3JCMd

Cryo-em structure of the spliceosomal u4/u6.u5 tri-snrnp
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
77
structure length
77
Chain Sequence
TPLDLLKLNLDERVYIKLRGARTLVGTLQAFDSHCNIVLSDAVETIYQLNNEELSESERRCEMVFIRGDTVTLISTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The 3.8 angstrom structure of the U4/U6.U5 tri-snRNP: Insights into spliceosome assembly and catalysis
pubmed doi rcsb
molecule tags Transcription
molecule keywords Pre-mRNA-splicing factor 8
total genus 8
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2015-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
d PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3jcmd00
4XTUA 2DTIA 4M77C 5GANe 4F7UG 4C92D 3L1AA 4HA8A 4F7UB 3JB9H 5LJ3j 1M5Q1 4M78B 5LJ3h 3SWNC 5GAMf 4M78F 4MMLA 2E64A 4M7AD 4PJOC 2ZGWA 4M75F 1LJOA 3AHUA 4RCCA 3INZA 5LJ5e 5GANd 5GAN2 1M8VA 2YLCA 1B34A 4A53A 4XU2A 5GANh 5GAN4 5GAOn 5GMKl 3JCMQ 1I5LA 3HFOA 3RKXA 4J6XA 2I2LA 4EMGA 4XU0A 4JRIA 2EJFA 4PJOG 4XTVA 4F7UA 4M7AE 4M78A 1KQ2A 4RCBA 1YCYA 3RKYA 4C92E 5GMKj 1U1TA 3V7SA 2EWNA 4M77G 2FYKA 3V8LA 1Y96B 4C92A 4M7AF 4A54A 4NOYA 4WF2A 5GAN7 4M75D 4C8QF 5GAN8 3JB9G 5GAOl 4JUVA 3HSBA 4XQ3A 5GANg 5GAN3 3V7RA 3EFRA 4M7DF 2FB7A 2DTOA 1D3BA 4MMKA 2RA2A 2E65A 4XTWA 4XTYA 1X01A 3BW1A 3RUXA 4M78E 3BFMA 3BY7A 3PGGA 5GAMh 3JCMV 2DXUA 4EMHA 1H641 1Y96A 4QVDA 2EAYA 3FIFA 4DQ2A 1WPYA 4JRKA 4M78G 4Y91A 1WQWA 4M7AG 4PJOE 1I4K1 4M77F 3JB9I 4C8QG 5I21A 4JLIA 5LJ3e 2YLBA 4C8QD 2DZ9A 5GMKh 1D3BB 4F7UF 5LJ3g 4N0AC 1HXDA 1WQ7A 4M75A 5GAN6 3JCMP 4PJOF 4M7DD 2EJ9A 4M78D 4PJOA 1TH7A 5GANj 3SWNA 1HK9A 2E41A 3HFNA 3SB2A 3JCMJ 1U1SA 2YHTA 3FB9A 4M7DC 1LNXA 5LJ3d 3FJPA 4M77A 4C92C 2VXFA 5GAOm 4QVCA 5GANf 4J6WA 2VXEA 5LJ5g 4M7DG 2DZCA 4M75E 5LJ5h 1N9RA 5GMKe 2JN0A 5LJ5j 5GMKi 3JCMX 2Y90A 4M75G 3V8KA 5GAOq 3JB9F 2DJZA 3QUIA 4M7DE 4PJOB 1N9SA 2DEQA 2DTHA 4C8QA 4OP0A 4NL2A 4XTXA 3VU3C 2E10A 3QO3A 2RD1A 4X9DA 4C8QC 4M77B 4HT8A 2HNIA 3RKWA 4XU1A 2E1HA 3QSUA 3JCMb 4F7UE 3JCMW 3GIBA 4M7AA 3JCMh 3JCMe 2CGHA 1JRIA 5LJ5f 5GAMd 4J5YA 4C8QE 5GAOr 4X9CA 2RM4A 1BIAA 4M75B 5GMKm 4J6YA 4XU3A 4EMKB 3JB9D 4M7DA 4PJOD 4M7AC 3SWNB 5GAMj 1LOJA 4M78C 3JCMd 4V2SA 2K57A 3QHSA 3RERA 4EMKC 2RB6A 4M77D 4M75C 5GAN5 1I8FA 3M4GA 2DVEA 4N0AA 4M7AB 3EFSA 3JCMc 3RESA 5GAMe 5LJ3f 5DY9A 1I81A 2DXTA 2QTXA 4C92B 5CAIA 2DKGA 4PNOA 3JCMg 5GAOp 3JCMf 4EMKA 4C92G 4M7DB 2EJGA 1BIBA 1KQ1A 3RIRA 4C92F 1JBMA 5GAMg 4NL3A 3JB9J 4XTZA 4HT9A 3V8JA 1B34B 4C8QB 1WNLA 1MGQA 3L2ZA 4M77E 5LJ5d 3BDUA 2VC8A 3V7CA
chains in the Genus database with same CATH superfamily
3G6ET 1I07A 4C92D 3H0HA 1GXIE 4ZN1A 1B07A 3OYDA 1D0XA 2I0NA 4Y28E 1YHQQ 4JJCA 4DBFA 1XQHA 4OB2B 4J6XA 2I2LA 1VQOA 4EMGA 1OU8A 2ROTA 1A0NB 1Q7YC 1UGQB 2JOYA 4A63B 4C5EA 3E9FA 1K9MR 4QVZA 1IXDA 5GANg 4OMQA 2X9HA 5FW9A 1CKAA 2DTOA 2KYBA 2ZPHB 1PRMC 3GP8A 3IQLA 4KUIA 1OZ3A 3NTKA 2D0QB 1NPRA 4HCKA 1ZBJA 3X28B 2LT4A 4RTTA 2QTVA 1OOTA 1TH7A 3L2WA 3HKSA 3JCMJ 2O88A 3FB9A 1ZA2B 3G7ZA 2PUOB 5GAOm 2ZPGB 4JZ4A 2BZXA 2JTEA 1WHKA 2G6FX 4RG2A 1OX8A 2P0PA 4PJOB 1YN8A 2LCLA 3VS0A 2HEQA 4OB3B 1UJYA 2RI2A 4X34A 1V76A 1VYUA 2KRMA 4RTVA 4NS5A 2J6KA 1ZHIA 4RUGA 4F16A 1WYXA 2EIFA 2YUPA 3LH0A 4IIMA 2R58A 3QDFA 4DA4A 3JB9D 1QVFP 3L2RA 1LOJA 4D6WA 3O5ZA 2E6NA 3MEAA 1AWOA 5L23A 2CREA 2KY9A 1RAGB 1UG1A 1WNLA 1KQSS 4E7HA 3L1AA 3X24B 3JB9H 1QLYA 3CCSA 5FU6C 5GAN4 5GAOn 1VQ6T 4EIKA 2DXCA 4KH1B 1RADB 1B7TA 1UGRB 1YCSB 3CC2Q 4M78A 4RCBA 1RL2A 5ECAA 1VQ8A 3J7AF 4NOYA 2AZSA 1NJIU 1NEGA 3CC4Q 1IO6A 3OYLA 2CP0A 2F2VA 3I56A 3VS2A 2F2XA 2COYA 3BW1A 3PGGA 4B9XA 3EG3A 3VKIA 1X43A 2HBPA 3OMGA 2OAWA 3VRZA 7AT1B 1NZ9A 3ZBDA 2K5LA 4PJMA 5GANj 2OTLA 1GBQA 3CMET 3CCUA 1NLPC 5GANf 4N4HA 2OX7A 2BKDN 1VQ4Q 2MCNA 2DEQA 2B8AA 2HMAA 1ZQ1A 4C8QC 4C0GA 3RKWA 1SRLA 4II1A 2QASA 3CCEA 3GIBA 4BY6C 3JCMh 3EG0A 3JCMe 1KK7A 2FZGB 4C8QE 5GAOr 1VQ6Q 2X51A 1M90U 1YJWA 5IN1A 2IG0A 3JCMd 4Y92A 2L5QA 2JVVA 4B6MA 1M2VA 1GCPA 5DY9A 5CAIA 2E5KA 2Z0WA 3EH1A 1I0CA 4HT9A 1RAIB 2VGNA 1ZSZA 2IIMA 1VQNA 1QQJA 4F7UB 5IXBA 1BI2A 3H0IA 3OQ5A 1D09B 5LJ5e 1M1GA 5CKHA 3CCEQ 4XU2A 1VQKQ 3EG9A 3JCMQ 5AYFA 3L2QA 5FU7C 5KYYB 3CMEQ 2CKKA 4FW2A 3GNGA 4RKUE 4ELZC 3O8VA 3LGFA 1K9MC 5DM7R 3HSBA 4JUVA 3G6EA 2JT4A 1VIFA 5GAN3 4BUGA 4M7DF 4LD9K 3OS2A 2E65A 2CZ6B 3OW2A 1GFDA 1PKTA 5KE3A 4HCCA 4OVAA 1IZ6A 1U06A 4Q5WA 5LJ3g 2SRCA 4AFQC 2RJEA 3SFMA 2PU9B 2GF7A 2XDPA 2DBMA 2O4XB 1FYNA 1SSHA 2K9GA 2RNAA 1QCNA 1VQNT 1YFNA 2DZCA 4JDSA 1N9RA 3CPWS 2PNIA 1SRMA 1YITT 2EPDA 3M54A 3TSZA 1N9SA 2EKHA 3CC2A 3JV3A 5HY6A 4AFSC 2M02A 4BY6B 4F7UE 5LL6S 1BI3A 3DB3A 1IHWA 3AT1B 1UHCA 1D1CA 4V2SA 1RABB 3CCVA 2BE7D 3BDLA 4LN2A 3M4GA 2E3HA 1LPLA 3RESA 3CC7A 1TUDA 2EYYA 2SEMA 1N27A 3CMAA 1VQMA 2ENMA 4C92F 1Q7YR 2K3YA 3RMSA 1YIJA 2EKOA 4FM4B 2D8HA 2DTIA 4LD6A 4RTZA 4J8OA 1ZUUA 3GNFB 3I35A 4EDUA 2KRSA 4A4GA 4DEXA 3HFOA 5FWCA 1K1ZA 3GF5A 3RKXA 4LUEA 1S1NA 2QQSA 4XTVA 3CQTA 1YJNQ 1U1TA 2CZ0B 3PVLA 3HRTA 2VUBA 5GAN7 3CCJA 1R77A 2QXFA 2RQUA 4XQ3A 1OPLA 3V7RA 5IHNA 2E6ZA 3GPLA 2H3EB 1PD0A 2AKLA 2QQRA 3CXCP 4BE0A 4QVDA 5FU6B 4GY5A 1KG1A 3ZEHA 2DIQA 4ME7A 1VYVA 3SHWA 5GJVB 1E6HA 4O6JA 4CI0C 4CC7A 3SWNA 2LZ6B 3QIIA 1LNXA 3HRUA 4LDVA 1Q81U 5CVIA 2XG8D 1ZUYA 5LJ5h 3G71T 1C1AA 1QKXA 3QUIA 2KXCA 1JB0E 1NEBA 4LDUA 2LDMA 4BD3A 1K8AR 4XTXA 3EGXB 3R6OA 1XNIA 1IRXA 3RMQA 3R6NA 3DLLA 4DOVA 4E47A 3JSCA 5M9OA 3JCMW 1UGPB 3L42A 4RG8A 4MDXA 2O9SA 4M75B 4M7DA 1BU1A 2EW3A 2JW4A 2YUNA 3GBQA 2JMCA 2KT1A 1I5OB 4M75C 3JCMc 5GAN5 5KYXB 4M7AB 1M2OA 2YXYA 4PLIA 1D1AA 2M9UA 4KT0E 4C0DB 5KH6A 2EYZA 2OTJA 3RIRA 1VQKT 4JS5A 1VIEA 4FT2A 2JNGA 4Z8AA 4XTUA 4M77C 3META 2LJ3A 4IUUA 4RTYA 1M5Q1 1WJRA 1ZSGA 2LQNA 1VYTA 1VQ9T 3INZA 4A4EA 2DRMA 3QPHA 2HZYA 4VUBA 2CP6A 2DETA 3TVTA 3OA6A 5FROA 2EJFA 1BCOA 2ZPFB 2PVDB 4RMOA 4QQGA 2KMTA 2CUBA 2KBTA 4CC4B 3CCLT 2DD5A 2M51A 3EFRA 2E4HA 2FB7A 4GBQA 5D6WA 4EPCA 4ZTJA 2VV5A 4OMPA 4J83A 1VQOT 3MEVA 3JB9I 2RQWA 3QYHB 3CCMT 4F7UF 3MP1A 4J9EA 3G71Q 3M0TA 3PVQA 1KHCA 2K3XA 1T0HA 4FIBA 2LQKA 2ESWA 1U1SA 2KE9A 2D1XA 4C92C 2HD0A 1OV3A 2DD4A 4IURA 1MV3A 4LXCA 1W1FA 3JB9F 2DJZA 3PT9A 1AWJA 1XJWB 2XHCA 1AHJB 2RHXA 1QWFA 4XU1A 4ZGDB 5HCKA 4M7AA 4ELYC 2CGHA 2QG9B 3VS5A 2DEUA 2DILA 1W6XA 1TOVA 3EG1A 2CH4A 2QK0A 2LQ8A 4M78C 3KBGA 3BE3A 3THKA 2LT1A 2QGFB 4JJBA 2LVMA 3M0RA 2HCKA 5KYNA 2A08A 2ZAEA 2RHYA 4CC2A 2K2VA 1K0SA 2QYZA 1HJDA 3D7SB 1D1BA 2RK1A 3LH5A 3S6WA 3I5SA 4C0FA 1KHIA 3RBBB 3CPWP 3OYGA 3VRYA 5CCAA 4B9WA 2HKNA 3I55Q 3VYHB 1Q86R 4R0KA 4HVWA 2LJ0A 1NBEB 3E19A 3V7SA 1ZX6A 1AD5A 3CD6Q 1H3HA 4HKEA 1M3AA 1G2BA 2IVWA 1BI0A 2NYSA 2RA2A 8AT1B 2CS7A 1T3SA 2QEXT 3JCMV 2LJ1A 2RQTA 2EAYA 4JS4A 1WPYA 3OYEA 4M7AG 4JLIA 4KRTA 4N0AC 2DXBA 5KYWA 4M78D 4PLLA 3CCJQ 1C0MA 2Y4YA 5LJ3d 1QVFA 2OTLT 4M7DG 2RQRA 2YRDA 3ZFJA 5KE2A 2L3SA 2EGAA 2XD0A 2EVRA 1YP5A 3PMIA 2CP7A 1VQNQ 2L8DA 3OYAA 1IB8A 1KD1R 1PHTA 3M56A 3X26B 4AG2C 1K76A 2NUTB 1VQMQ 3OBYA 3HPWA 1JU5C 2NUPA 3LW5E 2A0FB 2RB6A 3CC7Q 3NGPA 5KCHA 3CXCS 1ARKA 1OI1A 3J81E 2HAXA 3M0SA 2A36A 1QVPA 1B34B 4C8QB 2NLUA 2VC8A 2GCXA 5CQXA 2Y4XA 4F7UG 2DL7A 4LDWA 1NG2A 3KXTA 2KI7A 2R57A 4MMLA 1QP2A 3MEWA 5HK3A 2DA9A 2YLCA 2X4XA 1NPPA 5GMKl 2EFIA 2RHUA 3OYKA 1VQ5Q 4PJJA 1YCYA 3C94A 4N4GA 2XI9A 4QW2A 1RI0A 1VQOQ 3EGDA 5GAOl 1M90R 2FG0A 2K4YA 1QVFS 1IGUA 1IREB 1G3TA 3TCJA 1X6BA 1X01A 2L89A 3OY9A 1EIFA 3BY7A 4HVUA 2JJ9A 5CKEA 1SF9A 2GGRA 1AWWA 3UF4A 1Y0MA 3OYIA 3UT1A 3M5AA 4JJNK 2DO3A 1WQ7A 2QEXA 1G5VA 3SB2A 2LX7A 2MF2A 2DBKA 2E5QA 1ABQA 1BCMA 2RMOA 3OYJA 3M57A 5GMKe 1RLQC 3V8KA 3P8DA 1S72T 1X27A 4HT8A 3HP9A 2QA4T 1Z9ZA 2HNIA 2K79A 3EHQA 2F2WA 4J9FA 1YJ9Q 1KQSA 2CZ1B 2MWPA 3C95A 2C06A 4J6YA 4X1VA 3CD6T 4M7AC 1Q95G 1BK2A 2ATCB 2GQVA 2KQWA 2DVEA 5GAMe 4HCZA 4J7IA 2MIOA 4ZGEB 5LJ3f 2HQXA 1KSWA 2OJ2A 4C92G 2F1LA 4FT4A 1VQ9A 1YJWQ 1BIBA 5GAMg 3TQ7P 2CT3A 2PUKB 3V8JA 4GLKA 1NM7A 3QJYA 1M2VB 2MI6A 2D9TA 1PD1A 1H8KA 3EHRA 4A4HA 1M8VA 2M16A 4A53A 1U5SA 2FPEA 3KFVA 2CSQA 4F7UA 1TWBA 2QEXQ 2EYWA 1VQ4T 3RKYA 5CO7A 2CDTA 2FL7A 2NUZA 1Y96B 1KD1C 1S72Q 2RJCA 1OEBA 3C12A 1TTHB 4MMKA 4PKCC 3HTRA 1YIJT 5GAMh 2B86A 1O9SA 1M4ZA 2CP2A 1W2BA 2DPPB 1UECA 3X25B 4AG1C 1WQWA 3I55A 5LJ3e 2YLBA 3I56Q 1KC8C 1KC8R 5FRMA 1AZEA 3F70A 3UWNA 1VQ5A 5GAN6 2XDBA 2AKKA 4FCYA 1HK9A 2KNBB 1GBRA 3OSVA 5EG2A 2L0AA 4J6WA 2VXEA 4M75E 3VYGA 2JN0A 3EG2A 4J9CA 5GMKi 3C4SA 2MPXC 3OYNA 2EGEA 1DJ7B 5GJWB 2JZ2A 1VQLT 1ZA1B 2E10A 2YWWA 4FL6A 1S72A 2RJFA 1X6GA 4C0ZA 1PG5B 3JCMb 2GQIA 2RHIA 3A8LB 4A4FA 2RM4A 2K5FA 2KR3A 2CH4W 3FDRA 3PIOA 2M1HA 1RAEB 4E7LA 4PFZA 1PRLC 1F1BB 3MP8A 2WSFE 2OTJT 1V1CA 2O2OA 3NTIA 2EJGA 4OMFB 4PK4A 3OBWA 2DYIA 1RI9A 3L2ZA 2YRCA 1M9SA 1JEGA 3FJ5A 1YI2T 3WVEB 1Q81C 3ZL7C 1Q81R 2EQJA 3SWNC 8ATCB 3LWIA 3REBB 1RLPC 4D8KA 2K3BA 4MDWA 4FSSA 1VQPT 4OMMA 1X6OA 1WGSA 1N6AA 2VB6A 1OQKA 2QDYB 4M77G 4A54A 1K73C 5FWBA 2A28A 3DLMA 3A8HB 2XMFA 4KULA 4BE2A 5HKCA 1AVZC 2GBQA 1VQ5T 1ZSZC 4C5HA 1BBZA 1YBYA 4AFUC 1V29B 4Z02A 4BI4A 2DL3A 1RAHB 1M3CA 5I21A 4DEYA 1BB9A 3A8GB 1UTIA 4TVRA 1M1KR 1JO8A 1R0CB 4RTXA 2DLPA 1G3YA 3OS0A 2AT1B 3CCJT 1OZ2A 4DBQA 5LJ5g 3CCRT 4FYVB 2KK4A 2RF0A 2DTHA 4C8QA 1VQPA 3UA7A 1YI2Q 5J39A 2NUTA 3E9GA 3G4ST 2DK3A 2RHZA 2KAFA 3VUZA 1K73R 1X2QA 3S3NA 3S3MA 5J26A 5GAMd 2AZVA 4J5YA 1RACB 3U23A 2J6OA 3SWNB 1EX4A 2DYBA 2A3LA 2DFUA 4KGVB 1I8FA 2CUDA 1VQMT 2KXDA 1ZBXA 3JCMg 3PE0A 3JCMf 4M7DB 1Q82U 1D0YA 3C0CA 5IT9E 5IHIA 3OYHA 3V7CA 4FYYB 1PC0A 1JJ2S 2G3RA 4M7AD 4LDXA 1SHFA 1WXTA 2R5MA 4MZTA 3KUFA 2ZGWA 1OYXA 1LJOA 1WXBA 2CZ7B 2L3PA 3OSSC 5GANh 4JRPA 1B3QA 1KC8U 2IPOB 4JRIA 4M7AE 1C6VX 4J9DA 3OYFA 3G71A 4ZGJB 3TREA 4WF2A 4ZN3A 2CP3A 2CT4A 1N8RC 3UPUA 3EGUA 1N8RR 2DIGA 2KEAA 1JJ2A 4QQDA 2HQEA 2KRNA 1AWXA 1HD3A 3L2VA 2PTKA 4M78E 4LUDA 3G4SQ 4KUDK 1M3BA 2L3RA 3QDRB 2D0NA 2EQIA 1P92A 4Y91A 5I22A 3M4YA 4C8QD 4BACA 2X3XD 4DBRA 3H0FA 1MV0B 1JXMA 4J9BA 4PJOF 5C0MA 4PJOA 4BB7A 2JM9A 1PCXA 2FPDA 3FJPA 2VXFA 2LRQA 3EGDB 2EQMA 3I5RA 1QCFA 1PNJA 2DNUA 3CBMA 1YITQ 4M77B 4E2FB 2XIDA 1MMAA 2JUFA 2RQVA 2E1HA 4OB1B 4ZNXA 5IHKA 3QSUA 9ATCB 2MYSA 1NLOC 3OYMA 3REAB 4BE1A 2D6FA 3QXEB 1UB4A 4OB0B 3H41A 2DVJA 3TU4K 2ZPBB 3A5ZB 1UGSB 1LCKA 2K57A 1WZOA 4N0AA 3CCMA 2DKGA 1Q86C 2AK5A 1H3ZA 1JBMA 1PSEA 1WI7A 1EFNA 1X2KA 1JRIA 2GNCA 3BDUA 4PJLA 4E7JA 4JLGA 2MMPA 1GL5A 5LJ3j 4E7SA 1E7OA 2E64A 2KDSA 4PJOC 3VS6A 2EGCA 1FMVA 2LC4A 3NPFA 3TSWA 1YITA 4PJOG 1WX6A 2LCCA 1KD1U 1Y57A 2P84A 4C5GA 1JJ2P 4XTWA 4HXJA 4EMHA 1GCQC 2V1RA 3HHTB 4IKFA 1G8XA 1OX9A 5GMKh 5C6SA 4CRIA 1YJNA 1TUGB 2QQAA 3MJXA 5DLOA 3CCRA 3G1JA 2KSSA 2C0IA 2NUPB 1WDXA 4M77A 3HL8A 2ED0A 1VQ9Q 2YDLA 2ZPIB 4FSXA 3VV0A 1VQ8T 4J9HA 3LX7A 1Q82R 2BIVA 4NL2A 2EYQA 1IHVA 4X9DA 2FZKB 2QQ9A 1WA7A 3CMAQ 3UDCA 2LQWA 1U3OA 4F04B 1VA7A 5LJ5f 1VQLQ 1M1FA 5CK9A 1WIEA 5KYWB 1YJ9A 4ZTFA 1M1KU 2K2MA 2K7AA 3CCVQ 4RTWA 4M77D 4EMKC 3LWHA 1CSKA 4YTLA 3QYGB 2HDAA 1YWOA 1HSQA 3A8MB 2BE9B 5CKDA 2QTXA 2ECZA 4PNOA 2RJDA 2X35A 1SPKA 2ZPEB 2FZCB 1GFCA 4NL3A 4XTZA 3OB9A 3QWXX 3FLGA 2RI5A 1N8RU 5A2QE 2WSEE 3EG9B 2DX1A 2OTJQ 4OF1A 5KYUA 2DRKA 2HL5C 4BDYA 1K73U 5GAMf 1FXXA 2DMOA 4M75F 5GAN2 2OTLQ 1B34A 4JZ3A 2DAQA 2FEIA 1RAAB 1VQPQ 2QQBA 4PJNA 1UFFA 3MO8A 3M55A 3A98A 4C92A 1BKBA 4M4ZA 5FLXE 3VUBA 1I1JA 4F17A 3CC4A 3CMAT 3FC3A 2R5AA 2DXUA 3M0QA 1QWEA 3M0PA 4DQ2A 2LNHB 4JRKA 2O4XA 3CC7T 1WHJA 3I56T 2FPFA 4R55A 3CCVT 1RUWA 2RPNA 1QMCA 2E41A 2QI2A 3NTHA 3PTAA 2LX9A 1KQSP 1KFZA 4RTUA 4M7DC 2HSEB 3CPFA 1UJ0A 2E70A 1W2BP 1WXUA 1M27C 1OPKA 3OW2S 4M7DE 3PNWC 2V8IA 3I55T 4L5GA 4AT1B 3VU3C 5FRNA 1KIKA 2KGTA 2RH2A 4MZMA 2X4JA 3CC4T 3A1PA 1VQ7T 1Y71A 1PKSA 2LNVA 1Q82C 2BZYA 5A0GA 2GTJA 2ED1A 3H9NA 1YIJQ 2DJQA 1QP3A 1WJQA 2CYZB 3M58A 5LJ5d 2H3JA 1W70A 2ABLA 5HK0A 1FWZA 2P4RA 4M78B 5L8RE 5LJ3h 2XDDA 5DLQE 3MHXA 1G83A 3AHUA 3WVDB 2DL8A 1W2BS 2VGMA 4D8DA 1TG0A 3CXCA 2LP5A 3I9QA 4XU0A 2VKNA 4J7FA 3J80E 1TUCA 3VJPA 3QBYA 3Q1JA 1D0ZA 1QCOA 2D8JA 1LVKA 1MUZA 3CD6A 3JB9G 1M90C 1QVGS 1FX7A 2H8HA 4PFOA 3MEUA 4XTYA 3RUXA 3MP6A 2A7YA 4QKUA 1Y96A 1ZUKA 1AOJA 5CIUA 2PZ1A 1TU0B 1K8AC 1NYFA 2DF6A 4PJOE 4M77F 1D3BB 2NWMA 3JCMP 3ULRB 4ESRA 3GLXA 3H6ZA 3EGXA 1MHNA 2C0TA 3CCSQ 2PVGB 3CCET 5CR2A 3OYYA 2V8KA 1UE9A 1NYGA 2DM1A 3P8HA 1Y7XA 2P4TA 2WACA 3DKMA 4E7KA 3G6EQ 4JJDA 1TS9A 1Q86U 1UEBA 3QWYA 2W0ZA 2CP5A 1XOVA 3CMEA 1T0JA 1R0BG 1RAFB 3OYCA 3ASKA 3X20B 2BZ8A 4ORZA 1BIAA 1NJIR 5EC7A 3A8OB 4XU3A 1OULA 1T3LA 2KVQG 1VQKA 3EFOB 1GRIA 2DXTA 5GAOp 1BYMA 1VQLA 2GTOA 3SDZA 4EMKA 4JPBW 1KQ1A 4HVVA 4FYWB 2CSIA 5I11A 4C0DC 1K0XA 1MGQA 2V26A 5GAMj 3MKDA 4PL6A 1PWTA 3LGLA 3CEYA 1WHLA 2ZZDA 4Z89A 2VVKA 1X69A 2HL3A 5A0DA 2J7IA 4RCCA 4OMLA 2EQKA 1R8OB 1I5LA 5AT1B 1VQ6A 2JXBA 1M30A 4C92E 1QW1A 3CCRQ 2JS2A 2HKQB 2EWNA 3RR6A 1WHGA 1AZGB 4BDZA 2O01E 4C8QF 2X4WA 4IUQA 3MCAB 1XTDA 2FO0A 2RK2A 1AT1B 3JAME 2RI3A 4KH0B 2HQHA 2X4YA 1ACMB 5I2SA 3OS1A 2MOXA 3CCUQ 3NHNA 1I4K1 4C8QG 1PM3A 5IXFA 1HXDA 2EJ9A 1K4US 1YNZA 3PMTA 1VOMA 1MNEA 4QVCA 1QVGP 1ABOA 2AHJB 2F5TX 3PIPA 5CQYA 5GAOq 2P0QA 5IAYA 1QKWA 3QZ9B 4OMOA 2ROLA 4OP0A 2LTOA 4MZPA 1MMNA 1VQ8Q 2RN8A 3QKJA 3CBOA 3SD4A 3WXMB 3EAEA 4X9CA 3OS5A 4XK8E 2E12A 4PJOD 2O9VA 4ANJA 1MMGA 2QA4A 3CPWA 3EFSA 2J05A 2WSCE 4DBHA 2OAUA 4J9IA 1WHHA 3FRNA 1O75A 2JM8A 4IUVA 4AMCA 3M0UA 5A0LA 1K9MU 2RO0A 2ZCFB 2O31A 5GANe 3CCLA 1VUBA 1M1KC 2E3IA 4HA8A 2LMJA 4M78F 5D6XA 1MMDA 4J9GA 2M0OA 5GANd 4OGCA 2DL5A 4IUPA 2XKOC 3CC2T 2JTMA 1Y07A 3OW2P 3CBPA 1J3TA 4FU6A 3V8LA 4M7AF 1UDLA 2F69A 4GLMA 2JMAA 3QJ6A 5GAN8 4QQ6A 2EQUA 4LE9A 4JRQA 5D7UA 1SG5A 3CCQT 2M0YA 3G4SA 4KGXB 2DL4A 3BFMA 1EZZB 1H641 1PSFA 4L6V5 1NE8A 3T9NA 4OMNA 2HBWA 3N5BB 4XAXB 1IGQA 1X75C 4M75A 2COWA 2GFUA 1Q7YU 2P0KA 2F5KA 3DB4A 1CKBA 4N4IA 1VQ7A 2DERA 3RDVA 4C5IA 4BI8B 4A4KA 3E1SA 6AT1B 1HYOA 2JTFA 2JS0A 3JCMX 3RNJA 1SKUB 1GCQA 4DOWA 2RD1A 2X3WD 2J6FA 1TXQA 4QT7A 1H92A 4WCIA 2EYXA 5FU7B 4F14A 2QA4Q 1YJ9T 3CCST 1ZLMA 2QGGA 5KYXA 2YSQA 3OMCA 2FVUA 4OGEA 2YT6A 2FRYA 2VYTA 3EH2A 4CC3A 1WHMA 3QHSA 2COZA 3RERA 1YHQA 3CCMQ 3LLRA 5IH2A 4UC4A 5J3BA 1I81A 2KYMA 4FW1A 3VS4A 1UHFA 2L3QA 2V1QA 1UGVA 4HCBA 4P5NA 2VASA 3JB9J 4FYXB 1YJWT 4M77E 3CCQQ 2FHDA 2BUDA 1YI2A 3UA6A 1G3WA 3VS1A 3QZ5B 4O5VA 2C0OA 2XK0A 3M59A 2W10A 2VWFA 1VQ7Q 5CKFA 3HRSA 4AFZC 2XU8A 3SEMA 1K8AU 1KQ2A 1OU9A 2XICA 1MNDA 5GMKj 4ATOA 1SEMA 1Z9QA 2QDLA 2FYKA 4M75D 3CCUT 2PQWA 1G3SA 5KYYA 1ZSZB 3ER0A 4R56A 2EBPA 3LYIA 1D3BA 1KJWA 1E6GA 4KGZB 3L2UA 4E7ZA 2KT8A 3FIFA 1AEYA 2MWOA 3UATA 4M78G 2MK5A 2DZ9A 2MAMA 4E7IA 1YHQT 3OYBA 5CKBA 4LNPA 3URGA 4M7DD 3ME9A 3E2UA 2PVOB 4KBMB 3HFNA 3VS3A 2YHTA 2QAZA 1U8RA 1FMKA 1TSFA 4L59A 1QVGA 1NJIC 2FRWA 3P8BB 1YWPA 3QG1A 4BI3A 3TEEA 5LJ5j 2Y90A 4M75G 3GOXA 3CCLQ 2K6DA 2YRVA 4LDYA 1WLPB 3VS7A 3QO3A 4E6RA 5KYUB 4IIOA 3MPUB 5KCOA 2BTTA 4K11A 3H8ZA 3EFOA 5I2MA 1WJSA 2K5IA 2A37A 3M53A 2V8JA 3PFSA 2OI3A 2KROA 5GMKm 2GFAA 4EMKB 1SHGA 1M8MA 1UUEA 1SSFA 3S3OA 3JRZA 4IUTA 5D6YA 1K9AA 2HSPA 2YUOA 3NMZC 2LCSA 1WFWA 1YJNT 3M9QA 1BI1A 1W4SA 1VQ4A 4Z88A 3NFCA 3FEOA 2L2PA 1N5ZA 4C92B 2J06A 1JXOA 4PFPA 3CCQA 1JQQA 2DE0X 2YUQA 4WTOB 1FMWA 2AIRB
chains in the Genus database with same CATH topology
1YI2T 4XTUA 3G6ET 4M77C 2H3JA 3META 4C92D 3WVEB 1Q81C 1GXIE 4ZN1A 4IUUA 5HK0A 1FWZA 3OYDA 1M5Q1 1WJRA 2EQJA 4M78B 5L8RE 5DLQE 3SWNC 4Y28E 5LJ3h 3MHXA 2XDDA 3LWIA 3AHUA 1VQ9T 3INZA 4A4EA 4MDWA 3QPHA 3WVDB 1XQHA 4OB2B 1VQPT 1W2BS 2VGMA 4VUBA 3CXCA 4J6XA 2I2LA 1VQOA 4EMGA 1X6OA 4XU0A 3OA6A 5FROA 2EJFA 2ZPFB 4J7FA 1WGSA 3J80E 3VJPA 3QBYA 3Q1JA 1N6AA 1Q7YC 2PVDB 2QDYB 4RMOA 1UGQB 4M77G 4QQGA 2KMTA 2JOYA 4A54A 1K73C 4C5EA 3E9FA 3CCLT 3JB9G 4QVZA 1M90C 3DLMA 3CD6A 3A8HB 2DD5A 1FX7A 5GANg 1QVGS 4KULA 3EFRA 3MEUA 4BE2A 5HKCA 2FB7A 2DTOA 5D6WA 2ZPHB 4XTYA 4EPCA 3RUXA 3GP8A 1VQ5T 3MP6A 2A7YA 4C5HA 4ZTJA 1Y96A 1YBYA 4KUIA 1OZ3A 1V29B 2VV5A 3NTKA 4Z02A 5CIUA 4BI4A 1K8AC 2D0QB 1NPRA 4J83A 1VQOT 3MEVA 4PJOE 4M77F 3JB9I 3QYHB 3X28B 5I21A 3CCMT 2LT4A 1D3BB 3MP1A 4F7UF 3A8GB 1KHCA 3JCMP 2K3XA 4TVRA 1TH7A 4FIBA 3L2WA 3HKSA 3JCMJ 2LQKA 1U1SA 3GLXA 3H6ZA 3FB9A 3G7ZA 2PUOB 1MHNA 4C92C 1G3YA 2ZPGB 5GAOm 2HD0A 3OS0A 3CCJT 1OZ2A 5LJ5g 2PVGB 2DD4A 4IURA 3CCET 5CR2A 3OYYA 3CCRT 2KK4A 2V8KA 4RG2A 3JB9F 2P0PA 2DJZA 4PJOB 2LCLA 3PT9A 3P8HA 2DTHA 4E7KA 1Y7XA 2P4TA 2WACA 3DKMA 4C8QA 1VQPA 2XHCA 1AHJB 2RHXA 4OB3B 5J39A 3E9GA 3G4ST 1Q86U 2DK3A 2RI2A 4X34A 1UEBA 4XU1A 2RHZA 4ZGDB 2KAFA 3VUZA 4NS5A 1ZHIA 4M7AA 4ELYC 1XOVA 2EIFA 3CMEA 2CGHA 3S3NA 5J26A 5GAMd 4J5YA 3LH0A 3ASKA 3X20B 3OYCA 1BIAA 2R58A 3A8OB 4XU3A 4DA4A 3JB9D 3L2RA 2LQ8A 2KVQG 3SWNB 1VQKA 1LOJA 4M78C 3KBGA 4D6WA 2A3LA 2LT1A 1I8FA 1VQMT 2E6NA 3MEAA 1ZBXA 2DXTA 5GAOp 1BYMA 1VQLA 2LVMA 3JCMg 3JCMf 3SDZA 4EMKA 4M7DB 1Q82U 2KY9A 1KQ1A 2RHYA 4C0DC 5IT9E 1WNLA 1MGQA 2K2VA 5GAMj 3OYHA 4PL6A 3LGLA 3V7CA 1KQSS 4E7HA 1JJ2S 2G3RA 3L1AA 3CEYA 3X24B 3JB9H 2ZZDA 4M7AD 4LDXA 2R5MA 4MZTA 3KUFA 2ZGWA 1OYXA 5A0DA 1LJOA 2RK1A 4RCCA 3CCSA 5FU6C 5GANh 2CZ7B 3OSSC 3S6WA 4C0FA 5GAN4 1KHIA 4JRPA 2EQKA 5GAOn 3OYGA 5CCAA 1R8OB 2DXCA 4B9WA 1I5LA 1VQ6T 1VQ6A 1KC8U 1UGRB 4JRIA 4M7AE 3VYHB 4M78A 3OYFA 3G71A 4RCBA 1RL2A 4C92E 1QW1A 3E19A 3V7SA 3TREA 2EWNA 4ZGJB 1VQ8A 3J7AF 4NOYA 4WF2A 4HKEA 4BDZA 4ZN3A 1N8RC 2O01E 4C8QF 2X4WA 4IUQA 3UPUA 3MCAB 1XTDA 2DIGA 1NJIU 2IVWA 3OYLA 1BI0A 4QQDA 1JJ2A 2RK2A 2HQEA 3JAME 3I56A 2RI3A 1YJNT 2RA2A 2CS7A 2X4YA 3BW1A 3L2VA 4M78E 3PGGA 2QEXT 4B9XA 4KUDK 3JCMV 5I2SA 2EAYA 4JS4A 3VKIA 2L3RA 1WPYA 3QDRB 3OYEA 2HBPA 3OS1A 4Y91A 1P92A 4M7AG 1I4K1 3OMGA 4C8QG 4JLIA 3M4YA 4C8QD 4BACA 4N0AC 1HXDA 2DXBA 1NZ9A 3ZBDA 5C0MA 4PJOF 2K5LA 2EJ9A 4M78D 4PLLA 4PJOA 5GANj 2OTLA 4BB7A 3PMTA 3CMET 3CCUA 2Y4YA 5LJ3d 3FJPA 2VXFA 2LRQA 4QVCA 5GANf 1QVFA 2OTLT 4M7DG 4N4HA 3ZFJA 2AHJB 2EQMA 5KE2A 2F5TX 2BKDN 2XD0A 3PIPA 5CQYA 5GAOq 2P0QA 5IAYA 3PMIA 3CBMA 3QZ9B 2DEQA 2B8AA 1ZQ1A 4OP0A 2LTOA 4C8QC 4M77B 2XIDA 3LWHA 4MZPA 2L8DA 4C0GA 3RKWA 2JUFA 3OYAA 2E1HA 3QKJA 3CBOA 4II1A 3M56A 4OB1B 3CCEA 3X26B 4BY6C 3GIBA 3SD4A 3JCMh 3JCMe 3QSUA 3OYMA 3WXMB 4BE1A 3EAEA 2D6FA 5GAOr 4C8QE 3QXEB 4X9CA 1UB4A 1M90U 3OS5A 4OB0B 4XK8E 2E12A 4PJOD 1YJWA 3OBYA 2ZPBB 3HPWA 3A5ZB 2IG0A 1UGSB 5IN1A 3TU4K 3JCMd 2L5QA 2K57A 3LW5E 2JVVA 2RB6A 2QA4A 5KCHA 3CXCS 4N0AA 3CPWA 3EFSA 3CCMA 2WSCE 5DY9A 2OAUA 3FRNA 5CAIA 2DKGA 1Q86C 1O75A 1OI1A 3J81E 2HAXA 4IUVA 1H3ZA 4HT9A 1JBMA 5A0LA 1PSEA 1QVPA 2VGNA 2RO0A 1B34B 4C8QB 2NLUA 1K9MU 1JRIA 3BDUA 2VC8A 2ZCFB 1VQNA 2GCXA 5CQXA 2Y4XA 4F7UG 5GANe 4JLGA 1VUBA 4E7JA 1M1KC 3CCLA 4HA8A 2MMPA 4F7UB 4LDWA 5LJ3j 3KXTA 1BI2A 2R57A 3OQ5A 4M78F 2E64A 2KDSA 4MMLA 5D6XA 4PJOC 1QP2A 3MEWA 5HK3A 2M0OA 5LJ5e 5GANd 4OGCA 1M1GA 2YLCA 5CKHA 4XU2A 4IUPA 3CC2T 2XKOC 2JTMA 1Y07A 2X4XA 1NPPA 5GMKl 2EFIA 2LC4A 3JCMQ 5AYFA 3L2QA 5FU7C 1YITA 4PJOG 2RHUA 3OYKA 3CBPA 2CKKA 2LCCA 1YCYA 3C94A 1KD1U 4N4GA 3GNGA 2XI9A 4FU6A 4RKUE 4ELZC 3V8LA 3O8VA 4M7AF 3LGFA 4QW2A 1RI0A 2F69A 1K9MC 3QJ6A 5GAN8 5DM7R 5GAOl 4JUVA 4QQ6A 3G6EA 3HSBA 2EQUA 2K4YA 1VIFA 5GAN3 1QVFS 4BUGA 4JRQA 4C5GA 1IREB 4M7DF 1G3TA 4LD9K 3CCQT 3OS2A 2E65A 4XTWA 3TCJA 1X01A 2L89A 3OY9A 3G4SA 2CZ6B 1EIFA 3BFMA 3BY7A 3OW2A 4EMHA 1H641 5CKEA 1PSFA 3HHTB 4L6V5 5KE3A 4HCCA 4IKFA 1NE8A 3T9NA 4OVAA 3N5BB 4XAXB 1IZ6A 3OYIA 4Q5WA 3M5AA 3UT1A 5GMKh 5C6SA 4JJNK 4CRIA 2DO3A 5LJ3g 1YJNA 1X75C 1WQ7A 2QQAA 4M75A 5DLOA 2QEXA 2GFUA 3CCRA 1Q7YU 2RJEA 1G5VA 2P0KA 3SFMA 2PU9B 2F5KA 2GF7A 2KSSA 2XDPA 3DB4A 3SB2A 4N4IA 1VQ7A 2MF2A 4C5IA 2O4XB 4M77A 3HL8A 4BI8B 4A4KA 3E1SA 2E5QA 3S3MA 1VQNT 2DZCA 2JTFA 2ZPIB 4FSXA 4JDSA 3VV0A 3M57A 1N9RA 5GMKe 3OYJA 3CPWS 1VQ8T 3LX7A 1YITT 3JCMX 3V8KA 3M54A 3P8DA 1S72T 1N9SA 4DOWA 2BIVA 4NL2A 3CC2A 2EYQA 4X9DA 4HT8A 2RD1A 2QQ9A 3HP9A 2QA4T 2HNIA 5HY6A 3GOXA 5FU7B 4BY6B 1YJ9T 3UDCA 1KQSA 3CCST 4F7UE 2CZ1B 5LJ5f 5LL6S 1BI3A 3DB3A 1M1FA 2MWPA 3OMCA 3C95A 2C06A 5CK9A 2FVUA 4J6YA 1YJ9A 4OGEA 4ZTFA 1M1KU 3CD6T 4M7AC 2VYTA 4V2SA 3CCVA 3QHSA 3RERA 4EMKC 4M77D 3BDLA 2GQVA 2KQWA 1YHQA 3M4GA 2DVEA 3QYGB 3LLRA 4HCZA 4YTLA 4J7IA 3RESA 5GAMe 5LJ3f 4ZGEB 3A8MB 1I81A 4UC4A 5J3BA 3CC7A 2HQXA 5CKDA 2QTXA 4PNOA 2RJDA 2X35A 1N27A 4FT4A 4C92G 3CMAA 1VQMA 1VQ9A 1BIBA 4HCBA 4P5NA 4C92F 2ZPEB 5GAMg 4NL3A 3JB9J 3OB9A 4XTZA 2PUKB 3V8JA 1YJWT 2K3YA 3FLGA 2RI5A 4GLKA 3RMSA 4M77E 1YIJA 5A2QE 2EKOA 1N8RU 2WSEE 3QJYA 2FHDA 4FM4B 2DTIA 2MI6A 2BUDA 4OF1A 1YI2A 4LD6A 1G3WA 4BDYA 1K73U 2D9TA 5GAMf 4J8OA 1FXXA 3QZ5B 4M75F 4A4HA 3GNFB 4O5VA 5GAN2 4EDUA 1M8VA 2M16A 2XK0A 1B34A 4A53A 3M59A 2DAQA 4A4GA 5CKFA 3HFOA 3HRSA 3GF5A 3RKXA 2XU8A 2QQSA 4F7UA 4XTVA 1K8AU 1KQ2A 1VQ4T 2XICA 2QQBA 3RKYA 4ATOA 5GMKj 1U1TA 3MO8A 5CO7A 2CZ0B 2FL7A 2FYKA 1Y96B 3M55A 4C92A 3HRTA 1KD1C 2VUBA 5GAN7 4M75D 3CCJA 3CCUT 2PQWA 2RJCA 2QXFA 1BKBA 1G3SA 5FLXE 4XQ3A 3VUBA 3C12A 3V7RA 3ER0A 4R56A 2E6ZA 3GPLA 3LYIA 3CC4A 1D3BA 4MMKA 3L2UA 3CMAT 2QQRA 4PKCC 3FC3A 1YIJT 5GAMh 4BE0A 2R5AA 2DXUA 4QVDA 5FU6B 4DQ2A 3FIFA 1O9SA 2MWOA 4JRKA 1M4ZA 1W2BA 2DPPB 3X25B 4M78G 4GY5A 1KG1A 1WQWA 2O4XA 3ZEHA 3I55A 3CC7T 5LJ3e 2DIQA 2YLBA 2DZ9A 2MAMA 4ME7A 1KC8C 5FRMA 4E7IA 1YHQT 3F70A 4O6JA 3UWNA 4R55A 3OYBA 4CI0C 5GAN6 5CKBA 3I56T 1VQ5A 3CCVT 3URGA 2XDBA 4M7DD 3ME9A 2PVOB 4KBMB 1HK9A 2E41A 3HFNA 2QI2A 3NTHA 3SWNA 3PTAA 2LX9A 2YHTA 3QIIA 3OSVA 5EG2A 3CPFA 1U8RA 1LNXA 4M7DC 4L59A 3HRUA 1QVGA 2E70A 4LDVA 1Q81U 1NJIC 3P8BB 4J6WA 2VXEA 3QG1A 5CVIA 2XG8D 4M75E 3VYGA 4BI3A 5LJ5h 3G71T 2JN0A 3TEEA 5LJ5j 5GMKi 2Y90A 4M75G 3C4SA 3OYNA 3QUIA 3OW2S 4M7DE 1JB0E 3PNWC 2V8IA 1DJ7B 2YRVA 4LDUA 2LDMA 2JZ2A 4LDYA 4BD3A 3I55T 4L5GA 1VQLT 4XTXA 3VU3C 2E10A 3QO3A 4FL6A 1S72A 3R6OA 2RJFA 5FRNA 1XNIA 3DLLA 3RMQA 2RH2A 4DOVA 4E47A 5KCOA 3JSCA 4C0ZA 5M9OA 3JCMb 3H8ZA 1UGPB 3JCMW 4MZMA 2X4JA 5I2MA 1WJSA 2K5IA 3M53A 3L42A 2V8JA 3CC4T 2RHIA 4RG8A 3PFSA 4MDXA 3A8LB 4A4FA 2RM4A 4M75B 5GMKm 1VQ7T 2K5FA 2GFAA 4EMKB 4M7DA 1Y71A 3FDRA 1SSFA 3PIOA 3S3OA 3JRZA 2M1HA 4IUTA 5D6YA 4E7LA 4M75C 2LNVA 3M9QA 3JCMc 1BI1A 5GAN5 1W4SA 4M7AB 3NFCA 1VQ4A 3FEOA 3MP8A 4PLIA 2WSFE 2OTJT 2M9UA 4KT0E 1Q82C 4C0DB 4C92B 5KH6A 5A0GA 2OTJA 3NTIA 2EJGA 4OMFB 3RIRA 1VQKT 3CCQA 4JS5A 3OBWA 1QP3A 1VIEA 1WJQA 4FT2A 3L2ZA 2CYZB 3M58A 5LJ5d 2JNGA 1M9SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XTU A;  2DTI A;  4M77 C;  5GAN e;  4F7U G;  4C92 D;  3L1A A;  4HA8 A;  4F7U B;  3JB9 H;  5LJ3 j;  1M5Q 1;  4M78 B;  5LJ3 h;  3SWN C;  5GAM f;  4M78 F;  4MML A;  2E64 A;  4M7A D;  4PJO C;  2ZGW A;  4M75 F;  1LJO A;  3AHU A;  4RCC A;  3INZ A;  5LJ5 e;  5GAN d;  5GAN 2;  1M8V A;  2YLC A;  1B34 A;  4A53 A;  4XU2 A;  5GAN h;  5GAN 4;  5GAO n;  5GMK l;  3JCM Q;  1I5L A;  3HFO A;  3RKX A;  4J6X A;  2I2L A;  4EMG A;  4XU0 A;  4JRI A;  2EJF A;  4PJO G;  4XTV A;  4F7U A;  4M7A E;  4M78 A;  1KQ2 A;  4RCB A;  1YCY A;  3RKY A;  4C92 E;  5GMK j;  1U1T A;  3V7S A;  2EWN A;  4M77 G;  2FYK A;  3V8L A;  1Y96 B;  4C92 A;  4M7A F;  4A54 A;  4NOY A;  4WF2 A;  5GAN 7;  4M75 D;  4C8Q F;  5GAN 8;  3JB9 G;  5GAO l;  4JUV A;  3HSB A;  4XQ3 A;  5GAN g;  5GAN 3;  3V7R A;  3EFR A;  4M7D F;  2FB7 A;  2DTO A;  1D3B A;  4MMK A;  2RA2 A;  2E65 A;  4XTW A;  4XTY A;  1X01 A;  3BW1 A;  3RUX A;  4M78 E;  3BFM A;  3BY7 A;  3PGG A;  5GAM h;  3JCM V;  2DXU A;  4EMH A;  1H64 1;  1Y96 A;  4QVD A;  2EAY A;  3FIF A;  4DQ2 A;  1WPY A;  4JRK A;  4M78 G;  4Y91 A;  1WQW A;  4M7A G;  4PJO E;  1I4K 1;  4M77 F;  3JB9 I;  4C8Q G;  5I21 A;  4JLI A;  5LJ3 e;  2YLB A;  4C8Q D;  2DZ9 A;  5GMK h;  1D3B B;  4F7U F;  5LJ3 g;  4N0A C;  1HXD A;  1WQ7 A;  4M75 A;  5GAN 6;  3JCM P;  4PJO F;  4M7D D;  2EJ9 A;  4M78 D;  4PJO A;  1TH7 A;  5GAN j;  3SWN A;  1HK9 A;  2E41 A;  3HFN A;  3SB2 A;  3JCM J;  1U1S A;  2YHT A;  3FB9 A;  4M7D C;  1LNX A;  5LJ3 d;  3FJP A;  4M77 A;  4C92 C;  2VXF A;  5GAO m;  4QVC A;  5GAN f;  4J6W A;  2VXE A;  5LJ5 g;  4M7D G;  2DZC A;  4M75 E;  5LJ5 h;  1N9R A;  5GMK e;  2JN0 A;  5LJ5 j;  5GMK i;  3JCM X;  2Y90 A;  4M75 G;  3V8K A;  5GAO q;  3JB9 F;  2DJZ A;  3QUI A;  4M7D E;  4PJO B;  1N9S A;  2DEQ A;  2DTH A;  4C8Q A;  4OP0 A;  4NL2 A;  4XTX A;  3VU3 C;  2E10 A;  3QO3 A;  2RD1 A;  4X9D A;  4C8Q C;  4M77 B;  4HT8 A;  2HNI A;  3RKW A;  4XU1 A;  2E1H A;  3QSU A;  3JCM b;  4F7U E;  3JCM W;  3GIB A;  4M7A A;  3JCM h;  3JCM e;  2CGH A;  1JRI A;  5LJ5 f;  5GAM d;  4J5Y A;  4C8Q E;  5GAO r;  4X9C A;  2RM4 A;  1BIA A;  4M75 B;  5GMK m;  4J6Y A;  4XU3 A;  4EMK B;  3JB9 D;  4M7D A;  4PJO D;  4M7A C;  3SWN B;  5GAM j;  1LOJ A;  4M78 C;  3JCM d;  4V2S A;  2K57 A;  3QHS A;  3RER A;  4EMK C;  2RB6 A;  4M77 D;  4M75 C;  5GAN 5;  1I8F A;  3M4G A;  2DVE A;  4N0A A;  4M7A B;  3EFS A;  3JCM c;  3RES A;  5GAM e;  5LJ3 f;  5DY9 A;  1I81 A;  2DXT A;  2QTX A;  4C92 B;  5CAI A;  2DKG A;  4PNO A;  3JCM g;  5GAO p;  3JCM f;  4EMK A;  4C92 G;  4M7D B;  2EJG A;  1BIB A;  1KQ1 A;  3RIR A;  4C92 F;  1JBM A;  5GAM g;  4NL3 A;  3JB9 J;  4XTZ A;  4HT9 A;  3V8J A;  1B34 B;  4C8Q B;  1WNL A;  1MGQ A;  3L2Z A;  4M77 E;  5LJ5 d;  3BDU A;  2VC8 A;  3V7C A; 
#chains in the Genus database with same CATH topology
 3G6E T;  1I07 A;  4C92 D;  3H0H A;  1GXI E;  4ZN1 A;  1B07 A;  3OYD A;  1D0X A;  2I0N A;  4Y28 E;  1YHQ Q;  4JJC A;  4DBF A;  1XQH A;  4OB2 B;  4J6X A;  2I2L A;  1VQO A;  4EMG A;  1OU8 A;  2ROT A;  1A0N B;  1Q7Y C;  1UGQ B;  2JOY A;  4A63 B;  4C5E A;  3E9F A;  1K9M R;  4QVZ A;  1IXD A;  5GAN g;  4OMQ A;  2X9H A;  5FW9 A;  1CKA A;  2DTO A;  2KYB A;  2ZPH B;  1PRM C;  3GP8 A;  3IQL A;  4KUI A;  1OZ3 A;  3NTK A;  2D0Q B;  1NPR A;  4HCK A;  1ZBJ A;  3X28 B;  2LT4 A;  4RTT A;  2QTV A;  1OOT A;  1TH7 A;  3L2W A;  3HKS A;  3JCM J;  2O88 A;  3FB9 A;  1ZA2 B;  3G7Z A;  2PUO B;  5GAO m;  2ZPG B;  4JZ4 A;  2BZX A;  2JTE A;  1WHK A;  2G6F X;  4RG2 A;  1OX8 A;  2P0P A;  4PJO B;  1YN8 A;  2LCL A;  3VS0 A;  2HEQ A;  4OB3 B;  1UJY A;  2RI2 A;  4X34 A;  1V76 A;  1VYU A;  2KRM A;  4RTV A;  4NS5 A;  2J6K A;  1ZHI A;  4RUG A;  4F16 A;  1WYX A;  2EIF A;  2YUP A;  3LH0 A;  4IIM A;  2R58 A;  3QDF A;  4DA4 A;  3JB9 D;  1QVF P;  3L2R A;  1LOJ A;  4D6W A;  3O5Z A;  2E6N A;  3MEA A;  1AWO A;  5L23 A;  2CRE A;  2KY9 A;  1RAG B;  1UG1 A;  1WNL A;  1KQS S;  4E7H A;  3L1A A;  3X24 B;  3JB9 H;  1QLY A;  3CCS A;  5FU6 C;  5GAN 4;  5GAO n;  1VQ6 T;  4EIK A;  2DXC A;  4KH1 B;  1RAD B;  1B7T A;  1UGR B;  1YCS B;  3CC2 Q;  4M78 A;  4RCB A;  1RL2 A;  5ECA A;  1VQ8 A;  3J7A F;  4NOY A;  2AZS A;  1NJI U;  1NEG A;  3CC4 Q;  1IO6 A;  3OYL A;  2CP0 A;  2F2V A;  3I56 A;  3VS2 A;  2F2X A;  2COY A;  3BW1 A;  3PGG A;  4B9X A;  3EG3 A;  3VKI A;  1X43 A;  2HBP A;  3OMG A;  2OAW A;  3VRZ A;  7AT1 B;  1NZ9 A;  3ZBD A;  2K5L A;  4PJM A;  5GAN j;  2OTL A;  1GBQ A;  3CME T;  3CCU A;  1NLP C;  5GAN f;  4N4H A;  2OX7 A;  2BKD N;  1VQ4 Q;  2MCN A;  2DEQ A;  2B8A A;  2HMA A;  1ZQ1 A;  4C8Q C;  4C0G A;  3RKW A;  1SRL A;  4II1 A;  2QAS A;  3CCE A;  3GIB A;  4BY6 C;  3JCM h;  3EG0 A;  3JCM e;  1KK7 A;  2FZG B;  4C8Q E;  5GAO r;  1VQ6 Q;  2X51 A;  1M90 U;  1YJW A;  5IN1 A;  2IG0 A;  3JCM d;  4Y92 A;  2L5Q A;  2JVV A;  4B6M A;  1M2V A;  1GCP A;  5DY9 A;  5CAI A;  2E5K A;  2Z0W A;  3EH1 A;  1I0C A;  4HT9 A;  1RAI B;  2VGN A;  1ZSZ A;  2IIM A;  1VQN A;  1QQJ A;  4F7U B;  5IXB A;  1BI2 A;  3H0I A;  3OQ5 A;  1D09 B;  5LJ5 e;  1M1G A;  5CKH A;  3CCE Q;  4XU2 A;  1VQK Q;  3EG9 A;  3JCM Q;  5AYF A;  3L2Q A;  5FU7 C;  5KYY B;  3CME Q;  2CKK A;  4FW2 A;  3GNG A;  4RKU E;  4ELZ C;  3O8V A;  3LGF A;  1K9M C;  5DM7 R;  3HSB A;  4JUV A;  3G6E A;  2JT4 A;  1VIF A;  5GAN 3;  4BUG A;  4M7D F;  4LD9 K;  3OS2 A;  2E65 A;  2CZ6 B;  3OW2 A;  1GFD A;  1PKT A;  5KE3 A;  4HCC A;  4OVA A;  1IZ6 A;  1U06 A;  4Q5W A;  5LJ3 g;  2SRC A;  4AFQ C;  2RJE A;  3SFM A;  2PU9 B;  2GF7 A;  2XDP A;  2DBM A;  2O4X B;  1FYN A;  1SSH A;  2K9G A;  2RNA A;  1QCN A;  1VQN T;  1YFN A;  2DZC A;  4JDS A;  1N9R A;  3CPW S;  2PNI A;  1SRM A;  1YIT T;  2EPD A;  3M54 A;  3TSZ A;  1N9S A;  2EKH A;  3CC2 A;  3JV3 A;  5HY6 A;  4AFS C;  2M02 A;  4BY6 B;  4F7U E;  5LL6 S;  1BI3 A;  3DB3 A;  1IHW A;  3AT1 B;  1UHC A;  1D1C A;  4V2S A;  1RAB B;  3CCV A;  2BE7 D;  3BDL A;  4LN2 A;  3M4G A;  2E3H A;  1LPL A;  3RES A;  3CC7 A;  1TUD A;  2EYY A;  2SEM A;  1N27 A;  3CMA A;  1VQM A;  2ENM A;  4C92 F;  1Q7Y R;  2K3Y A;  3RMS A;  1YIJ A;  2EKO A;  4FM4 B;  2D8H A;  2DTI A;  4LD6 A;  4RTZ A;  4J8O A;  1ZUU A;  3GNF B;  3I35 A;  4EDU A;  2KRS A;  4A4G A;  4DEX A;  3HFO A;  5FWC A;  1K1Z A;  3GF5 A;  3RKX A;  4LUE A;  1S1N A;  2QQS A;  4XTV A;  3CQT A;  1YJN Q;  1U1T A;  2CZ0 B;  3PVL A;  3HRT A;  2VUB A;  5GAN 7;  3CCJ A;  1R77 A;  2QXF A;  2RQU A;  4XQ3 A;  1OPL A;  3V7R A;  5IHN A;  2E6Z A;  3GPL A;  2H3E B;  1PD0 A;  2AKL A;  2QQR A;  3CXC P;  4BE0 A;  4QVD A;  5FU6 B;  4GY5 A;  1KG1 A;  3ZEH A;  2DIQ A;  4ME7 A;  1VYV A;  3SHW A;  5GJV B;  1E6H A;  4O6J A;  4CI0 C;  4CC7 A;  3SWN A;  2LZ6 B;  3QII A;  1LNX A;  3HRU A;  4LDV A;  1Q81 U;  5CVI A;  2XG8 D;  1ZUY A;  5LJ5 h;  3G71 T;  1C1A A;  1QKX A;  3QUI A;  2KXC A;  1JB0 E;  1NEB A;  4LDU A;  2LDM A;  4BD3 A;  1K8A R;  4XTX A;  3EGX B;  3R6O A;  1XNI A;  1IRX A;  3RMQ A;  3R6N A;  3DLL A;  4DOV A;  4E47 A;  3JSC A;  5M9O A;  3JCM W;  1UGP B;  3L42 A;  4RG8 A;  4MDX A;  2O9S A;  4M75 B;  4M7D A;  1BU1 A;  2EW3 A;  2JW4 A;  2YUN A;  3GBQ A;  2JMC A;  2KT1 A;  1I5O B;  4M75 C;  3JCM c;  5GAN 5;  5KYX B;  4M7A B;  1M2O A;  2YXY A;  4PLI A;  1D1A A;  2M9U A;  4KT0 E;  4C0D B;  5KH6 A;  2EYZ A;  2OTJ A;  3RIR A;  1VQK T;  4JS5 A;  1VIE A;  4FT2 A;  2JNG A;  4Z8A A;  4XTU A;  4M77 C;  3MET A;  2LJ3 A;  4IUU A;  4RTY A;  1M5Q 1;  1WJR A;  1ZSG A;  2LQN A;  1VYT A;  1VQ9 T;  3INZ A;  4A4E A;  2DRM A;  3QPH A;  2HZY A;  4VUB A;  2CP6 A;  2DET A;  3TVT A;  3OA6 A;  5FRO A;  2EJF A;  1BCO A;  2ZPF B;  2PVD B;  4RMO A;  4QQG A;  2KMT A;  2CUB A;  2KBT A;  4CC4 B;  3CCL T;  2DD5 A;  2M51 A;  3EFR A;  2E4H A;  2FB7 A;  4GBQ A;  5D6W A;  4EPC A;  4ZTJ A;  2VV5 A;  4OMP A;  4J83 A;  1VQO T;  3MEV A;  3JB9 I;  2RQW A;  3QYH B;  3CCM T;  4F7U F;  3MP1 A;  4J9E A;  3G71 Q;  3M0T A;  3PVQ A;  1KHC A;  2K3X A;  1T0H A;  4FIB A;  2LQK A;  2ESW A;  1U1S A;  2KE9 A;  2D1X A;  4C92 C;  2HD0 A;  1OV3 A;  2DD4 A;  4IUR A;  1MV3 A;  4LXC A;  1W1F A;  3JB9 F;  2DJZ A;  3PT9 A;  1AWJ A;  1XJW B;  2XHC A;  1AHJ B;  2RHX A;  1QWF A;  4XU1 A;  4ZGD B;  5HCK A;  4M7A A;  4ELY C;  2CGH A;  2QG9 B;  3VS5 A;  2DEU A;  2DIL A;  1W6X A;  1TOV A;  3EG1 A;  2CH4 A;  2QK0 A;  2LQ8 A;  4M78 C;  3KBG A;  3BE3 A;  3THK A;  2LT1 A;  2QGF B;  4JJB A;  2LVM A;  3M0R A;  2HCK A;  5KYN A;  2A08 A;  2ZAE A;  2RHY A;  4CC2 A;  2K2V A;  1K0S A;  2QYZ A;  1HJD A;  3D7S B;  1D1B A;  2RK1 A;  3LH5 A;  3S6W A;  3I5S A;  4C0F A;  1KHI A;  3RBB B;  3CPW P;  3OYG A;  3VRY A;  5CCA A;  4B9W A;  2HKN A;  3I55 Q;  3VYH B;  1Q86 R;  4R0K A;  4HVW A;  2LJ0 A;  1NBE B;  3E19 A;  3V7S A;  1ZX6 A;  1AD5 A;  3CD6 Q;  1H3H A;  4HKE A;  1M3A A;  1G2B A;  2IVW A;  1BI0 A;  2NYS A;  2RA2 A;  8AT1 B;  2CS7 A;  1T3S A;  2QEX T;  3JCM V;  2LJ1 A;  2RQT A;  2EAY A;  4JS4 A;  1WPY A;  3OYE A;  4M7A G;  4JLI A;  4KRT A;  4N0A C;  2DXB A;  5KYW A;  4M78 D;  4PLL A;  3CCJ Q;  1C0M A;  2Y4Y A;  5LJ3 d;  1QVF A;  2OTL T;  4M7D G;  2RQR A;  2YRD A;  3ZFJ A;  5KE2 A;  2L3S A;  2EGA A;  2XD0 A;  2EVR A;  1YP5 A;  3PMI A;  2CP7 A;  1VQN Q;  2L8D A;  3OYA A;  1IB8 A;  1KD1 R;  1PHT A;  3M56 A;  3X26 B;  4AG2 C;  1K76 A;  2NUT B;  1VQM Q;  3OBY A;  3HPW A;  1JU5 C;  2NUP A;  3LW5 E;  2A0F B;  2RB6 A;  3CC7 Q;  3NGP A;  5KCH A;  3CXC S;  1ARK A;  1OI1 A;  3J81 E;  2HAX A;  3M0S A;  2A36 A;  1QVP A;  1B34 B;  4C8Q B;  2NLU A;  2VC8 A;  2GCX A;  5CQX A;  2Y4X A;  4F7U G;  2DL7 A;  4LDW A;  1NG2 A;  3KXT A;  2KI7 A;  2R57 A;  4MML A;  1QP2 A;  3MEW A;  5HK3 A;  2DA9 A;  2YLC A;  2X4X A;  1NPP A;  5GMK l;  2EFI A;  2RHU A;  3OYK A;  1VQ5 Q;  4PJJ A;  1YCY A;  3C94 A;  4N4G A;  2XI9 A;  4QW2 A;  1RI0 A;  1VQO Q;  3EGD A;  5GAO l;  1M90 R;  2FG0 A;  2K4Y A;  1QVF S;  1IGU A;  1IRE B;  1G3T A;  3TCJ A;  1X6B A;  1X01 A;  2L89 A;  3OY9 A;  1EIF A;  3BY7 A;  4HVU A;  2JJ9 A;  5CKE A;  1SF9 A;  2GGR A;  1AWW A;  3UF4 A;  1Y0M A;  3OYI A;  3UT1 A;  3M5A A;  4JJN K;  2DO3 A;  1WQ7 A;  2QEX A;  1G5V A;  3SB2 A;  2LX7 A;  2MF2 A;  2DBK A;  2E5Q A;  1ABQ A;  1BCM A;  2RMO A;  3OYJ A;  3M57 A;  5GMK e;  1RLQ C;  3V8K A;  3P8D A;  1S72 T;  1X27 A;  4HT8 A;  3HP9 A;  2QA4 T;  1Z9Z A;  2HNI A;  2K79 A;  3EHQ A;  2F2W A;  4J9F A;  1YJ9 Q;  1KQS A;  2CZ1 B;  2MWP A;  3C95 A;  2C06 A;  4J6Y A;  4X1V A;  3CD6 T;  4M7A C;  1Q95 G;  1BK2 A;  2ATC B;  2GQV A;  2KQW A;  2DVE A;  5GAM e;  4HCZ A;  4J7I A;  2MIO A;  4ZGE B;  5LJ3 f;  2HQX A;  1KSW A;  2OJ2 A;  4C92 G;  2F1L A;  4FT4 A;  1VQ9 A;  1YJW Q;  1BIB A;  5GAM g;  3TQ7 P;  2CT3 A;  2PUK B;  3V8J A;  4GLK A;  1NM7 A;  3QJY A;  1M2V B;  2MI6 A;  2D9T A;  1PD1 A;  1H8K A;  3EHR A;  4A4H A;  1M8V A;  2M16 A;  4A53 A;  1U5S A;  2FPE A;  3KFV A;  2CSQ A;  4F7U A;  1TWB A;  2QEX Q;  2EYW A;  1VQ4 T;  3RKY A;  5CO7 A;  2CDT A;  2FL7 A;  2NUZ A;  1Y96 B;  1KD1 C;  1S72 Q;  2RJC A;  1OEB A;  3C12 A;  1TTH B;  4MMK A;  4PKC C;  3HTR A;  1YIJ T;  5GAM h;  2B86 A;  1O9S A;  1M4Z A;  2CP2 A;  1W2B A;  2DPP B;  1UEC A;  3X25 B;  4AG1 C;  1WQW A;  3I55 A;  5LJ3 e;  2YLB A;  3I56 Q;  1KC8 C;  1KC8 R;  5FRM A;  1AZE A;  3F70 A;  3UWN A;  1VQ5 A;  5GAN 6;  2XDB A;  2AKK A;  4FCY A;  1HK9 A;  2KNB B;  1GBR A;  3OSV A;  5EG2 A;  2L0A A;  4J6W A;  2VXE A;  4M75 E;  3VYG A;  2JN0 A;  3EG2 A;  4J9C A;  5GMK i;  3C4S A;  2MPX C;  3OYN A;  2EGE A;  1DJ7 B;  5GJW B;  2JZ2 A;  1VQL T;  1ZA1 B;  2E10 A;  2YWW A;  4FL6 A;  1S72 A;  2RJF A;  1X6G A;  4C0Z A;  1PG5 B;  3JCM b;  2GQI A;  2RHI A;  3A8L B;  4A4F A;  2RM4 A;  2K5F A;  2KR3 A;  2CH4 W;  3FDR A;  3PIO A;  2M1H A;  1RAE B;  4E7L A;  4PFZ A;  1PRL C;  1F1B B;  3MP8 A;  2WSF E;  2OTJ T;  1V1C A;  2O2O A;  3NTI A;  2EJG A;  4OMF B;  4PK4 A;  3OBW A;  2DYI A;  1RI9 A;  3L2Z A;  2YRC A;  1M9S A;  1JEG A;  3FJ5 A;  1YI2 T;  3WVE B;  1Q81 C;  3ZL7 C;  1Q81 R;  2EQJ A;  3SWN C;  8ATC B;  3LWI A;  3REB B;  1RLP C;  4D8K A;  2K3B A;  4MDW A;  4FSS A;  1VQP T;  4OMM A;  1X6O A;  1WGS A;  1N6A A;  2VB6 A;  1OQK A;  2QDY B;  4M77 G;  4A54 A;  1K73 C;  5FWB A;  2A28 A;  3DLM A;  3A8H B;  2XMF A;  4KUL A;  4BE2 A;  5HKC A;  1AVZ C;  2GBQ A;  1VQ5 T;  1ZSZ C;  4C5H A;  1BBZ A;  1YBY A;  4AFU C;  1V29 B;  4Z02 A;  4BI4 A;  2DL3 A;  1RAH B;  1M3C A;  5I21 A;  4DEY A;  1BB9 A;  3A8G B;  1UTI A;  4TVR A;  1M1K R;  1JO8 A;  1R0C B;  4RTX A;  2DLP A;  1G3Y A;  3OS0 A;  2AT1 B;  3CCJ T;  1OZ2 A;  4DBQ A;  5LJ5 g;  3CCR T;  4FYV B;  2KK4 A;  2RF0 A;  2DTH A;  4C8Q A;  1VQP A;  3UA7 A;  1YI2 Q;  5J39 A;  2NUT A;  3E9G A;  3G4S T;  2DK3 A;  2RHZ A;  2KAF A;  3VUZ A;  1K73 R;  1X2Q A;  3S3N A;  3S3M A;  5J26 A;  5GAM d;  2AZV A;  4J5Y A;  1RAC B;  3U23 A;  2J6O A;  3SWN B;  1EX4 A;  2DYB A;  2A3L A;  2DFU A;  4KGV B;  1I8F A;  2CUD A;  1VQM T;  2KXD A;  1ZBX A;  3JCM g;  3PE0 A;  3JCM f;  4M7D B;  1Q82 U;  1D0Y A;  3C0C A;  5IT9 E;  5IHI A;  3OYH A;  3V7C A;  4FYY B;  1PC0 A;  1JJ2 S;  2G3R A;  4M7A D;  4LDX A;  1SHF A;  1WXT A;  2R5M A;  4MZT A;  3KUF A;  2ZGW A;  1OYX A;  1LJO A;  1WXB A;  2CZ7 B;  2L3P A;  3OSS C;  5GAN h;  4JRP A;  1B3Q A;  1KC8 U;  2IPO B;  4JRI A;  4M7A E;  1C6V X;  4J9D A;  3OYF A;  3G71 A;  4ZGJ B;  3TRE A;  4WF2 A;  4ZN3 A;  2CP3 A;  2CT4 A;  1N8R C;  3UPU A;  3EGU A;  1N8R R;  2DIG A;  2KEA A;  1JJ2 A;  4QQD A;  2HQE A;  2KRN A;  1AWX A;  1HD3 A;  3L2V A;  2PTK A;  4M78 E;  4LUD A;  3G4S Q;  4KUD K;  1M3B A;  2L3R A;  3QDR B;  2D0N A;  2EQI A;  1P92 A;  4Y91 A;  5I22 A;  3M4Y A;  4C8Q D;  4BAC A;  2X3X D;  4DBR A;  3H0F A;  1MV0 B;  1JXM A;  4J9B A;  4PJO F;  5C0M A;  4PJO A;  4BB7 A;  2JM9 A;  1PCX A;  2FPD A;  3FJP A;  2VXF A;  2LRQ A;  3EGD B;  2EQM A;  3I5R A;  1QCF A;  1PNJ A;  2DNU A;  3CBM A;  1YIT Q;  4M77 B;  4E2F B;  2XID A;  1MMA A;  2JUF A;  2RQV A;  2E1H A;  4OB1 B;  4ZNX A;  5IHK A;  3QSU A;  9ATC B;  2MYS A;  1NLO C;  3OYM A;  3REA B;  4BE1 A;  2D6F A;  3QXE B;  1UB4 A;  4OB0 B;  3H41 A;  2DVJ A;  3TU4 K;  2ZPB B;  3A5Z B;  1UGS B;  1LCK A;  2K57 A;  1WZO A;  4N0A A;  3CCM A;  2DKG A;  1Q86 C;  2AK5 A;  1H3Z A;  1JBM A;  1PSE A;  1WI7 A;  1EFN A;  1X2K A;  1JRI A;  2GNC A;  3BDU A;  4PJL A;  4E7J A;  4JLG A;  2MMP A;  1GL5 A;  5LJ3 j;  4E7S A;  1E7O A;  2E64 A;  2KDS A;  4PJO C;  3VS6 A;  2EGC A;  1FMV A;  2LC4 A;  3NPF A;  3TSW A;  1YIT A;  4PJO G;  1WX6 A;  2LCC A;  1KD1 U;  1Y57 A;  2P84 A;  4C5G A;  1JJ2 P;  4XTW A;  4HXJ A;  4EMH A;  1GCQ C;  2V1R A;  3HHT B;  4IKF A;  1G8X A;  1OX9 A;  5GMK h;  5C6S A;  4CRI A;  1YJN A;  1TUG B;  2QQA A;  3MJX A;  5DLO A;  3CCR A;  3G1J A;  2KSS A;  2C0I A;  2NUP B;  1WDX A;  4M77 A;  3HL8 A;  2ED0 A;  1VQ9 Q;  2YDL A;  2ZPI B;  4FSX A;  3VV0 A;  1VQ8 T;  4J9H A;  3LX7 A;  1Q82 R;  2BIV A;  4NL2 A;  2EYQ A;  1IHV A;  4X9D A;  2FZK B;  2QQ9 A;  1WA7 A;  3CMA Q;  3UDC A;  2LQW A;  1U3O A;  4F04 B;  1VA7 A;  5LJ5 f;  1VQL Q;  1M1F A;  5CK9 A;  1WIE A;  5KYW B;  1YJ9 A;  4ZTF A;  1M1K U;  2K2M A;  2K7A A;  3CCV Q;  4RTW A;  4M77 D;  4EMK C;  3LWH A;  1CSK A;  4YTL A;  3QYG B;  2HDA A;  1YWO A;  1HSQ A;  3A8M B;  2BE9 B;  5CKD A;  2QTX A;  2ECZ A;  4PNO A;  2RJD A;  2X35 A;  1SPK A;  2ZPE B;  2FZC B;  1GFC A;  4NL3 A;  4XTZ A;  3OB9 A;  3QWX X;  3FLG A;  2RI5 A;  1N8R U;  5A2Q E;  2WSE E;  3EG9 B;  2DX1 A;  2OTJ Q;  4OF1 A;  5KYU A;  2DRK A;  2HL5 C;  4BDY A;  1K73 U;  5GAM f;  1FXX A;  2DMO A;  4M75 F;  5GAN 2;  2OTL Q;  1B34 A;  4JZ3 A;  2DAQ A;  2FEI A;  1RAA B;  1VQP Q;  2QQB A;  4PJN A;  1UFF A;  3MO8 A;  3M55 A;  3A98 A;  4C92 A;  1BKB A;  4M4Z A;  5FLX E;  3VUB A;  1I1J A;  4F17 A;  3CC4 A;  3CMA T;  3FC3 A;  2R5A A;  2DXU A;  3M0Q A;  1QWE A;  3M0P A;  4DQ2 A;  2LNH B;  4JRK A;  2O4X A;  3CC7 T;  1WHJ A;  3I56 T;  2FPF A;  4R55 A;  3CCV T;  1RUW A;  2RPN A;  1QMC A;  2E41 A;  2QI2 A;  3NTH A;  3PTA A;  2LX9 A;  1KQS P;  1KFZ A;  4RTU A;  4M7D C;  2HSE B;  3CPF A;  1UJ0 A;  2E70 A;  1W2B P;  1WXU A;  1M27 C;  1OPK A;  3OW2 S;  4M7D E;  3PNW C;  2V8I A;  3I55 T;  4L5G A;  4AT1 B;  3VU3 C;  5FRN A;  1KIK A;  2KGT A;  2RH2 A;  4MZM A;  2X4J A;  3CC4 T;  3A1P A;  1VQ7 T;  1Y71 A;  1PKS A;  2LNV A;  1Q82 C;  2BZY A;  5A0G A;  2GTJ A;  2ED1 A;  3H9N A;  1YIJ Q;  2DJQ A;  1QP3 A;  1WJQ A;  2CYZ B;  3M58 A;  5LJ5 d;  2H3J A;  1W70 A;  2ABL A;  5HK0 A;  1FWZ A;  2P4R A;  4M78 B;  5L8R E;  5LJ3 h;  2XDD A;  5DLQ E;  3MHX A;  1G83 A;  3AHU A;  3WVD B;  2DL8 A;  1W2B S;  2VGM A;  4D8D A;  1TG0 A;  3CXC A;  2LP5 A;  3I9Q A;  4XU0 A;  2VKN A;  4J7F A;  3J80 E;  1TUC A;  3VJP A;  3QBY A;  3Q1J A;  1D0Z A;  1QCO A;  2D8J A;  1LVK A;  1MUZ A;  3CD6 A;  3JB9 G;  1M90 C;  1QVG S;  1FX7 A;  2H8H A;  4PFO A;  3MEU A;  4XTY A;  3RUX A;  3MP6 A;  2A7Y A;  4QKU A;  1Y96 A;  1ZUK A;  1AOJ A;  5CIU A;  2PZ1 A;  1TU0 B;  1K8A C;  1NYF A;  2DF6 A;  4PJO E;  4M77 F;  1D3B B;  2NWM A;  3JCM P;  3ULR B;  4ESR A;  3GLX A;  3H6Z A;  3EGX A;  1MHN A;  2C0T A;  3CCS Q;  2PVG B;  3CCE T;  5CR2 A;  3OYY A;  2V8K A;  1UE9 A;  1NYG A;  2DM1 A;  3P8H A;  1Y7X A;  2P4T A;  2WAC A;  3DKM A;  4E7K A;  3G6E Q;  4JJD A;  1TS9 A;  1Q86 U;  1UEB A;  3QWY A;  2W0Z A;  2CP5 A;  1XOV A;  3CME A;  1T0J A;  1R0B G;  1RAF B;  3OYC A;  3ASK A;  3X20 B;  2BZ8 A;  4ORZ A;  1BIA A;  1NJI R;  5EC7 A;  3A8O B;  4XU3 A;  1OUL A;  1T3L A;  2KVQ G;  1VQK A;  3EFO B;  1GRI A;  2DXT A;  5GAO p;  1BYM A;  1VQL A;  2GTO A;  3SDZ A;  4EMK A;  4JPB W;  1KQ1 A;  4HVV A;  4FYW B;  2CSI A;  5I11 A;  4C0D C;  1K0X A;  1MGQ A;  2V26 A;  5GAM j;  3MKD A;  4PL6 A;  1PWT A;  3LGL A;  3CEY A;  1WHL A;  2ZZD A;  4Z89 A;  2VVK A;  1X69 A;  2HL3 A;  5A0D A;  2J7I A;  4RCC A;  4OML A;  2EQK A;  1R8O B;  1I5L A;  5AT1 B;  1VQ6 A;  2JXB A;  1M30 A;  4C92 E;  1QW1 A;  3CCR Q;  2JS2 A;  2HKQ B;  2EWN A;  3RR6 A;  1WHG A;  1AZG B;  4BDZ A;  2O01 E;  4C8Q F;  2X4W A;  4IUQ A;  3MCA B;  1XTD A;  2FO0 A;  2RK2 A;  1AT1 B;  3JAM E;  2RI3 A;  4KH0 B;  2HQH A;  2X4Y A;  1ACM B;  5I2S A;  3OS1 A;  2MOX A;  3CCU Q;  3NHN A;  1I4K 1;  4C8Q G;  1PM3 A;  5IXF A;  1HXD A;  2EJ9 A;  1K4U S;  1YNZ A;  3PMT A;  1VOM A;  1MNE A;  4QVC A;  1QVG P;  1ABO A;  2AHJ B;  2F5T X;  3PIP A;  5CQY A;  5GAO q;  2P0Q A;  5IAY A;  1QKW A;  3QZ9 B;  4OMO A;  2ROL A;  4OP0 A;  2LTO A;  4MZP A;  1MMN A;  1VQ8 Q;  2RN8 A;  3QKJ A;  3CBO A;  3SD4 A;  3WXM B;  3EAE A;  4X9C A;  3OS5 A;  4XK8 E;  2E12 A;  4PJO D;  2O9V A;  4ANJ A;  1MMG A;  2QA4 A;  3CPW A;  3EFS A;  2J05 A;  2WSC E;  4DBH A;  2OAU A;  4J9I A;  1WHH A;  3FRN A;  1O75 A;  2JM8 A;  4IUV A;  4AMC A;  3M0U A;  5A0L A;  1K9M U;  2RO0 A;  2ZCF B;  2O31 A;  5GAN e;  3CCL A;  1VUB A;  1M1K C;  2E3I A;  4HA8 A;  2LMJ A;  4M78 F;  5D6X A;  1MMD A;  4J9G A;  2M0O A;  5GAN d;  4OGC A;  2DL5 A;  4IUP A;  2XKO C;  3CC2 T;  2JTM A;  1Y07 A;  3OW2 P;  3CBP A;  1J3T A;  4FU6 A;  3V8L A;  4M7A F;  1UDL A;  2F69 A;  4GLM A;  2JMA A;  3QJ6 A;  5GAN 8;  4QQ6 A;  2EQU A;  4LE9 A;  4JRQ A;  5D7U A;  1SG5 A;  3CCQ T;  2M0Y A;  3G4S A;  4KGX B;  2DL4 A;  3BFM A;  1EZZ B;  1H64 1;  1PSF A;  4L6V 5;  1NE8 A;  3T9N A;  4OMN A;  2HBW A;  3N5B B;  4XAX B;  1IGQ A;  1X75 C;  4M75 A;  2COW A;  2GFU A;  1Q7Y U;  2P0K A;  2F5K A;  3DB4 A;  1CKB A;  4N4I A;  1VQ7 A;  2DER A;  3RDV A;  4C5I A;  4BI8 B;  4A4K A;  3E1S A;  6AT1 B;  1HYO A;  2JTF A;  2JS0 A;  3JCM X;  3RNJ A;  1SKU B;  1GCQ A;  4DOW A;  2RD1 A;  2X3W D;  2J6F A;  1TXQ A;  4QT7 A;  1H92 A;  4WCI A;  2EYX A;  5FU7 B;  4F14 A;  2QA4 Q;  1YJ9 T;  3CCS T;  1ZLM A;  2QGG A;  5KYX A;  2YSQ A;  3OMC A;  2FVU A;  4OGE A;  2YT6 A;  2FRY A;  2VYT A;  3EH2 A;  4CC3 A;  1WHM A;  3QHS A;  2COZ A;  3RER A;  1YHQ A;  3CCM Q;  3LLR A;  5IH2 A;  4UC4 A;  5J3B A;  1I81 A;  2KYM A;  4FW1 A;  3VS4 A;  1UHF A;  2L3Q A;  2V1Q A;  1UGV A;  4HCB A;  4P5N A;  2VAS A;  3JB9 J;  4FYX B;  1YJW T;  4M77 E;  3CCQ Q;  2FHD A;  2BUD A;  1YI2 A;  3UA6 A;  1G3W A;  3VS1 A;  3QZ5 B;  4O5V A;  2C0O A;  2XK0 A;  3M59 A;  2W10 A;  2VWF A;  1VQ7 Q;  5CKF A;  3HRS A;  4AFZ C;  2XU8 A;  3SEM A;  1K8A U;  1KQ2 A;  1OU9 A;  2XIC A;  1MND A;  5GMK j;  4ATO A;  1SEM A;  1Z9Q A;  2QDL A;  2FYK A;  4M75 D;  3CCU T;  2PQW A;  1G3S A;  5KYY A;  1ZSZ B;  3ER0 A;  4R56 A;  2EBP A;  3LYI A;  1D3B A;  1KJW A;  1E6G A;  4KGZ B;  3L2U A;  4E7Z A;  2KT8 A;  3FIF A;  1AEY A;  2MWO A;  3UAT A;  4M78 G;  2MK5 A;  2DZ9 A;  2MAM A;  4E7I A;  1YHQ T;  3OYB A;  5CKB A;  4LNP A;  3URG A;  4M7D D;  3ME9 A;  3E2U A;  2PVO B;  4KBM B;  3HFN A;  3VS3 A;  2YHT A;  2QAZ A;  1U8R A;  1FMK A;  1TSF A;  4L59 A;  1QVG A;  1NJI C;  2FRW A;  3P8B B;  1YWP A;  3QG1 A;  4BI3 A;  3TEE A;  5LJ5 j;  2Y90 A;  4M75 G;  3GOX A;  3CCL Q;  2K6D A;  2YRV A;  4LDY A;  1WLP B;  3VS7 A;  3QO3 A;  4E6R A;  5KYU B;  4IIO A;  3MPU B;  5KCO A;  2BTT A;  4K11 A;  3H8Z A;  3EFO A;  5I2M A;  1WJS A;  2K5I A;  2A37 A;  3M53 A;  2V8J A;  3PFS A;  2OI3 A;  2KRO A;  5GMK m;  2GFA A;  4EMK B;  1SHG A;  1M8M A;  1UUE A;  1SSF A;  3S3O A;  3JRZ A;  4IUT A;  5D6Y A;  1K9A A;  2HSP A;  2YUO A;  3NMZ C;  2LCS A;  1WFW A;  1YJN T;  3M9Q A;  1BI1 A;  1W4S A;  1VQ4 A;  4Z88 A;  3NFC A;  3FEO A;  2L2P A;  1N5Z A;  4C92 B;  2J06 A;  1JXO A;  4PFP A;  3CCQ A;  1JQQ A;  2DE0 X;  2YUQ A;  4WTO B;  1FMW A;  2AIR B; 
#chains in the Genus database with same CATH homology
 1YI2 T;  4XTU A;  3G6E T;  4M77 C;  2H3J A;  3MET A;  4C92 D;  3WVE B;  1Q81 C;  1GXI E;  4ZN1 A;  4IUU A;  5HK0 A;  1FWZ A;  3OYD A;  1M5Q 1;  1WJR A;  2EQJ A;  4M78 B;  5L8R E;  5DLQ E;  3SWN C;  4Y28 E;  5LJ3 h;  3MHX A;  2XDD A;  3LWI A;  3AHU A;  1VQ9 T;  3INZ A;  4A4E A;  4MDW A;  3QPH A;  3WVD B;  1XQH A;  4OB2 B;  1VQP T;  1W2B S;  2VGM A;  4VUB A;  3CXC A;  4J6X A;  2I2L A;  1VQO A;  4EMG A;  1X6O A;  4XU0 A;  3OA6 A;  5FRO A;  2EJF A;  2ZPF B;  4J7F A;  1WGS A;  3J80 E;  3VJP A;  3QBY A;  3Q1J A;  1N6A A;  1Q7Y C;  2PVD B;  2QDY B;  4RMO A;  1UGQ B;  4M77 G;  4QQG A;  2KMT A;  2JOY A;  4A54 A;  1K73 C;  4C5E A;  3E9F A;  3CCL T;  3JB9 G;  4QVZ A;  1M90 C;  3DLM A;  3CD6 A;  3A8H B;  2DD5 A;  1FX7 A;  5GAN g;  1QVG S;  4KUL A;  3EFR A;  3MEU A;  4BE2 A;  5HKC A;  2FB7 A;  2DTO A;  5D6W A;  2ZPH B;  4XTY A;  4EPC A;  3RUX A;  3GP8 A;  1VQ5 T;  3MP6 A;  2A7Y A;  4C5H A;  4ZTJ A;  1Y96 A;  1YBY A;  4KUI A;  1OZ3 A;  1V29 B;  2VV5 A;  3NTK A;  4Z02 A;  5CIU A;  4BI4 A;  1K8A C;  2D0Q B;  1NPR A;  4J83 A;  1VQO T;  3MEV A;  4PJO E;  4M77 F;  3JB9 I;  3QYH B;  3X28 B;  5I21 A;  3CCM T;  2LT4 A;  1D3B B;  3MP1 A;  4F7U F;  3A8G B;  1KHC A;  3JCM P;  2K3X A;  4TVR A;  1TH7 A;  4FIB A;  3L2W A;  3HKS A;  3JCM J;  2LQK A;  1U1S A;  3GLX A;  3H6Z A;  3FB9 A;  3G7Z A;  2PUO B;  1MHN A;  4C92 C;  1G3Y A;  2ZPG B;  5GAO m;  2HD0 A;  3OS0 A;  3CCJ T;  1OZ2 A;  5LJ5 g;  2PVG B;  2DD4 A;  4IUR A;  3CCE T;  5CR2 A;  3OYY A;  3CCR T;  2KK4 A;  2V8K A;  4RG2 A;  3JB9 F;  2P0P A;  2DJZ A;  4PJO B;  2LCL A;  3PT9 A;  3P8H A;  2DTH A;  4E7K A;  1Y7X A;  2P4T A;  2WAC A;  3DKM A;  4C8Q A;  1VQP A;  2XHC A;  1AHJ B;  2RHX A;  4OB3 B;  5J39 A;  3E9G A;  3G4S T;  1Q86 U;  2DK3 A;  2RI2 A;  4X34 A;  1UEB A;  4XU1 A;  2RHZ A;  4ZGD B;  2KAF A;  3VUZ A;  4NS5 A;  1ZHI A;  4M7A A;  4ELY C;  1XOV A;  2EIF A;  3CME A;  2CGH A;  3S3N A;  5J26 A;  5GAM d;  4J5Y A;  3LH0 A;  3ASK A;  3X20 B;  3OYC A;  1BIA A;  2R58 A;  3A8O B;  4XU3 A;  4DA4 A;  3JB9 D;  3L2R A;  2LQ8 A;  2KVQ G;  3SWN B;  1VQK A;  1LOJ A;  4M78 C;  3KBG A;  4D6W A;  2A3L A;  2LT1 A;  1I8F A;  1VQM T;  2E6N A;  3MEA A;  1ZBX A;  2DXT A;  5GAO p;  1BYM A;  1VQL A;  2LVM A;  3JCM g;  3JCM f;  3SDZ A;  4EMK A;  4M7D B;  1Q82 U;  2KY9 A;  1KQ1 A;  2RHY A;  4C0D C;  5IT9 E;  1WNL A;  1MGQ A;  2K2V A;  5GAM j;  3OYH A;  4PL6 A;  3LGL A;  3V7C A;  1KQS S;  4E7H A;  1JJ2 S;  2G3R A;  3L1A A;  3CEY A;  3X24 B;  3JB9 H;  2ZZD A;  4M7A D;  4LDX A;  2R5M A;  4MZT A;  3KUF A;  2ZGW A;  1OYX A;  5A0D A;  1LJO A;  2RK1 A;  4RCC A;  3CCS A;  5FU6 C;  5GAN h;  2CZ7 B;  3OSS C;  3S6W A;  4C0F A;  5GAN 4;  1KHI A;  4JRP A;  2EQK A;  5GAO n;  3OYG A;  5CCA A;  1R8O B;  2DXC A;  4B9W A;  1I5L A;  1VQ6 T;  1VQ6 A;  1KC8 U;  1UGR B;  4JRI A;  4M7A E;  3VYH B;  4M78 A;  3OYF A;  3G71 A;  4RCB A;  1RL2 A;  4C92 E;  1QW1 A;  3E19 A;  3V7S A;  3TRE A;  2EWN A;  4ZGJ B;  1VQ8 A;  3J7A F;  4NOY A;  4WF2 A;  4HKE A;  4BDZ A;  4ZN3 A;  1N8R C;  2O01 E;  4C8Q F;  2X4W A;  4IUQ A;  3UPU A;  3MCA B;  1XTD A;  2DIG A;  1NJI U;  2IVW A;  3OYL A;  1BI0 A;  4QQD A;  1JJ2 A;  2RK2 A;  2HQE A;  3JAM E;  3I56 A;  2RI3 A;  1YJN T;  2RA2 A;  2CS7 A;  2X4Y A;  3BW1 A;  3L2V A;  4M78 E;  3PGG A;  2QEX T;  4B9X A;  4KUD K;  3JCM V;  5I2S A;  2EAY A;  4JS4 A;  3VKI A;  2L3R A;  1WPY A;  3QDR B;  3OYE A;  2HBP A;  3OS1 A;  4Y91 A;  1P92 A;  4M7A G;  1I4K 1;  3OMG A;  4C8Q G;  4JLI A;  3M4Y A;  4C8Q D;  4BAC A;  4N0A C;  1HXD A;  2DXB A;  1NZ9 A;  3ZBD A;  5C0M A;  4PJO F;  2K5L A;  2EJ9 A;  4M78 D;  4PLL A;  4PJO A;  5GAN j;  2OTL A;  4BB7 A;  3PMT A;  3CME T;  3CCU A;  2Y4Y A;  5LJ3 d;  3FJP A;  2VXF A;  2LRQ A;  4QVC A;  5GAN f;  1QVF A;  2OTL T;  4M7D G;  4N4H A;  3ZFJ A;  2AHJ B;  2EQM A;  5KE2 A;  2F5T X;  2BKD N;  2XD0 A;  3PIP A;  5CQY A;  5GAO q;  2P0Q A;  5IAY A;  3PMI A;  3CBM A;  3QZ9 B;  2DEQ A;  2B8A A;  1ZQ1 A;  4OP0 A;  2LTO A;  4C8Q C;  4M77 B;  2XID A;  3LWH A;  4MZP A;  2L8D A;  4C0G A;  3RKW A;  2JUF A;  3OYA A;  2E1H A;  3QKJ A;  3CBO A;  4II1 A;  3M56 A;  4OB1 B;  3CCE A;  3X26 B;  4BY6 C;  3GIB A;  3SD4 A;  3JCM h;  3JCM e;  3QSU A;  3OYM A;  3WXM B;  4BE1 A;  3EAE A;  2D6F A;  5GAO r;  4C8Q E;  3QXE B;  4X9C A;  1UB4 A;  1M90 U;  3OS5 A;  4OB0 B;  4XK8 E;  2E12 A;  4PJO D;  1YJW A;  3OBY A;  2ZPB B;  3HPW A;  3A5Z B;  2IG0 A;  1UGS B;  5IN1 A;  3TU4 K;  3JCM d;  2L5Q A;  2K57 A;  3LW5 E;  2JVV A;  2RB6 A;  2QA4 A;  5KCH A;  3CXC S;  4N0A A;  3CPW A;  3EFS A;  3CCM A;  2WSC E;  5DY9 A;  2OAU A;  3FRN A;  5CAI A;  2DKG A;  1Q86 C;  1O75 A;  1OI1 A;  3J81 E;  2HAX A;  4IUV A;  1H3Z A;  4HT9 A;  1JBM A;  5A0L A;  1PSE A;  1QVP A;  2VGN A;  2RO0 A;  1B34 B;  4C8Q B;  2NLU A;  1K9M U;  1JRI A;  3BDU A;  2VC8 A;  2ZCF B;  1VQN A;  2GCX A;  5CQX A;  2Y4X A;  4F7U G;  5GAN e;  4JLG A;  1VUB A;  4E7J A;  1M1K C;  3CCL A;  4HA8 A;  2MMP A;  4F7U B;  4LDW A;  5LJ3 j;  3KXT A;  1BI2 A;  2R57 A;  3OQ5 A;  4M78 F;  2E64 A;  2KDS A;  4MML A;  5D6X A;  4PJO C;  1QP2 A;  3MEW A;  5HK3 A;  2M0O A;  5LJ5 e;  5GAN d;  4OGC A;  1M1G A;  2YLC A;  5CKH A;  4XU2 A;  4IUP A;  3CC2 T;  2XKO C;  2JTM A;  1Y07 A;  2X4X A;  1NPP A;  5GMK l;  2EFI A;  2LC4 A;  3JCM Q;  5AYF A;  3L2Q A;  5FU7 C;  1YIT A;  4PJO G;  2RHU A;  3OYK A;  3CBP A;  2CKK A;  2LCC A;  1YCY A;  3C94 A;  1KD1 U;  4N4G A;  3GNG A;  2XI9 A;  4FU6 A;  4RKU E;  4ELZ C;  3V8L A;  3O8V A;  4M7A F;  3LGF A;  4QW2 A;  1RI0 A;  2F69 A;  1K9M C;  3QJ6 A;  5GAN 8;  5DM7 R;  5GAO l;  4JUV A;  4QQ6 A;  3G6E A;  3HSB A;  2EQU A;  2K4Y A;  1VIF A;  5GAN 3;  1QVF S;  4BUG A;  4JRQ A;  4C5G A;  1IRE B;  4M7D F;  1G3T A;  4LD9 K;  3CCQ T;  3OS2 A;  2E65 A;  4XTW A;  3TCJ A;  1X01 A;  2L89 A;  3OY9 A;  3G4S A;  2CZ6 B;  1EIF A;  3BFM A;  3BY7 A;  3OW2 A;  4EMH A;  1H64 1;  5CKE A;  1PSF A;  3HHT B;  4L6V 5;  5KE3 A;  4HCC A;  4IKF A;  1NE8 A;  3T9N A;  4OVA A;  3N5B B;  4XAX B;  1IZ6 A;  3OYI A;  4Q5W A;  3M5A A;  3UT1 A;  5GMK h;  5C6S A;  4JJN K;  4CRI A;  2DO3 A;  5LJ3 g;  1YJN A;  1X75 C;  1WQ7 A;  2QQA A;  4M75 A;  5DLO A;  2QEX A;  2GFU A;  3CCR A;  1Q7Y U;  2RJE A;  1G5V A;  2P0K A;  3SFM A;  2PU9 B;  2F5K A;  2GF7 A;  2KSS A;  2XDP A;  3DB4 A;  3SB2 A;  4N4I A;  1VQ7 A;  2MF2 A;  4C5I A;  2O4X B;  4M77 A;  3HL8 A;  4BI8 B;  4A4K A;  3E1S A;  2E5Q A;  3S3M A;  1VQN T;  2DZC A;  2JTF A;  2ZPI B;  4FSX A;  4JDS A;  3VV0 A;  3M57 A;  1N9R A;  5GMK e;  3OYJ A;  3CPW S;  1VQ8 T;  3LX7 A;  1YIT T;  3JCM X;  3V8K A;  3M54 A;  3P8D A;  1S72 T;  1N9S A;  4DOW A;  2BIV A;  4NL2 A;  3CC2 A;  2EYQ A;  4X9D A;  4HT8 A;  2RD1 A;  2QQ9 A;  3HP9 A;  2QA4 T;  2HNI A;  5HY6 A;  3GOX A;  5FU7 B;  4BY6 B;  1YJ9 T;  3UDC A;  1KQS A;  3CCS T;  4F7U E;  2CZ1 B;  5LJ5 f;  5LL6 S;  1BI3 A;  3DB3 A;  1M1F A;  2MWP A;  3OMC A;  3C95 A;  2C06 A;  5CK9 A;  2FVU A;  4J6Y A;  1YJ9 A;  4OGE A;  4ZTF A;  1M1K U;  3CD6 T;  4M7A C;  2VYT A;  4V2S A;  3CCV A;  3QHS A;  3RER A;  4EMK C;  4M77 D;  3BDL A;  2GQV A;  2KQW A;  1YHQ A;  3M4G A;  2DVE A;  3QYG B;  3LLR A;  4HCZ A;  4YTL A;  4J7I A;  3RES A;  5GAM e;  5LJ3 f;  4ZGE B;  3A8M B;  1I81 A;  4UC4 A;  5J3B A;  3CC7 A;  2HQX A;  5CKD A;  2QTX A;  4PNO A;  2RJD A;  2X35 A;  1N27 A;  4FT4 A;  4C92 G;  3CMA A;  1VQM A;  1VQ9 A;  1BIB A;  4HCB A;  4P5N A;  4C92 F;  2ZPE B;  5GAM g;  4NL3 A;  3JB9 J;  3OB9 A;  4XTZ A;  2PUK B;  3V8J A;  1YJW T;  2K3Y A;  3FLG A;  2RI5 A;  4GLK A;  3RMS A;  4M77 E;  1YIJ A;  5A2Q E;  2EKO A;  1N8R U;  2WSE E;  3QJY A;  2FHD A;  4FM4 B;  2DTI A;  2MI6 A;  2BUD A;  4OF1 A;  1YI2 A;  4LD6 A;  1G3W A;  4BDY A;  1K73 U;  2D9T A;  5GAM f;  4J8O A;  1FXX A;  3QZ5 B;  4M75 F;  4A4H A;  3GNF B;  4O5V A;  5GAN 2;  4EDU A;  1M8V A;  2M16 A;  2XK0 A;  1B34 A;  4A53 A;  3M59 A;  2DAQ A;  4A4G A;  5CKF A;  3HFO A;  3HRS A;  3GF5 A;  3RKX A;  2XU8 A;  2QQS A;  4F7U A;  4XTV A;  1K8A U;  1KQ2 A;  1VQ4 T;  2XIC A;  2QQB A;  3RKY A;  4ATO A;  5GMK j;  1U1T A;  3MO8 A;  5CO7 A;  2CZ0 B;  2FL7 A;  2FYK A;  1Y96 B;  3M55 A;  4C92 A;  3HRT A;  1KD1 C;  2VUB A;  5GAN 7;  4M75 D;  3CCJ A;  3CCU T;  2PQW A;  2RJC A;  2QXF A;  1BKB A;  1G3S A;  5FLX E;  4XQ3 A;  3VUB A;  3C12 A;  3V7R A;  3ER0 A;  4R56 A;  2E6Z A;  3GPL A;  3LYI A;  3CC4 A;  1D3B A;  4MMK A;  3L2U A;  3CMA T;  2QQR A;  4PKC C;  3FC3 A;  1YIJ T;  5GAM h;  4BE0 A;  2R5A A;  2DXU A;  4QVD A;  5FU6 B;  4DQ2 A;  3FIF A;  1O9S A;  2MWO A;  4JRK A;  1M4Z A;  1W2B A;  2DPP B;  3X25 B;  4M78 G;  4GY5 A;  1KG1 A;  1WQW A;  2O4X A;  3ZEH A;  3I55 A;  3CC7 T;  5LJ3 e;  2DIQ A;  2YLB A;  2DZ9 A;  2MAM A;  4ME7 A;  1KC8 C;  5FRM A;  4E7I A;  1YHQ T;  3F70 A;  4O6J A;  3UWN A;  4R55 A;  3OYB A;  4CI0 C;  5GAN 6;  5CKB A;  3I56 T;  1VQ5 A;  3CCV T;  3URG A;  2XDB A;  4M7D D;  3ME9 A;  2PVO B;  4KBM B;  1HK9 A;  2E41 A;  3HFN A;  2QI2 A;  3NTH A;  3SWN A;  3PTA A;  2LX9 A;  2YHT A;  3QII A;  3OSV A;  5EG2 A;  3CPF A;  1U8R A;  1LNX A;  4M7D C;  4L59 A;  3HRU A;  1QVG A;  2E70 A;  4LDV A;  1Q81 U;  1NJI C;  3P8B B;  4J6W A;  2VXE A;  3QG1 A;  5CVI A;  2XG8 D;  4M75 E;  3VYG A;  4BI3 A;  5LJ5 h;  3G71 T;  2JN0 A;  3TEE A;  5LJ5 j;  5GMK i;  2Y90 A;  4M75 G;  3C4S A;  3OYN A;  3QUI A;  3OW2 S;  4M7D E;  1JB0 E;  3PNW C;  2V8I A;  1DJ7 B;  2YRV A;  4LDU A;  2LDM A;  2JZ2 A;  4LDY A;  4BD3 A;  3I55 T;  4L5G A;  1VQL T;  4XTX A;  3VU3 C;  2E10 A;  3QO3 A;  4FL6 A;  1S72 A;  3R6O A;  2RJF A;  5FRN A;  1XNI A;  3DLL A;  3RMQ A;  2RH2 A;  4DOV A;  4E47 A;  5KCO A;  3JSC A;  4C0Z A;  5M9O A;  3JCM b;  3H8Z A;  1UGP B;  3JCM W;  4MZM A;  2X4J A;  5I2M A;  1WJS A;  2K5I A;  3M53 A;  3L42 A;  2V8J A;  3CC4 T;  2RHI A;  4RG8 A;  3PFS A;  4MDX A;  3A8L B;  4A4F A;  2RM4 A;  4M75 B;  5GMK m;  1VQ7 T;  2K5F A;  2GFA A;  4EMK B;  4M7D A;  1Y71 A;  3FDR A;  1SSF A;  3PIO A;  3S3O A;  3JRZ A;  2M1H A;  4IUT A;  5D6Y A;  4E7L A;  4M75 C;  2LNV A;  3M9Q A;  3JCM c;  1BI1 A;  5GAN 5;  1W4S A;  4M7A B;  3NFC A;  1VQ4 A;  3FEO A;  3MP8 A;  4PLI A;  2WSF E;  2OTJ T;  2M9U A;  4KT0 E;  1Q82 C;  4C0D B;  4C92 B;  5KH6 A;  5A0G A;  2OTJ A;  3NTI A;  2EJG A;  4OMF B;  3RIR A;  1VQK T;  3CCQ A;  4JS5 A;  3OBW A;  1QP3 A;  1VIE A;  1WJQ A;  4FT2 A;  3L2Z A;  2CYZ B;  3M58 A;  5LJ5 d;  2JNG A;  1M9S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...