGEA 4QQGA 3VJPA 4J6WA 4GLKA 2EQMA 3M9QA 4IUUA 4OF1A 1P92A 4N4GA 4Z02A 5DLQE 3RMQA 1Q86U 2DO3A 3GP8A 5CR2A 4XTZA 1MGQA 4IUPA 5LJ3f 5I2MA 4C0GA 4M7DG 2E70A 1YI2T 1VQ4A 4ELZC 2EJFA 1NPPA 2OTLA 1YIJT 1QVGA 1NJIC 4X9DA 1BI0A 2OTJA 1Q86C 1NZ9A 5GAMd 4EMKA 2JOYA 3J7AF 3QJ6A 2HBPA 2IG0A 1QP3A 4EMGA 3S6WA 1VQNT 3FJPA 4ELYC 4XAXB 3JCMX 2RD1A 3OYLA 4B9WA 4M7DD 4C92D 1D3BA 1K73U 1VIEA 2RHUA 3DB4A 3P8HA 4XTYA 1N9RA 2RI5A 4XTWA 1H3ZA 2X4YA 4JS4A 4LDYA 1VQ4T 2OTLT 2P0KA 2PUKB 1M1GA 3CCQA 2L89A 5LJ5d 1YJWA 3MCAB 4IUVA 3DKMA 1VQ6A 4PL6A 1N8RU 4NS5A 2HD0A 4EMKC 3L1AA 4M75D 3FIFA 2KMTA 4PNOA 1IREB 1D3BB 4QQ6A 5GAN7 2R58A 1VQOA 2DIGA 3MP6A 2DTHA 2ZPFB 3OYJA 5KE3A 2NLUA 2CYZB 3SDZA 2A3LA 3MP8A 2KVQG 3HP9A 3L2UA 3AHUA 4JRIA 4IURA 1HK9A 3OYEA 2FB7A 1N8RC 1VQ8A 2G3RA 4XK8E 4HCZA 4MZPA 2WACA 3JCMf 3OYHA 2E6NA 2JTMA 4ZTFA 1W2BA 3JB9I 2DXBA 1QP2A 3PIOA 1QVPA 3OSSC 4FIBA 2DD4A 2WSCE 4CRIA 3CCVA 4FM4B 2RJFA 1FWZA 2DKGA 5CK9A 3CCQT 1XQHA 1YJWT 2XI9A 1VQ6T 1N27A 3G7ZA 4N0AA 1IZ6A 2BUDA 2VUBA 2WSFE 4HA8A 3HFOA 4RCBA 1M1FA 3P8DA 3LWIA 2D9TA 3PMTA 1VQOT 3QYHB 3CD6A 2JZ2A 3QO3A 1EIFA 4M7AA 3QUIA 1B34B 4C8QE 2K3YA 1X75C 3NFCA 2LRQA 2PVOB 2KY9A 4E7JA 2RI2A 2EQJA 1VQ8T 3CC4T 3RUXA 2MI6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QHS A;  4XTU A;  2DTO A;  1N9S A;  2DEQ A;  4PJO G;  1WQW A;  5GAN 2;  1TH7 A;  5GAO l;  3JCM W;  3JCM g;  1M5Q 1;  4M7D B;  2EJG A;  2Y90 A;  4C92 B;  2HNI A;  4Y91 A;  4M7A B;  5LJ5 e;  4N0A C;  3JCM c;  3JB9 J;  2ZGW A;  2YLB A;  5GAN h;  3JB9 D;  4M7D F;  4C92 F;  4M7D C;  3BFM A;  2VC8 A;  4JLI A;  1U1T A;  5GAN 8;  4C92 G;  5GMK h;  4M7A E;  4M7A F;  1WQ7 A;  4NL3 A;  1LJO A;  2DXU A;  5GAO p;  5GAN e;  2EWN A;  4QVD A;  5LJ3 j;  3INZ A;  4PJO E;  1WNL A;  2EJ9 A;  3JCM h;  4PJO D;  2DZ9 A;  3V8K A;  4XU1 A;  2RB6 A;  2RM4 A;  4M75 B;  4M78 F;  4XQ3 A;  4F7U E;  3JCM P;  2I2L A;  1X01 A;  4M78 C;  3JCM b;  4J6X A;  1I8F A;  3JCM e;  4J5Y A;  1BIB A;  3M4G A;  5GAM j;  4M75 F;  3SWN A;  2DVE A;  4M75 G;  3RKX A;  5GAN 3;  4A54 A;  3BW1 A;  5I21 A;  4J6W A;  3RES A;  1KQ2 A;  2DTI A;  3V8J A;  4F7U A;  4M77 A;  2DJZ A;  4C8Q A;  1KQ1 A;  4XTZ A;  1MGQ A;  5LJ3 g;  1H64 1;  5LJ3 f;  4XU0 A;  5LJ3 d;  4M7D G;  5GMK i;  1M8V A;  1I81 A;  2CGH A;  2DXT A;  2EJF A;  4M7A G;  4M78 B;  3BY7 A;  4X9D A;  5LJ5 j;  2JN0 A;  5GAM g;  5GAM f;  5GAM d;  4EMK A;  5GMK e;  3SWN C;  4M77 B;  5GMK m;  4M78 G;  4M7A D;  2E64 A;  1LOJ A;  5LJ3 h;  3QSU A;  2E65 A;  1LNX A;  4EMG A;  2E41 A;  4EMH A;  3FJP A;  5GAN j;  3JCM X;  3GIB A;  2RD1 A;  2QTX A;  3HFN A;  4M77 F;  4F7U F;  4M7D D;  4C92 E;  4M7D E;  4C92 D;  2YLC A;  1D3B A;  1B34 A;  1HXD A;  4M77 C;  4MML A;  3JCM V;  4C8Q F;  4C8Q C;  3JCM J;  1BIA A;  4XTY A;  1N9R A;  4WF2 A;  4XU3 A;  4PJO A;  4XTW A;  4DQ2 A;  5GAM h;  3V7R A;  4NL2 A;  2YHT A;  4M78 E;  5DY9 A;  4M78 D;  5GAM e;  1YCY A;  1JRI A;  4NOY A;  5LJ5 g;  4A53 A;  5LJ5 f;  5LJ5 d;  5GAO n;  5GMK l;  2FYK A;  3SWN B;  4EMK C;  4M75 E;  4C92 A;  3L1A A;  4M75 D;  3FIF A;  4PNO A;  5GAN 6;  3RIR A;  1D3B B;  2DZC A;  5GAN 7;  3JB9 F;  4JUV A;  2K57 A;  4JRK A;  3JB9 G;  2DTH A;  3EFR A;  4PJO B;  5GAN f;  5GAN d;  3BDU A;  2RA2 A;  4F7U B;  3AHU A;  4C8Q B;  4JRI A;  4PJO F;  1Y96 A;  1HK9 A;  4MMK A;  2FB7 A;  5LJ5 h;  4X9C A;  3JCM Q;  3HSB A;  3JB9 H;  4PJO C;  1WPY A;  1JBM A;  1I5L A;  3JCM f;  4M75 A;  1I4K 1;  3JCM d;  4F7U G;  5GAO q;  4M77 G;  3JB9 I;  5GMK j;  5GAO r;  3L2Z A;  5LJ3 e;  4C8Q G;  2VXE A;  2E1H A;  3V8L A;  2DKG A;  1U1S A;  3SB2 A;  4EMK B;  4C92 C;  5GAO m;  3RER A;  4M7A C;  4N0A A;  2E10 A;  5CAI A;  3RKW A;  4HA8 A;  1Y96 B;  3HFO A;  3FB9 A;  4RCB A;  5GAN 4;  4HT9 A;  4V2S A;  4M7D A;  2VXF A;  3RKY A;  3V7C A;  3QO3 A;  4M77 E;  4J6Y A;  3QUI A;  1B34 B;  4M77 D;  4XTV A;  4M7A A;  3V7S A;  4C8Q E;  4C8Q D;  4QVC A;  2EAY A;  4OP0 A;  4RCC A;  4XU2 A;  4HT8 A;  3PGG A;  3VU3 C;  5GAN g;  3EFS A;  3RUX A;  4M75 C;  5GAN 5;  4XTX A;  4M78 A; 
#chains in the Genus database with same CATH topology
 2DTO A;  2DEQ A;  2JNG A;  3G6E A;  2EJG A;  4AFQ C;  1C1A A;  5IN1 A;  2QA4 A;  5D6W A;  1Q81 U;  2KRO A;  2VC8 A;  2EVR A;  3CEY A;  1X69 A;  2F1L A;  1X2K A;  1C0M A;  2DZ9 A;  3V8K A;  2M0O A;  1UJY A;  2KSS A;  2X3W D;  3CCS A;  1J3T A;  1KIK A;  2CSQ A;  3SEM A;  1YJ9 A;  4RTW A;  4IUQ A;  2LMJ A;  2L8D A;  1CKA A;  3CCL T;  1M27 C;  1QWF A;  2K3B A;  3M56 A;  1VQK A;  3VUZ A;  7AT1 B;  4ZTJ A;  3ZL7 C;  2M1H A;  3SFM A;  4O6J A;  3C0C A;  2DXT A;  1RAC B;  4DBQ A;  1VQ5 T;  3MEV A;  1AOJ A;  2VWF A;  1HSQ A;  5FLX E;  5GMK e;  4HXJ A;  1AZE A;  2EQI A;  4OGC A;  2E64 A;  2X4J A;  1YIT Q;  1KQS A;  1LNX A;  3ZFJ A;  5GAN j;  5IHK A;  2J6F A;  4M77 F;  4C5H A;  2YLC A;  3A1P A;  3JCM J;  3X26 B;  3X20 B;  1G3S A;  1KG1 A;  3TRE A;  1UDL A;  4F14 A;  3RMS A;  2BIV A;  4OB1 B;  1BBZ A;  3G4S A;  3KBG A;  2YUN A;  5AT1 B;  2DYI A;  1D1B A;  2DZC A;  2JMA A;  2X4W A;  1ZUY A;  2GQV A;  4JUV A;  1WX6 A;  2RJC A;  3EGX B;  3HTR A;  3NGP A;  3H8Z A;  2KRN A;  3M0T A;  5CCA A;  3CME Q;  4QVZ A;  4PJO F;  4RTZ A;  3I55 Q;  1I5L A;  4M75 A;  2LT4 A;  1GXI E;  3R6N A;  5LJ3 e;  4OMP A;  4LDU A;  3VYG A;  1WI7 A;  3VS3 A;  4EMK B;  1JO8 A;  2OX7 A;  3LWH A;  2E10 A;  1KC8 U;  4LXC A;  4E47 A;  4V2S A;  2V8I A;  3M5A A;  2JM9 A;  1ZQ1 A;  3V7S A;  1S72 Q;  1ZUK A;  4J7F A;  4ATO A;  3VRZ A;  2R5A A;  1N9S A;  2ROT A;  2DAQ A;  4FCY A;  2EPD A;  1KHC A;  1UGS B;  5FRN A;  1QQJ A;  2GTO A;  2CZ7 B;  5CO7 A;  1NE8 A;  4C0D C;  3E9F A;  2FPE A;  2KT8 A;  3T9N A;  1Q7Y R;  2D0N A;  4F7U E;  1JQQ A;  3GPL A;  4K11 A;  1OYX A;  2QQS A;  3G71 T;  3DB3 A;  1VQ7 T;  1SKU B;  6AT1 B;  2K5I A;  4C8Q A;  2R5M A;  4JJN K;  3NTI A;  5GMK i;  3SD4 A;  4PJL A;  3GF5 A;  5IH2 A;  4KGZ B;  2V1Q A;  2K6D A;  2PU9 B;  4F16 A;  1GCQ C;  3R6O A;  5GMK m;  4CC7 A;  2J05 A;  4GLM A;  3NPF A;  2X3X D;  3C94 A;  4PFO A;  4PJM A;  1VQ9 T;  4BE1 A;  4E7K A;  2PVG B;  2MIO A;  3V7R A;  2QAZ A;  1OQK A;  3H0F A;  1O75 A;  2DL4 A;  2COY A;  1SPK A;  4M78 E;  2JT4 A;  3DLL A;  1YCY A;  2LNH B;  2O9V A;  2FYK A;  2YUQ A;  2B86 A;  5GAN 6;  2HKN A;  3JB9 F;  1VQP Q;  2JTE A;  3JSC A;  4HCK A;  2ZPI B;  5I22 A;  3JCM Q;  2E1H A;  3SB2 A;  1QCN A;  4II1 A;  3S3M A;  2EIF A;  2FPF A;  1WGS A;  2P0P A;  3RKW A;  5GAN 4;  2L2P A;  3CME A;  2L0A A;  1RAG B;  4M77 D;  3M4Y A;  4A4F A;  3I55 A;  4LUE A;  4OP0 A;  4RCC A;  5D6Y A;  3PGG A;  3HPW A;  2AZS A;  1YJN T;  4MZT A;  2LP5 A;  2X4X A;  2LC4 A;  3O8V A;  4M7D B;  3M0U A;  3OS1 A;  4LN2 A;  1IHV A;  1R0C B;  1VQN Q;  2DBK A;  2DIL A;  3L2R A;  4C92 F;  2XDD A;  4M7D C;  1S72 A;  3OYM A;  3EHR A;  4PJO D;  2DEU A;  3JCM P;  2OTL Q;  3KFV A;  1VYU A;  2KBT A;  4AMC A;  2B8A A;  5CQX A;  1W6X A;  3CCM T;  5IT9 E;  1IGU A;  2CUD A;  1KQ1 A;  2VV5 A;  4HCC A;  2O88 A;  1AVZ C;  3C4S A;  2KAF A;  3JRZ A;  3H0H A;  4BE2 A;  4PKC C;  2FZG B;  1D0X A;  2Y4Y A;  2FL7 A;  1IO6 A;  3QSU A;  1QKX A;  4QQD A;  1HYO A;  2KK4 A;  3UAT A;  3GIB A;  4J83 A;  3JCM V;  1YWP A;  4XU3 A;  1UB4 A;  3OY9 A;  4ESR A;  1BI2 A;  2VAS A;  3TEE A;  3CCV Q;  4AFU C;  3E9G A;  1FMK A;  5D7U A;  2XU8 A;  3OS2 A;  2EYX A;  4L59 A;  2NUP A;  3BDU A;  1Q82 C;  2Y4X A;  1TOV A;  3LGF A;  4QT7 A;  2C0T A;  4F7U G;  3MKD A;  2NUT B;  3L2Z A;  2KRM A;  3CCL A;  2XHC A;  3NHN A;  3PNW C;  1NLO C;  1BCM A;  1RI9 A;  2ZAE A;  1VQP A;  2DIQ A;  2M16 A;  5LL6 S;  2PUO B;  1BYM A;  3QWX X;  1SHF A;  4MDX A;  1Q81 C;  2K3X A;  1WHL A;  4BY6 C;  4M78 A;  1EZZ B;  2EQK A;  3A8H B;  1M5Q 1;  1QMC A;  2K4Y A;  4C5G A;  1W2B P;  1G3W A;  4BDY A;  3JB9 D;  3I56 Q;  5A0G A;  2CZ0 B;  2HQE A;  2CT4 A;  3OW2 S;  2DE0 X;  1VQM T;  3EG1 A;  1X01 A;  4IUT A;  1QCO A;  1M90 C;  3OBY A;  1ZLM A;  4CC2 A;  4B6M A;  4KUD K;  1W2B S;  1SSF A;  1VQN A;  2XDB A;  2EFI A;  1WHH A;  1WHK A;  3QDR B;  1V29 B;  4QQG A;  1F1B B;  2DA9 A;  4Z02 A;  2KT1 A;  2DO3 A;  1MNE A;  1NG2 A;  1OX9 A;  1T3S A;  3GP8 A;  4XTZ A;  1CKB A;  1MGQ A;  4GBQ A;  5LJ3 f;  4M7D G;  1RAI B;  2L3P A;  4RTU A;  1NPP A;  2OTL A;  2F2X A;  3EFO A;  5GAM d;  3VS4 A;  2EGE A;  2YRC A;  2EKH A;  4JJB A;  3J7A F;  1VQL Q;  2HBP A;  2IG0 A;  3S6W A;  4F04 B;  4C92 D;  2DYB A;  1D1A A;  2RI5 A;  4XTW A;  1H3Z A;  2MCN A;  1UEC A;  4LDY A;  1VQ4 T;  3CCJ Q;  2P0K A;  1M1G A;  1M3C A;  3CCR Q;  5LJ5 d;  1VYV A;  1V76 A;  2DRK A;  1OEB A;  4PNO A;  1IRE B;  2OI3 A;  5GAN 7;  2R58 A;  3MP6 A;  2DLP A;  2ZPF B;  1BK2 A;  2CYZ B;  1MND A;  3TQ7 P;  4KRT A;  3AHU A;  1HK9 A;  2G3R A;  4HCZ A;  1W2B A;  3OYH A;  2DXB A;  3CCV A;  1WXT A;  4FM4 B;  2DKG A;  5CK9 A;  1MMD A;  1BB9 A;  2XI9 A;  2M0Y A;  2BUD A;  4JJD A;  1OU9 A;  1FMV A;  1ZA2 B;  2HDA A;  3QYH B;  1WHJ A;  2JZ2 A;  3QUI A;  1B34 B;  1K9A A;  2QDL A;  2K3Y A;  3NFC A;  1SSH A;  1VQ8 T;  2XDP A;  1PRM C;  3L42 A;  4DEX A;  2MOX A;  4CC4 B;  4J9C A;  4FYV B;  4M7A B;  4Z8A A;  1SHG A;  2DMO A;  3JCM c;  2KXD A;  3A5Z B;  2KRS A;  5KCO A;  3G6E Q;  2MMP A;  3DLM A;  3CD6 T;  2PVD B;  2HEQ A;  5GAO p;  1WNL A;  1O9S A;  2HL3 A;  2RB6 A;  3X24 B;  3X25 B;  1AWJ A;  2LQ8 A;  3CC7 Q;  3ME9 A;  1NM7 A;  3SWN A;  3CCE T;  2ED1 A;  3BW1 A;  3I56 A;  1IRX A;  3RES A;  2O2O A;  2RJD A;  2DBM A;  1MHN A;  2MWP A;  4PK4 A;  2RQW A;  1YHQ Q;  1K76 A;  1OV3 A;  1JXM A;  3QZ5 B;  5J26 A;  5KYU A;  4FSS A;  3PMI A;  2E41 A;  3FC3 A;  2LQW A;  1UGQ B;  2P4T A;  1Y07 A;  1PD0 A;  4DQ2 A;  2L5Q A;  2O9S A;  4NL2 A;  5FRO A;  3CC2 T;  3BDL A;  3A8O B;  2HQH A;  3NMZ C;  4M75 E;  5CKB A;  4C92 A;  1G3Y A;  1VQL A;  2BZX A;  1UHF A;  2JW4 A;  2JS2 A;  3QJY A;  1PSE A;  1GL5 A;  1Y96 A;  1WPY A;  1JBM A;  1QLY A;  2BE9 B;  4WCI A;  3VS2 A;  3CCJ A;  5GAO r;  3CCR A;  1GFC A;  1VUB A;  2PQW A;  1YN8 A;  5FU7 C;  4KUI A;  1U1S A;  1Q86 R;  1K8A C;  5C0M A;  4BAC A;  4E6R A;  4FT2 A;  5D6X A;  2K5F A;  3VU3 C;  2QEX T;  3UWN A;  3EAE A;  3CMA T;  4M75 C;  4XTU A;  2ENM A;  2A08 A;  1KQS P;  4LUD A;  5I2S A;  2W10 A;  1TH7 A;  1EFN A;  1LVK A;  1K73 R;  3WVD B;  4HVV A;  2YRV A;  4JLI A;  2EBP A;  2DXU A;  3LW5 E;  3OYF A;  4FW2 A;  1K9M C;  4JS5 A;  2RM4 A;  4OMO A;  1JJ2 A;  3JCM b;  1KQS S;  3JCM e;  1RAD B;  5GAM j;  1RI0 A;  1XTD A;  1TUC A;  5I21 A;  1I07 A;  1UE9 A;  2DTI A;  4Y28 E;  3MEU A;  2DJZ A;  1GRI A;  2RHZ A;  4KH1 B;  2KQW A;  2MK5 A;  2DK3 A;  2V26 A;  4RG2 A;  3CC7 A;  4FYY B;  4M7A G;  4AFZ C;  4OMM A;  5FU6 C;  5LJ5 j;  2QYZ A;  9ATC B;  1B3Q A;  2YRD A;  3S3N A;  2JJ9 A;  2VYT A;  4HKE A;  2QDY B;  2VVK A;  4F7U F;  3CXC P;  3M55 A;  3CCU Q;  1YHQ A;  4C8Q C;  4WF2 A;  2XMF A;  2DL7 A;  2JXB A;  2ZPE B;  5GAM e;  4MZM A;  1WJS A;  2F2V A;  5HK0 A;  4E7L A;  3OYY A;  1XOV A;  3EFR A;  3VV0 A;  4UC4 A;  4JZ4 A;  3QXE B;  4HVW A;  1PM3 A;  3OA6 A;  4ZGD B;  1BI1 A;  2HCK A;  3P8B B;  4EPC A;  3ZBD A;  4O5V A;  4RG8 A;  1OZ3 A;  3FEO A;  3QII A;  5FRM A;  2QI2 A;  1KJW A;  3OSV A;  2NUZ A;  2W0Z A;  4QKU A;  2VXF A;  4ZGJ B;  3A8G B;  1SF9 A;  3GNG A;  4HT8 A;  2F69 A;  2F5T X;  2IVW A;  3MHX A;  1DJ7 B;  1G8X A;  3MO8 A;  4JLG A;  2JMC A;  4XTX A;  1XJW B;  4FT4 A;  2OAW A;  3H6Z A;  1UJ0 A;  1WQW A;  3M0S A;  4L6V 5;  2HNI A;  4LD6 A;  2V8J A;  2LT1 A;  2C06 A;  4M7D F;  3OYC A;  3FJ5 A;  2GCX A;  5GAN e;  2EWN A;  2H3E B;  3JCM h;  1BI3 A;  3AT1 B;  5CVI A;  2P84 A;  3KXT A;  3OYK A;  5HCK A;  3WXM B;  1NBE B;  1YNZ A;  4GY5 A;  3CXC A;  4M75 G;  2OTJ Q;  1AWO A;  3EG9 B;  4PFZ A;  1M1K C;  4N4I A;  5CKD A;  2HBW A;  2JUF A;  1QCF A;  3QYG B;  4C0D B;  4AG1 C;  3A98 A;  1M2V A;  8ATC B;  5KH6 A;  1H64 1;  2KE9 A;  1M8V A;  3JAM E;  1G5V A;  4DBF A;  5EC7 A;  2JN0 A;  2K2V A;  3MJX A;  1YJW Q;  1EX4 A;  1Q7Y C;  3L2W A;  1VQ6 Q;  3NTK A;  3ASK A;  1GBQ A;  2ED0 A;  1VQO Q;  2GGR A;  4CC3 A;  4J9G A;  1ZA1 B;  1T0H A;  5GAM h;  2P4R A;  3PVQ A;  4R55 A;  3NTH A;  1K1Z A;  2NWM A;  5GMK l;  1QVG P;  1RLQ C;  5KYY B;  2DER A;  1AWW A;  2JS0 A;  3CBO A;  3CCU A;  4F7U B;  2FRY A;  4M4Z A;  2QTV A;  4FU6 A;  3PTA A;  5LJ5 h;  1OZ2 A;  1UGV A;  1HJD A;  2RQT A;  1WJR A;  5J39 A;  3E19 A;  1QWE A;  4C8Q G;  4F17 A;  2VXE A;  4FYW B;  1KD1 R;  1OI1 A;  1MV0 B;  2A0F B;  2R57 A;  5GAO m;  3CCL Q;  4HT9 A;  1B07 A;  3RKY A;  4PFP A;  4M77 E;  2V1R A;  2KGT A;  2M51 A;  3GNF B;  4XU2 A;  3THK A;  5CKF A;  5KYX A;  1MV3 A;  2D8J A;  4DBH A;  2LTO A;  4RTX A;  4CI0 C;  3I5R A;  1SRL A;  3JV3 A;  3BE3 A;  1VQ5 Q;  3HRU A;  1SRM A;  4A4H A;  2Y90 A;  3UPU A;  1TUG B;  2A7Y A;  2GNC A;  3JB9 J;  5GAN h;  1D0Z A;  5IXF A;  5HY6 A;  3LLR A;  4BD3 A;  5J3B A;  2RHY A;  4FYX B;  4QVD A;  4PJO E;  2DPP B;  3INZ A;  2KNB B;  4M78 C;  2WSE E;  3PIP A;  5GAN 3;  1NPR A;  5A0D A;  2DJQ A;  3PFS A;  4OGE A;  5DLQ E;  3M9Q A;  1Q86 U;  1CSK A;  1RAA B;  2EGA A;  1OX8 A;  5I2M A;  1YI2 T;  1PKT A;  1QKW A;  4J9H A;  1YIJ T;  1QVG A;  1NJI C;  2Z0W A;  1M8M A;  3H9N A;  1KFZ A;  2OTJ A;  2LX7 A;  4EMK A;  2JOY A;  4WTO B;  3QJ6 A;  1QP3 A;  4EMG A;  4ELY C;  3OYL A;  4M7D D;  3I9Q A;  1K73 U;  2CP6 A;  1N9R A;  2IPO B;  1RAH B;  4X1V A;  3EFO B;  4JS4 A;  1NLP C;  1ZSZ A;  2FO0 A;  1YJW A;  1VQ6 A;  4PL6 A;  1N8R U;  5GAN 5;  2HD0 A;  4QQ6 A;  2DL5 A;  1VQO A;  1S1N A;  2DTH A;  1JEG A;  2KVQ G;  3HP9 A;  4JRI A;  1PRL C;  2KYB A;  4XK8 E;  3JCM f;  1Q95 G;  1X2Q A;  3JB9 I;  3PIO A;  1ZUU A;  3CCQ T;  1N27 A;  4N0A A;  2VUB A;  2WSF E;  4RCB A;  1M1F A;  1VQ7 Q;  3PMT A;  1ZBJ A;  2PVO B;  2RI2 A;  5L23 A;  3CC4 T;  3RUX A;  2DNU A;  3O5Z A;  2X9H A;  3FDR A;  3JCM g;  3M0P A;  4A63 B;  4PJJ A;  4RUG A;  4M7A F;  5GAN 8;  3M54 A;  3GOX A;  2O4X B;  2AZV A;  1VQ9 Q;  4RMO A;  2EJ9 A;  1TXQ A;  2K2M A;  2MAM A;  4BY6 B;  4OB3 B;  1VQ5 A;  4PJN A;  1WHG A;  1RLP C;  2CH4 W;  4J5Y A;  4J9E A;  4L5G A;  1YFN A;  2QK0 A;  1OOT A;  1D09 B;  2QA4 T;  2AK5 A;  1OPK A;  1WJQ A;  4M77 A;  3M57 A;  1NYF A;  3GBQ A;  1PSF A;  1WFW A;  3BY7 A;  2P0Q A;  3CCS T;  5GAM g;  3SWN C;  2LCL A;  4M78 G;  1YJ9 T;  1LOJ A;  3EHQ A;  5I11 A;  1JB0 E;  4EMH A;  4C92 E;  3OQ5 A;  2JVV A;  2MWO A;  2GQI A;  4PJO A;  1VQK T;  2QQA A;  2RNA A;  3LYI A;  2X51 A;  2YHT A;  2LNV A;  3RR6 A;  4OMQ A;  4A4G A;  1E6G A;  1FMW A;  5GAO n;  5LJ5 g;  2IIM A;  2HSP A;  1M90 R;  3FRN A;  2DL3 A;  4KT0 E;  2D8H A;  1Z9Q A;  5C6S A;  2GFA A;  4MDW A;  2JTF A;  1M2O A;  2RH2 A;  2KYM A;  3EGD A;  5GAN f;  3OYD A;  3VS7 A;  2KEA A;  3LH0 A;  1VIF A;  3WVE B;  1QW1 A;  2SRC A;  1N6A A;  2F2W A;  3G4S T;  3M0R A;  4C92 C;  1Y57 A;  2CP7 A;  3OS5 A;  1IHW A;  1Y96 B;  2QXF A;  2XG8 D;  3CCM Q;  5KCH A;  2O01 E;  3VS1 A;  5GAN g;  1KC8 C;  1D0Y A;  5HK3 A;  1R0B G;  2ATC B;  5FWC A;  4JDS A;  2QAS A;  2LX9 A;  3MEA A;  3G71 A;  2DX1 A;  1MMN A;  1I1J A;  5DM7 R;  4LE9 A;  1X27 A;  1FXX A;  1VQ7 A;  2ECZ A;  4IIO A;  2XKO C;  1VOM A;  2DVJ A;  2DXC A;  2RN8 A;  1E7O A;  1I0C A;  1TU0 B;  3VRY A;  1BIB A;  2COZ A;  1RAB B;  3OBW A;  1KD1 U;  2LVM A;  4A54 A;  1U8R A;  2GBQ A;  1E6H A;  1KSW A;  1VQ9 A;  1VYT A;  3CPW P;  5HKC A;  3UT1 A;  5LJ3 d;  4XU0 A;  2NUT A;  3QWY A;  4HCB A;  3J81 E;  1HXD A;  4C8Q F;  4ZNX A;  2FVU A;  4M7A D;  3CPW S;  2H8H A;  2XID A;  2LJ3 A;  2GTJ A;  5DY9 A;  1Y7X A;  3ER0 A;  4A53 A;  2RI3 A;  1TWB A;  1PD1 A;  2K57 A;  3JB9 G;  1JJ2 P;  2PZ1 A;  2XK0 A;  2ZZD A;  3OB9 A;  1YJN A;  3LH5 A;  5GAO q;  2A36 A;  1VQM Q;  2RHI A;  2J06 A;  4BB7 A;  1A0N B;  4DOV A;  1AT1 B;  1UG1 A;  2LQN A;  2E6Z A;  3RER A;  1C6V X;  1YBY A;  1YIT T;  1PWT A;  4BE0 A;  2RK2 A;  2CSI A;  4LDX A;  4XTV A;  1JJ2 S;  4IKF A;  3H0I A;  1AEY A;  3CBM A;  3EFS A;  5CKH A;  4P5N A;  1AWX A;  2HZY A;  2RHX A;  1W70 A;  5FU7 B;  1U5S A;  4B9X A;  3OYN A;  2OAU A;  3CPW A;  3CCM A;  2QQ9 A;  1H3H A;  4PLL A;  4C92 G;  3CME T;  3L2Q A;  1K0X A;  3I55 T;  1K0S A;  4M75 B;  3HL8 A;  4J6X A;  3QKJ A;  1WDX A;  2RO0 A;  4LD9 K;  4RKU E;  2RK1 A;  4FSX A;  1AD5 A;  1IXD A;  3V8J A;  4X34 A;  1M30 A;  1IGQ A;  1JU5 C;  3X28 B;  1S72 T;  2ZPG B;  2C0O A;  2EQU A;  2EW3 A;  2YUO A;  1K73 C;  2DRM A;  3Q1J A;  1T3L A;  1UFF A;  2EYW A;  2DD5 A;  1UGR B;  4E7H A;  2FHD A;  1N8R R;  1PG5 B;  3D7S B;  1BU1 A;  1V1C A;  2EYZ A;  4Z89 A;  3CC4 A;  2V8K A;  3C12 A;  1QVF A;  4MML A;  1B34 A;  2AKL A;  5IAY A;  4ZN3 A;  4RTT A;  3ZEH A;  2CZ1 B;  5EG2 A;  1Q82 U;  4KBM B;  5FU6 B;  4NOY A;  3REB B;  1OUL A;  4AT1 B;  1MUZ A;  2HAX A;  2MF2 A;  1Y71 A;  3TVT A;  3CD6 Q;  4C8Q B;  1UTI A;  2HL5 C;  3RNJ A;  1TUD A;  1R8O B;  5GMK j;  4R0K A;  2BKD N;  4OB2 B;  3MET A;  4RTV A;  5CAI A;  4R56 A;  3CCE Q;  1W1F A;  5KYW A;  4LDV A;  2HQX A;  2PTK A;  4C8Q D;  4DEY A;  1VQM A;  1GBR A;  3CXC S;  2DFU A;  2MYS A;  3OYI A;  2E12 A;  5GAN 2;  4PLI A;  2DF6 A;  2GF7 A;  5LJ5 e;  1M90 U;  2YLB A;  1VQP T;  5KYX B;  1D1C A;  3TSW A;  1GCP A;  3UF4 A;  5LJ3 j;  2DET A;  2I0N A;  1RAF B;  3LGL A;  3OMC A;  4M78 F;  2I2L A;  3CC2 Q;  3M4G A;  3EH2 A;  1M3B A;  2K9G A;  3RKX A;  1UHC A;  5GJW B;  5CQY A;  3VUB A;  3VKI A;  2EYY A;  4J6W A;  5KE2 A;  2EQM A;  2RQU A;  1I5O B;  1P92 A;  4OF1 A;  1WXU A;  3RMQ A;  2CP5 A;  2CUB A;  2E70 A;  1VQ4 A;  2EJF A;  1FYN A;  5IHN A;  1JXO A;  1NZ9 A;  1VQN T;  3JCM X;  2RD1 A;  2NYS A;  1X6G A;  1D3B A;  1WYX A;  2RHU A;  3DB4 A;  3P8H A;  4XTY A;  2X4Y A;  2QEX Q;  3CMA Q;  1LCK A;  2OTL T;  3MCA B;  2E3I A;  4EMK C;  1WHM A;  3L1A A;  2KMT A;  2HSE B;  2O31 A;  3SDZ A;  2A3L A;  1ZSZ B;  1M1K R;  4ORZ A;  1VQ8 A;  4MZP A;  2WAC A;  2E6N A;  2M02 A;  2LCS A;  1ZSZ C;  1RUW A;  2DD4 A;  4CRI A;  2L3Q A;  1XQH A;  3G7Z A;  1IZ6 A;  1WLP B;  4HA8 A;  3HFO A;  3P8D A;  3UA6 A;  3LWI A;  2D9T A;  3CD6 A;  1NEG A;  3QO3 A;  1EIF A;  1X75 C;  2YXY A;  4E7J A;  4E7S A;  4IIM A;  2MI6 A;  2ZPB B;  2DL8 A;  3HHT B;  2RQV A;  2YSQ A;  5GAO l;  3CCV T;  3OS0 A;  4RTY A;  3CCE A;  1T0J A;  4N0A C;  4DA4 A;  1LPL A;  1SG5 A;  2BZ8 A;  2ZGW A;  1KD1 C;  2CH4 A;  1BCO A;  1ZBX A;  4OB0 B;  2NUP B;  3VS0 A;  5GMK h;  2RQR A;  1QVG S;  3QZ9 B;  5M9O A;  4XU1 A;  3E1S A;  4D8D A;  1ZX6 A;  4QW2 A;  2AHJ B;  3CPF A;  1X6O A;  2DVE A;  3UDC A;  4AFS C;  2PNI A;  4C5I A;  1YCS B;  4ZN1 A;  2HKQ B;  1M4Z A;  3HRT A;  3F70 A;  2CZ6 B;  4AG2 C;  2CGH A;  3CC2 A;  4M78 B;  1X6B A;  1YIT A;  5GJV B;  2XIC A;  2K7A A;  2D0Q B;  2LJ1 A;  4M77 B;  4J8O A;  4N4H A;  5CKE A;  2A28 A;  5LJ3 h;  2E65 A;  2LQK A;  3I56 T;  4M7D E;  4J9D A;  2M9U A;  4KUL A;  4M77 C;  2K5L A;  3EGX A;  1UEB A;  1ZSG A;  2ABL A;  4M78 D;  1ARK A;  2A37 A;  4BI3 A;  2COW A;  2D6F A;  1R77 A;  2RMO A;  2OJ2 A;  4PJO B;  1Y0M A;  1B7T A;  3U23 A;  2RA2 A;  2SEM A;  1NEB A;  1FX7 A;  2QEX A;  4PJO C;  4D8K A;  3CMA A;  4A4E A;  1K8A U;  1PKS A;  3VYH B;  4D6W A;  2VGM A;  1WIE A;  5KYN A;  2BTT A;  1AHJ B;  3EGD B;  5L8R E;  1NJI R;  1VQL T;  2CRE A;  4J7I A;  1NYG A;  3EG9 A;  2QQB A;  3FB9 A;  5A0L A;  3QG1 A;  2BE7 D;  1WXB A;  2VGN A;  1ABO A;  4KGV B;  1H8K A;  3HKS A;  3CCJ T;  2CS7 A;  3CCR T;  1AZG B;  1G3T A;  4DOW A;  2LDM A;  4Y91 A;  1K9M U;  4ZGE B;  5AYF A;  4YTL A;  4Q5W A;  2QQR A;  3EG0 A;  3BFM A;  1ABQ A;  2EGC A;  2L3S A;  3G71 Q;  4C5E A;  1LJO A;  3RDV A;  4JRP A;  4E7I A;  3L2V A;  2K79 A;  5ECA A;  4FW1 A;  4XQ3 A;  2ROL A;  4ME7 A;  4ANJ A;  1GCQ A;  1UGP B;  4HVU A;  5IXB A;  5KYY A;  1KQ2 A;  4F7U A;  1ACM B;  2AT1 B;  5A2Q E;  3QPH A;  2D1X A;  2FZC B;  1OPL A;  1I81 A;  4KH0 B;  4LDW A;  3HRS A;  1M3A A;  1Q82 R;  4VUB A;  5GAM f;  3REA B;  4OVA A;  2KXC A;  3PVL A;  4J9B A;  3MP1 A;  3ULR B;  2QTX A;  1WZO A;  2ZCF B;  3HFN A;  3G6E T;  2E5Q A;  1M9S A;  1HD3 A;  3VS6 A;  2G6F X;  2C0I A;  3CC7 T;  1U06 A;  3EG2 A;  1JRI A;  5LJ5 f;  3H41 A;  1Z9Z A;  3SWN B;  1Q81 R;  2YWW A;  3I35 A;  4OML A;  3OYB A;  2YUP A;  3OW2 P;  3IQL A;  2CKK A;  2H3J A;  4BUG A;  4MMK A;  1YHQ T;  3JB9 H;  4X9C A;  3HSB A;  3URG A;  1K4U S;  3JCM d;  1VA7 A;  4M77 G;  5KYU B;  4LNP A;  3OMG A;  2FRW A;  1YJN Q;  2J7I A;  2LCC A;  3GLX A;  2RPN A;  1IB8 A;  2QG9 B;  3I5S A;  1PHT A;  4M7D A;  1TSF A;  3M53 A;  4KGX B;  3MEW A;  2CT3 A;  3EGU A;  4QVC A;  4DBR A;  2EAY A;  1WA7 A;  3A8M B;  1YI2 Q;  3QHS A;  2L3R A;  2XD0 A;  3M59 A;  3N5B B;  3A8L B;  1G2B A;  3FLG A;  1YIJ Q;  4BI4 A;  4PJO G;  2J6O A;  4C92 B;  3OYG A;  4OMF B;  1U3O A;  3S3O A;  1ZHI A;  8AT1 B;  1WQ7 A;  4NL3 A;  2EKO A;  5IHI A;  1PCX A;  4JJC A;  2JM8 A;  5CIU A;  3OYA A;  4E2F B;  1M1K U;  1XNI A;  4A4K A;  2ZPH B;  4M75 F;  3J80 E;  3RBB B;  1X43 A;  3TCJ A;  1Q7Y U;  5LJ3 g;  1RAE B;  2E5K A;  4EDU A;  1H92 A;  1KC8 R;  3OW2 A;  1KK7 A;  3CCQ Q;  2KI7 A;  2ESW A;  2X35 A;  2RJE A;  1TS9 A;  1MMA A;  2FEI A;  4BDZ A;  4M7A E;  3EG3 A;  1BIA A;  1N5Z A;  2VKN A;  3UA7 A;  2HMA A;  3CC4 Q;  2FG0 A;  3EH1 A;  3RIR A;  3M58 A;  3PE0 A;  3TU4 K;  4JRK A;  2KDS A;  3QDF A;  2QGG A;  5GAN d;  4JPB W;  2O4X A;  2GFU A;  3QBY A;  3MPU B;  1KHI A;  1I4K 1;  1TTH B;  4C0F A;  3V8L A;  2AIR B;  4BI8 B;  3KUF A;  4M7A C;  1SEM A;  2QA4 Q;  2MPX C;  1BKB A;  1RL2 A;  3V7C A;  4J6Y A;  4Z88 A;  3CCU T;  5DLO A;  4JRQ A;  2E3H A;  4TVR A;  1W4S A;  2RF0 A;  3G1J A;  3LX7 A;  2DM1 A;  3CBP A;  3C95 A;  2CP2 A;  1G83 A;  2E4H A;  2VB6 A;  3CCS Q;  3JCM W;  5KYW B;  1QVF P;  3CQT A;  1YJ9 Q;  2EYQ A;  1U1T A;  1TG0 A;  2BZY A;  1VQK Q;  1YI2 A;  3PT9 A;  1YIJ A;  2F5K A;  1I8F A;  2J6K A;  3E2U A;  5FW9 A;  2YT6 A;  1QVF S;  4FL6 A;  4JZ3 A;  4C0Z A;  3VJP A;  1NJI U;  4GLK A;  4IUU A;  4N4G A;  5CR2 A;  3VS5 A;  4IUP A;  4C0G A;  4J9I A;  4ELZ C;  1PNJ A;  4X9D A;  3G4S Q;  1BI0 A;  1Q86 C;  2QGF B;  1VQ4 Q;  3FJP A;  4XAX B;  1GFD A;  4B9W A;  2LZ6 B;  1VIE A;  2CP0 A;  1PC0 A;  2FZK B;  1K8A R;  2CDT A;  4OMN A;  2PUK B;  3CCQ A;  2L89 A;  2YDL A;  4IUV A;  3DKM A;  1YWO A;  4NS5 A;  2OTJ T;  4M75 D;  1OU8 A;  3FIF A;  5FWB A;  1D3B B;  4Y92 A;  2DIG A;  1UUE A;  3OYJ A;  5KE3 A;  2NLU A;  1MMG A;  4EIK A;  2FPD A;  3MP8 A;  3L2U A;  4J9F A;  4IUR A;  2CP3 A;  1M2V B;  2FB7 A;  4E7Z A;  3OYE A;  1N8R C;  4ZTF A;  2JTM A;  3SHW A;  1QP2 A;  1QVP A;  3OSS C;  4FIB A;  2WSC E;  2RJF A;  1FWZ A;  1YJW T;  1VQ8 Q;  3M0Q A;  1YP5 A;  1VQ6 T;  1K9M R;  1VQO T;  2LJ0 A;  3TSZ A;  4M7A A;  4C8Q E;  2AKK A;  2LRQ A;  2KY9 A;  2EQJ A;  2KR3 A; 
#chains in the Genus database with same CATH homology
 2ZPB B;  2DTO A;  2XDP A;  3L42 A;  2DEQ A;  2JNG A;  3FDR A;  3HHT B;  3G6E A;  5GAO l;  3CCV T;  3JCM g;  2EJG A;  3OS0 A;  3CCE A;  4M7A B;  4N0A C;  5IN1 A;  3JCM c;  2QA4 A;  5D6W A;  4DA4 A;  2ZGW A;  1Q81 U;  1KD1 C;  1ZBX A;  2VC8 A;  4OB0 B;  3A5Z B;  5KCO A;  5GMK h;  5GAN 8;  4M7A F;  2MMP A;  3CEY A;  3DLM A;  2PVD B;  3CD6 T;  3M54 A;  3GOX A;  2O4X B;  5GAO p;  1QVG S;  4RMO A;  3QZ9 B;  1WNL A;  2EJ9 A;  2DZ9 A;  3V8K A;  2MAM A;  4XU1 A;  1O9S A;  2M0O A;  2RB6 A;  3E1S A;  3X24 B;  4BY6 B;  5M9O A;  2KSS A;  3X25 B;  2LQ8 A;  4OB3 B;  1VQ5 A;  3ME9 A;  3CCS A;  4J5Y A;  4QW2 A;  2AHJ B;  3CPF A;  4L5G A;  1X6O A;  3SWN A;  2DVE A;  1YJ9 A;  3UDC A;  4IUQ A;  2L8D A;  3CCE T;  3BW1 A;  3I56 A;  3CCL T;  2QA4 T;  2XD0 A;  4C5I A;  3RES A;  2RJD A;  1WJQ A;  1MHN A;  4M77 A;  3M57 A;  4ZN1 A;  3M56 A;  1M4Z A;  2MWP A;  1VQK A;  3VUZ A;  3HRT A;  3F70 A;  4ZTJ A;  2CZ6 B;  2M1H A;  3SFM A;  4O6J A;  1PSF A;  2CGH A;  2DXT A;  3QZ5 B;  5J26 A;  4M78 B;  1YIT A;  3CC2 A;  3BY7 A;  2P0Q A;  2XIC A;  1VQ5 T;  3MEV A;  3CCS T;  5GAM g;  5FLX E;  1KQS A;  5GMK e;  2D0Q B;  3SWN C;  4M77 B;  4J8O A;  4N4H A;  2LCL A;  4M78 G;  5CKE A;  1YJ9 T;  1LOJ A;  2E64 A;  2X4J A;  4OGC A;  2E65 A;  1LNX A;  3PMI A;  1JB0 E;  2E41 A;  2LQK A;  5LJ3 h;  3ZFJ A;  4EMH A;  3I56 T;  5GAN j;  4M7D E;  4M77 F;  3FC3 A;  4C92 E;  2M9U A;  3OQ5 A;  2JVV A;  2MWO A;  2YLC A;  4KUL A;  4M77 C;  4C5H A;  3JCM J;  3X26 B;  3X20 B;  1UGQ B;  2P4T A;  4PJO A;  1Y07 A;  2K5L A;  1VQK T;  4DQ2 A;  1G3S A;  1KG1 A;  2L5Q A;  2QQA A;  3LYI A;  3TRE A;  1UEB A;  4NL2 A;  3RMS A;  2BIV A;  2YHT A;  2LNV A;  4OB1 B;  5FRO A;  4A4G A;  3G4S A;  3KBG A;  4M78 D;  3CC2 T;  3BDL A;  4BI3 A;  5LJ5 g;  3A8O B;  5GAO n;  3FRN A;  4M75 E;  5CKB A;  4C92 A;  1G3Y A;  1VQL A;  4KT0 E;  2D6F A;  2DZC A;  2X4W A;  5C6S A;  2GFA A;  2GQV A;  4JUV A;  4MDW A;  4PJO B;  2RJC A;  2JTF A;  2RH2 A;  5GAN f;  3QJY A;  2RA2 A;  3H8Z A;  3OYD A;  1PSE A;  1BYM A;  5CCA A;  3LH0 A;  4QVZ A;  1FX7 A;  4PJO F;  1VIF A;  1Y96 A;  2QEX A;  4PJO C;  3CMA A;  3WVE B;  1WPY A;  1JBM A;  4A4E A;  1QW1 A;  1K8A U;  3VYH B;  1I5L A;  4M75 A;  1N6A A;  4D6W A;  3CCJ A;  2LT4 A;  5GAO r;  1GXI E;  3CCR A;  5LJ3 e;  1VUB A;  2VGM A;  4LDU A;  3G4S T;  2PQW A;  3VYG A;  5FU7 C;  4KUI A;  1AHJ B;  1U1S A;  4EMK B;  5L8R E;  4C92 C;  3LWH A;  3OS5 A;  2E10 A;  1VQL T;  1KC8 U;  4J7I A;  1K8A C;  1Y96 B;  2QQB A;  3FB9 A;  2QXF A;  4E47 A;  2V8I A;  4V2S A;  3M5A A;  2XG8 D;  5C0M A;  4BAC A;  5A0L A;  3QG1 A;  1ZQ1 A;  4FT2 A;  5KCH A;  2O01 E;  5D6X A;  3V7S A;  2K5F A;  3VU3 C;  2QEX T;  4J7F A;  2VGN A;  3EAE A;  3UWN A;  5GAN g;  3CMA T;  4ATO A;  4M75 C;  1KC8 C;  2R5A A;  3HKS A;  4XTU A;  5HK3 A;  3CCJ T;  1N9S A;  2CS7 A;  3CCR T;  5I2S A;  2DAQ A;  1TH7 A;  1G3T A;  4JDS A;  2LX9 A;  3MEA A;  3G71 A;  4DOW A;  1KHC A;  2LDM A;  4Y91 A;  4ZGE B;  5DM7 R;  1K9M U;  1FXX A;  5AYF A;  1VQ7 A;  1UGS B;  4YTL A;  4Q5W A;  2QQR A;  5FRN A;  3WVD B;  2YRV A;  3BFM A;  4JLI A;  2XKO C;  2CZ7 B;  5CO7 A;  1NE8 A;  4C0D C;  3E9F A;  4C5E A;  1LJO A;  2DXC A;  2DXU A;  3LW5 E;  4JRP A;  4E7I A;  3T9N A;  3L2V A;  3OYF A;  1K9M C;  4JS5 A;  2RM4 A;  4F7U E;  4XQ3 A;  1JJ2 A;  3JCM b;  4ME7 A;  1KQS S;  3JCM e;  3GPL A;  1BIB A;  5GAM j;  1OYX A;  1RI0 A;  2QQS A;  3OBW A;  1XTD A;  1UGP B;  1KD1 U;  2LVM A;  3G71 T;  4A54 A;  1U8R A;  3DB3 A;  5I21 A;  1VQ7 T;  1KQ2 A;  2DTI A;  4Y28 E;  4F7U A;  3MEU A;  1VQ9 A;  2DJZ A;  2K5I A;  4C8Q A;  3QPH A;  5A2Q E;  2RHZ A;  5HKC A;  2R5M A;  2KQW A;  3UT1 A;  4JJN K;  3NTI A;  5LJ3 d;  2DK3 A;  4XU0 A;  5GMK i;  4RG2 A;  3CC7 A;  1I81 A;  3SD4 A;  4M7A G;  3GF5 A;  4LDW A;  3HRS A;  5FU6 C;  5LJ5 j;  2PU9 B;  4VUB A;  5GAM f;  3S3N A;  3R6O A;  4OVA A;  5GMK m;  2VYT A;  4HKE A;  2QDY B;  3MP1 A;  2QTX A;  2ZCF B;  3HFN A;  3C94 A;  4F7U F;  3G6E T;  2E5Q A;  4HCB A;  3J81 E;  1HXD A;  3M55 A;  4C8Q F;  2FVU A;  1M9S A;  1YHQ A;  4C8Q C;  3CPW S;  1VQ9 T;  4M7A D;  4BE1 A;  4WF2 A;  4E7K A;  2PVG B;  3V7R A;  2XID A;  1O75 A;  1NJI U;  2ZPE B;  3CC7 T;  4M78 E;  5DY9 A;  5GAM e;  3DLL A;  1YCY A;  1Y7X A;  1JRI A;  4MZM A;  3ER0 A;  4A53 A;  5LJ5 f;  1WJS A;  2RI3 A;  2FYK A;  3SWN B;  4HT8 A;  5HK0 A;  5GAN 6;  3JB9 F;  4E7L A;  3OYY A;  2K57 A;  1XOV A;  3OYB A;  3JB9 G;  3EFR A;  3VV0 A;  4UC4 A;  3JSC A;  3QXE B;  2ZPI B;  2CKK A;  2H3J A;  4BUG A;  2XK0 A;  4MMK A;  3JCM Q;  2ZZD A;  1YHQ T;  3JB9 H;  4X9C A;  3OB9 A;  1YJN A;  3URG A;  3OA6 A;  3HSB A;  3JCM d;  4ZGD B;  1BI1 A;  5GAO q;  4M77 G;  4EPC A;  3P8B B;  2RHI A;  3ZBD A;  4O5V A;  2E1H A;  4RG8 A;  4BB7 A;  1OZ3 A;  3FEO A;  3QII A;  3OMG A;  4DOV A;  5FRM A;  3SB2 A;  2QI2 A;  3OSV A;  4II1 A;  2E6Z A;  3S3M A;  3RER A;  2EIF A;  2LCC A;  3GLX A;  1YBY A;  1WGS A;  2P0P A;  3RKW A;  1YIT T;  5GAN 4;  4BE0 A;  2VXF A;  4ZGJ B;  2RK2 A;  3A8G B;  3CME A;  4M7D A;  4LDX A;  3M53 A;  4XTV A;  3MEW A;  4M77 D;  1JJ2 S;  3M4Y A;  4IKF A;  3GNG A;  4A4F A;  3I55 A;  4QVC A;  2EAY A;  2F69 A;  2F5T X;  2IVW A;  3CBM A;  3MHX A;  3PGG A;  4OP0 A;  1DJ7 B;  3HPW A;  4RCC A;  5D6Y A;  3EFS A;  3MO8 A;  1YJN T;  4JLG A;  4MZT A;  5CKH A;  3A8M B;  4XTX A;  3QHS A;  2L3R A;  4FT4 A;  3M59 A;  3N5B B;  3A8L B;  2X4X A;  3FLG A;  4P5N A;  2RHX A;  4BI4 A;  4PJO G;  3H6Z A;  1WQW A;  2LC4 A;  4L6V 5;  5FU7 B;  3O8V A;  4B9X A;  4M7D B;  4C92 B;  3OYG A;  4OMF B;  2HNI A;  4LD6 A;  2V8J A;  2LT1 A;  3OS1 A;  3OYN A;  2OAU A;  3CPW A;  3S3O A;  2C06 A;  3CCM A;  4M7D F;  1ZHI A;  3L2R A;  3OYC A;  2QQ9 A;  4C92 F;  2XDD A;  4M7D C;  4PLL A;  4C92 G;  1S72 A;  3OYM A;  1WQ7 A;  4NL3 A;  3CME T;  2GCX A;  2EKO A;  5GAN e;  2EWN A;  3L2Q A;  4PJO D;  3I55 T;  3JCM h;  1BI3 A;  5CIU A;  4M75 B;  3OYA A;  1M1K U;  3HL8 A;  5CVI A;  3KXT A;  3JCM P;  1XNI A;  4A4K A;  3OYK A;  4J6X A;  3QKJ A;  2ZPH B;  3WXM B;  4M75 F;  3J80 E;  4GY5 A;  3CXC A;  2RO0 A;  4M75 G;  4LD9 K;  4RKU E;  2RK1 A;  2B8A A;  4FSX A;  1M1K C;  5CQX A;  5IT9 E;  3CCM T;  4N4I A;  3V8J A;  4X34 A;  5CKD A;  2JUF A;  3TCJ A;  3QYG B;  4C0D B;  3X28 B;  1S72 T;  1KQ1 A;  2ZPG B;  1Q7Y U;  5KH6 A;  2EQU A;  1H64 1;  2VV5 A;  5LJ3 g;  4HCC A;  4EDU A;  1K73 C;  5KE2 A;  1M8V A;  3C4S A;  3Q1J A;  2KAF A;  3JAM E;  1G5V A;  3JRZ A;  2DD5 A;  1UGR B;  2JN0 A;  2K2V A;  4PKC C;  4BE2 A;  3OW2 A;  4E7H A;  2FHD A;  2FL7 A;  2Y4Y A;  1Q7Y C;  3L2W A;  2X35 A;  3NTK A;  2RJE A;  3QSU A;  3ASK A;  4QQD A;  3CC4 A;  2KK4 A;  3GIB A;  2V8K A;  3C12 A;  1QVF A;  4J83 A;  4BDZ A;  4MML A;  1B34 A;  3JCM V;  4M7A E;  1BIA A;  4XU3 A;  5IAY A;  5GAM h;  1UB4 A;  4ZN3 A;  3OY9 A;  3ZEH A;  1BI2 A;  4R55 A;  2CZ1 B;  5EG2 A;  1Q82 U;  3NTH A;  4KBM B;  5FU6 B;  4NOY A;  3TEE A;  5GMK l;  3RIR A;  3E9G A;  3M58 A;  3TU4 K;  4JRK A;  2KDS A;  2XU8 A;  2MF2 A;  2HAX A;  1Y71 A;  3CBO A;  3OS2 A;  3CCU A;  4L59 A;  5GAN d;  3BDU A;  4F7U B;  1Q82 C;  4C8Q B;  2O4X A;  4FU6 A;  3PTA A;  5LJ5 h;  1OZ2 A;  2GFU A;  2Y4X A;  3LGF A;  3QBY A;  1KHI A;  1I4K 1;  4F7U G;  1WJR A;  1R8O B;  5J39 A;  3L2Z A;  5GMK j;  3E19 A;  2BKD N;  2XHC A;  2VXE A;  4OB2 B;  4C0F A;  3V8L A;  4C8Q G;  4BI8 B;  3CCL A;  1OI1 A;  2R57 A;  3PNW C;  3VKI A;  3KUF A;  5GAO m;  4M7A C;  3MET A;  5CAI A;  4R56 A;  1VQP A;  2DIQ A;  4HT9 A;  2M16 A;  5LL6 S;  4LDV A;  1BKB A;  1RL2 A;  2PUO B;  4J6Y A;  4M77 E;  3RKY A;  3V7C A;  3CCU T;  5DLO A;  4MDX A;  2HQX A;  4JRQ A;  4C8Q D;  3GNF B;  1Q81 C;  4XU2 A;  2K3X A;  5CKF A;  1VQM A;  4TVR A;  1W4S A;  3CXC S;  4BY6 C;  2LTO A;  3LX7 A;  5GAN 5;  4M78 A;  3CBP A;  4CI0 C;  3C95 A;  3OYI A;  2E12 A;  5GAN 2;  2EQK A;  3A8H B;  3HRU A;  4PLI A;  3JCM W;  4A4H A;  1M5Q 1;  4C5G A;  2K4Y A;  2GF7 A;  2Y90 A;  5LJ5 e;  1G3W A;  3UPU A;  2A7Y A;  4BDY A;  3JB9 J;  2EYQ A;  2YLB A;  5GAN h;  3JB9 D;  1VQP T;  5HY6 A;  1M90 U;  3LLR A;  5A0G A;  1U1T A;  4BD3 A;  5J3B A;  2RHY A;  2CZ0 B;  4QVD A;  5LJ3 j;  2DPP B;  3INZ A;  4PJO E;  1YI2 A;  2HQE A;  3OW2 S;  3PT9 A;  1VQM T;  1YIJ A;  3LGL A;  3OMC A;  4M78 F;  2I2L A;  1X01 A;  4IUT A;  4M78 C;  2F5K A;  1I8F A;  3OBY A;  1M90 C;  3M4G A;  4KUD K;  2OTJ T;  2WSE E;  1W2B S;  1SSF A;  3PIP A;  3RKX A;  1QVF S;  5GAN 3;  4FL6 A;  1NPR A;  5A0D A;  4C0Z A;  1VQN A;  2XDB A;  2EFI A;  3PFS A;  5CQY A;  3QDR B;  3VUB A;  1V29 B;  4OGE A;  4QQG A;  3VJP A;  4J6W A;  4GLK A;  2EQM A;  3M9Q A;  4IUU A;  4OF1 A;  1P92 A;  4N4G A;  4Z02 A;  5DLQ E;  3RMQ A;  1Q86 U;  2DO3 A;  3GP8 A;  5CR2 A;  4XTZ A;  1MGQ A;  4IUP A;  5LJ3 f;  5I2M A;  4C0G A;  4M7D G;  2E70 A;  1YI2 T;  1VQ4 A;  4ELZ C;  2EJF A;  1NPP A;  2OTL A;  1YIJ T;  1QVG A;  1NJI C;  4X9D A;  1BI0 A;  2OTJ A;  1Q86 C;  1NZ9 A;  5GAM d;  4EMK A;  2JOY A;  3J7A F;  3QJ6 A;  2HBP A;  2IG0 A;  1QP3 A;  4EMG A;  3S6W A;  1VQN T;  3FJP A;  4ELY C;  4XAX B;  3JCM X;  2RD1 A;  3OYL A;  4B9W A;  4M7D D;  4C92 D;  1D3B A;  1K73 U;  1VIE A;  2RHU A;  3DB4 A;  3P8H A;  4XTY A;  1N9R A;  2RI5 A;  4XTW A;  1H3Z A;  2X4Y A;  4JS4 A;  4LDY A;  1VQ4 T;  2OTL T;  2P0K A;  2PUK B;  1M1G A;  3CCQ A;  2L89 A;  5LJ5 d;  1YJW A;  3MCA B;  4IUV A;  3DKM A;  1VQ6 A;  4PL6 A;  1N8R U;  4NS5 A;  2HD0 A;  4EMK C;  3L1A A;  4M75 D;  3FIF A;  2KMT A;  4PNO A;  1IRE B;  1D3B B;  4QQ6 A;  5GAN 7;  2R58 A;  1VQO A;  2DIG A;  3MP6 A;  2DTH A;  2ZPF B;  3OYJ A;  5KE3 A;  2NLU A;  2CYZ B;  3SDZ A;  2A3L A;  3MP8 A;  2KVQ G;  3HP9 A;  3L2U A;  3AHU A;  4JRI A;  4IUR A;  1HK9 A;  3OYE A;  2FB7 A;  1N8R C;  1VQ8 A;  2G3R A;  4XK8 E;  4HCZ A;  4MZP A;  2WAC A;  3JCM f;  3OYH A;  2E6N A;  2JTM A;  4ZTF A;  1W2B A;  3JB9 I;  2DXB A;  1QP2 A;  3PIO A;  1QVP A;  3OSS C;  4FIB A;  2DD4 A;  2WSC E;  4CRI A;  3CCV A;  4FM4 B;  2RJF A;  1FWZ A;  2DKG A;  5CK9 A;  3CCQ T;  1XQH A;  1YJW T;  2XI9 A;  1VQ6 T;  1N27 A;  3G7Z A;  4N0A A;  1IZ6 A;  2BUD A;  2VUB A;  2WSF E;  4HA8 A;  3HFO A;  4RCB A;  1M1F A;  3P8D A;  3LWI A;  2D9T A;  3PMT A;  1VQO T;  3QYH B;  3CD6 A;  2JZ2 A;  3QO3 A;  1EIF A;  4M7A A;  3QUI A;  1B34 B;  4C8Q E;  2K3Y A;  1X75 C;  3NFC A;  2LRQ A;  2PVO B;  2KY9 A;  4E7J A;  2RI2 A;  2EQJ A;  1VQ8 T;  3CC4 T;  3RUX A;  2MI6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...