3JCMd

Cryo-em structure of the spliceosomal u4/u6.u5 tri-snrnp
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
77
structure length
77
Chain Sequence
TPLDLLKLNLDERVYIKLRGARTLVGTLQAFDSHCNIVLSDAVETIYQLNNEELSESERRCEMVFIRGDTVTLISTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pre-mRNA-splicing factor 8
publication title The 3.8 angstrom structure of the U4/U6.U5 tri-snRNP: Insights into spliceosome assembly and catalysis
pubmed doi rcsb
molecule tags Transcription
total genus 8
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2015-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
d PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3jcmd00
3JCMd 4M78A 4C92E 5GMKl 4M7AB 5GAMg 5GANg 5GAOl 4C92B 2DVEA 1BIAA 4F7UA 5GMKm 5GAOq 2Y90A 3AHUA 4A53A 5GAOm 2RD1A 4RCBA 5LJ5h 4F7UG 2DXTA 2HNIA 4XTYA 5GAN8 4JLIA 2EWNA 4XTWA 4X9CA 4J6YA 5GAMf 3JCMW 4XU1A 5GANf 4PJOB 5LJ3f 2RA2A 2DJZA 4C8QB 2FB7A 1U1TA 4M75C 4QVCA 4M7AE 4JUVA 1I8FA 5GAMj 4M77A 3JCMV 3FB9A 1LJOA 4M75D 4N0AA 5GANj 4C8QC 5LJ3j 4PJOC 4M7AA 4M78C 3RKWA 4C92A 4PJOD 4C8QD 3V7RA 4Y91A 4M78D 5GMKi 5GAN5 5LJ5g 1B34B 4RCCA 3JB9I 1HXDA 3INZA 1N9RA 5GMKh 4M7DE 4DQ2A 1N9SA 4M75G 1YCYA 4M7DB 4C8QA 4XTVA 4PJOA 4MMLA 1LNXA 5GAN4 4EMKB 3QO3A 4PJOG 2E10A 4C8QG 5LJ5f 4XU3A 2YLCA 4J6WA 2DKGA 4M78G 2YHTA 1LOJA 2YLBA 4M77C 1KQ2A 4N0AC 5DY9A 3V7SA 4PNOA 4NOYA 3JCMQ 4M7AC 4M75F 4M77D 4C92C 5LJ5j 2RM4A 1Y96B 4A54A 4M7AD 4X9DA 4MMKA 4PJOF 1B34A 4C92D 4C8QF 5GAMe 5GANe 3JCMh 5LJ3e 1JBMA 4M78F 2E65A 5CAIA 3BDUA 2K57A 4M7DA 4F7UF 1JRIA 4EMKA 1X01A 4HT8A 4XTXA 4M77G 1KQ1A 4M7AG 5GAOr 4J5YA 4C92G 1TH7A 2DTIA 4EMHA 4J6XA 2DZCA 5GAMd 1D3BB 2JN0A 5LJ3d 1Y96A 4M7AF 4M77F 3JCMX 5GMKj 3JCMg 5GAN6 1WPYA 2EJGA 3L1AA 3QHSA 3SWNB 4C92F 3JB9D 3RERA 4EMGA 3QSUA 5LJ5e 4M7DC 3VU3C 1WNLA 3BY7A 3HFNA 1H641 3RKXA 4EMKC 3V8KA 5GAN7 3JCMJ 1MGQA 2DTOA 3FIFA 3PGGA 3SWNC 3JCMb 5GAN3 4M7DD 3RESA 2I2LA 2QTXA 3JCMf 2VXFA 4NL3A 1D3BA 3JB9G 1M8VA 3FJPA 4QVDA 2EJFA 4WF2A 2VC8A 4HA8A 5GAOn 2VXEA 5GAOp 3HSBA 4M7DG 3SWNA 2E1HA 3JCMc 3JB9F 3SB2A 4XU0A 4V2SA 2ZGWA 2E41A 3JB9H 1I81A 5GANd 2DZ9A 5GMKe 3BW1A 4JRIA 5LJ3g 2EJ9A 4XQ3A 3HFOA 1I5LA 4M7DF 4NL2A 3GIBA 4M75E 1WQWA 2FYKA 4M75B 5GAN2 3RUXA 1BIBA 4OP0A 4PJOE 3EFRA 4C8QE 3M4GA 3RKYA 1I4K1 4M78E 2EAYA 2DTHA 4XTUA 4XTZA 4XU2A 5GAMh 4M78B 5GANh 3RIRA 5LJ3h 2DXUA 4F7UE 1M5Q1 5I21A 4F7UB 2DEQA 1HK9A 3JCMe 4HT9A 3BFMA 1U1SA 5LJ5d 3JCMP 3V7CA 2E64A 1WQ7A 3JB9J 4M75A 3V8JA 3L2ZA 2RB6A 3EFSA 2CGHA 4M77E 3QUIA 4M77B 4JRKA 3V8LA
chains in the Genus database with same CATH superfamily
2C0OA 4KGZB 2V26A 2A37A 1M90R 1WX6A 4L6V5 2EWNA 1VQ4Q 4QT7A 1DJ7B 1YITA 1MMDA 1VIFA 3FB9A 4CRIA 3HL8A 1VYTA 3E9GA 3H41A 3I5SA 1JQQA 1UB4A 2F2XA 2P4RA 1HXDA 2K3YA 3VUBA 1VA7A 2PUKB 3L2QA 2JTMA 3CCLT 1NM7A 4EMKB 2L0AA 1YN8A 1LOJA 3DB3A 3VRYA 3H0FA 4NOYA 3VS0A 1Q95G 1PD1A 4OMPA 1A0NB 4C8QF 5GANe 2L3SA 1JBMA 3G6ET 3LW5E 1PRMC 3REBB 1JRIA 3MP8A 2NWMA 4EMKA 4KULA 2XHCA 4ELYC 1VQMT 3CC2A 2HEQA 1QMCA 1ZA1B 1FMVA 3CBOA 3M0PA 3I55Q 4IIMA 3UWNA 3UA6A 2I0NA 4BE2A 2OJ2A 3C94A 4IUQA 5GAN7 1NBEB 1Q81R 1SRLA 2A3LA 3JCMf 4NL3A 1GBRA 2DERA 1LCKA 1OULA 1K73R 4ZN1A 3UF4A 4MZTA 3NTHA 1S72Q 5GMKe 4C0DC 3L2WA 1I5LA 3M57A 2JJ9A 4X1VA 2GTJA 2HBWA 4IIOA 1XNIA 5CQXA 3CC7A 2XMFA 4Z8AA 4C5HA 2EVRA 1CSKA 4DBFA 4TVRA 1Z9ZA 3BFMA 1SSHA 2DD4A 1BI3A 1VQPA 3OYCA 2C0IA 2E6ZA 4BB7A 1Q82R 2DRKA 3V8LA 3NMZC 3MEAA 4C0GA 5GAOm 1QCFA 2HNIA 2V8IA 3A8MB 2P0PA 2OAWA 2YUPA 1VQ7Q 1VQNT 4JUVA 1X69A 4PJOC 4B6MA 4C8QD 5I2SA 1ZQ1A 5FWBA 3WVEB 3OYIA 1Y57A 2J7IA 3PVLA 5FU6C 3VS4A 2ZPHB 2GFUA 3CCQQ 1P92A 2YLCA 3QDRB 3DB4A 4ZN3A 1OZ3A 5KYUB 5I11A 4Z02A 4A54A 5KYWB 1OU8A 3DLLA 1M2VB 2OTJA 2JNGA 3CCVQ 3M55A 1KQ1A 3G71Q 2F2WA 1D0YA 2O4XB 4RUGA 1TH7A 4EMHA 5I22A 2E5KA 5KYUA 3QIIA 5KYWA 1WJSA 2LCCA 2YUQA 2K2VA 3QHSA 2A08A 1TG0A 3JCMJ 2DTOA 3OYJA 2O4XA 3X24B 1KC8U 2BIVA 3CC2T 1M8VA 2HQHA 3PTAA 2EYWA 1OV3A 2MPXC 2VXEA 2DD5A 5DM7R 1VQKA 3CPFA 2LDMA 2RQWA 5KYXB 2GTOA 2JT4A 5A0LA 4CI0C 2MOXA 2YWWA 2RF0A 1E6HA 1NLPC 2DBMA 4Q5WA 4N4HA 4J9DA 2DEQA 2JS0A 1IB8A 3SD4A 1K1ZA 5KYXA 2ZPFB 1U1SA 1W2BP 4KRTA 5CKBA 2QYZA 2JOYA 2NLUA 4AFZC 4FYVB 3CC7T 2CZ0B 2JW4A 3CCJQ 3C95A 1GXIE 2DL8A 5L8RE 1VQPT 2K3BA 5GAMj 2LMJA 3JCMV 1EZZB 1KD1C 2L89A 3X25B 1OPKA 3X20B 2XI9A 2D9TA 1IRXA 2QK0A 3CMEQ 2LC4A 2RN8A 4PJOG 1UHCA 4XU3A 2DA9A 1NE8A 2DKGA 3MEWA 3OYHA 5HK3A 4N0AC 3CBPA 4LXCA 2CH4A 4PJJA 2RHXA 1WDXA 3CCUA 3BDUA 4J7IA 4LD9K 1ZHIA 1NJIU 2DILA 1YWOA 1YI2A 1W1FA 4E7ZA 3PT9A 1SG5A 3RR6A 3I56Q 2JXBA 1W4SA 2MWOA 5KH6A 5GAN6 3RERA 1VYVA 2QEXQ 2FZCB 2W10A 3QXEB 2LJ0A 3CPWP 2CP7A 3VS3A 1MGQA 4ZGEB 1O75A 5FRNA 1I5OB 2ZPIB 1C6VX 2KNBB 1WJQA 1D1BA 1UFFA 3QYHB 1AWXA 3CCSA 3OBYA 4FL6A 1QVFS 1W2BA 2RI3A 2LQKA 1YWPA 1G8XA 1K9MU 3EFOB 5A0GA 3HFOA 3ME9A 2BE7D 3GLXA 2LP5A 1G2BA 4PJOE 4XU2A 2COWA 2VB6A 4PFZA 2ABLA 1HK9A 3EGXB 2LZ6B 1ABOA 1F1BB 1VQKT 3EFOA 3M59A 1W2BS 1AOJA 4LN2A 2VWFA 2O2OA 2VKNA 1U06A 1LVKA 3EGXA 5LJ5h 1T3SA 9ATCB 3CC4A 1ZUYA 4XTWA 3UPUA 5GAMf 1PC0A 2X51A 1NEBA 2BZ8A 5GANj 2M9UA 5GMKi 5LJ5g 1K0XA 2K4YA 1ZSGA 4ELZC 1SPKA 4AFSC 1D1AA 1YCYA 2EYXA 1O9SA 2R5MA 3V7SA 1KC8R 4M7AC 4OMFB 4ANJA 2DL3A 2YRDA 3UDCA 3CPWA 2X3WD 5LJ3e 1YHQA 2E65A 1D0ZA 2K57A 1CKBA 2COYA 3LGLA 1TWBA 4XTXA 2DL4A 2HZYA 5IHKA 3S3OA 1U8RA 2FO0A 2BZYA 4DEYA 2FHDA 2CP0A 1D09B 2RHUA 3MEVA 5GMKj 4BI8B 4IURA 2RQRA 1VUBA 2DPPB 2RHYA 3PVQA 5CVIA 2FVUA 5HCKA 1ZUKA 2X3XD 1YIJA 3CPWS 1YI2T 2PTKA 5FU7C 4QVDA 4ME7A 2AHJB 1JJ2P 3A98A 2JS2A 3LX7A 3LYIA 1HYOA 4E7LA 2X35A 2ROTA 1NYFA 3CQTA 3M5AA 4NL2A 1UGPB 2C0TA 1BB9A 3EFRA 2PVDB 3AT1B 3CCST 2COZA 1N8RC 4F7UE 4E6RA 1YJNQ 3OYYA 5CKEA 1B07A 1AHJB 3META 3ER0A 5IXBA 2CSIA 3ZFJA 2X4WA 2O01E 1WQ7A 5A0DA 3L2ZA 2JZ2A 2E6NA 4RTUA 3JCMd 3CMAA 3PMIA 5GAOl 2DVEA 1BIAA 3JRZA 2Y90A 2RD1A 1ABQA 1N27A 2F69A 2EQKA 5GANf 4D8DA 1NJIR 1TS9A 1BCMA 2LVMA 1T0JA 1HD3A 2FEIA 2LX7A 4QVZA 4A4EA 3EG1A 2KEAA 4HCCA 3OS2A 3CC4T 4LDWA 2X4YA 1G3YA 3BDLA 4C92C 4C5IA 3JCMh 3GPLA 3EH2A 1K8AU 1X01A 2CZ6B 3P8DA 1K9MR 1JJ2A 4M7AG 2DM1A 1RLPC 3MPUB 2OTJQ 3EGDB 4KUDK 1PKTA 4MZMA 3JCMg 4GLMA 2KXCA 3SWNB 4DBQA 4M7DC 3VU3C 1YHQT 1VQOQ 3L2UA 5C0MA 1WHHA 4HCKA 2K5IA 2E3HA 2PQWA 3OBWA 3MO8A 3R6OA 3VS6A 1N6AA 1V29B 3SWNA 1RUWA 1FYNA 1JJ2S 2E1HA 3SB2A 1M3BA 2DZ9A 3OA6A 4MDXA 2L3PA 3GIBA 2E70A 3MEUA 1BI1A 2RPNA 1YIJT 3TEEA 3M9QA 4R0KA 2KSSA 3M54A 3L2VA 4E7JA 1RAHB 2KVQG 5L23A 4JS5A 2FRYA 1YCSB 5DLQE 5J3BA 3S6WA 4OB2B 1VQ9Q 1ZSZB 4M7AE 2HD0A 4Y28E 2NUTB 4ZGJB 2K2MA 4E7KA 1J3TA 2EQIA 4J7FA 2ZZDA 3NTKA 4C8QB 2ENMA 2DK3A 1ZSZA 4UC4A 2WSEE 1KK7A 1NG2A 4EPCA 2XIDA 2NUTA 2WSFE 2GBQA 3CMAT 3F70A 1RAGB 3X28B 4D8KA 4C8QA 1M30A 2P4TA 2X4JA 2KQWA 2YLBA 5J26A 2KT8A 1ZX6A 4PFOA 1I1JA 1IZ6A 4LUEA 4FSSA 5CAIA 4DEXA 2DF6A 2A36A 1GCQC 3EHQA 1BK2A 2DFUA 2VGMA 3TQ7P 4HCZA 1WHGA 4C92G 4OGEA 3CCUQ 3ASKA 4J6XA 4RTWA 3M0TA 3VYHB 4BY6C 2EGCA 1NEGA 2RK1A 3G1JA 4IUUA 3P8BB 1FXXA 2RJFA 2LJ3A 3JB9G 2CZ7B 2EJFA 5A2QE 2FZGB 4M7DG 4LDVA 2DAQA 1SHFA 8ATCB 3BW1A 5LJ3g 2J6KA 3CXCS 3VJPA 1RAAB 4OP0A 1AWOA 5HK0A 3M4GA 1I4K1 3TU4K 2JMCA 2HMAA 1VQ5Q 2VASA 5CKDA 2DXUA 4X34A 1QVGP 3FEOA 1GRIA 2VYTA 2O9SA 2XDBA 2F2VA 2CREA 2QASA 2AZSA 4DOWA 2J05A 4NS5A 4BDYA 1X75C 3O5ZA 5IHNA 3QBYA 2O9VA 2EIFA 2DYBA 2L8DA 4OB3B 1ZA2B 4C92E 3C0CA 2KK4A 5GAOq 4JRQA 3AHUA 1PCXA 1M90C 1RAFB 1K0SA 4Y92A 4JLIA 2DMOA 2QGFB 1WYXA 2AZVA 2HAXA 4M75C 4LDUA 1K8AR 2QEXT 2RI5A 1LJOA 5LJ3j 2F5TX 2BUDA 2BE9B 2AKKA 3V7RA 1KIKA 1OX9A 1B34B 1OPLA 4M7DE 2YUNA 4JS4A 2M0YA 1VQ6Q 3SFMA 2A28A 1WGSA 2W0ZA 4DBRA 4J6WA 2L3RA 2EBPA 3OSVA 2G6FX 2OTLA 2JTFA 3HHTB 2PVOB 1B34A 1NPRA 1YJWA 3ZEHA 1QWFA 5CKFA 2E5QA 4A4FA 5GAMd 2MF2A 1MMNA 3JCMX 1Q86C 2K7AA 4AMCA 4PJMA 2MWPA 1H641 2E4HA 1Q81C 4KBMB 3PGGA 1EIFA 3JCMb 3RESA 1XQHA 4CC3A 3WVDB 1QVGA 2K9GA 4KUIA 4J9GA 4HVVA 2SEMA 2IPOB 2DX1A 1IGQA 2KMTA 1M3AA 4PFPA 1HSQA 2JM9A 4JJDA 4BACA 1IHVA 1ZLMA 4BDZA 4D6WA 1UGQB 5GAMh 1WLPB 3H0IA 4L5GA 4ZTJA 1BKBA 1QVFP 3CCMA 2QA4Q 1QVGS 2RQTA 1PHTA 2O31A 1Q82C 5GAMg 4HVWA 1VQ8A 3CD6A 4DBHA 2CUBA 3CCEA 5LJ3f 2DJZA 4J9FA 1I8FA 1G3TA 3SEMA 5KCHA 3HKSA 3H6ZA 4BD3A 1TUGB 2KT1A 1UECA 4M78C 1VQLA 2EW3A 1B7TA 3JB9I 4M75G 2HQXA 5FW9A 3PE0A 2E10A 3JAME 4IUTA 2CKKA 2G3RA 4JZ3A 4M77C 5DY9A 3LWIA 4ZTFA 3GBQA 4ESRA 3HP9A 3PIOA 2WACA 3CCLQ 1EX4A 4C0DB 3L2RA 3G4SA 2EGEA 2AK5A 4BE1A 4B9XA 3U23A 4Z88A 3QWXX 2OTLT 3EG2A 2RH2A 1YJ9T 2EJGA 2EQMA 3G6EQ 1XJWB 1KG1A 2HSPA 3E9FA 2XG8D 2MI6A 3HFNA 1VQMQ 1KHCA 5GAN3 2I2LA 2QTXA 2J6FA 1YJWT 3MP1A 3CCRA 3HRSA 1TTHB 4WF2A 1QVFA 1WXBA 3EAEA 4FYYB 4EDUA 2OX7A 3JCMc 3OS0A 2RMOA 4V2SA 1QWEA 3G7ZA 5IAYA 4JDSA 2A7YA 1NLOC 1MUZA 4M75E 1WQWA 2DRMA 1QP3A 3IQLA 1QLYA 1G5VA 2A0FB 4XTUA 4XTZA 5IXFA 5GANh 1GFCA 1ACMB 3T9NA 1NYGA 2KYBA 4M4ZA 5LJ5d 2H8HA 4OB0B 1U3OA 2RB6A 1AZEA 2RQUA 2MYSA 5GANg 2WSCE 2HCKA 1T3LA 2KR3A 5CO7A 2J06A 1Q7YU 1AVZC 3M0SA 3CCMT 1KJWA 2KRMA 2IIMA 2JUFA 1K9AA 1VQOT 2OI3A 3I55A 4E7HA 2KBTA 1GCPA 3URGA 1JB0E 3OW2S 4ATOA 3QZ9B 3A8GB 1SKUB 2XU8A 2ED1A 1VQ8T 5GMKh 2R57A 3CD6T 4J9IA 1VQNQ 2DL7A 2M51A 1H92A 3VS2A 3CCET 4M78G 5KE3A 2D0NA 2ATCB 3VS1A 3OYGA 4PJOF 1S72A 1AWWA 1MNEA 8AT1B 1VQLT 4OGCA 1E7OA 4M77G 5GAOr 1YITQ 3H0HA 1YFNA 2K6DA 3MHXA 5KYNA 4AFQC 4B9WA 2DXCA 1WNLA 4JJBA 3FLGA 3FIFA 3SWNC 3QZ5B 5D6WA 1WXUA 2NUZA 4QQDA 2VGNA 3G4ST 1PKSA 4XU0A 1W70A 2KI7A 3QJYA 2E41A 1I07A 3FJ5A 1I81A 2EJ9A 1VQ7A 4PJNA 1QW1A 3CC2Q 5C6SA 1JO8A 2FYKA 1RACB 3M0UA 3CBMA 2EKOA 2EAYA 4M78E 3CCRT 1PD0A 2QQSA 1M5Q1 1S1NA 4F7UB 2V1QA 3TREA 1KHIA 2V8KA 2RQVA 3A1PA 1ZBJA 3CCQA 2DBKA 5GJVB 1VQ4T 1JXMA 5M9OA 3JB9J 4A4HA 2CGHA 2DIQA 4M77E 1WHMA 3QUIA 4HVUA 3SHWA 2M1HA 4F7UA 1T0HA 4HXJA 2RI2A 3CCVA 2RJCA 4RTZA 4E7IA 2CP2A 5D6XA 4O5VA 4Z89A 3J81E 4BE0A 3Q1JA 1X6GA 4R55A 4N0AA 4C8QC 2GGRA 2EGAA 4PJOD 2LNVA 5GAN5 2FL7A 3CC7Q 3NFCA 1WHKA 2MCNA 2QTVA 2L5QA 1N9SA 2PU9B 1SSFA 1VQPQ 2QQRA 1KC8C 1OZ2A 1M2OA 5CIUA 2J6OA 3UT1A 2RM4A 3I55T 4X9DA 4MMKA 1RADB 4ORZA 2XKOC 2EFIA 1QP2A 5GJWB 4F7UF 2EPDA 3LH0A 1M1KC 2R5AA 1B3QA 1UTIA 1ZBXA 2JN0A 1TSFA 4OMOA 1FMKA 3UA7A 4DOVA 4KH1B 2BKDN 3L1AA 4C0FA 1S72T 4EMKC 3V8KA 4AFUC 1Y0MA 3RNJA 3FJPA 4RTXA 3D7SB 5CKHA 2KDSA 1AZGB 4FT2A 1M3CA 1PSEA 1YNZA 4JRPA 5IHIA 4DA4A 4FT4A 4WCIA 3CCJA 2NUPB 4J83A 3A8HB 1Q7YR 1TOVA 2X4XA 3MCAB 1BIBA 4WTOB 2HSEB 1OYXA 2FPDA 2QI2A 1N5ZA 2CP3A 5KE2A 3RIRA 3OS1A 2GFAA 1TU0B 3CMEA 2NUPA 1SRMA 2QAZA 3GNFB 3EHRA 4YTLA 2YT6A 1VQ7T 1H3ZA 2P0KA 3QG1A 3CXCP 2K3XA 4M7AB 2CP5A 3OYDA 1UEBA 2GCXA 3I5RA 4BUGA 2DEUA 1VQKQ 1UUEA 1NJIC 6AT1B 3CCQT 2ZAEA 3I56A 3OYBA 1ARKA 2HKNA 4M7AA 1BI0A 3RKWA 3OYEA 2QEXA 3LLRA 3KXTA 3NHNA 3INZA 1V1CA 4JPBW 3CCVT 1AEYA 1LNXA 4J9EA 3QO3A 3EH1A 4C8QG 3G71T 1R0BG 1K4US 1W6XA 3A5ZB 5FROA 1OU9A 1WHLA 4QW2A 4N4GA 2HQEA 1K9MC 1UGSB 2KGTA 4FSXA 2DZCA 1KD1U 1VOMA 5LJ3d 1XTDA 2DXBA 1EFNA 4BI3A 4R56A 4FW1A 4M7AF 2XK0A 4OMNA 2XDPA 3BY7A 4EIKA 2VUBA 3EG0A 3OYFA 4PKCC 4LDYA 5CCAA 4E47A 1BBZA 1QVPA 2EYZA 2HL5C 2QDLA 1Y07A 1X43A 1UGRB 2PNIA 2LNHB 4F14A 2XICA 1JU5C 2GQVA 2KRSA 1YI2Q 1PRLC 3CXCA 4GY5A 1WHJA 3RUXA 1PSFA 4N4IA 1LPLA 1NPPA 4C8QE 3RKYA 4VUBA 2YRVA 2P0QA 3OSSC 5LJ3h 4PL6A 2CP6A 1GL5A 3THKA 4HT9A 2RHZA 3QWYA 1X2QA 3CCJT 1IXDA 3V8JA 2GF7A 4JRKA 3CCSQ 4P5NA 4C92B 1D0XA 1IREB 1E6GA 1GFDA 2DXTA 4FCYA 5EC7A 4XTYA 5GAN8 4XU1A 3CMET 3OS5A 2FB7A 1U1TA 4QVCA 3QDFA 1UGVA 1AWJA 1M8MA 4C92A 1AT1B 3PMTA 1SHGA 2QG9B 3PFSA 1N9RA 1M27C 1OX8A 2F5KA 4M7DB 3H8ZA 4XTVA 4MMLA 1PG5B 1Q86R 1FMWA 2B8AA 2YHTA 1X27A 4C5GA 1Y96B 3I56T 4M7AD 1YP5A 1WXTA 1OEBA 4M7DA 2VV5A 4FU6A 3CC4Q 1RI0A 4KGVB 4IUVA 1MMAA 4OB1B 2RNAA 3GOXA 3VV0A 2LRQA 1Y96A 1NZ9A 2F1LA 1YJNA 4C5EA 4C92F 1UE9A 4ZNXA 5LJ5e 3M53A 2KE9A 1RAIB 1YJ9A 2K79A 3DKMA 5AT1B 1G3SA 3M0QA 4MDWA 4FIBA 3JB9F 1YHQQ 2ESWA 1R0CB 3TCJA 3KFVA 4JRIA 2E3IA 1VIEA 4M7DF 1UDLA 1K76A 2JM8A 2FPFA 2GQIA 1XOVA 5I21A 4FW2A 4GBQA 2O88A 1H8KA 1K73C 3HRUA 2KAFA 1Y71A 3OYNA 3PNWC 4PLIA 4J9BA 1YIJQ 4AG1C 4II1A 2QXFA 4IKFA 4JJNK 2LX9A 1WI7A 5GMKm 1PNJA 4CC4B 1YITT 2CT3A 3PIPA 3JCMW 4RTYA 2AIRB 1K8AC 1V76A 2R58A 3P8HA 4XK8E 3MJXA 4OMMA 4LE9A 2DL5A 4J9HA 4BY6B 1N8RU 1KD1R 4QKUA 4RTTA 2MK5A 1SF9A 4Y91A 4BI4A 3OYMA 2L2PA 1VQOA 1GCQA 1MV0B 2KRNA 1M2VA 2MAMA 1MMGA 1BU1A 4KT0E 1JEGA 3JCMQ 3I9QA 3J80E 3CMAQ 3C12A 1X6OA 4C92D 2CZ1B 2B86A 3VKIA 5FWCA 3OW2P 1QCNA 2P84A 4HT8A 1GBQA 2ZCFB 4KH0B 4RTVA 4J5YA 1H3HA 2DTIA 4AT1B 3BE3A 2CYZB 1M1KU 3C4SA 5KYYB 2RJDA 4A4GA 3JB9D 1WPYA 2ECZA 4LUDA 4EMGA 5CK9A 2VVKA 3LGFA 4J9CA 3RMQA 3RKXA 4M7DD 1R8OB 2RHIA 1VQ9A 4RMOA 5KYYA 2D6FA 4FYWB 2HDAA 3HSBA 4F04B 1JXOA 1YJNT 4C0ZA 2M0OA 5GANd 4E2FB 1UHFA 5ECAA 3VRZA 4OF1A 2EYQA 1MNDA 4M75B 3OMCA 3DLMA 2DTHA 4ZGDB 3R6NA 4AG2C 3FRNA 3JCMe 1Z9QA 3TSZA 2KY9A 1OI1A 5FLXE 1BYMA 4JLGA 3WXMB 1M1GA 4M75A 1WZOA 5CQYA 1UG1A 1VQ4A 4L59A 1C0MA 1Y7XA 4OVAA 4A53A 2DE0X 1U5SA 3QJ6A 3A8OB 2HBPA 2LCSA 2D0QB 3O8VA 4PJOB 2LJ1A 2XD0A 1IGUA 3E2UA 3OY9A 2H3EB 5J39A 3MKDA 1TUCA 2LQNA 2BZXA 5DLOA 1QKXA 5FU6B 3ULRB 2EKHA 3OW2A 7AT1B 3EG9B 3LH5A 1AD5A 4IUPA 3S3MA 4PJOA 3RBBB 5GAN4 4OMLA 1KQ2A 2DIGA 1RL2A 3M0RA 3TSWA 2OTJT 1KSWA 2LQ8A 4M75F 3ZL7C 3EG9A 5D6YA 1WA7A 3M4YA 2DO3A 4LNPA 2DETA 3QYGB 2BTTA 1UJYA 1BCOA 4HCBA 3OB9A 2ZPBB 1MV3A 2LQWA 3FC3A 5LL6S 1VQ5A 4E7SA 3I35A 2AT1B 3QSUA 2MIOA 3VS5A 3X26B 1WIEA 4OMQA 3VUZA 3REAB 3EGUA 4K11A 2VC8A 4HA8A 5GAOp 4RG2A 1X2KA 2V8JA 3H9NA 2ZGWA 3JB9H 2FRWA 4J8OA 3GF5A 4CC7A 2KYMA 1VYUA 2V1RA 1VQ9T 4CC2A 3HTRA 4M78B 4PLLA 2LCLA 1N8RR 1VQ6A 2Z0WA 1X6BA 4JZ4A 3M56A 1MHNA 3JCMP 2E64A 3MP6A 3EFSA 1OQKA 3JV3A 4M77B 2ROLA 4M78A 3VS7A 1RI9A 3OYKA 4F7UG 4A63B 4X9CA 4J6YA 1TXQA 3OQ5A 2FG0A 3L42A 3ZBDA 4M77A 3HPWA 2H3JA 1BI2A 4M75D 2X9HA 3VYGA 2QDYB 3J7AF 1IHWA 4LD6A 1M1KR 4RCCA 2GNCA 1M4ZA 3A8LB 2JMAA 2XDDA 2PVGB 1ZSZC 3CCUT 2EYYA 1YBYA 1G3WA 5LJ5j 3G71A 3JSCA 1OOTA 1M90U 1KQSP 4M78F 2DYIA 2QGGA 4RKUE 2D1XA 2DJQA 2M02A 1ZUUA 4MZPA 3GP8A 1D3BB 1D1CA 1RAEB 2PZ1A 4FYXB 2QQ9A 4A4KA 3S3NA 5CR2A 5D7UA 4M77F 2OAUA 2QA4A 2EQJA 3KUFA 3OMGA 3OYLA 2CDTA 2HKQB 1IO6A 2RK2A 2VXFA 4JJCA 1D3BA 2KXDA 4PK4A 2OTLQ 2EQUA 1UJ0A 4FM4B 2JVVA 2LT1A 1YJ9Q 1VQ5T 3RDVA 3GNGA 3QKJA 2K5FA 2LT4A 4XQ3A 2CT4A 1YJWQ 4XAXB 5GAN2 2PUOB 1FWZA 2CUDA 2RO0A 4KGXB 2AKLA 2DVJA 1Q86U 2IVWA 2LTOA 3M58A 3SDZA 1Q81U 4PJLA 5AYFA 2KROA 1RLQC 2MMPA 3KBGA 1WFWA 3N5BB 2ZPEB 2FZKB 2L3QA 1K73U 1PWTA 2DNUA 1CKAA 4O6JA 2HL3A 3EG3A 3LWHA 3QPHA 2E12A 5GMKl 2Y4XA 1R77A 2CS7A 2NYSA 4RCBA 2SRCA 2M16A 3CCLA 2JTEA 1C1AA 5FRMA 1VQ6T 2RA2A 2YDLA 4GLKA 2FPEA 2DLPA 1KFZA 1KQSA 1QKWA 2RJEA 3G6EA 4M78D 5KCOA 1VQMA 4DQ2A 1TUDA 1QQJA 4QQ6A 3CCMQ 1FX7A 1M9SA 1Q82U 5LJ5f 2YRCA 4PNOA 4M77D 2D8HA 5GAMe 3EGDA 1VQ8Q 3HRTA 5EG2A 3CD6Q 1KQSS 4HKEA 3OYAA 5I2MA 3CCEQ 1QCOA 3CEYA 3RMSA 2YUOA 3NPFA 4LDXA 2CSQA 5IT9E 3UATA 1HJDA 1VQLQ 1G83A 3FDRA 4F16A 3TVTA 5FU7B 2IG0A 2ZPGB 1WJRA 2ED0A 4QQGA 5IN1A 5GAOn 2CH4W 3NTIA 4F17A 2YSQA 4RG8A 2QQBA 5IH2A 2QA4T 1M1FA 1Q7YC 3E19A 2YXYA 3G4SQ 2K5LA 1SEMA 2D8JA 1I0CA 1PM3A 3NGPA 1RABB 3E1SA 5HKCA 2Y4YA 2QQAA 1VQNA 3V7CA 2C06A 5HY6A 3CCRQ
chains in the Genus database with same CATH topology
3JCMd 3CMAA 4JJNK 5GANg 2WSCE 3PMIA 2LX9A 5GAOl 2DVEA 1BIAA 5GMKm 3JRZA 2Y90A 2RD1A 1YITT 5CO7A 3PIPA 1N27A 3JCMW 4L6V5 2EWNA 2F69A 1Q7YU 2EQKA 5GANf 1K8AC 3CCMT 1DJ7B 1YITA 2R58A 1VIFA 2JUFA 3P8HA 4XK8E 3FB9A 4CRIA 1VQOT 3I55A 4E7HA 3HL8A 2LVMA 4BY6B 1N8RU 3URGA 1JB0E 3E9GA 3OW2S 4ATOA 3QZ9B 1UB4A 3A8GB 4Y91A 4BI4A 3OYMA 4QVZA 4A4EA 2XU8A 1VQ8T 1VQOA 1HXDA 2K3YA 3VUBA 5GMKh 2PUKB 3L2QA 4HCCA 2JTMA 2R57A 3OS2A 3CCLT 3CD6T 4EMKB 2MAMA 3CC4T 4LDWA 4KT0E 3CCET 4M78G 5KE3A 1LOJA 2X4YA 1G3YA 3DB3A 4NOYA 3JCMQ 3BDLA 4C92C 3J80E 3OYGA 3C12A 1X6OA 4PJOF 4C5IA 4C8QF 4C92D 5GANe 2CZ1B 3JCMh 1JBMA 1S72A 3VKIA 3G6ET 3LW5E 3GPLA 1VQLT 1JRIA 4OGCA 3MP8A 4EMKA 1K8AU 1X01A 4KULA 4HT8A 2XHCA 4ELYC 1VQMT 4M77G 2ZCFB 2CZ6B 3CC2A 3P8DA 1JJ2A 4M7AG 5GAOr 4J5YA 2DTIA 3CBOA 2CYZB 1M1KU 3MHXA 4KUDK 3C4SA 3UWNA 2RJDA 4MZMA 3JCMg 4A4GA 1WPYA 4BE2A 3JB9D 3SWNB 3C94A 5CK9A 4B9WA 2DXCA 4EMGA 3LGFA 4IUQA 3VU3C 1YHQT 1WNLA 3RMQA 4M7DC 3RKXA 5GAN7 3FLGA 3L2UA 3FIFA 5C0MA 3SWNC 4M7DD 3QZ5B 1R8OB 2A3LA 5D6WA 2K5IA 2RHIA 3JCMf 4NL3A 1VQ9A 2PQWA 4QQDA 2VGNA 3OBWA 3MO8A 3G4ST 4RMOA 4ZN1A 2D6FA 3R6OA 1N6AA 3HSBA 1V29B 3SWNA 4MZTA 3NTHA 1YJNT 1JJ2S 2E1HA 4C0ZA 3SB2A 4XU0A 3QJYA 2E41A 2M0OA 1I81A 5GANd 2DZ9A 5GMKe 4C0DC 3OA6A 4MDXA 3L2WA 2EJ9A 1VQ7A 1I5LA 4OF1A 1QW1A 2E70A 3M57A 3MEUA 3GIBA 5C6SA 2EYQA 2FYKA 4M75B 1BI1A 3OMCA 3DLMA 1YIJT 3CBMA 3TEEA 2EKOA 2EAYA 2DTHA 2KSSA 1XNIA 3M54A 3M9QA 4M78E 4ZGDB 3L2VA 5CQXA 2QQSA 3CCRT 3CC7A 4C5HA 1M5Q1 2KVQG 4F7UB 3FRNA 3JCMe 3TREA 4TVRA 1KHIA 2KY9A 3BFMA 1OI1A 5FLXE 2V8KA 4JS5A 2DD4A 4JLGA 3WXMB 1BYMA 1BI3A 3CCQA 1VQPA 1M1GA 3OYCA 5DLQE 5J3BA 3S6WA 5M9OA 4M75A 3JB9J 1VQ4T 4A4HA 4OB2B 2E6ZA 2CGHA 2DIQA 4M77E 4BB7A 3QUIA 4M7AE 3V8LA 2HD0A 4Y28E 5CQYA 1VQ4A 4L59A 2M1HA 1Y7XA 3MEAA 4C0GA 4F7UA 4OVAA 4ZGJB 2RI2A 4A53A 5GAOm 3CCVA 4E7KA 2RJCA 3QJ6A 3A8OB 2HNIA 2HBPA 2V8IA 3A8MB 4E7IA 2D0QB 3O8VA 4J7FA 2P0PA 2ZZDA 4PJOB 3NTKA 4C8QB 2DK3A 2XD0A 5D6XA 1VQNT 4JUVA 4O5VA 3OY9A 3J81E 4BE0A 3Q1JA 4R55A 4N0AA 4UC4A 4PJOC 2WSEE 4C8QC 5J39A 5DLOA 5FU6B 4EPCA 4PJOD 2XIDA 4C8QD 2LNVA 2WSFE 3OW2A 5I2SA 1ZQ1A 3OYIA 3F70A 2FL7A 3WVEB 5GAN5 3CMAT 3NFCA 5FU6C 3X28B 2L5QA 4IUPA 1N9SA 3S3MA 4PJOA 4C8QA 2ZPHB 5GAN4 2PU9B 2GFUA 2P4TA 1SSFA 1P92A 2QQRA 2YLCA 1KQ2A 2X4JA 2KQWA 2DIGA 1RL2A 2YLBA 3DB4A 3QDRB 1OZ2A 4ZN3A 1KC8C 1OZ3A 2LQ8A 2OTJT 5J26A 4M75F 5CIUA 3UT1A 4Z02A 2RM4A 5D6YA 4A54A 3I55T 3M4YA 1IZ6A 2DO3A 4MMKA 3QYGB 4X9DA 3DLLA 2OTJA 2JNGA 2XKOC 2EFIA 5CAIA 1QP2A 4F7UF 3M55A 4HCBA 1KQ1A 2VGMA 3LH0A 4HCZA 1M1KC 3OB9A 2R5AA 2ZPBB 2O4XB 4C92G 4OGEA 1TH7A 4EMHA 3ASKA 4J6XA 1ZBXA 3VYHB 3FC3A 2JN0A 5LL6S 4BY6C 3QIIA 1VQ5A 4DOVA 1WJSA 2BKDN 2LCCA 3L1AA 2K2VA 3QHSA 4C0FA 3QSUA 2RK1A 4IUUA 1S72T 4EMKC 3V8KA 3JCMJ 2DTOA 3P8BB 3X26B 3OYJA 2O4XA 3X24B 1FXXA 2RJFA 3VUZA 1KC8U 2BIVA 3JB9G 3CC2T 2CZ7B 3FJPA 1M8VA 3PTAA 5CKHA 2EJFA 2VC8A 2KDSA 4HA8A 4FT2A 5A2QE 2VXEA 2DD5A 5GAOp 4RG2A 4M7DG 1PSEA 4LDVA 5DM7R 2V8JA 4JRPA 2DAQA 1VQKA 2ZGWA 4DA4A 3CPFA 4FT4A 2LDMA 3JB9H 3BW1A 5LJ3g 3CCJA 4J8OA 4J83A 3GF5A 5A0LA 4CI0C 3CXCS 3A8HB 3VJPA 2X4XA 3MCAB 1BIBA 4OP0A 1VQ9T 5HK0A 1OYXA 2QI2A 3M4GA 1I4K1 5KE2A 3TU4K 5CKDA 4M78B 4PLLA 3RIRA 2DXUA 4Q5WA 4N4HA 3OS1A 2LCLA 4X34A 2DEQA 2GFAA 3FEOA 2VYTA 3SD4A 1VQ6A 2XDBA 3CMEA 3M56A 2ZPFB 1U1SA 1MHNA 3JCMP 2E64A 4DOWA 4BDYA 4NS5A 1X75C 3MP6A 3EFSA 3GNFB 3QBYA 4YTLA 1VQ7T 1H3ZA 5CKBA 2EIFA 2P0KA 4M77B 2L8DA 2JOYA 3QG1A 4M78A 2K3XA 4OB3B 4M7AB 4C92E 3OYDA 3OYKA 2KK4A 5GAOq 1UEBA 4JRQA 3AHUA 2GCXA 1M90C 2NLUA 4BUGA 4F7UG 3CC7T 2CZ0B 4JLIA 5FRNA 4X9CA 4J6YA 1NJIC 2HAXA 3C95A 3OQ5A 1GXIE 4M75C 4LDUA 3L42A 4M7AA 2QEXT 5L8RE 3CCQT 1VQPT 2RI5A 3ZBDA 4M77A 3JCMV 5GAMj 1LJOA 2H3JA 1BI2A 3HPWA 4M75D 2F5TX 5LJ3j 3OYBA 2BUDA 3VYGA 1BI0A 3I56A 2QDYB 2L89A 3RKWA 1KD1C 3OYEA 3J7AF 3V7RA 3X25B 4LD6A 2QEXA 3LLRA 3KXTA 1B34B 4RCCA 3X20B 2XI9A 2D9TA 3INZA 4M7DE 4JS4A 1M4ZA 3CCVT 3SFMA 3A8LB 1LNXA 2LC4A 1WGSA 3QO3A 4PJOG 4C8QG 3G71T 4XU3A 4J6WA 2PVGB 1NE8A 2DKGA 3MEWA 2L3RA 2XDDA 3OYHA 5HK3A 3OSVA 4N0AC 3CCUT 3CBPA 2OTLA 1YBYA 2JTFA 3A5ZB 3HHTB 1G3WA 5LJ5j 5FROA 2PVOB 3G71A 3JSCA 2RHXA 1B34A 1M90U 4M78F 3CCUA 4QW2A 3BDUA 4N4GA 4RKUE 4J7IA 4LD9K 1ZHIA 2HQEA 1NJIU 1NPRA 1YJWA 1YI2A 1K9MC 1UGSB 3ZEHA 5CKFA 2E5QA 4A4FA 4MZPA 3PT9A 4FSXA 5GAMd 2MF2A 2DZCA 3GP8A 1D3BB 3S3NA 1KD1U 5LJ3d 4A4KA 1XTDA 2QQ9A 2DXBA 5CR2A 4M77F 1W4SA 3JCMX 1Q86C 2MWOA 4BI3A 5KH6A 2OAUA 4R56A 5GAN6 4M7AF 3RERA 2XK0A 3QXEB 2QA4A 2XDPA 3BY7A 2MWPA 1H641 1Q81C 2EQJA 4KBMB 3KUFA 1MGQA 2VUBA 3OMGA 3PGGA 1EIFA 4ZGEB 1O75A 4LDYA 4PKCC 3RESA 3JCMb 5CCAA 4E47A 2RK2A 2VXFA 1XQHA 2ZPIB 3OYLA 1WJQA 1D3BA 1QVPA 3QYHB 3CCSA 3WVDB 1QVGA 2EQUA 3OBYA 4KUIA 4FL6A 1QVFS 4FM4B 2JVVA 2LT1A 1VQ5T 1Y07A 3GNGA 1W2BA 2RI3A 1UGRB 2KMTA 2LQKA 3QKJA 2K5FA 2XICA 1K9MU 2LT4A 2GQVA 4BACA 4XQ3A 5A0GA 3HFOA 4BDZA 3ME9A 3CXCA 4GY5A 4XAXB 4D6WA 3OYFA 5GAN2 1UGQB 3GLXA 1PSFA 3RUXA 4N4IA 2PUOB 1FWZA 1NPPA 2RO0A 3RKYA 4C8QE 4PJOE 1Q86U 5GAMh 4VUBA 4XU2A 2YRVA 2P0QA 2IVWA 3OSSC 5LJ3h 4PL6A 2LTOA 4L5GA 4ZTJA 3M58A 1BKBA 3SDZA 1HK9A 1Q81U 5AYFA 3CCMA 4HT9A 1VQKT 2RHZA 2MMPA 3KBGA 1QVGS 3N5BB 2ZPEB 3M59A 3CCJT 1K73U 3V8JA 1Q82C 1W2BS 2GF7A 4O6JA 4JRKA 3LWHA 3QPHA 5GAMg 2E12A 5GMKl 4P5NA 4C92B 1VQ8A 2Y4XA 5LJ5h 2CS7A 4RCBA 1IREB 2M16A 2DXTA 3CCLA 3CD6A 3CC4A 4XTYA 5GAN8 4XTWA 3UPUA 5GAMf 5FRMA 1VQ6T 4XU1A 2E6NA 3CCEA 5LJ3f 2RA2A 2DJZA 3OS5A 4GLKA 3CMET 2FB7A 1U1TA 4QVCA 1I8FA 1G3TA 5KCHA 5GANj 1KQSA 3HKSA 3H6ZA 4BD3A 4M78C 4C92A 3PMTA 2RJEA 2M9UA 3G6EA 4M78D 5GMKi 5LJ5g 1VQLA 2K4YA 4ELZC 3JB9I 3PFSA 5KCOA 1N9RA 1VQMA 4DQ2A 4M75G 2F5KA 1YCYA 2HQXA 4QQ6A 3H8ZA 4XTVA 4MMLA 4M7DB 1O9SA 1FX7A 1M9SA 2E10A 2R5MA 1Q82U 5LJ5f 3JAME 4IUTA 2CKKA 2B8AA 2G3RA 2YHTA 4M77C 5DY9A 3V7SA 4PNOA 4C5GA 4M7AC 4OMFB 4M77D 1Y96B 3I56T 3LWIA 4M7AD 3UDCA 5GAMe 3CPWA 4ZTFA 1YHQA 5LJ3e 2E65A 3HRTA 2K57A 3HP9A 3PIOA 2VV5A 4M7DA 2WACA 5EG2A 3LGLA 1KQSS 4FU6A 1RI0A 4HKEA 4XTXA 3OYAA 4C0DB 4IUVA 5I2MA 3L2RA 3G4SA 3CEYA 4OB1B 3RMSA 3S3OA 1U8RA 4BE1A 3GOXA 4B9XA 3VV0A 2LRQA 4LDXA 1Y96A 2FHDA 2OTLT 1NZ9A 1YJNA 2RHUA 2RH2A 3MEVA 4BI8B 4C5EA 5GMKj 2EJGA 4IURA 5IT9E 2EQMA 1YJ9T 4C92F 1VUBA 1KG1A 3E9FA 5LJ5e 2DPPB 2MI6A 2XG8D 3M53A 3HFNA 2RHYA 3FDRA 5CVIA 2FVUA 5FU7B 1KHCA 5GAN3 2IG0A 2I2LA 2QTXA 1YJ9A 2ZPGB 3DKMA 3CPWS 1WJRA 1YI2T 1G3SA 1YIJA 1YJWT 3MP1A 5FU7C 4MDWA 3HRSA 4FIBA 4QVDA 4QQGA 4ME7A 3CCRA 2AHJB 4WF2A 5IN1A 5GAOn 1QVFA 3EAEA 3NTIA 4EDUA 3JCMc 3LX7A 3LYIA 3OS0A 3JB9F 4V2SA 4RG8A 2QQBA 3TCJA 3G7ZA 5IAYA 4E7LA 2X35A 4JDSA 2A7YA 1M1FA 1VIEA 4JRIA 2QA4T 1Q7YC 3M5AA 4M7DF 4NL2A 3E19A 4M75E 1WQWA 1UGPB 2K5LA 1QP3A 3EFRA 2PVDB 1G5VA 4XTUA 4XTZA 3CCST 3E1SA 5GANh 1N8RC 4F7UE 1XOVA 3OYYA 5CKEA 5I21A 3T9NA 5HKCA 4E7JA 1AHJB 3META 2Y4YA 3ER0A 1K73C 3HRUA 2KAFA 2QQAA 3ZFJA 1VQNA 2X4WA 5LJ5d 1Y71A 2O01E 3V7CA 1WQ7A 3OYNA 3PNWC 4OB0B 4PLIA 5A0DA 2C06A 3L2ZA 2RB6A 5HY6A 2JZ2A 4II1A 2QXFA 4IKFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JCM d;  4M78 A;  4C92 E;  5GMK l;  4M7A B;  5GAM g;  5GAN g;  5GAO l;  4C92 B;  2DVE A;  1BIA A;  4F7U A;  5GMK m;  5GAO q;  2Y90 A;  3AHU A;  4A53 A;  5GAO m;  2RD1 A;  4RCB A;  5LJ5 h;  4F7U G;  2DXT A;  2HNI A;  4XTY A;  5GAN 8;  4JLI A;  2EWN A;  4XTW A;  4X9C A;  4J6Y A;  5GAM f;  3JCM W;  4XU1 A;  5GAN f;  4PJO B;  5LJ3 f;  2RA2 A;  2DJZ A;  4C8Q B;  2FB7 A;  1U1T A;  4M75 C;  4QVC A;  4M7A E;  4JUV A;  1I8F A;  5GAM j;  4M77 A;  3JCM V;  3FB9 A;  1LJO A;  4M75 D;  4N0A A;  5GAN j;  4C8Q C;  5LJ3 j;  4PJO C;  4M7A A;  4M78 C;  3RKW A;  4C92 A;  4PJO D;  4C8Q D;  3V7R A;  4Y91 A;  4M78 D;  5GMK i;  5GAN 5;  5LJ5 g;  1B34 B;  4RCC A;  3JB9 I;  1HXD A;  3INZ A;  1N9R A;  5GMK h;  4M7D E;  4DQ2 A;  1N9S A;  4M75 G;  1YCY A;  4M7D B;  4C8Q A;  4XTV A;  4PJO A;  4MML A;  1LNX A;  5GAN 4;  4EMK B;  3QO3 A;  4PJO G;  2E10 A;  4C8Q G;  5LJ5 f;  4XU3 A;  2YLC A;  4J6W A;  2DKG A;  4M78 G;  2YHT A;  1LOJ A;  2YLB A;  4M77 C;  1KQ2 A;  4N0A C;  5DY9 A;  3V7S A;  4PNO A;  4NOY A;  3JCM Q;  4M7A C;  4M75 F;  4M77 D;  4C92 C;  5LJ5 j;  2RM4 A;  1Y96 B;  4A54 A;  4M7A D;  4X9D A;  4MMK A;  4PJO F;  1B34 A;  4C92 D;  4C8Q F;  5GAM e;  5GAN e;  3JCM h;  5LJ3 e;  1JBM A;  4M78 F;  2E65 A;  5CAI A;  3BDU A;  2K57 A;  4M7D A;  4F7U F;  1JRI A;  4EMK A;  1X01 A;  4HT8 A;  4XTX A;  4M77 G;  1KQ1 A;  4M7A G;  5GAO r;  4J5Y A;  4C92 G;  1TH7 A;  2DTI A;  4EMH A;  4J6X A;  2DZC A;  5GAM d;  1D3B B;  2JN0 A;  5LJ3 d;  1Y96 A;  4M7A F;  4M77 F;  3JCM X;  5GMK j;  3JCM g;  5GAN 6;  1WPY A;  2EJG A;  3L1A A;  3QHS A;  3SWN B;  4C92 F;  3JB9 D;  3RER A;  4EMG A;  3QSU A;  5LJ5 e;  4M7D C;  3VU3 C;  1WNL A;  3BY7 A;  3HFN A;  1H64 1;  3RKX A;  4EMK C;  3V8K A;  5GAN 7;  3JCM J;  1MGQ A;  2DTO A;  3FIF A;  3PGG A;  3SWN C;  3JCM b;  5GAN 3;  4M7D D;  3RES A;  2I2L A;  2QTX A;  3JCM f;  2VXF A;  4NL3 A;  1D3B A;  3JB9 G;  1M8V A;  3FJP A;  4QVD A;  2EJF A;  4WF2 A;  2VC8 A;  4HA8 A;  5GAO n;  2VXE A;  5GAO p;  3HSB A;  4M7D G;  3SWN A;  2E1H A;  3JCM c;  3JB9 F;  3SB2 A;  4XU0 A;  4V2S A;  2ZGW A;  2E41 A;  3JB9 H;  1I81 A;  5GAN d;  2DZ9 A;  5GMK e;  3BW1 A;  4JRI A;  5LJ3 g;  2EJ9 A;  4XQ3 A;  3HFO A;  1I5L A;  4M7D F;  4NL2 A;  3GIB A;  4M75 E;  1WQW A;  2FYK A;  4M75 B;  5GAN 2;  3RUX A;  1BIB A;  4OP0 A;  4PJO E;  3EFR A;  4C8Q E;  3M4G A;  3RKY A;  1I4K 1;  4M78 E;  2EAY A;  2DTH A;  4XTU A;  4XTZ A;  4XU2 A;  5GAM h;  4M78 B;  5GAN h;  3RIR A;  5LJ3 h;  2DXU A;  4F7U E;  1M5Q 1;  5I21 A;  4F7U B;  2DEQ A;  1HK9 A;  3JCM e;  4HT9 A;  3BFM A;  1U1S A;  5LJ5 d;  3JCM P;  3V7C A;  2E64 A;  1WQ7 A;  3JB9 J;  4M75 A;  3V8J A;  3L2Z A;  2RB6 A;  3EFS A;  2CGH A;  4M77 E;  3QUI A;  4M77 B;  4JRK A;  3V8L A; 
#chains in the Genus database with same CATH topology
 2C0O A;  4KGZ B;  2V26 A;  2A37 A;  1M90 R;  1WX6 A;  4L6V 5;  2EWN A;  1VQ4 Q;  4QT7 A;  1DJ7 B;  1YIT A;  1MMD A;  1VIF A;  3FB9 A;  4CRI A;  3HL8 A;  1VYT A;  3E9G A;  3H41 A;  3I5S A;  1JQQ A;  1UB4 A;  2F2X A;  2P4R A;  1HXD A;  2K3Y A;  3VUB A;  1VA7 A;  2PUK B;  3L2Q A;  2JTM A;  3CCL T;  1NM7 A;  4EMK B;  2L0A A;  1YN8 A;  1LOJ A;  3DB3 A;  3VRY A;  3H0F A;  4NOY A;  3VS0 A;  1Q95 G;  1PD1 A;  4OMP A;  1A0N B;  4C8Q F;  5GAN e;  2L3S A;  1JBM A;  3G6E T;  3LW5 E;  1PRM C;  3REB B;  1JRI A;  3MP8 A;  2NWM A;  4EMK A;  4KUL A;  2XHC A;  4ELY C;  1VQM T;  3CC2 A;  2HEQ A;  1QMC A;  1ZA1 B;  1FMV A;  3CBO A;  3M0P A;  3I55 Q;  4IIM A;  3UWN A;  3UA6 A;  2I0N A;  4BE2 A;  2OJ2 A;  3C94 A;  4IUQ A;  5GAN 7;  1NBE B;  1Q81 R;  1SRL A;  2A3L A;  3JCM f;  4NL3 A;  1GBR A;  2DER A;  1LCK A;  1OUL A;  1K73 R;  4ZN1 A;  3UF4 A;  4MZT A;  3NTH A;  1S72 Q;  5GMK e;  4C0D C;  3L2W A;  1I5L A;  3M57 A;  2JJ9 A;  4X1V A;  2GTJ A;  2HBW A;  4IIO A;  1XNI A;  5CQX A;  3CC7 A;  2XMF A;  4Z8A A;  4C5H A;  2EVR A;  1CSK A;  4DBF A;  4TVR A;  1Z9Z A;  3BFM A;  1SSH A;  2DD4 A;  1BI3 A;  1VQP A;  3OYC A;  2C0I A;  2E6Z A;  4BB7 A;  1Q82 R;  2DRK A;  3V8L A;  3NMZ C;  3MEA A;  4C0G A;  5GAO m;  1QCF A;  2HNI A;  2V8I A;  3A8M B;  2P0P A;  2OAW A;  2YUP A;  1VQ7 Q;  1VQN T;  4JUV A;  1X69 A;  4PJO C;  4B6M A;  4C8Q D;  5I2S A;  1ZQ1 A;  5FWB A;  3WVE B;  3OYI A;  1Y57 A;  2J7I A;  3PVL A;  5FU6 C;  3VS4 A;  2ZPH B;  2GFU A;  3CCQ Q;  1P92 A;  2YLC A;  3QDR B;  3DB4 A;  4ZN3 A;  1OZ3 A;  5KYU B;  5I11 A;  4Z02 A;  4A54 A;  5KYW B;  1OU8 A;  3DLL A;  1M2V B;  2OTJ A;  2JNG A;  3CCV Q;  3M55 A;  1KQ1 A;  3G71 Q;  2F2W A;  1D0Y A;  2O4X B;  4RUG A;  1TH7 A;  4EMH A;  5I22 A;  2E5K A;  5KYU A;  3QII A;  5KYW A;  1WJS A;  2LCC A;  2YUQ A;  2K2V A;  3QHS A;  2A08 A;  1TG0 A;  3JCM J;  2DTO A;  3OYJ A;  2O4X A;  3X24 B;  1KC8 U;  2BIV A;  3CC2 T;  1M8V A;  2HQH A;  3PTA A;  2EYW A;  1OV3 A;  2MPX C;  2VXE A;  2DD5 A;  5DM7 R;  1VQK A;  3CPF A;  2LDM A;  2RQW A;  5KYX B;  2GTO A;  2JT4 A;  5A0L A;  4CI0 C;  2MOX A;  2YWW A;  2RF0 A;  1E6H A;  1NLP C;  2DBM A;  4Q5W A;  4N4H A;  4J9D A;  2DEQ A;  2JS0 A;  1IB8 A;  3SD4 A;  1K1Z A;  5KYX A;  2ZPF B;  1U1S A;  1W2B P;  4KRT A;  5CKB A;  2QYZ A;  2JOY A;  2NLU A;  4AFZ C;  4FYV B;  3CC7 T;  2CZ0 B;  2JW4 A;  3CCJ Q;  3C95 A;  1GXI E;  2DL8 A;  5L8R E;  1VQP T;  2K3B A;  5GAM j;  2LMJ A;  3JCM V;  1EZZ B;  1KD1 C;  2L89 A;  3X25 B;  1OPK A;  3X20 B;  2XI9 A;  2D9T A;  1IRX A;  2QK0 A;  3CME Q;  2LC4 A;  2RN8 A;  4PJO G;  1UHC A;  4XU3 A;  2DA9 A;  1NE8 A;  2DKG A;  3MEW A;  3OYH A;  5HK3 A;  4N0A C;  3CBP A;  4LXC A;  2CH4 A;  4PJJ A;  2RHX A;  1WDX A;  3CCU A;  3BDU A;  4J7I A;  4LD9 K;  1ZHI A;  1NJI U;  2DIL A;  1YWO A;  1YI2 A;  1W1F A;  4E7Z A;  3PT9 A;  1SG5 A;  3RR6 A;  3I56 Q;  2JXB A;  1W4S A;  2MWO A;  5KH6 A;  5GAN 6;  3RER A;  1VYV A;  2QEX Q;  2FZC B;  2W10 A;  3QXE B;  2LJ0 A;  3CPW P;  2CP7 A;  3VS3 A;  1MGQ A;  4ZGE B;  1O75 A;  5FRN A;  1I5O B;  2ZPI B;  1C6V X;  2KNB B;  1WJQ A;  1D1B A;  1UFF A;  3QYH B;  1AWX A;  3CCS A;  3OBY A;  4FL6 A;  1QVF S;  1W2B A;  2RI3 A;  2LQK A;  1YWP A;  1G8X A;  1K9M U;  3EFO B;  5A0G A;  3HFO A;  3ME9 A;  2BE7 D;  3GLX A;  2LP5 A;  1G2B A;  4PJO E;  4XU2 A;  2COW A;  2VB6 A;  4PFZ A;  2ABL A;  1HK9 A;  3EGX B;  2LZ6 B;  1ABO A;  1F1B B;  1VQK T;  3EFO A;  3M59 A;  1W2B S;  1AOJ A;  4LN2 A;  2VWF A;  2O2O A;  2VKN A;  1U06 A;  1LVK A;  3EGX A;  5LJ5 h;  1T3S A;  9ATC B;  3CC4 A;  1ZUY A;  4XTW A;  3UPU A;  5GAM f;  1PC0 A;  2X51 A;  1NEB A;  2BZ8 A;  5GAN j;  2M9U A;  5GMK i;  5LJ5 g;  1K0X A;  2K4Y A;  1ZSG A;  4ELZ C;  1SPK A;  4AFS C;  1D1A A;  1YCY A;  2EYX A;  1O9S A;  2R5M A;  3V7S A;  1KC8 R;  4M7A C;  4OMF B;  4ANJ A;  2DL3 A;  2YRD A;  3UDC A;  3CPW A;  2X3W D;  5LJ3 e;  1YHQ A;  2E65 A;  1D0Z A;  2K57 A;  1CKB A;  2COY A;  3LGL A;  1TWB A;  4XTX A;  2DL4 A;  2HZY A;  5IHK A;  3S3O A;  1U8R A;  2FO0 A;  2BZY A;  4DEY A;  2FHD A;  2CP0 A;  1D09 B;  2RHU A;  3MEV A;  5GMK j;  4BI8 B;  4IUR A;  2RQR A;  1VUB A;  2DPP B;  2RHY A;  3PVQ A;  5CVI A;  2FVU A;  5HCK A;  1ZUK A;  2X3X D;  1YIJ A;  3CPW S;  1YI2 T;  2PTK A;  5FU7 C;  4QVD A;  4ME7 A;  2AHJ B;  1JJ2 P;  3A98 A;  2JS2 A;  3LX7 A;  3LYI A;  1HYO A;  4E7L A;  2X35 A;  2ROT A;  1NYF A;  3CQT A;  3M5A A;  4NL2 A;  1UGP B;  2C0T A;  1BB9 A;  3EFR A;  2PVD B;  3AT1 B;  3CCS T;  2COZ A;  1N8R C;  4F7U E;  4E6R A;  1YJN Q;  3OYY A;  5CKE A;  1B07 A;  1AHJ B;  3MET A;  3ER0 A;  5IXB A;  2CSI A;  3ZFJ A;  2X4W A;  2O01 E;  1WQ7 A;  5A0D A;  3L2Z A;  2JZ2 A;  2E6N A;  4RTU A;  3JCM d;  3CMA A;  3PMI A;  5GAO l;  2DVE A;  1BIA A;  3JRZ A;  2Y90 A;  2RD1 A;  1ABQ A;  1N27 A;  2F69 A;  2EQK A;  5GAN f;  4D8D A;  1NJI R;  1TS9 A;  1BCM A;  2LVM A;  1T0J A;  1HD3 A;  2FEI A;  2LX7 A;  4QVZ A;  4A4E A;  3EG1 A;  2KEA A;  4HCC A;  3OS2 A;  3CC4 T;  4LDW A;  2X4Y A;  1G3Y A;  3BDL A;  4C92 C;  4C5I A;  3JCM h;  3GPL A;  3EH2 A;  1K8A U;  1X01 A;  2CZ6 B;  3P8D A;  1K9M R;  1JJ2 A;  4M7A G;  2DM1 A;  1RLP C;  3MPU B;  2OTJ Q;  3EGD B;  4KUD K;  1PKT A;  4MZM A;  3JCM g;  4GLM A;  2KXC A;  3SWN B;  4DBQ A;  4M7D C;  3VU3 C;  1YHQ T;  1VQO Q;  3L2U A;  5C0M A;  1WHH A;  4HCK A;  2K5I A;  2E3H A;  2PQW A;  3OBW A;  3MO8 A;  3R6O A;  3VS6 A;  1N6A A;  1V29 B;  3SWN A;  1RUW A;  1FYN A;  1JJ2 S;  2E1H A;  3SB2 A;  1M3B A;  2DZ9 A;  3OA6 A;  4MDX A;  2L3P A;  3GIB A;  2E70 A;  3MEU A;  1BI1 A;  2RPN A;  1YIJ T;  3TEE A;  3M9Q A;  4R0K A;  2KSS A;  3M54 A;  3L2V A;  4E7J A;  1RAH B;  2KVQ G;  5L23 A;  4JS5 A;  2FRY A;  1YCS B;  5DLQ E;  5J3B A;  3S6W A;  4OB2 B;  1VQ9 Q;  1ZSZ B;  4M7A E;  2HD0 A;  4Y28 E;  2NUT B;  4ZGJ B;  2K2M A;  4E7K A;  1J3T A;  2EQI A;  4J7F A;  2ZZD A;  3NTK A;  4C8Q B;  2ENM A;  2DK3 A;  1ZSZ A;  4UC4 A;  2WSE E;  1KK7 A;  1NG2 A;  4EPC A;  2XID A;  2NUT A;  2WSF E;  2GBQ A;  3CMA T;  3F70 A;  1RAG B;  3X28 B;  4D8K A;  4C8Q A;  1M30 A;  2P4T A;  2X4J A;  2KQW A;  2YLB A;  5J26 A;  2KT8 A;  1ZX6 A;  4PFO A;  1I1J A;  1IZ6 A;  4LUE A;  4FSS A;  5CAI A;  4DEX A;  2DF6 A;  2A36 A;  1GCQ C;  3EHQ A;  1BK2 A;  2DFU A;  2VGM A;  3TQ7 P;  4HCZ A;  1WHG A;  4C92 G;  4OGE A;  3CCU Q;  3ASK A;  4J6X A;  4RTW A;  3M0T A;  3VYH B;  4BY6 C;  2EGC A;  1NEG A;  2RK1 A;  3G1J A;  4IUU A;  3P8B B;  1FXX A;  2RJF A;  2LJ3 A;  3JB9 G;  2CZ7 B;  2EJF A;  5A2Q E;  2FZG B;  4M7D G;  4LDV A;  2DAQ A;  1SHF A;  8ATC B;  3BW1 A;  5LJ3 g;  2J6K A;  3CXC S;  3VJP A;  1RAA B;  4OP0 A;  1AWO A;  5HK0 A;  3M4G A;  1I4K 1;  3TU4 K;  2JMC A;  2HMA A;  1VQ5 Q;  2VAS A;  5CKD A;  2DXU A;  4X34 A;  1QVG P;  3FEO A;  1GRI A;  2VYT A;  2O9S A;  2XDB A;  2F2V A;  2CRE A;  2QAS A;  2AZS A;  4DOW A;  2J05 A;  4NS5 A;  4BDY A;  1X75 C;  3O5Z A;  5IHN A;  3QBY A;  2O9V A;  2EIF A;  2DYB A;  2L8D A;  4OB3 B;  1ZA2 B;  4C92 E;  3C0C A;  2KK4 A;  5GAO q;  4JRQ A;  3AHU A;  1PCX A;  1M90 C;  1RAF B;  1K0S A;  4Y92 A;  4JLI A;  2DMO A;  2QGF B;  1WYX A;  2AZV A;  2HAX A;  4M75 C;  4LDU A;  1K8A R;  2QEX T;  2RI5 A;  1LJO A;  5LJ3 j;  2F5T X;  2BUD A;  2BE9 B;  2AKK A;  3V7R A;  1KIK A;  1OX9 A;  1B34 B;  1OPL A;  4M7D E;  2YUN A;  4JS4 A;  2M0Y A;  1VQ6 Q;  3SFM A;  2A28 A;  1WGS A;  2W0Z A;  4DBR A;  4J6W A;  2L3R A;  2EBP A;  3OSV A;  2G6F X;  2OTL A;  2JTF A;  3HHT B;  2PVO B;  1B34 A;  1NPR A;  1YJW A;  3ZEH A;  1QWF A;  5CKF A;  2E5Q A;  4A4F A;  5GAM d;  2MF2 A;  1MMN A;  3JCM X;  1Q86 C;  2K7A A;  4AMC A;  4PJM A;  2MWP A;  1H64 1;  2E4H A;  1Q81 C;  4KBM B;  3PGG A;  1EIF A;  3JCM b;  3RES A;  1XQH A;  4CC3 A;  3WVD B;  1QVG A;  2K9G A;  4KUI A;  4J9G A;  4HVV A;  2SEM A;  2IPO B;  2DX1 A;  1IGQ A;  2KMT A;  1M3A A;  4PFP A;  1HSQ A;  2JM9 A;  4JJD A;  4BAC A;  1IHV A;  1ZLM A;  4BDZ A;  4D6W A;  1UGQ B;  5GAM h;  1WLP B;  3H0I A;  4L5G A;  4ZTJ A;  1BKB A;  1QVF P;  3CCM A;  2QA4 Q;  1QVG S;  2RQT A;  1PHT A;  2O31 A;  1Q82 C;  5GAM g;  4HVW A;  1VQ8 A;  3CD6 A;  4DBH A;  2CUB A;  3CCE A;  5LJ3 f;  2DJZ A;  4J9F A;  1I8F A;  1G3T A;  3SEM A;  5KCH A;  3HKS A;  3H6Z A;  4BD3 A;  1TUG B;  2KT1 A;  1UEC A;  4M78 C;  1VQL A;  2EW3 A;  1B7T A;  3JB9 I;  4M75 G;  2HQX A;  5FW9 A;  3PE0 A;  2E10 A;  3JAM E;  4IUT A;  2CKK A;  2G3R A;  4JZ3 A;  4M77 C;  5DY9 A;  3LWI A;  4ZTF A;  3GBQ A;  4ESR A;  3HP9 A;  3PIO A;  2WAC A;  3CCL Q;  1EX4 A;  4C0D B;  3L2R A;  3G4S A;  2EGE A;  2AK5 A;  4BE1 A;  4B9X A;  3U23 A;  4Z88 A;  3QWX X;  2OTL T;  3EG2 A;  2RH2 A;  1YJ9 T;  2EJG A;  2EQM A;  3G6E Q;  1XJW B;  1KG1 A;  2HSP A;  3E9F A;  2XG8 D;  2MI6 A;  3HFN A;  1VQM Q;  1KHC A;  5GAN 3;  2I2L A;  2QTX A;  2J6F A;  1YJW T;  3MP1 A;  3CCR A;  3HRS A;  1TTH B;  4WF2 A;  1QVF A;  1WXB A;  3EAE A;  4FYY B;  4EDU A;  2OX7 A;  3JCM c;  3OS0 A;  2RMO A;  4V2S A;  1QWE A;  3G7Z A;  5IAY A;  4JDS A;  2A7Y A;  1NLO C;  1MUZ A;  4M75 E;  1WQW A;  2DRM A;  1QP3 A;  3IQL A;  1QLY A;  1G5V A;  2A0F B;  4XTU A;  4XTZ A;  5IXF A;  5GAN h;  1GFC A;  1ACM B;  3T9N A;  1NYG A;  2KYB A;  4M4Z A;  5LJ5 d;  2H8H A;  4OB0 B;  1U3O A;  2RB6 A;  1AZE A;  2RQU A;  2MYS A;  5GAN g;  2WSC E;  2HCK A;  1T3L A;  2KR3 A;  5CO7 A;  2J06 A;  1Q7Y U;  1AVZ C;  3M0S A;  3CCM T;  1KJW A;  2KRM A;  2IIM A;  2JUF A;  1K9A A;  1VQO T;  2OI3 A;  3I55 A;  4E7H A;  2KBT A;  1GCP A;  3URG A;  1JB0 E;  3OW2 S;  4ATO A;  3QZ9 B;  3A8G B;  1SKU B;  2XU8 A;  2ED1 A;  1VQ8 T;  5GMK h;  2R57 A;  3CD6 T;  4J9I A;  1VQN Q;  2DL7 A;  2M51 A;  1H92 A;  3VS2 A;  3CCE T;  4M78 G;  5KE3 A;  2D0N A;  2ATC B;  3VS1 A;  3OYG A;  4PJO F;  1S72 A;  1AWW A;  1MNE A;  8AT1 B;  1VQL T;  4OGC A;  1E7O A;  4M77 G;  5GAO r;  1YIT Q;  3H0H A;  1YFN A;  2K6D A;  3MHX A;  5KYN A;  4AFQ C;  4B9W A;  2DXC A;  1WNL A;  4JJB A;  3FLG A;  3FIF A;  3SWN C;  3QZ5 B;  5D6W A;  1WXU A;  2NUZ A;  4QQD A;  2VGN A;  3G4S T;  1PKS A;  4XU0 A;  1W70 A;  2KI7 A;  3QJY A;  2E41 A;  1I07 A;  3FJ5 A;  1I81 A;  2EJ9 A;  1VQ7 A;  4PJN A;  1QW1 A;  3CC2 Q;  5C6S A;  1JO8 A;  2FYK A;  1RAC B;  3M0U A;  3CBM A;  2EKO A;  2EAY A;  4M78 E;  3CCR T;  1PD0 A;  2QQS A;  1M5Q 1;  1S1N A;  4F7U B;  2V1Q A;  3TRE A;  1KHI A;  2V8K A;  2RQV A;  3A1P A;  1ZBJ A;  3CCQ A;  2DBK A;  5GJV B;  1VQ4 T;  1JXM A;  5M9O A;  3JB9 J;  4A4H A;  2CGH A;  2DIQ A;  4M77 E;  1WHM A;  3QUI A;  4HVU A;  3SHW A;  2M1H A;  4F7U A;  1T0H A;  4HXJ A;  2RI2 A;  3CCV A;  2RJC A;  4RTZ A;  4E7I A;  2CP2 A;  5D6X A;  4O5V A;  4Z89 A;  3J81 E;  4BE0 A;  3Q1J A;  1X6G A;  4R55 A;  4N0A A;  4C8Q C;  2GGR A;  2EGA A;  4PJO D;  2LNV A;  5GAN 5;  2FL7 A;  3CC7 Q;  3NFC A;  1WHK A;  2MCN A;  2QTV A;  2L5Q A;  1N9S A;  2PU9 B;  1SSF A;  1VQP Q;  2QQR A;  1KC8 C;  1OZ2 A;  1M2O A;  5CIU A;  2J6O A;  3UT1 A;  2RM4 A;  3I55 T;  4X9D A;  4MMK A;  1RAD B;  4ORZ A;  2XKO C;  2EFI A;  1QP2 A;  5GJW B;  4F7U F;  2EPD A;  3LH0 A;  1M1K C;  2R5A A;  1B3Q A;  1UTI A;  1ZBX A;  2JN0 A;  1TSF A;  4OMO A;  1FMK A;  3UA7 A;  4DOV A;  4KH1 B;  2BKD N;  3L1A A;  4C0F A;  1S72 T;  4EMK C;  3V8K A;  4AFU C;  1Y0M A;  3RNJ A;  3FJP A;  4RTX A;  3D7S B;  5CKH A;  2KDS A;  1AZG B;  4FT2 A;  1M3C A;  1PSE A;  1YNZ A;  4JRP A;  5IHI A;  4DA4 A;  4FT4 A;  4WCI A;  3CCJ A;  2NUP B;  4J83 A;  3A8H B;  1Q7Y R;  1TOV A;  2X4X A;  3MCA B;  1BIB A;  4WTO B;  2HSE B;  1OYX A;  2FPD A;  2QI2 A;  1N5Z A;  2CP3 A;  5KE2 A;  3RIR A;  3OS1 A;  2GFA A;  1TU0 B;  3CME A;  2NUP A;  1SRM A;  2QAZ A;  3GNF B;  3EHR A;  4YTL A;  2YT6 A;  1VQ7 T;  1H3Z A;  2P0K A;  3QG1 A;  3CXC P;  2K3X A;  4M7A B;  2CP5 A;  3OYD A;  1UEB A;  2GCX A;  3I5R A;  4BUG A;  2DEU A;  1VQK Q;  1UUE A;  1NJI C;  6AT1 B;  3CCQ T;  2ZAE A;  3I56 A;  3OYB A;  1ARK A;  2HKN A;  4M7A A;  1BI0 A;  3RKW A;  3OYE A;  2QEX A;  3LLR A;  3KXT A;  3NHN A;  3INZ A;  1V1C A;  4JPB W;  3CCV T;  1AEY A;  1LNX A;  4J9E A;  3QO3 A;  3EH1 A;  4C8Q G;  3G71 T;  1R0B G;  1K4U S;  1W6X A;  3A5Z B;  5FRO A;  1OU9 A;  1WHL A;  4QW2 A;  4N4G A;  2HQE A;  1K9M C;  1UGS B;  2KGT A;  4FSX A;  2DZC A;  1KD1 U;  1VOM A;  5LJ3 d;  1XTD A;  2DXB A;  1EFN A;  4BI3 A;  4R56 A;  4FW1 A;  4M7A F;  2XK0 A;  4OMN A;  2XDP A;  3BY7 A;  4EIK A;  2VUB A;  3EG0 A;  3OYF A;  4PKC C;  4LDY A;  5CCA A;  4E47 A;  1BBZ A;  1QVP A;  2EYZ A;  2HL5 C;  2QDL A;  1Y07 A;  1X43 A;  1UGR B;  2PNI A;  2LNH B;  4F14 A;  2XIC A;  1JU5 C;  2GQV A;  2KRS A;  1YI2 Q;  1PRL C;  3CXC A;  4GY5 A;  1WHJ A;  3RUX A;  1PSF A;  4N4I A;  1LPL A;  1NPP A;  4C8Q E;  3RKY A;  4VUB A;  2YRV A;  2P0Q A;  3OSS C;  5LJ3 h;  4PL6 A;  2CP6 A;  1GL5 A;  3THK A;  4HT9 A;  2RHZ A;  3QWY A;  1X2Q A;  3CCJ T;  1IXD A;  3V8J A;  2GF7 A;  4JRK A;  3CCS Q;  4P5N A;  4C92 B;  1D0X A;  1IRE B;  1E6G A;  1GFD A;  2DXT A;  4FCY A;  5EC7 A;  4XTY A;  5GAN 8;  4XU1 A;  3CME T;  3OS5 A;  2FB7 A;  1U1T A;  4QVC A;  3QDF A;  1UGV A;  1AWJ A;  1M8M A;  4C92 A;  1AT1 B;  3PMT A;  1SHG A;  2QG9 B;  3PFS A;  1N9R A;  1M27 C;  1OX8 A;  2F5K A;  4M7D B;  3H8Z A;  4XTV A;  4MML A;  1PG5 B;  1Q86 R;  1FMW A;  2B8A A;  2YHT A;  1X27 A;  4C5G A;  1Y96 B;  3I56 T;  4M7A D;  1YP5 A;  1WXT A;  1OEB A;  4M7D A;  2VV5 A;  4FU6 A;  3CC4 Q;  1RI0 A;  4KGV B;  4IUV A;  1MMA A;  4OB1 B;  2RNA A;  3GOX A;  3VV0 A;  2LRQ A;  1Y96 A;  1NZ9 A;  2F1L A;  1YJN A;  4C5E A;  4C92 F;  1UE9 A;  4ZNX A;  5LJ5 e;  3M53 A;  2KE9 A;  1RAI B;  1YJ9 A;  2K79 A;  3DKM A;  5AT1 B;  1G3S A;  3M0Q A;  4MDW A;  4FIB A;  3JB9 F;  1YHQ Q;  2ESW A;  1R0C B;  3TCJ A;  3KFV A;  4JRI A;  2E3I A;  1VIE A;  4M7D F;  1UDL A;  1K76 A;  2JM8 A;  2FPF A;  2GQI A;  1XOV A;  5I21 A;  4FW2 A;  4GBQ A;  2O88 A;  1H8K A;  1K73 C;  3HRU A;  2KAF A;  1Y71 A;  3OYN A;  3PNW C;  4PLI A;  4J9B A;  1YIJ Q;  4AG1 C;  4II1 A;  2QXF A;  4IKF A;  4JJN K;  2LX9 A;  1WI7 A;  5GMK m;  1PNJ A;  4CC4 B;  1YIT T;  2CT3 A;  3PIP A;  3JCM W;  4RTY A;  2AIR B;  1K8A C;  1V76 A;  2R58 A;  3P8H A;  4XK8 E;  3MJX A;  4OMM A;  4LE9 A;  2DL5 A;  4J9H A;  4BY6 B;  1N8R U;  1KD1 R;  4QKU A;  4RTT A;  2MK5 A;  1SF9 A;  4Y91 A;  4BI4 A;  3OYM A;  2L2P A;  1VQO A;  1GCQ A;  1MV0 B;  2KRN A;  1M2V A;  2MAM A;  1MMG A;  1BU1 A;  4KT0 E;  1JEG A;  3JCM Q;  3I9Q A;  3J80 E;  3CMA Q;  3C12 A;  1X6O A;  4C92 D;  2CZ1 B;  2B86 A;  3VKI A;  5FWC A;  3OW2 P;  1QCN A;  2P84 A;  4HT8 A;  1GBQ A;  2ZCF B;  4KH0 B;  4RTV A;  4J5Y A;  1H3H A;  2DTI A;  4AT1 B;  3BE3 A;  2CYZ B;  1M1K U;  3C4S A;  5KYY B;  2RJD A;  4A4G A;  3JB9 D;  1WPY A;  2ECZ A;  4LUD A;  4EMG A;  5CK9 A;  2VVK A;  3LGF A;  4J9C A;  3RMQ A;  3RKX A;  4M7D D;  1R8O B;  2RHI A;  1VQ9 A;  4RMO A;  5KYY A;  2D6F A;  4FYW B;  2HDA A;  3HSB A;  4F04 B;  1JXO A;  1YJN T;  4C0Z A;  2M0O A;  5GAN d;  4E2F B;  1UHF A;  5ECA A;  3VRZ A;  4OF1 A;  2EYQ A;  1MND A;  4M75 B;  3OMC A;  3DLM A;  2DTH A;  4ZGD B;  3R6N A;  4AG2 C;  3FRN A;  3JCM e;  1Z9Q A;  3TSZ A;  2KY9 A;  1OI1 A;  5FLX E;  1BYM A;  4JLG A;  3WXM B;  1M1G A;  4M75 A;  1WZO A;  5CQY A;  1UG1 A;  1VQ4 A;  4L59 A;  1C0M A;  1Y7X A;  4OVA A;  4A53 A;  2DE0 X;  1U5S A;  3QJ6 A;  3A8O B;  2HBP A;  2LCS A;  2D0Q B;  3O8V A;  4PJO B;  2LJ1 A;  2XD0 A;  1IGU A;  3E2U A;  3OY9 A;  2H3E B;  5J39 A;  3MKD A;  1TUC A;  2LQN A;  2BZX A;  5DLO A;  1QKX A;  5FU6 B;  3ULR B;  2EKH A;  3OW2 A;  7AT1 B;  3EG9 B;  3LH5 A;  1AD5 A;  4IUP A;  3S3M A;  4PJO A;  3RBB B;  5GAN 4;  4OML A;  1KQ2 A;  2DIG A;  1RL2 A;  3M0R A;  3TSW A;  2OTJ T;  1KSW A;  2LQ8 A;  4M75 F;  3ZL7 C;  3EG9 A;  5D6Y A;  1WA7 A;  3M4Y A;  2DO3 A;  4LNP A;  2DET A;  3QYG B;  2BTT A;  1UJY A;  1BCO A;  4HCB A;  3OB9 A;  2ZPB B;  1MV3 A;  2LQW A;  3FC3 A;  5LL6 S;  1VQ5 A;  4E7S A;  3I35 A;  2AT1 B;  3QSU A;  2MIO A;  3VS5 A;  3X26 B;  1WIE A;  4OMQ A;  3VUZ A;  3REA B;  3EGU A;  4K11 A;  2VC8 A;  4HA8 A;  5GAO p;  4RG2 A;  1X2K A;  2V8J A;  3H9N A;  2ZGW A;  3JB9 H;  2FRW A;  4J8O A;  3GF5 A;  4CC7 A;  2KYM A;  1VYU A;  2V1R A;  1VQ9 T;  4CC2 A;  3HTR A;  4M78 B;  4PLL A;  2LCL A;  1N8R R;  1VQ6 A;  2Z0W A;  1X6B A;  4JZ4 A;  3M56 A;  1MHN A;  3JCM P;  2E64 A;  3MP6 A;  3EFS A;  1OQK A;  3JV3 A;  4M77 B;  2ROL A;  4M78 A;  3VS7 A;  1RI9 A;  3OYK A;  4F7U G;  4A63 B;  4X9C A;  4J6Y A;  1TXQ A;  3OQ5 A;  2FG0 A;  3L42 A;  3ZBD A;  4M77 A;  3HPW A;  2H3J A;  1BI2 A;  4M75 D;  2X9H A;  3VYG A;  2QDY B;  3J7A F;  1IHW A;  4LD6 A;  1M1K R;  4RCC A;  2GNC A;  1M4Z A;  3A8L B;  2JMA A;  2XDD A;  2PVG B;  1ZSZ C;  3CCU T;  2EYY A;  1YBY A;  1G3W A;  5LJ5 j;  3G71 A;  3JSC A;  1OOT A;  1M90 U;  1KQS P;  4M78 F;  2DYI A;  2QGG A;  4RKU E;  2D1X A;  2DJQ A;  2M02 A;  1ZUU A;  4MZP A;  3GP8 A;  1D3B B;  1D1C A;  1RAE B;  2PZ1 A;  4FYX B;  2QQ9 A;  4A4K A;  3S3N A;  5CR2 A;  5D7U A;  4M77 F;  2OAU A;  2QA4 A;  2EQJ A;  3KUF A;  3OMG A;  3OYL A;  2CDT A;  2HKQ B;  1IO6 A;  2RK2 A;  2VXF A;  4JJC A;  1D3B A;  2KXD A;  4PK4 A;  2OTL Q;  2EQU A;  1UJ0 A;  4FM4 B;  2JVV A;  2LT1 A;  1YJ9 Q;  1VQ5 T;  3RDV A;  3GNG A;  3QKJ A;  2K5F A;  2LT4 A;  4XQ3 A;  2CT4 A;  1YJW Q;  4XAX B;  5GAN 2;  2PUO B;  1FWZ A;  2CUD A;  2RO0 A;  4KGX B;  2AKL A;  2DVJ A;  1Q86 U;  2IVW A;  2LTO A;  3M58 A;  3SDZ A;  1Q81 U;  4PJL A;  5AYF A;  2KRO A;  1RLQ C;  2MMP A;  3KBG A;  1WFW A;  3N5B B;  2ZPE B;  2FZK B;  2L3Q A;  1K73 U;  1PWT A;  2DNU A;  1CKA A;  4O6J A;  2HL3 A;  3EG3 A;  3LWH A;  3QPH A;  2E12 A;  5GMK l;  2Y4X A;  1R77 A;  2CS7 A;  2NYS A;  4RCB A;  2SRC A;  2M16 A;  3CCL A;  2JTE A;  1C1A A;  5FRM A;  1VQ6 T;  2RA2 A;  2YDL A;  4GLK A;  2FPE A;  2DLP A;  1KFZ A;  1KQS A;  1QKW A;  2RJE A;  3G6E A;  4M78 D;  5KCO A;  1VQM A;  4DQ2 A;  1TUD A;  1QQJ A;  4QQ6 A;  3CCM Q;  1FX7 A;  1M9S A;  1Q82 U;  5LJ5 f;  2YRC A;  4PNO A;  4M77 D;  2D8H A;  5GAM e;  3EGD A;  1VQ8 Q;  3HRT A;  5EG2 A;  3CD6 Q;  1KQS S;  4HKE A;  3OYA A;  5I2M A;  3CCE Q;  1QCO A;  3CEY A;  3RMS A;  2YUO A;  3NPF A;  4LDX A;  2CSQ A;  5IT9 E;  3UAT A;  1HJD A;  1VQL Q;  1G83 A;  3FDR A;  4F16 A;  3TVT A;  5FU7 B;  2IG0 A;  2ZPG B;  1WJR A;  2ED0 A;  4QQG A;  5IN1 A;  5GAO n;  2CH4 W;  3NTI A;  4F17 A;  2YSQ A;  4RG8 A;  2QQB A;  5IH2 A;  2QA4 T;  1M1F A;  1Q7Y C;  3E19 A;  2YXY A;  3G4S Q;  2K5L A;  1SEM A;  2D8J A;  1I0C A;  1PM3 A;  3NGP A;  1RAB B;  3E1S A;  5HKC A;  2Y4Y A;  2QQA A;  1VQN A;  3V7C A;  2C06 A;  5HY6 A;  3CCR Q; 
#chains in the Genus database with same CATH homology
 3JCM d;  3CMA A;  4JJN K;  5GAN g;  2WSC E;  3PMI A;  2LX9 A;  5GAO l;  2DVE A;  1BIA A;  5GMK m;  3JRZ A;  2Y90 A;  2RD1 A;  1YIT T;  5CO7 A;  3PIP A;  1N27 A;  3JCM W;  4L6V 5;  2EWN A;  2F69 A;  1Q7Y U;  2EQK A;  5GAN f;  1K8A C;  3CCM T;  1DJ7 B;  1YIT A;  2R58 A;  1VIF A;  2JUF A;  3P8H A;  4XK8 E;  3FB9 A;  4CRI A;  1VQO T;  3I55 A;  4E7H A;  3HL8 A;  2LVM A;  4BY6 B;  1N8R U;  3URG A;  1JB0 E;  3E9G A;  3OW2 S;  4ATO A;  3QZ9 B;  1UB4 A;  3A8G B;  4Y91 A;  4BI4 A;  3OYM A;  4QVZ A;  4A4E A;  2XU8 A;  1VQ8 T;  1VQO A;  1HXD A;  2K3Y A;  3VUB A;  5GMK h;  2PUK B;  3L2Q A;  4HCC A;  2JTM A;  2R57 A;  3OS2 A;  3CCL T;  3CD6 T;  4EMK B;  2MAM A;  3CC4 T;  4LDW A;  4KT0 E;  3CCE T;  4M78 G;  5KE3 A;  1LOJ A;  2X4Y A;  1G3Y A;  3DB3 A;  4NOY A;  3JCM Q;  3BDL A;  4C92 C;  3J80 E;  3OYG A;  3C12 A;  1X6O A;  4PJO F;  4C5I A;  4C8Q F;  4C92 D;  5GAN e;  2CZ1 B;  3JCM h;  1JBM A;  1S72 A;  3VKI A;  3G6E T;  3LW5 E;  3GPL A;  1VQL T;  1JRI A;  4OGC A;  3MP8 A;  4EMK A;  1K8A U;  1X01 A;  4KUL A;  4HT8 A;  2XHC A;  4ELY C;  1VQM T;  4M77 G;  2ZCF B;  2CZ6 B;  3CC2 A;  3P8D A;  1JJ2 A;  4M7A G;  5GAO r;  4J5Y A;  2DTI A;  3CBO A;  2CYZ B;  1M1K U;  3MHX A;  4KUD K;  3C4S A;  3UWN A;  2RJD A;  4MZM A;  3JCM g;  4A4G A;  1WPY A;  4BE2 A;  3JB9 D;  3SWN B;  3C94 A;  5CK9 A;  4B9W A;  2DXC A;  4EMG A;  3LGF A;  4IUQ A;  3VU3 C;  1YHQ T;  1WNL A;  3RMQ A;  4M7D C;  3RKX A;  5GAN 7;  3FLG A;  3L2U A;  3FIF A;  5C0M A;  3SWN C;  4M7D D;  3QZ5 B;  1R8O B;  2A3L A;  5D6W A;  2K5I A;  2RHI A;  3JCM f;  4NL3 A;  1VQ9 A;  2PQW A;  4QQD A;  2VGN A;  3OBW A;  3MO8 A;  3G4S T;  4RMO A;  4ZN1 A;  2D6F A;  3R6O A;  1N6A A;  3HSB A;  1V29 B;  3SWN A;  4MZT A;  3NTH A;  1YJN T;  1JJ2 S;  2E1H A;  4C0Z A;  3SB2 A;  4XU0 A;  3QJY A;  2E41 A;  2M0O A;  1I81 A;  5GAN d;  2DZ9 A;  5GMK e;  4C0D C;  3OA6 A;  4MDX A;  3L2W A;  2EJ9 A;  1VQ7 A;  1I5L A;  4OF1 A;  1QW1 A;  2E70 A;  3M57 A;  3MEU A;  3GIB A;  5C6S A;  2EYQ A;  2FYK A;  4M75 B;  1BI1 A;  3OMC A;  3DLM A;  1YIJ T;  3CBM A;  3TEE A;  2EKO A;  2EAY A;  2DTH A;  2KSS A;  1XNI A;  3M54 A;  3M9Q A;  4M78 E;  4ZGD B;  3L2V A;  5CQX A;  2QQS A;  3CCR T;  3CC7 A;  4C5H A;  1M5Q 1;  2KVQ G;  4F7U B;  3FRN A;  3JCM e;  3TRE A;  4TVR A;  1KHI A;  2KY9 A;  3BFM A;  1OI1 A;  5FLX E;  2V8K A;  4JS5 A;  2DD4 A;  4JLG A;  3WXM B;  1BYM A;  1BI3 A;  3CCQ A;  1VQP A;  1M1G A;  3OYC A;  5DLQ E;  5J3B A;  3S6W A;  5M9O A;  4M75 A;  3JB9 J;  1VQ4 T;  4A4H A;  4OB2 B;  2E6Z A;  2CGH A;  2DIQ A;  4M77 E;  4BB7 A;  3QUI A;  4M7A E;  3V8L A;  2HD0 A;  4Y28 E;  5CQY A;  1VQ4 A;  4L59 A;  2M1H A;  1Y7X A;  3MEA A;  4C0G A;  4F7U A;  4OVA A;  4ZGJ B;  2RI2 A;  4A53 A;  5GAO m;  3CCV A;  4E7K A;  2RJC A;  3QJ6 A;  3A8O B;  2HNI A;  2HBP A;  2V8I A;  3A8M B;  4E7I A;  2D0Q B;  3O8V A;  4J7F A;  2P0P A;  2ZZD A;  4PJO B;  3NTK A;  4C8Q B;  2DK3 A;  2XD0 A;  5D6X A;  1VQN T;  4JUV A;  4O5V A;  3OY9 A;  3J81 E;  4BE0 A;  3Q1J A;  4R55 A;  4N0A A;  4UC4 A;  4PJO C;  2WSE E;  4C8Q C;  5J39 A;  5DLO A;  5FU6 B;  4EPC A;  4PJO D;  2XID A;  4C8Q D;  2LNV A;  2WSF E;  3OW2 A;  5I2S A;  1ZQ1 A;  3OYI A;  3F70 A;  2FL7 A;  3WVE B;  5GAN 5;  3CMA T;  3NFC A;  5FU6 C;  3X28 B;  2L5Q A;  4IUP A;  1N9S A;  3S3M A;  4PJO A;  4C8Q A;  2ZPH B;  5GAN 4;  2PU9 B;  2GFU A;  2P4T A;  1SSF A;  1P92 A;  2QQR A;  2YLC A;  1KQ2 A;  2X4J A;  2KQW A;  2DIG A;  1RL2 A;  2YLB A;  3DB4 A;  3QDR B;  1OZ2 A;  4ZN3 A;  1KC8 C;  1OZ3 A;  2LQ8 A;  2OTJ T;  5J26 A;  4M75 F;  5CIU A;  3UT1 A;  4Z02 A;  2RM4 A;  5D6Y A;  4A54 A;  3I55 T;  3M4Y A;  1IZ6 A;  2DO3 A;  4MMK A;  3QYG B;  4X9D A;  3DLL A;  2OTJ A;  2JNG A;  2XKO C;  2EFI A;  5CAI A;  1QP2 A;  4F7U F;  3M55 A;  4HCB A;  1KQ1 A;  2VGM A;  3LH0 A;  4HCZ A;  1M1K C;  3OB9 A;  2R5A A;  2ZPB B;  2O4X B;  4C92 G;  4OGE A;  1TH7 A;  4EMH A;  3ASK A;  4J6X A;  1ZBX A;  3VYH B;  3FC3 A;  2JN0 A;  5LL6 S;  4BY6 C;  3QII A;  1VQ5 A;  4DOV A;  1WJS A;  2BKD N;  2LCC A;  3L1A A;  2K2V A;  3QHS A;  4C0F A;  3QSU A;  2RK1 A;  4IUU A;  1S72 T;  4EMK C;  3V8K A;  3JCM J;  2DTO A;  3P8B B;  3X26 B;  3OYJ A;  2O4X A;  3X24 B;  1FXX A;  2RJF A;  3VUZ A;  1KC8 U;  2BIV A;  3JB9 G;  3CC2 T;  2CZ7 B;  3FJP A;  1M8V A;  3PTA A;  5CKH A;  2EJF A;  2VC8 A;  2KDS A;  4HA8 A;  4FT2 A;  5A2Q E;  2VXE A;  2DD5 A;  5GAO p;  4RG2 A;  4M7D G;  1PSE A;  4LDV A;  5DM7 R;  2V8J A;  4JRP A;  2DAQ A;  1VQK A;  2ZGW A;  4DA4 A;  3CPF A;  4FT4 A;  2LDM A;  3JB9 H;  3BW1 A;  5LJ3 g;  3CCJ A;  4J8O A;  4J83 A;  3GF5 A;  5A0L A;  4CI0 C;  3CXC S;  3A8H B;  3VJP A;  2X4X A;  3MCA B;  1BIB A;  4OP0 A;  1VQ9 T;  5HK0 A;  1OYX A;  2QI2 A;  3M4G A;  1I4K 1;  5KE2 A;  3TU4 K;  5CKD A;  4M78 B;  4PLL A;  3RIR A;  2DXU A;  4Q5W A;  4N4H A;  3OS1 A;  2LCL A;  4X34 A;  2DEQ A;  2GFA A;  3FEO A;  2VYT A;  3SD4 A;  1VQ6 A;  2XDB A;  3CME A;  3M56 A;  2ZPF B;  1U1S A;  1MHN A;  3JCM P;  2E64 A;  4DOW A;  4BDY A;  4NS5 A;  1X75 C;  3MP6 A;  3EFS A;  3GNF B;  3QBY A;  4YTL A;  1VQ7 T;  1H3Z A;  5CKB A;  2EIF A;  2P0K A;  4M77 B;  2L8D A;  2JOY A;  3QG1 A;  4M78 A;  2K3X A;  4OB3 B;  4M7A B;  4C92 E;  3OYD A;  3OYK A;  2KK4 A;  5GAO q;  1UEB A;  4JRQ A;  3AHU A;  2GCX A;  1M90 C;  2NLU A;  4BUG A;  4F7U G;  3CC7 T;  2CZ0 B;  4JLI A;  5FRN A;  4X9C A;  4J6Y A;  1NJI C;  2HAX A;  3C95 A;  3OQ5 A;  1GXI E;  4M75 C;  4LDU A;  3L42 A;  4M7A A;  2QEX T;  5L8R E;  3CCQ T;  1VQP T;  2RI5 A;  3ZBD A;  4M77 A;  3JCM V;  5GAM j;  1LJO A;  2H3J A;  1BI2 A;  3HPW A;  4M75 D;  2F5T X;  5LJ3 j;  3OYB A;  2BUD A;  3VYG A;  1BI0 A;  3I56 A;  2QDY B;  2L89 A;  3RKW A;  1KD1 C;  3OYE A;  3J7A F;  3V7R A;  3X25 B;  4LD6 A;  2QEX A;  3LLR A;  3KXT A;  1B34 B;  4RCC A;  3X20 B;  2XI9 A;  2D9T A;  3INZ A;  4M7D E;  4JS4 A;  1M4Z A;  3CCV T;  3SFM A;  3A8L B;  1LNX A;  2LC4 A;  1WGS A;  3QO3 A;  4PJO G;  4C8Q G;  3G71 T;  4XU3 A;  4J6W A;  2PVG B;  1NE8 A;  2DKG A;  3MEW A;  2L3R A;  2XDD A;  3OYH A;  5HK3 A;  3OSV A;  4N0A C;  3CCU T;  3CBP A;  2OTL A;  1YBY A;  2JTF A;  3A5Z B;  3HHT B;  1G3W A;  5LJ5 j;  5FRO A;  2PVO B;  3G71 A;  3JSC A;  2RHX A;  1B34 A;  1M90 U;  4M78 F;  3CCU A;  4QW2 A;  3BDU A;  4N4G A;  4RKU E;  4J7I A;  4LD9 K;  1ZHI A;  2HQE A;  1NJI U;  1NPR A;  1YJW A;  1YI2 A;  1K9M C;  1UGS B;  3ZEH A;  5CKF A;  2E5Q A;  4A4F A;  4MZP A;  3PT9 A;  4FSX A;  5GAM d;  2MF2 A;  2DZC A;  3GP8 A;  1D3B B;  3S3N A;  1KD1 U;  5LJ3 d;  4A4K A;  1XTD A;  2QQ9 A;  2DXB A;  5CR2 A;  4M77 F;  1W4S A;  3JCM X;  1Q86 C;  2MWO A;  4BI3 A;  5KH6 A;  2OAU A;  4R56 A;  5GAN 6;  4M7A F;  3RER A;  2XK0 A;  3QXE B;  2QA4 A;  2XDP A;  3BY7 A;  2MWP A;  1H64 1;  1Q81 C;  2EQJ A;  4KBM B;  3KUF A;  1MGQ A;  2VUB A;  3OMG A;  3PGG A;  1EIF A;  4ZGE B;  1O75 A;  4LDY A;  4PKC C;  3RES A;  3JCM b;  5CCA A;  4E47 A;  2RK2 A;  2VXF A;  1XQH A;  2ZPI B;  3OYL A;  1WJQ A;  1D3B A;  1QVP A;  3QYH B;  3CCS A;  3WVD B;  1QVG A;  2EQU A;  3OBY A;  4KUI A;  4FL6 A;  1QVF S;  4FM4 B;  2JVV A;  2LT1 A;  1VQ5 T;  1Y07 A;  3GNG A;  1W2B A;  2RI3 A;  1UGR B;  2KMT A;  2LQK A;  3QKJ A;  2K5F A;  2XIC A;  1K9M U;  2LT4 A;  2GQV A;  4BAC A;  4XQ3 A;  5A0G A;  3HFO A;  4BDZ A;  3ME9 A;  3CXC A;  4GY5 A;  4XAX B;  4D6W A;  3OYF A;  5GAN 2;  1UGQ B;  3GLX A;  1PSF A;  3RUX A;  4N4I A;  2PUO B;  1FWZ A;  1NPP A;  2RO0 A;  3RKY A;  4C8Q E;  4PJO E;  1Q86 U;  5GAM h;  4VUB A;  4XU2 A;  2YRV A;  2P0Q A;  2IVW A;  3OSS C;  5LJ3 h;  4PL6 A;  2LTO A;  4L5G A;  4ZTJ A;  3M58 A;  1BKB A;  3SDZ A;  1HK9 A;  1Q81 U;  5AYF A;  3CCM A;  4HT9 A;  1VQK T;  2RHZ A;  2MMP A;  3KBG A;  1QVG S;  3N5B B;  2ZPE B;  3M59 A;  3CCJ T;  1K73 U;  3V8J A;  1Q82 C;  1W2B S;  2GF7 A;  4O6J A;  4JRK A;  3LWH A;  3QPH A;  5GAM g;  2E12 A;  5GMK l;  4P5N A;  4C92 B;  1VQ8 A;  2Y4X A;  5LJ5 h;  2CS7 A;  4RCB A;  1IRE B;  2M16 A;  2DXT A;  3CCL A;  3CD6 A;  3CC4 A;  4XTY A;  5GAN 8;  4XTW A;  3UPU A;  5GAM f;  5FRM A;  1VQ6 T;  4XU1 A;  2E6N A;  3CCE A;  5LJ3 f;  2RA2 A;  2DJZ A;  3OS5 A;  4GLK A;  3CME T;  2FB7 A;  1U1T A;  4QVC A;  1I8F A;  1G3T A;  5KCH A;  5GAN j;  1KQS A;  3HKS A;  3H6Z A;  4BD3 A;  4M78 C;  4C92 A;  3PMT A;  2RJE A;  2M9U A;  3G6E A;  4M78 D;  5GMK i;  5LJ5 g;  1VQL A;  2K4Y A;  4ELZ C;  3JB9 I;  3PFS A;  5KCO A;  1N9R A;  1VQM A;  4DQ2 A;  4M75 G;  2F5K A;  1YCY A;  2HQX A;  4QQ6 A;  3H8Z A;  4XTV A;  4MML A;  4M7D B;  1O9S A;  1FX7 A;  1M9S A;  2E10 A;  2R5M A;  1Q82 U;  5LJ5 f;  3JAM E;  4IUT A;  2CKK A;  2B8A A;  2G3R A;  2YHT A;  4M77 C;  5DY9 A;  3V7S A;  4PNO A;  4C5G A;  4M7A C;  4OMF B;  4M77 D;  1Y96 B;  3I56 T;  3LWI A;  4M7A D;  3UDC A;  5GAM e;  3CPW A;  4ZTF A;  1YHQ A;  5LJ3 e;  2E65 A;  3HRT A;  2K57 A;  3HP9 A;  3PIO A;  2VV5 A;  4M7D A;  2WAC A;  5EG2 A;  3LGL A;  1KQS S;  4FU6 A;  1RI0 A;  4HKE A;  4XTX A;  3OYA A;  4C0D B;  4IUV A;  5I2M A;  3L2R A;  3G4S A;  3CEY A;  4OB1 B;  3RMS A;  3S3O A;  1U8R A;  4BE1 A;  3GOX A;  4B9X A;  3VV0 A;  2LRQ A;  4LDX A;  1Y96 A;  2FHD A;  2OTL T;  1NZ9 A;  1YJN A;  2RHU A;  2RH2 A;  3MEV A;  4BI8 B;  4C5E A;  5GMK j;  2EJG A;  4IUR A;  5IT9 E;  2EQM A;  1YJ9 T;  4C92 F;  1VUB A;  1KG1 A;  3E9F A;  5LJ5 e;  2DPP B;  2MI6 A;  2XG8 D;  3M53 A;  3HFN A;  2RHY A;  3FDR A;  5CVI A;  2FVU A;  5FU7 B;  1KHC A;  5GAN 3;  2IG0 A;  2I2L A;  2QTX A;  1YJ9 A;  2ZPG B;  3DKM A;  3CPW S;  1WJR A;  1YI2 T;  1G3S A;  1YIJ A;  1YJW T;  3MP1 A;  5FU7 C;  4MDW A;  3HRS A;  4FIB A;  4QVD A;  4QQG A;  4ME7 A;  3CCR A;  2AHJ B;  4WF2 A;  5IN1 A;  5GAO n;  1QVF A;  3EAE A;  3NTI A;  4EDU A;  3JCM c;  3LX7 A;  3LYI A;  3OS0 A;  3JB9 F;  4V2S A;  4RG8 A;  2QQB A;  3TCJ A;  3G7Z A;  5IAY A;  4E7L A;  2X35 A;  4JDS A;  2A7Y A;  1M1F A;  1VIE A;  4JRI A;  2QA4 T;  1Q7Y C;  3M5A A;  4M7D F;  4NL2 A;  3E19 A;  4M75 E;  1WQW A;  1UGP B;  2K5L A;  1QP3 A;  3EFR A;  2PVD B;  1G5V A;  4XTU A;  4XTZ A;  3CCS T;  3E1S A;  5GAN h;  1N8R C;  4F7U E;  1XOV A;  3OYY A;  5CKE A;  5I21 A;  3T9N A;  5HKC A;  4E7J A;  1AHJ B;  3MET A;  2Y4Y A;  3ER0 A;  1K73 C;  3HRU A;  2KAF A;  2QQA A;  3ZFJ A;  1VQN A;  2X4W A;  5LJ5 d;  1Y71 A;  2O01 E;  3V7C A;  1WQ7 A;  3OYN A;  3PNW C;  4OB0 B;  4PLI A;  5A0D A;  2C06 A;  3L2Z A;  2RB6 A;  5HY6 A;  2JZ2 A;  4II1 A;  2QXF A;  4IKF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...