3JCUE

Cryo-em structure of spinach psii-lhcii supercomplex at 3.2 angstrom resolution
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
79
structure length
79
Chain Sequence
STGERSFADIITSIRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYFTESRQGIPLITGRFDSLEQLDEFSRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem II protein D1
publication title Structure of spinach photosystem II-LHCII supercomplex at 3.2 A resolution
doi rcsb
molecule tags Membrane protein
total genus 20
structure length 79
sequence length 79
chains with identical sequence e
ec nomenclature
pdb deposition date 2016-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00283 Cytochrom_B559 Cytochrome b559, alpha (gene psbE) and beta (gene psbF)subunits
E PF00284 Cytochrom_B559a Lumenal portion of Cytochrome b559, alpha (gene psbE) subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.860 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Photosystem II cytochrome b559, alpha subunit 3jcuE00
5KAFE 4IL6E 5GTHE 4UB8E 5TISE 5B66E 1S5LE 5KAIE 5B5EE 5H2FE 4UB6E 5E79E 3A0BE 3A0HE 1W5CE 3KZIE 4PJ0E 5GTIE 2AXTE 3WU2E 3JCUE
chains in the Genus database with same CATH superfamily
1OW8A 3V5BA 5KJ7C 1EZVI 3HE4B 2FYUJ 1E5WA 5GTIH 2O01H 4DT0A 2KK7A 2KNCB 3B5ND 3D71A 2WPRA 1S5LH 2BCCD 3L73G 4LLHA 3LIDA 1JB0J 1GMJA 1L0LG 5KTBA 3WUUA 4H44D 2ZYDA 3CXHD 1URQB 4OWFA 4TLFA 4CPGA 1K8AQ 2D2CD 5CJ4A 4ZMDA 2ZVOB 4C7NB 3K5BA 1RH5B 1MUUA 2K9JB 1LGHB 1MKMA 1AQTA 1FBMA 2W6JH 1FZGA 1NTZK 3AEFC 2IZ1A 4JYCA 2PP6A 3GHGA 2W83C 4HKZH 3GMAA 4N3YB 1M56D 3KQGA 1HGZA 1M1JC 2E42A 3U1CA 3AEGC 1EZVG 2O1KA 2E75C 2WSCH 2E5YA 5KJ7D 1JTHA 1NH4A 3C1LA 3L73J 1W2BO 2QJPC 1YQ4C 2KB7P 1L0LJ 3PHLA 2WT7B 4HB1A 5KLIB 4NPEA 5CMZA 1GW4A 3EQ2A 1BE3J 3TF5A 3D70A 3CCJP 1VDFA 3FWLA 4GKGA 1N2DC 1X8YA 3II6A 1QVGO 4B86A 4H13C 1IO4A 1FZFA 1SQPE 2Q3EA 1S72P 1NTKE 3H1IE 3GHGC 1YI2P 4OGQB 2W6AA 2FFDA 1IFMA 1CW5A 4XE5B 3H1JG 4L75A 1SVFA 1KFNA 2WSFH 4DZOA 2CPSA 1LP1B 1FZCA 2AXCA 1PZQA 4PD4I 1A02J 1S3JA 3H1HG 2YXRB 1RE3A 3CCQP 1SQBJ 2XNDH 2PAJA 2AEMA 2B87A 3M0AA 1KYOH 4IFMA 3R2PA 3NMDA 1SQXJ 2P1JA 2QM7A 5L8RJ 1CI6B 1BCCD 2IDBA 2NPSB 2JWAA 1NYHA 1YQ3C 3ABVC 2YNYA 4K35A 2C9NY 3L74G 3KZIE 2H8PD 2M5AB 4IFFA 1ZR4A 2FFDC 4Z1MH 2YO2A 1H89A 3H1HJ 1U57A 1DD4A 2YO3A 3LW5H 2I1KA 2ZT9D 5GTHH 1MFTA 2P10A 1FZCC 2KSEA 1KORA 1K73Q 2JEEA 5AVYB 1NU1D 1IZNB 1WMKA 2IX7C 4JBZA 5DJUB 1H88A 5GTHE 1NVOA 2E5TA 2C0WA 4AUWA 2BCCE 1S1CX 1SQVD 1LTJA 3CXHE 3OAKA 3L74J 1OWAA 2R32A 3L72G 3V2RA 3CCEP 1IFDA 2OARA 3B4SA 2YMKA 5AVUB 1L0ND 1M1JB 2HLOA 3JC22 1N7SA 1VF5C 3MP7B 1MV8A 2E75B 1LJ2A 3C9IA 2FBWC 2V7QH 2Z5IA 2QJPB 1DEEG 2I8DA 1OW7A 1BDDA 1X9VA 2WQYC 1T3JA 1VQ4P 2HPCB 3ITKA 3CX5I 3N4XA 3CPWO 3HE5A 5CCGC 3RL0g 1SQPJ 3M0DC 3PTZA 3CXHI 1NTKJ 3OW2O 1LTJC 3SWYA 1AQ5A 1K05A 4H13B 4RO0A 3B71A 3CI9A 3VMYA 3Q2YA 1ZN5A 2R44A 2K9YA 4K3AA 1KQSO 1P84I 2Z4EA 2KXPB 3GHGB 3RL0C 1VQ6P 2JR8A 1HH0A 1N7SC 3CWBD 3H32A 4GDOA 3O6QA 1SFCC 1GL2C 1JTHB 3M9BA 1K04A 4OVNF 1KB9H 5AW6B 3A0HE 1Q86Q 1EXJA 1ZP0C 4WY4A 1AVYA 1VQ5P 4KT0J 3JCUH 2NRGA 1BCCE 1NTMG 5K5GB 2K3RA 3RK2D 4IOIH 1OMIA 4EI2A 2FFDB 3RGUA 4D6TD 3CC2P 1Y47A 3PH0A 3BRVB 1FZCB 2ZVNB 3USSA 4YXWH 1DEBA 2KLUA 3M06A 2E74C 4U3FD 3ZDMA 2KYVA 1NU1E 3AE5C 3L75D 4ZKPA 2B87B 1H0TA 5AVZB 4WY4C 4RJTA 1S9KD 1Q7YQ 1LWUA 5AVQB 1SQQD 1SQVE 4IFDK 2A06D 5KLVG 2ITAA 5AW9B 3AEAC 1Q82Q 2YIUC 1ZR2A 3L37A 2C9LY 1JNMA 1FOSF 1PGOA 1JY2P 2P7JA 1OVVA 1L0NE 1VF5B 1E79H 3B5NA 2ZXEB 3F89A 5CHXA 2FXPA 2I1JA 2A45I 3V4WA 2WMMA 1KN7A 3BCCD 1KMIZ 1QLED 4ZNCA 2P67A 3H1ID 1LTJB 3P8MC 1X22A 1LWUC 1NTZD 2PGDA 3CD6P 1YJWP 3P8CD 5AW5B 1M7LA 4IL6H 3D6ZA 4UB6E 3L70G 2GUVA 3RL0B 1GD2E 1IK7A 1ZLLA 1J1EC 2BEQD 3L71G 1N7SB 3B5NC 2PRRA 1N73A 2FYUG 1SFCB 1OIPA 1GL2B 3IR9A 3CWBE 1AFOA 2A45G 5H2FE 4HYTB 4M3LA 1N8RQ 4H44C 2H89C 3M91A 1NU1G 2B9BA 2D2CC 1SS1A 1SLQA 3RBXA 1UIIA 3SSUA 3WMM0 1KYOD 1FOSE 2H43A 1G1JA 3VYIA 1USEA 3L70J 1QL1A 1KILD 3NXSA 2R5DA 3A3YB 5B66H 2Y9ZA 3HD7A 3L71J 4Y99C 1KQLA 2GUSA 1NJIQ 1PPJD 1IFNA 4I2LC 1X79B 4JYBA 1N73C 1NU1J 3H32B 4GOEA 4D6TE 3Q3DA 1JEKA 5GTIE 5B5EH 1KTMA 1BGYD 1T3UA 4EIJA 2E74B 1SQVJ 3WU2H 3B8EB 1S5LE 4U3FE 2IBZI 1BE3G 4KJMA 4L76A 4WY4B 3L75E 1NAYA 1NOHA 4BRYB 1EXIA 1S9KE 3TNUA 4DCKA 1NO4A 1L0NJ 2YIUB 1SQQE 3TYYA 2A06E 5APVA 3CCVP 3L36A 1USDA 4PV1D 4C7RA 3FGAD 1OZHA 1G2CA 1QGKB 5KAIH 2J58A 2XDJA 2MKVA 4I6MC 4PD4H 1U7JA 1PP9D 3H1KD 5TISH 4EYYQ 1SQBG 2FKWB 2IBZG 1T2KD 1FE6A 1H0TB 3AEEC 3BCCE 1KZUB 1LT9B 1LWUB 1SQXG 4IL6X 2M0BA 1WRGA 1NTZE 4UB8H 3FWNA 1ZOYC 3P8CE 2ZT9C 1FS0E 3HD7D 4H0LD 1IFJA 1Q90D 1HF9A 1J1EB 2E76D 4OH8B 3RK3D 3H1LD 3B5NB 1GDTA 5AW3B 3I56P 2HODB 1RQUA 2RKLA 1KB9D 4H44B 3KYQA 4L73A 2D2CB 3BASA 3EFGA 1NHLA 4ZKUA 2AXTH 1HVVA 1J1DC 1KYOE 1SQQG 2FYNC 2VRSA 1PFIA 3HTKA 3OA7A 1L2PA 2XNXA 2SPZA 2NZ2A 1WT6A 1KILE 1YTZT 2E43A 4Y99B 1LTIC 2PFXA 1NTMK 4HJGH 1MFZA 1PPJE 1EC5A 3U59A 1R8EA 1N73B 4U3FJ 5BU8B 1JY2N 4LC1A 1RE3C 2WVRA 1G1IA 3L75J 1FJPA 1KC8Q 1FDMA 3TSIA 2JP3A 2YKQA 1EDIA 2IYPA 1BGYE 1CSBA 4NPDA 1SQQJ 3CX5H 1JOCA 1JM0A 1SQPG 3AEBC 2FY8A 2OYIA 3UIAA 4QMAA 2IFMA 1NTKG 3H1IG 3TDKA 1NAFA 4RESB 1OVRA 4WBAA 3VMAA 4I7ZC 1DX7A 2N9BA 1HJ0A 3D6YA 3SWFA 5KLVK 1P84H 1L4AD 4ASWA 2Q1KA 1JUNA 3M9QA 3V2QA 3NFQA 3TK1A 1XTCC 3EWKA 2XV5A 3BATA 3IAOA 1W5CE 2QE7H 3I5CA 4NPFX 3H1IJ 1PP9E 1NTZJ 3H1KE 2QJKC 1L0LD 2OYIC 1AA0A 2N1TA 3RK2C 1FJKA 3P32A 3TNUB 2FXOA 3O8ZA 1Y8AA 3Q1MA 2QIWA 2IYOA 5TJHA 1AVOA 2WSEJ 2ZT9B 2C0XA 2KUBA 1KFMA 1JO5A 1JY3P 1G2CB 1EZVD 3HE4A 1DIPA 1PIXA 3RK3E 2Q3IA 3H1LE 2W90A 2Z5HA 4TT3H 4C46A 2BCCG 1NKNA 2W27A 2FYUK 5KKZC 2KNCA 1KB9E 2ZAEB 3P7KA 1VQ9P 4I1LA 5M1BA 5DJTB 4MN4C 1J1DB 2N1TC 2FYNB 3E1RA 3AE1C 3G4SP 2L91A 3CLQA 3JCUE 1LTAC 1EDLA 1VQMP 3MD0A 1LTGC 1FZEA 1QX8A 2K88A 1HTLC 3V2PA 2J59M 1BSNA 1HGVA 4WVZA 2RH0A 2WTYA 2BCCJ 3H1JD 1BGYJ 3WUTA 3Q5RA 2G3AA 1YBKA 2Y0DA 1YYCA 1FU1A 3C8VA 3VMXA 1IFPA 3H1HD 2A45H 2P58A 2WT7A 1KILA 1LTSC 2V4HA 3WUVA 3CC4P 1L0LK 1LNQA 3VP8A 2H88C 5E79H 1VQKP 1VPCA 1IJDB 1HBWA 2N1TD 1FDIA 4I7ZB 2JDIH 2KSJA 5AW2B 1U7MA 2RMZA 4YTPC 1EDKA 4L74A 3GW6A 2Q6QA 3L74D 1A02F 2JKVA 2WITA 1FAVA 1YHQP 2KP8A 1RF1A 1GTWA 2K1AA 2G8YA 4JQ0D 4WB4A 2FYZA 2J5UA 3CCUP 1PP9J 2QEXP 3HUSA 2WPVB 4PD4D 5AVVB 2P2UA 4RKUJ 1KILC 3A0BH 4WWIA 1BCCG 2QJKB 3AE2C 4PJ0H 1BSHA 5AW8B 2OYIB 1SQBK 1Y9BA 1L0LE 2UWJE 2N9YB 3RK2B 2IZ0A 1URQD 3T97A 2NPSA 1SQXK 3F5HA 4EOTA 3L72D 1PGQA 4A7PA 4BWNA 2M3EA 1FC2C 3H1LJ 3VOPA 4IL6E 4GODA 5CBNA 1RF1C 2JWDA 4AQRD 3MUDA 2Y0EA 1EZVE 3HUSC 3A2AA 4GT1A 5KKZB 1VQLP 3HE5B 2HFED 1BCCJ 3I55P 3G3ZA 1OXZA 1SQVG 5APYA 2JO1A 5BU5A 2BEZF 3CMEP 1M1KQ 5AVWB 5EFWB 2B89A 4PV1C 3SFEC 1VQOP 1L0NG 1M8OB 1GU4A 1PGPA 5B66E 2POHA 4JPZB 1LTBC 2HYNA 3O6QB 2Q7CA 2OYHA 2ZYAA 4OGQD 2Q9IA 1Z56A 3MUDC 3H1JE 1T2KC 5CJ0A 3BVHA 2QA4P 1GW3A 3W67A 2LKMA 1AJYA 1J2JB 5B5EE 2B88A 4W80A 2W8ZA 2LR2A 2HPCA 4Y28J 1Q81Q 5AVXB 2O01N 3H1HE 1KQGB 3CX5D 2ZJSE 1PL5A 2YXQB 3WU2E 3VMZA 5CCHD 1BDCA 5APUA 1EQ7A 1M90Q 2XKMA 2IFNA 1SQPK 3HD7C 1DD3A 1N7LA 4H0LC 4N78D 1NTKK 2E76C 3RK3C 2NPSD 1NTMD 1P84D 2QM8A 3CWBG 3MIWA 3Q5PA 2OYHC 1RHZB 1YJ9P 4N6JA 3L74E 2QVAA 2XZRA 2YKOA 5KAIE 3SFDC 1OX3A 2OTJP 3V4QA 2QJYC 1JY3N 3HRNA 3CL3D 1ZRTD 4PD4E 1D7MA 1HUCA 2WZ7A 1KILB 5TISE 2WSSH 4XFJA 3GF3A 2BASA 1ZV8A 1L4AA 2RN0A 3CWBJ 5KLVD 1JY3O 1QL2A 1HWTC 4D6TG 4UB8E 1X0TA 3L72E 1YITP 1JCDA 3KHUA 2LXBA 2ZYGA 1GZLA 5BVZA 1RF1B 3VTPC 3IF4A 1YIJP 2HG5D 4AYCA 3MGNA 1TU3F 2WSEH 4U3FG 2E75D 2ZFCA 3HUSB 3MHVA 3L75G 1S4XA 2FXMA 4HH2A 1T8ZA 5AW7B 4W7YA 1HJBA 1UIXA 2A06G 4W7ZA 4KHXA 2AXTE 1NWQA 3L4FA 3AE3C 4D6TJ 3KZIH 1L4AC 3T97B 4PV1B 3CCLP 3G6EP 1K9MQ 4XA4A 2O01J 4H13D 2M3BA 3PRJA 3H1JJ 3L70D 2KS1A 1AV1A 3TGUD 3S4RA 3BRTB 3L71D 3EFFK 5APQA 2CK3H 3AECC 3AEDC 2FYUD 3V2NA 3N7NA 3CC7P 3BCCG 1S5LX 1KYOI 2R5BA 5APWA 4ASVA 3GG2A 2WWWA 3CXHH 4JF7A 3CCSP 3VP9A 1RE4A 5CCGA 4LGDE 1W2EA 1NTZG 2KOGA 3M0DA 3CX5E 2KZIA 3RBZA 1JY2O 1PGJA 5APXA 3HD7B 4H0LB 1LTTC 2WSCJ 2E76B 3RK3B 5AVRB 4N78E 1VQ7P 2JJLA 2R3SA 1NTME 1P84E 2OYHB 1CZQA 4EDFA 3A7OA 3BCCJ 1QVFO 5AW4B 3W68A 3OJAB 2ZXXA 1SFCA 1GL2A 2OGUA 2QJYB 2AEFA 2WPSA 3L73D 1EDJA 3MZWB 1VQPP 1ZRTE 1RE4C 1DH3A 1BE3D 2AEJA 1KQFB 3L72J 1LT1A 1RQVA 1VL2A 2WSFJ 1PPJG 1GK6A 4O9BA 1ZXGA 5KLVE 1IC2A 4GOFA 1T6AA 1KV4A 1R5SA 2XU6A 3R4YA 1BGYG 1VF5D 3A0HH 3S1KA 3H6PA 1FZAA 3AE4C 3M9HA 3AE9C 1NU1K 1JMBA 2O3JA 1FDOA 1URQA 2KZJA 2W6BA 1SQBD 1KD1Q 2IBZD 4YXDC 4C7NA 1SQVK 2K9JA 5CCGD 4BRYA 1MZ9A 1SQXD 2OTLP 2Y9YA 1L4AB 1RY3A 2H7HA 3LW5J 4GIFA 5APTA 1Q2NA 3IFMA 3V6IA 1L0NK 3PP5A 1GU5A 2WPQA 3AE6C 5C39A 2OQQA 3FXDA 3L70E 5AVSB 3RL0D 2KI7B 3TGUE 2YMYA 2IPPA 1KB9I 1NGMB 4YPCA 3G9RA 1N7SD 3KXDA 3L71E 1PP9G 1S2EA 4R4MA 3H1KG 1SFCD 1GL2D 2FYUE 1OVUA 2QSIA 1URQC 3MTUE 1SP4A 3GLMA 3QWOC 3AE8C 3PJSK 3GF7A 3HTKB 2QRXA 3PLNA 3S9OA 2Q5UA 1LT9A 2GA1A 5AVTB 5E79E 2K37A 1NTMJ 2GM4A 2V7QJ 1FZBA 3H25A 1NKZB 4U7JA 1IK9A 3L35A 1YJNP 3H1LG 2KS1B 1YTZI 1LP1A 3H1KJ 3FX0A 1ZMEC 3U1AA 3SWKA 3CCMP 3A5TA 1RF0A 2HODA 5APSA 3NTNA 2O1JA 5AW0B 5KLIC 2Y0CA 5CCHA 4BXLA 1IFIA 1VQ8P 3L73E 3FXEA 2E74D 2DW3A 3A0BE 1CI6A 3IN6A 1SQPD 4PJ0E 1ZW0A 2KIKA 5KLVJ 1PV3A 3VN0A 1NTKD 1BE3E 4UB6H 4WY4D 2L5GB 1LT9C 5CBOA 2M5AA 4OGQC 3E1IA 1N86A 5KAFH 2OYOA 3TGUG 5KJ7A 1H8AA 2LXCB 2CPBA 3Q5SA 3JSVC 5H2FH 3G71P 1M57D 5AW1B 5KAFE 2R3CA 4R4LA 1R5LA 4DJGA 1RF0C 1OFCX 1OW6A 3KPEA 1GK4A 2HR3A 1XTGB 5CCHC 3CCRP 2YKPA 3KDPB 3E7KA 3CMAP 4DOJA 2N1TB 1QEXA 1VQNP 1SQBE 2KLVA 2NPSC 2IBZE 2MJZA 2OTKE 1SQQK 2QG4A 3LIEA 3TGUJ 1JMMA 1SQXE 2M8RA 1JCCA 1M1JA 3QH9A 3AE7C
chains in the Genus database with same CATH topology
5KAFE 4IL6E 5GTHE 4UB8E 5TISE 5B66E 1S5LE 5KAIE 5B5EE 5H2FE 4UB6E 5E79E 3A0BE 3A0HE 1W5CE 3KZIE 4PJ0E 5GTIE 2AXTE 3WU2E 3JCUE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KAF E;  4IL6 E;  5GTH E;  4UB8 E;  5TIS E;  5B66 E;  1S5L E;  5KAI E;  5B5E E;  5H2F E;  4UB6 E;  5E79 E;  3A0B E;  3A0H E;  1W5C E;  3KZI E;  4PJ0 E;  5GTI E;  2AXT E;  3WU2 E;  3JCU E; 
#chains in the Genus database with same CATH topology
 1OW8 A;  3V5B A;  5KJ7 C;  1EZV I;  3HE4 B;  2FYU J;  1E5W A;  5GTI H;  2O01 H;  4DT0 A;  2KK7 A;  2KNC B;  3B5N D;  3D71 A;  2WPR A;  1S5L H;  2BCC D;  3L73 G;  4LLH A;  3LID A;  1JB0 J;  1GMJ A;  1L0L G;  5KTB A;  3WUU A;  4H44 D;  2ZYD A;  3CXH D;  1URQ B;  4OWF A;  4TLF A;  4CPG A;  1K8A Q;  2D2C D;  5CJ4 A;  4ZMD A;  2ZVO B;  4C7N B;  3K5B A;  1RH5 B;  1MUU A;  2K9J B;  1LGH B;  1MKM A;  1AQT A;  1FBM A;  2W6J H;  1FZG A;  1NTZ K;  3AEF C;  2IZ1 A;  4JYC A;  2PP6 A;  3GHG A;  2W83 C;  4HKZ H;  3GMA A;  4N3Y B;  1M56 D;  3KQG A;  1HGZ A;  1M1J C;  2E42 A;  3U1C A;  3AEG C;  1EZV G;  2O1K A;  2E75 C;  2WSC H;  2E5Y A;  5KJ7 D;  1JTH A;  1NH4 A;  3C1L A;  3L73 J;  1W2B O;  2QJP C;  1YQ4 C;  2KB7 P;  1L0L J;  3PHL A;  2WT7 B;  4HB1 A;  5KLI B;  4NPE A;  5CMZ A;  1GW4 A;  3EQ2 A;  1BE3 J;  3TF5 A;  3D70 A;  3CCJ P;  1VDF A;  3FWL A;  4GKG A;  1N2D C;  1X8Y A;  3II6 A;  1QVG O;  4B86 A;  4H13 C;  1IO4 A;  1FZF A;  1SQP E;  2Q3E A;  1S72 P;  1NTK E;  3H1I E;  3GHG C;  1YI2 P;  4OGQ B;  2W6A A;  2FFD A;  1IFM A;  1CW5 A;  4XE5 B;  3H1J G;  4L75 A;  1SVF A;  1KFN A;  2WSF H;  4DZO A;  2CPS A;  1LP1 B;  1FZC A;  2AXC A;  1PZQ A;  4PD4 I;  1A02 J;  1S3J A;  3H1H G;  2YXR B;  1RE3 A;  3CCQ P;  1SQB J;  2XND H;  2PAJ A;  2AEM A;  2B87 A;  3M0A A;  1KYO H;  4IFM A;  3R2P A;  3NMD A;  1SQX J;  2P1J A;  2QM7 A;  5L8R J;  1CI6 B;  1BCC D;  2IDB A;  2NPS B;  2JWA A;  1NYH A;  1YQ3 C;  3ABV C;  2YNY A;  4K35 A;  2C9N Y;  3L74 G;  3KZI E;  2H8P D;  2M5A B;  4IFF A;  1ZR4 A;  2FFD C;  4Z1M H;  2YO2 A;  1H89 A;  3H1H J;  1U57 A;  1DD4 A;  2YO3 A;  3LW5 H;  2I1K A;  2ZT9 D;  5GTH H;  1MFT A;  2P10 A;  1FZC C;  2KSE A;  1KOR A;  1K73 Q;  2JEE A;  5AVY B;  1NU1 D;  1IZN B;  1WMK A;  2IX7 C;  4JBZ A;  5DJU B;  1H88 A;  5GTH E;  1NVO A;  2E5T A;  2C0W A;  4AUW A;  2BCC E;  1S1C X;  1SQV D;  1LTJ A;  3CXH E;  3OAK A;  3L74 J;  1OWA A;  2R32 A;  3L72 G;  3V2R A;  3CCE P;  1IFD A;  2OAR A;  3B4S A;  2YMK A;  5AVU B;  1L0N D;  1M1J B;  2HLO A;  3JC2 2;  1N7S A;  1VF5 C;  3MP7 B;  1MV8 A;  2E75 B;  1LJ2 A;  3C9I A;  2FBW C;  2V7Q H;  2Z5I A;  2QJP B;  1DEE G;  2I8D A;  1OW7 A;  1BDD A;  1X9V A;  2WQY C;  1T3J A;  1VQ4 P;  2HPC B;  3ITK A;  3CX5 I;  3N4X A;  3CPW O;  3HE5 A;  5CCG C;  3RL0 g;  1SQP J;  3M0D C;  3PTZ A;  3CXH I;  1NTK J;  3OW2 O;  1LTJ C;  3SWY A;  1AQ5 A;  1K05 A;  4H13 B;  4RO0 A;  3B71 A;  3CI9 A;  3VMY A;  3Q2Y A;  1ZN5 A;  2R44 A;  2K9Y A;  4K3A A;  1KQS O;  1P84 I;  2Z4E A;  2KXP B;  3GHG B;  3RL0 C;  1VQ6 P;  2JR8 A;  1HH0 A;  1N7S C;  3CWB D;  3H32 A;  4GDO A;  3O6Q A;  1SFC C;  1GL2 C;  1JTH B;  3M9B A;  1K04 A;  4OVN F;  1KB9 H;  5AW6 B;  3A0H E;  1Q86 Q;  1EXJ A;  1ZP0 C;  4WY4 A;  1AVY A;  1VQ5 P;  4KT0 J;  3JCU H;  2NRG A;  1BCC E;  1NTM G;  5K5G B;  2K3R A;  3RK2 D;  4IOI H;  1OMI A;  4EI2 A;  2FFD B;  3RGU A;  4D6T D;  3CC2 P;  1Y47 A;  3PH0 A;  3BRV B;  1FZC B;  2ZVN B;  3USS A;  4YXW H;  1DEB A;  2KLU A;  3M06 A;  2E74 C;  4U3F D;  3ZDM A;  2KYV A;  1NU1 E;  3AE5 C;  3L75 D;  4ZKP A;  2B87 B;  1H0T A;  5AVZ B;  4WY4 C;  4RJT A;  1S9K D;  1Q7Y Q;  1LWU A;  5AVQ B;  1SQQ D;  1SQV E;  4IFD K;  2A06 D;  5KLV G;  2ITA A;  5AW9 B;  3AEA C;  1Q82 Q;  2YIU C;  1ZR2 A;  3L37 A;  2C9L Y;  1JNM A;  1FOS F;  1PGO A;  1JY2 P;  2P7J A;  1OVV A;  1L0N E;  1VF5 B;  1E79 H;  3B5N A;  2ZXE B;  3F89 A;  5CHX A;  2FXP A;  2I1J A;  2A45 I;  3V4W A;  2WMM A;  1KN7 A;  3BCC D;  1KMI Z;  1QLE D;  4ZNC A;  2P67 A;  3H1I D;  1LTJ B;  3P8M C;  1X22 A;  1LWU C;  1NTZ D;  2PGD A;  3CD6 P;  1YJW P;  3P8C D;  5AW5 B;  1M7L A;  4IL6 H;  3D6Z A;  4UB6 E;  3L70 G;  2GUV A;  3RL0 B;  1GD2 E;  1IK7 A;  1ZLL A;  1J1E C;  2BEQ D;  3L71 G;  1N7S B;  3B5N C;  2PRR A;  1N73 A;  2FYU G;  1SFC B;  1OIP A;  1GL2 B;  3IR9 A;  3CWB E;  1AFO A;  2A45 G;  5H2F E;  4HYT B;  4M3L A;  1N8R Q;  4H44 C;  2H89 C;  3M91 A;  1NU1 G;  2B9B A;  2D2C C;  1SS1 A;  1SLQ A;  3RBX A;  1UII A;  3SSU A;  3WMM 0;  1KYO D;  1FOS E;  2H43 A;  1G1J A;  3VYI A;  1USE A;  3L70 J;  1QL1 A;  1KIL D;  3NXS A;  2R5D A;  3A3Y B;  5B66 H;  2Y9Z A;  3HD7 A;  3L71 J;  4Y99 C;  1KQL A;  2GUS A;  1NJI Q;  1PPJ D;  1IFN A;  4I2L C;  1X79 B;  4JYB A;  1N73 C;  1NU1 J;  3H32 B;  4GOE A;  4D6T E;  3Q3D A;  1JEK A;  5GTI E;  5B5E H;  1KTM A;  1BGY D;  1T3U A;  4EIJ A;  2E74 B;  1SQV J;  3WU2 H;  3B8E B;  1S5L E;  4U3F E;  2IBZ I;  1BE3 G;  4KJM A;  4L76 A;  4WY4 B;  3L75 E;  1NAY A;  1NOH A;  4BRY B;  1EXI A;  1S9K E;  3TNU A;  4DCK A;  1NO4 A;  1L0N J;  2YIU B;  1SQQ E;  3TYY A;  2A06 E;  5APV A;  3CCV P;  3L36 A;  1USD A;  4PV1 D;  4C7R A;  3FGA D;  1OZH A;  1G2C A;  1QGK B;  5KAI H;  2J58 A;  2XDJ A;  2MKV A;  4I6M C;  4PD4 H;  1U7J A;  1PP9 D;  3H1K D;  5TIS H;  4EYY Q;  1SQB G;  2FKW B;  2IBZ G;  1T2K D;  1FE6 A;  1H0T B;  3AEE C;  3BCC E;  1KZU B;  1LT9 B;  1LWU B;  1SQX G;  4IL6 X;  2M0B A;  1WRG A;  1NTZ E;  4UB8 H;  3FWN A;  1ZOY C;  3P8C E;  2ZT9 C;  1FS0 E;  3HD7 D;  4H0L D;  1IFJ A;  1Q90 D;  1HF9 A;  1J1E B;  2E76 D;  4OH8 B;  3RK3 D;  3H1L D;  3B5N B;  1GDT A;  5AW3 B;  3I56 P;  2HOD B;  1RQU A;  2RKL A;  1KB9 D;  4H44 B;  3KYQ A;  4L73 A;  2D2C B;  3BAS A;  3EFG A;  1NHL A;  4ZKU A;  2AXT H;  1HVV A;  1J1D C;  1KYO E;  1SQQ G;  2FYN C;  2VRS A;  1PFI A;  3HTK A;  3OA7 A;  1L2P A;  2XNX A;  2SPZ A;  2NZ2 A;  1WT6 A;  1KIL E;  1YTZ T;  2E43 A;  4Y99 B;  1LTI C;  2PFX A;  1NTM K;  4HJG H;  1MFZ A;  1PPJ E;  1EC5 A;  3U59 A;  1R8E A;  1N73 B;  4U3F J;  5BU8 B;  1JY2 N;  4LC1 A;  1RE3 C;  2WVR A;  1G1I A;  3L75 J;  1FJP A;  1KC8 Q;  1FDM A;  3TSI A;  2JP3 A;  2YKQ A;  1EDI A;  2IYP A;  1BGY E;  1CSB A;  4NPD A;  1SQQ J;  3CX5 H;  1JOC A;  1JM0 A;  1SQP G;  3AEB C;  2FY8 A;  2OYI A;  3UIA A;  4QMA A;  2IFM A;  1NTK G;  3H1I G;  3TDK A;  1NAF A;  4RES B;  1OVR A;  4WBA A;  3VMA A;  4I7Z C;  1DX7 A;  2N9B A;  1HJ0 A;  3D6Y A;  3SWF A;  5KLV K;  1P84 H;  1L4A D;  4ASW A;  2Q1K A;  1JUN A;  3M9Q A;  3V2Q A;  3NFQ A;  3TK1 A;  1XTC C;  3EWK A;  2XV5 A;  3BAT A;  3IAO A;  1W5C E;  2QE7 H;  3I5C A;  4NPF X;  3H1I J;  1PP9 E;  1NTZ J;  3H1K E;  2QJK C;  1L0L D;  2OYI C;  1AA0 A;  2N1T A;  3RK2 C;  1FJK A;  3P32 A;  3TNU B;  2FXO A;  3O8Z A;  1Y8A A;  3Q1M A;  2QIW A;  2IYO A;  5TJH A;  1AVO A;  2WSE J;  2ZT9 B;  2C0X A;  2KUB A;  1KFM A;  1JO5 A;  1JY3 P;  1G2C B;  1EZV D;  3HE4 A;  1DIP A;  1PIX A;  3RK3 E;  2Q3I A;  3H1L E;  2W90 A;  2Z5H A;  4TT3 H;  4C46 A;  2BCC G;  1NKN A;  2W27 A;  2FYU K;  5KKZ C;  2KNC A;  1KB9 E;  2ZAE B;  3P7K A;  1VQ9 P;  4I1L A;  5M1B A;  5DJT B;  4MN4 C;  1J1D B;  2N1T C;  2FYN B;  3E1R A;  3AE1 C;  3G4S P;  2L91 A;  3CLQ A;  3JCU E;  1LTA C;  1EDL A;  1VQM P;  3MD0 A;  1LTG C;  1FZE A;  1QX8 A;  2K88 A;  1HTL C;  3V2P A;  2J59 M;  1BSN A;  1HGV A;  4WVZ A;  2RH0 A;  2WTY A;  2BCC J;  3H1J D;  1BGY J;  3WUT A;  3Q5R A;  2G3A A;  1YBK A;  2Y0D A;  1YYC A;  1FU1 A;  3C8V A;  3VMX A;  1IFP A;  3H1H D;  2A45 H;  2P58 A;  2WT7 A;  1KIL A;  1LTS C;  2V4H A;  3WUV A;  3CC4 P;  1L0L K;  1LNQ A;  3VP8 A;  2H88 C;  5E79 H;  1VQK P;  1VPC A;  1IJD B;  1HBW A;  2N1T D;  1FDI A;  4I7Z B;  2JDI H;  2KSJ A;  5AW2 B;  1U7M A;  2RMZ A;  4YTP C;  1EDK A;  4L74 A;  3GW6 A;  2Q6Q A;  3L74 D;  1A02 F;  2JKV A;  2WIT A;  1FAV A;  1YHQ P;  2KP8 A;  1RF1 A;  1GTW A;  2K1A A;  2G8Y A;  4JQ0 D;  4WB4 A;  2FYZ A;  2J5U A;  3CCU P;  1PP9 J;  2QEX P;  3HUS A;  2WPV B;  4PD4 D;  5AVV B;  2P2U A;  4RKU J;  1KIL C;  3A0B H;  4WWI A;  1BCC G;  2QJK B;  3AE2 C;  4PJ0 H;  1BSH A;  5AW8 B;  2OYI B;  1SQB K;  1Y9B A;  1L0L E;  2UWJ E;  2N9Y B;  3RK2 B;  2IZ0 A;  1URQ D;  3T97 A;  2NPS A;  1SQX K;  3F5H A;  4EOT A;  3L72 D;  1PGQ A;  4A7P A;  4BWN A;  2M3E A;  1FC2 C;  3H1L J;  3VOP A;  4IL6 E;  4GOD A;  5CBN A;  1RF1 C;  2JWD A;  4AQR D;  3MUD A;  2Y0E A;  1EZV E;  3HUS C;  3A2A A;  4GT1 A;  5KKZ B;  1VQL P;  3HE5 B;  2HFE D;  1BCC J;  3I55 P;  3G3Z A;  1OXZ A;  1SQV G;  5APY A;  2JO1 A;  5BU5 A;  2BEZ F;  3CME P;  1M1K Q;  5AVW B;  5EFW B;  2B89 A;  4PV1 C;  3SFE C;  1VQO P;  1L0N G;  1M8O B;  1GU4 A;  1PGP A;  5B66 E;  2POH A;  4JPZ B;  1LTB C;  2HYN A;  3O6Q B;  2Q7C A;  2OYH A;  2ZYA A;  4OGQ D;  2Q9I A;  1Z56 A;  3MUD C;  3H1J E;  1T2K C;  5CJ0 A;  3BVH A;  2QA4 P;  1GW3 A;  3W67 A;  2LKM A;  1AJY A;  1J2J B;  5B5E E;  2B88 A;  4W80 A;  2W8Z A;  2LR2 A;  2HPC A;  4Y28 J;  1Q81 Q;  5AVX B;  2O01 N;  3H1H E;  1KQG B;  3CX5 D;  2ZJS E;  1PL5 A;  2YXQ B;  3WU2 E;  3VMZ A;  5CCH D;  1BDC A;  5APU A;  1EQ7 A;  1M90 Q;  2XKM A;  2IFN A;  1SQP K;  3HD7 C;  1DD3 A;  1N7L A;  4H0L C;  4N78 D;  1NTK K;  2E76 C;  3RK3 C;  2NPS D;  1NTM D;  1P84 D;  2QM8 A;  3CWB G;  3MIW A;  3Q5P A;  2OYH C;  1RHZ B;  1YJ9 P;  4N6J A;  3L74 E;  2QVA A;  2XZR A;  2YKO A;  5KAI E;  3SFD C;  1OX3 A;  2OTJ P;  3V4Q A;  2QJY C;  1JY3 N;  3HRN A;  3CL3 D;  1ZRT D;  4PD4 E;  1D7M A;  1HUC A;  2WZ7 A;  1KIL B;  5TIS E;  2WSS H;  4XFJ A;  3GF3 A;  2BAS A;  1ZV8 A;  1L4A A;  2RN0 A;  3CWB J;  5KLV D;  1JY3 O;  1QL2 A;  1HWT C;  4D6T G;  4UB8 E;  1X0T A;  3L72 E;  1YIT P;  1JCD A;  3KHU A;  2LXB A;  2ZYG A;  1GZL A;  5BVZ A;  1RF1 B;  3VTP C;  3IF4 A;  1YIJ P;  2HG5 D;  4AYC A;  3MGN A;  1TU3 F;  2WSE H;  4U3F G;  2E75 D;  2ZFC A;  3HUS B;  3MHV A;  3L75 G;  1S4X A;  2FXM A;  4HH2 A;  1T8Z A;  5AW7 B;  4W7Y A;  1HJB A;  1UIX A;  2A06 G;  4W7Z A;  4KHX A;  2AXT E;  1NWQ A;  3L4F A;  3AE3 C;  4D6T J;  3KZI H;  1L4A C;  3T97 B;  4PV1 B;  3CCL P;  3G6E P;  1K9M Q;  4XA4 A;  2O01 J;  4H13 D;  2M3B A;  3PRJ A;  3H1J J;  3L70 D;  2KS1 A;  1AV1 A;  3TGU D;  3S4R A;  3BRT B;  3L71 D;  3EFF K;  5APQ A;  2CK3 H;  3AEC C;  3AED C;  2FYU D;  3V2N A;  3N7N A;  3CC7 P;  3BCC G;  1S5L X;  1KYO I;  2R5B A;  5APW A;  4ASV A;  3GG2 A;  2WWW A;  3CXH H;  4JF7 A;  3CCS P;  3VP9 A;  1RE4 A;  5CCG A;  4LGD E;  1W2E A;  1NTZ G;  2KOG A;  3M0D A;  3CX5 E;  2KZI A;  3RBZ A;  1JY2 O;  1PGJ A;  5APX A;  3HD7 B;  4H0L B;  1LTT C;  2WSC J;  2E76 B;  3RK3 B;  5AVR B;  4N78 E;  1VQ7 P;  2JJL A;  2R3S A;  1NTM E;  1P84 E;  2OYH B;  1CZQ A;  4EDF A;  3A7O A;  3BCC J;  1QVF O;  5AW4 B;  3W68 A;  3OJA B;  2ZXX A;  1SFC A;  1GL2 A;  2OGU A;  2QJY B;  2AEF A;  2WPS A;  3L73 D;  1EDJ A;  3MZW B;  1VQP P;  1ZRT E;  1RE4 C;  1DH3 A;  1BE3 D;  2AEJ A;  1KQF B;  3L72 J;  1LT1 A;  1RQV A;  1VL2 A;  2WSF J;  1PPJ G;  1GK6 A;  4O9B A;  1ZXG A;  5KLV E;  1IC2 A;  4GOF A;  1T6A A;  1KV4 A;  1R5S A;  2XU6 A;  3R4Y A;  1BGY G;  1VF5 D;  3A0H H;  3S1K A;  3H6P A;  1FZA A;  3AE4 C;  3M9H A;  3AE9 C;  1NU1 K;  1JMB A;  2O3J A;  1FDO A;  1URQ A;  2KZJ A;  2W6B A;  1SQB D;  1KD1 Q;  2IBZ D;  4YXD C;  4C7N A;  1SQV K;  2K9J A;  5CCG D;  4BRY A;  1MZ9 A;  1SQX D;  2OTL P;  2Y9Y A;  1L4A B;  1RY3 A;  2H7H A;  3LW5 J;  4GIF A;  5APT A;  1Q2N A;  3IFM A;  3V6I A;  1L0N K;  3PP5 A;  1GU5 A;  2WPQ A;  3AE6 C;  5C39 A;  2OQQ A;  3FXD A;  3L70 E;  5AVS B;  3RL0 D;  2KI7 B;  3TGU E;  2YMY A;  2IPP A;  1KB9 I;  1NGM B;  4YPC A;  3G9R A;  1N7S D;  3KXD A;  3L71 E;  1PP9 G;  1S2E A;  4R4M A;  3H1K G;  1SFC D;  1GL2 D;  2FYU E;  1OVU A;  2QSI A;  1URQ C;  3MTU E;  1SP4 A;  3GLM A;  3QWO C;  3AE8 C;  3PJS K;  3GF7 A;  3HTK B;  2QRX A;  3PLN A;  3S9O A;  2Q5U A;  1LT9 A;  2GA1 A;  5AVT B;  5E79 E;  2K37 A;  1NTM J;  2GM4 A;  2V7Q J;  1FZB A;  3H25 A;  1NKZ B;  4U7J A;  1IK9 A;  3L35 A;  1YJN P;  3H1L G;  2KS1 B;  1YTZ I;  1LP1 A;  3H1K J;  3FX0 A;  1ZME C;  3U1A A;  3SWK A;  3CCM P;  3A5T A;  1RF0 A;  2HOD A;  5APS A;  3NTN A;  2O1J A;  5AW0 B;  5KLI C;  2Y0C A;  5CCH A;  4BXL A;  1IFI A;  1VQ8 P;  3L73 E;  3FXE A;  2E74 D;  2DW3 A;  3A0B E;  1CI6 A;  3IN6 A;  1SQP D;  4PJ0 E;  1ZW0 A;  2KIK A;  5KLV J;  1PV3 A;  3VN0 A;  1NTK D;  1BE3 E;  4UB6 H;  4WY4 D;  2L5G B;  1LT9 C;  5CBO A;  2M5A A;  4OGQ C;  3E1I A;  1N86 A;  5KAF H;  2OYO A;  3TGU G;  5KJ7 A;  1H8A A;  2LXC B;  2CPB A;  3Q5S A;  3JSV C;  5H2F H;  3G71 P;  1M57 D;  5AW1 B;  5KAF E;  2R3C A;  4R4L A;  1R5L A;  4DJG A;  1RF0 C;  1OFC X;  1OW6 A;  3KPE A;  1GK4 A;  2HR3 A;  1XTG B;  5CCH C;  3CCR P;  2YKP A;  3KDP B;  3E7K A;  3CMA P;  4DOJ A;  2N1T B;  1QEX A;  1VQN P;  1SQB E;  2KLV A;  2NPS C;  2IBZ E;  2MJZ A;  2OTK E;  1SQQ K;  2QG4 A;  3LIE A;  3TGU J;  1JMM A;  1SQX E;  2M8R A;  1JCC A;  1M1J A;  3QH9 A;  3AE7 C; 
#chains in the Genus database with same CATH homology
 5KAF E;  4IL6 E;  5GTH E;  4UB8 E;  5TIS E;  5B66 E;  1S5L E;  5KAI E;  5B5E E;  5H2F E;  4UB6 E;  5E79 E;  3A0B E;  3A0H E;  1W5C E;  3KZI E;  4PJ0 E;  5GTI E;  2AXT E;  3WU2 E;  3JCU E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...