3JCUE

Cryo-em structure of spinach psii-lhcii supercomplex at 3.2 angstrom resolution
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
79
structure length
79
Chain Sequence
STGERSFADIITSIRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYFTESRQGIPLITGRFDSLEQLDEFSRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of spinach photosystem II-LHCII supercomplex at 3.2 A resolution
doi rcsb
molecule tags Membrane protein
molecule keywords Photosystem II protein D1
total genus 20
structure length 79
sequence length 79
chains with identical sequence e
ec nomenclature
pdb deposition date 2016-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00283 Cytochrom_B559 Cytochrome b559, alpha (gene psbE) and beta (gene psbF)subunits
E PF00284 Cytochrom_B559a Lumenal portion of Cytochrome b559, alpha (gene psbE) subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.860 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Photosystem II cytochrome b559, alpha subunit 3jcuE00
5B5EE 1W5CE 5GTIE 5H2FE 5KAIE 3WU2E 5E79E 3A0HE 3A0BE 3JCUE 4PJ0E 5TISE 4UB6E 3KZIE 5B66E 2AXTE 5KAFE 4IL6E 5GTHE 4UB8E 1S5LE
chains in the Genus database with same CATH superfamily
2KUBA 3LIDA 2LXCB 5AW4B 1ZV8A 4OWFA 1L2PA 1GMJA 5EFWB 3D71A 2L5GB 3EFGA 2Y0CA 1RF1A 4GOEA 3H1KE 1GL2B 1LP1B 3JCUE 2H8PD 3W67A 2JR8A 2FYUK 4RO0A 4EIJA 2O01N 5AVSB 3CCSP 1RQUA 3N7NA 3H1LD 3KYQA 3JSVC 4D6TE 2H7HA 4WY4C 2LXBA 2PP6A 5K5GB 3Q1MA 1FZCA 1BGYG 1NTMG 2B87B 2GUSA 4C7RA 2IBZG 2C0XA 2O01J 2QJYB 3HE5B 1L0NG 2R3CA 2YMKA 1PV3A 3KQGA 2DW3A 1NTMK 3PP5A 3CXHE 3VMAA 2WT7A 1VF5C 4KJMA 1S5LE 2P7JA 2WZ7A 1GK4A 5E79H 1JCCA 1DIPA 2KP8A 3H1KG 3V4QA 2JEEA 4TT3H 4U3FD 4ASVA 4UB6H 1EDIA 1K73Q 3AE2C 3A0BE 1UIIA 5APXA 3A0BH 1MUUA 3RK2B 1NTME 1DEBA 3H25A 2OGUA 1L0NE 2R3SA 2XDJA 4Y99B 2GUVA 2JJLA 3B8EB 1URQC 1RE3C 2V7QH 1JY3P 4W80A 5B66E 2FFDA 2N1TD 1QL1A 2WSEH 3BCCJ 1LTJB 3CX5I 2ZYGA 2IYPA 3MHVA 5AW1B 3B5NA 3CC4P 3S1KA 3I55P 4GOFA 1IK9A 2W6AA 4Z1MH 3H1KD 2ZXXA 3RBXA 1VQPP 3L71J 3O8ZA 5BU5A 1NU1E 2OARA 2WQYC 4K3AA 5TJHA 5AVWB 4JQ0D 1SQPK 4PD4E 2QVAA 1OW7A 3C8VA 2M0BA 1FDOA 1D7MA 1PGJA 1N7SA 4LLHA 3RK3C 1JO5A 2QA4P 3WU2E 1QLED 5KJ7A 5TISH 1S2EA 3M9QA 3AEEC 2I1JA 1BCCJ 1BGYD 5APUA 1EDLA 5CBNA 1CZQA 1L0LK 1L0NJ 1K9MQ 3R2PA 5AW3B 1YTZT 2BCCG 3CXHD 1BSHA 1NHLA 2H88C 4QMAA 1LTJA 4AUWA 3TNUB 1BE3D 2HLOA 1YJWP 4H0LB 3H1IJ 1KD1Q 1VL2A 4LGDE 4LC1A 3B71A 1M1JC 1KILC 2MKVA 1J2JB 1JY3O 1GU4A 1SQQD 2QG4A 1YHQP 1KQFB 2BEQD 5APWA 2JDIH 2KOGA 3MP7B 4KHXA 3I56P 2IYOA 3HTKB 4YTPC 1EXIA 2YIUB 3CMAP 2AEFA 1N8RQ 1JOCA 2KI7B 1GW3A 1L0LD 1SQPE 2KZIA 3L70D 1NH4A 3P8CE 1KQSO 1XTGB 2ZYAA 2R5DA 2FXPA 2ZT9C 3II6A 3QH9A 3CCMP 4PJ0H 2BCCE 1SFCA 4U3FG 1CI6B 3CCRP 2BCCJ 1S1CX 3TGUJ 2Z4EA 2AXCA 2RMZA 2RH0A 5B5EH 2Y9ZA 2FYUD 4UB6E 2HR3A 3H1LG 3LIEA 3NXSA 1QVGO 3Q2YA 1M8OB 3G4SP 3UIAA 1KILD 2YXQB 4H44D 5AVRB 2HODB 3AE8C 4HKZH 4U3FJ 5H2FH 2Q3EA 1U57A 5CCHC 3CLQA 1PP9D 3CCQP 1R8EA 3AEGC 1FZAA 3AEBC 3GG2A 2N1TA 2A45G 3N4XA 4U3FE 2XNDH 3HE4B 4YPCA 2E5YA 3H1JG 3GW6A 4BXLA 3D6YA 1CI6A 1JMMA 3HD7D 3H1JJ 2QIWA 3A3YB 3C9IA 3HE5A 1WRGA 3PLNA 4I6MC 4OGQC 5KLVD 3RL0g 3FX0A 2PAJA 2E74C 3GF7A 3L35A 3RGUA 4H13B 1P84D 3VTPC 1KFMA 4OH8B 2AEJA 1T8ZA 3L70J 3ITKA 1URQB 3KZIE 3KZIH 3AEAC 2Q3IA 5KLIC 4ZKPA 2O01H 1Q81Q 1SQVD 1SVFA 2OYOA 2OYIA 2E43A 4D6TD 2QM7A 1FS0E 1S9KD 3H1IG 1HJBA 2M8RA 2G8YA 3P7KA 2N9BA 2WITA 1BSNA 1NJIQ 1KB9I 2B9BA 2M5AB 4IFFA 3TNUA 4I7ZB 2B88A 2MJZA 3L74G 2FYNB 1SQXD 3M0AA 1GTWA 3H1HE 2FYUE 2M3BA 1IJDB 2HPCB 1ZXGA 2KSJA 1KILA 2K9YA 3IR9A 1OIPA 1CSBA 1G1JA 1NO4A 3B5ND 3VYIA 4BRYA 1HH0A 2NPSC 1PP9J 2P2UA 1AVOA 1L4AD 1S4XA 4PV1C 1FU1A 1H89A 4JYCA 5C39A 4C7NB 1W2EA 5CJ0A 1KORA 1LTBC 1OXZA 1NKZB 1L0LE 1LWUC 3RK3B 3SFDC 1G2CA 3VN0A 3WMM0 3T97A 4EYYQ 1N7SD 1NAYA 1M1KQ 1HWTC 1CW5A 3MZWB 2D2CC 2KB7P 3VMZA 1M1JB 2CK3H 2KZJA 3L72G 4GODA 3TYYA 1SQXJ 5AVUB 1K05A 4I1LA 1IFMA 1T3JA 3KXDA 2IZ0A 2K1AA 4R4MA 2XNXA 1Z56A 1IZNB 1PL5A 2NPSD 2E5TA 1GU5A 3D70A 3PHLA 3F5HA 2JO1A 1LTIC 4L73A 2IX7C 4JPZB 2ZT9D 1KYOH 1VDFA 3BCCE 4WY4A 1KYOE 1SFCB 5AVVB 2A06G 2M3EA 3AE5C 4GT1A 1FZGA 2FFDC 1N7LA 4PD4H 1FZFA 3RBZA 1KN7A 4PD4I 3VMYA 1HJ0A 3BRTB 1GL2C 2AXTH 1HGVA 1KQLA 2Q5UA 1NTMJ 3AEFC 1KYOI 1MFZA 3CX5D 5CHXA 1NGMB 2WPVB 1G2CB 1EZVE 1ZRTD 3AE3C 3H1ID 2YKQA 5AVQB 5CCHA 2WT7B 2HPCA 2WSSH 4C7NA 1SQVG 2OTLP 1JY2P 2HFED 3SSUA 3VP9A 2P10A 4GKGA 4CPGA 3EWKA 2K9JA 1PPJG 2Q1KA 5KLIB 2YO3A 2KSEA 1A02J 4ZMDA 3CWBG 4AYCA 3IAOA 2QJYC 1S72P 1LTSC 1JY2N 5APVA 3BASA 1OWAA 3BCCG 1PIXA 1UIXA 1GW4A 3B5NB 4IL6H 4IL6E 1NTKK 3GHGC 4OGQB 4UB8E 2C9NY 1NTZE 1VQLP 1R5SA 1ZOYC 3CL3D 1OFCX 2XKMA 2E75D 1P84E 1DH3A 2WTYA 3AE1C 1JMBA 3P8CD 3I5CA 1FZEA 5CCHD 1QGKB 2N9YB 5AW9B 3BCCD 2KK7A 5E79E 5BU8B 2ZAEB 2D2CD 4B86A 1DD3A 3MGNA 2W27A 3BVHA 2JP3A 1OZHA 1KQGB 2YNYA 2ZVNB 2FKWB 3SWKA 1PPJE 4D6TG 1SQQE 1KB9H 3SFEC 2RKLA 3ZDMA 1T3UA 3AE9C 3CX5H 3RL0B 1RF1C 2XZRA 1M90Q 3NTNA 2O1KA 4NPFX 3CC7P 1M57D 2YO2A 1G1IA 1SQBD 1BE3E 3CCUP 1PGPA 2FYUJ 2VRSA 3IN6A 1VQ6P 1YQ3C 3H32A 3L36A 2AXTE 2KLUA 3Q5RA 3HRNA 1EXJA 3Q5SA 1BCCD 1BGYJ 1JY2O 2IFNA 3KPEA 4L75A 5AVXB 1JY3N 2Q7CA 1KFNA 3L75E 2KXPB 3CCLP 1LT9C 1HGZA 2W90A 3L72J 2QJKB 3JCUH 1SQVJ 1LT1A 1Q2NA 1HBWA 1SFCC 2ZFCA 2M5AA 2BCCD 3FXDA 1FZCB 2IPPA 1IFDA 1H8AA 1VF5D 4HYTB 3L71D 1LWUB 2GA1A 4WB4A 2FFDB 2E42A 1R5LA 1IFJA 3AE4C 3H1HD 2J58A 3M06A 3RL0D 1SQXE 5APQA 1A02F 1X79B 1LP1A 1ZN5A 3HUSB 2FYZA 3C1LA 4H0LD 3U1AA 1RH5B 1L4AA 1SQPG 5TISE 4D6TJ 5KLVG 2B89A 3G71P 1JEKA 1LWUA 1EDKA 2KS1A 5KLVJ 1GD2E 3M91A 4H0LC 3A7OA 3H1JD 2B87A 2KNCB 4DZOA 4U7JA 3H6PA 3G6EP 1S9KE 3L75G 1AQ5A 2RN0A 4OGQD 2O3JA 2WSFJ 1L0ND 1NVOA 1SFCD 1SQBE 2E75B 1RF0C 1NTMD 1FE6A 1SQVK 5BVZA 5GTHE 1NOHA 1FAVA 3HE4A 1KB9E 1SQBJ 3GHGB 2N1TB 3GF3A 3NMDA 4NPDA 1OX3A 1GL2D 1Y47A 1KMIZ 1L4AC 3L4FA 4PV1D 1KV4A 1VQ4P 1RY3A 2ZVOB 2V4HA 4H44C 3WUTA 2Q6QA 2PFXA 2BASA 1YIJP 3GMAA 2W6BA 3MD0A 2OYIC 1X9VA 5CJ4A 3AE7C 3V2RA 1ZR4A 2OYHB 1U7MA 1XTCC 4PJ0E 1NYHA 4IL6X 3CPWO 1SQBG 2E74B 3A2AA 1KZUB 5KJ7D 4WVZA 3W68A 4UB8H 1FZCC 3EFFK 3V6IA 2ZXEB 3TGUD 1L0LJ 2QM8A 1KILE 1OVVA 3RK3E 1PGQA 3NFQA 3VOPA 1X0TA 5KKZC 1FDMA 2YXRB 2XV5A 3B4SA 4L76A 4RJTA 4EOTA 2XU6A 1SP4A 1JNMA 4HH2A 2NPSA 2PRRA 1DEEG 2W6JH 3FXEA 1Y9BA 4R4LA 1J1DB 5CCGC 4M3LA 2WSFH 1NTZK 3E1RA 4WWIA 1HTLC 1N73B 4WY4D 1VQ7P 2P1JA 3H1IE 1VQOP 1ZLLA 1TU3F 1BE3J 2FYNC 1W5CE 2I1KA 2P67A 1E79H 2FBWC 3CX5E 3P32A 1K04A 5KAIE 1N7SB 1SQPD 3CWBJ 3HD7C 1FJKA 1VPCA 4I2LC 1SQQJ 3E1IA 3H1HG 1VQMP 3FGAD 4TLFA 3MIWA 3G3ZA 1LNQA 2WPSA 4PV1B 4W7ZA 5GTHH 3RL0C 1JCDA 3PRJA 1OMIA 2NZ2A 2POHA 3V4WA 2HODA 1DD4A 1PZQA 1NU1J 2K88A 2Y9YA 2E76B 1M56D 2YKPA 3EQ2A 1NKNA 1LTAC 3WUUA 2IFMA 4WY4B 1NTZJ 2J59M 1NTKG 2ZYDA 1AQTA 1GDTA 1LGHB 1ZP0C 5CCGD 1SQPJ 2LKMA 3CWBD 3H1JE 3L73J 3G9RA 1USDA 3D6ZA 1S3JA 3USSA 2FY8A 2G3AA 3L73G 1ZMEC 1HVVA 2UWJE 3OA7A 2Q9IA 5B5EE 2N1TC 1OVRA 2NPSB 4DOJA 1HUCA 2BEZF 4W7YA 4PD4D 1NU1G 1FDIA 3HUSC 2FXOA 2AEMA 2LR2A 5M1BA 5KAFH 1YJNP 3IFMA 1JTHA 1RHZB 3PTZA 1NWQA 1VQ9P 2A06E 4XA4A 1NTKE 1IFNA 3L75D 2IBZE 3JC22 3OW2O 1ZW0A 3CCVP 2GM4A 1BCCE 4JBZA 2OYHA 2E75C 3TGUE 1AV1A 1WT6A 2Z5HA 3RK2D 1PP9G 1EZVG 4XFJA 2OTJP 3L74E 3LW5H 2QJPB 2QSIA 1MFTA 3L73E 4KT0J 4RESB 1YITP 2OQQA 1SQVE 4OVNF 3T97B 2J5UA 1L4AB 2WWWA 1PPJD 3PJSK 4GDOA 4O9BA 3S4RA 3OAKA 1FC2C 3L74J 3QWOC 4JF7A 1S5LX 1M7LA 2QE7H 3B5NC 5AW6B 1Q86Q 1N73C 5GTIH 1SLQA 5GTIE 2OYIB 1GK6A 5H2FE 2W8ZA 1QL2A 3SWFA 1LT9A 5AVZB 2OYHC 1USEA 3BRVB 1BCCG 1RE3A 1URQA 1KB9D 1MKMA 2R32A 2YMYA 4GIFA 5KLVK 3TDKA 1NTKJ 5AW7B 5KAIH 4BWNA 3CMEP 4DT0A 3H1LJ 3R4YA 4WBAA 5APTA 4ASWA 1DX7A 3FWLA 1X8YA 1EDJA 1NAFA 2KS1B 3TGUG 3V2QA 3L70G 3P8MC 2KLVA 1YQ4C 2KIKA 3M0DC 1PP9E 4A7PA 1FJPA 3CCJP 3MTUE 3H1LE 3L73D 5AW2B 1N2DC 2FXMA 2O1JA 3L74D 5DJUB 3VP8A 1W2BO 1RF1B 2E76C 1VQKP 1J1DC 2JWAA 3H1HJ 1SQXK 5KJ7C 1T2KC 1J1EB 2WPRA 1AVYA 1JM0A 3MUDA 5AW5B 1P84I 3TSIA 3CC2P 1L0NK 1S5LH 1BE3G 5APYA 2A06D 2C0WA 3L71E 1SS1A 2L91A 1RQVA 1YJ9P 1LT9B 2A45H 2K9JB 1EQ7A 2QJKC 1ZR2A 4EDFA 2JWDA 2ZT9B 2CPBA 2QEXP 2P58A 1OVUA 3E7KA 3A0HE 3L70E 2R44A 4DCKA 1KTMA 1LTTC 1H0TA 1KYOD 4EI2A 3OJAB 2HYNA 1IFPA 2WSEJ 3CI9A 1LJ2A 3M9BA 4L74A 5AW0B 3S9OA 5AW8B 1OW6A 5DJTB 1FOSF 3CXHI 4MN4C 3V2NA 3CWBE 2WVRA 1QVFO 3HD7A 3ABVC 3U1CA 1IFIA 1LTGC 3FWNA 1U7JA 2WSCJ 1MV8A 4JYBA 3SWYA 1URQD 2YIUC 4Y28J 1Q7YQ 1AJYA 5KAFE 2W83C 3HTKA 1NTZG 4C46A 1BDDA 2QJPC 5CCGA 3L71G 1GL2A 3U59A 3M9HA 2Z5IA 2E76D 2ITAA 2V7QJ 1Y8AA 1JB0J 2QRXA 2WPQA 1N86A 2YKOA 4IFDK 5B66H 4H13D 3VMXA 4HB1A 1PFIA 4HJGH 2FYUG 2PGDA 1VQ8P 2NRGA 3WU2H 4N78D 2Y0DA 1YBKA 1NTZD 2CPSA 2Y0EA 1YTZI 5AVYB 1RE4A 1SQQG 4H44B 1IO4A 1IK7A 2IZ1A 1NU1D 4H13C 2OTKE 4YXDC 1SQQK 5CMZA 3TF5A 3MUDC 3K5BA 4XE5B 1L0LG 3BATA 2IDBA 3L72D 1JTHB 4AQRD 2HG5D 2I8DA 3L72E 1FBMA 3H1KJ 1FZBA 1T6AA 2E74D 3L75J 4N3YB 4Y99C 3RK3D 2IBZD 3O6QA 1YI2P 1YYCA 3CXHH 1M1JA 1NTKD 1WMKA 5KTBA 3A5TA 1EZVD 1ZRTE 2KNCA 3M0DA 5KKZB 1VF5B 1LTJC 2WSCH 1AA0A 4NPEA 1RF0A 1QX8A 4ZNCA 4N78E 1NU1K 3HUSA 5AVTB 3L37A 2C9LY 1AFOA 1PGOA 1H88A 3IF4A 1MZ9A 1EC5A 1SQXG 3PH0A 2A45I 3CCEP 1QEXA 2R5BA 1GZLA 4K35A 4DJGA 2SPZA 5KLVE 3AECC 4N6JA 3RK2C 2IBZI 1VQ5P 1N7SC 3CD6P 3HD7B 1Q82Q 1P84H 1N73A 3GLMA 2ZJSE 3TK1A 2K3RA 3O6QB 5APSA 1VQNP 1RE4C 3AEDC 5CBOA 2H89C 2K37A 2D2CB 3Q5PA 1OW8A 1X22A 1H0TB 2WMMA 1T2KD 3KHUA 2JKVA 1J1EC 1HF9A 3H32B 3GHGA 4I7ZC 1Q90D 1KC8Q 2H43A 1JUNA 1SQBK 4IFMA 4YXWH 4RKUJ 1EZVI 3Q3DA 1E5WA 1IC2A 3AE6C 3A0HH 3KDPB 1KILB 3WUVA 4IOIH 4BRYB 1BGYE 5L8RJ 2KYVA 3V5BA 3V2PA 4ZKUA 3F89A 1FOSE 3LW5J 1BDCA 1K8AQ
chains in the Genus database with same CATH topology
5B5EE 1W5CE 5GTIE 5H2FE 5KAIE 3WU2E 5E79E 3A0HE 3A0BE 3JCUE 4PJ0E 5TISE 4UB6E 3KZIE 5B66E 2AXTE 5KAFE 4IL6E 5GTHE 4UB8E 1S5LE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B5E E;  1W5C E;  5GTI E;  5H2F E;  5KAI E;  3WU2 E;  5E79 E;  3A0H E;  3A0B E;  3JCU E;  4PJ0 E;  5TIS E;  4UB6 E;  3KZI E;  5B66 E;  2AXT E;  5KAF E;  4IL6 E;  5GTH E;  4UB8 E;  1S5L E; 
#chains in the Genus database with same CATH topology
 2KUB A;  3LID A;  2LXC B;  5AW4 B;  1ZV8 A;  4OWF A;  1L2P A;  1GMJ A;  5EFW B;  3D71 A;  2L5G B;  3EFG A;  2Y0C A;  1RF1 A;  4GOE A;  3H1K E;  1GL2 B;  1LP1 B;  3JCU E;  2H8P D;  3W67 A;  2JR8 A;  2FYU K;  4RO0 A;  4EIJ A;  2O01 N;  5AVS B;  3CCS P;  1RQU A;  3N7N A;  3H1L D;  3KYQ A;  3JSV C;  4D6T E;  2H7H A;  4WY4 C;  2LXB A;  2PP6 A;  5K5G B;  3Q1M A;  1FZC A;  1BGY G;  1NTM G;  2B87 B;  2GUS A;  4C7R A;  2IBZ G;  2C0X A;  2O01 J;  2QJY B;  3HE5 B;  1L0N G;  2R3C A;  2YMK A;  1PV3 A;  3KQG A;  2DW3 A;  1NTM K;  3PP5 A;  3CXH E;  3VMA A;  2WT7 A;  1VF5 C;  4KJM A;  1S5L E;  2P7J A;  2WZ7 A;  1GK4 A;  5E79 H;  1JCC A;  1DIP A;  2KP8 A;  3H1K G;  3V4Q A;  2JEE A;  4TT3 H;  4U3F D;  4ASV A;  4UB6 H;  1EDI A;  1K73 Q;  3AE2 C;  3A0B E;  1UII A;  5APX A;  3A0B H;  1MUU A;  3RK2 B;  1NTM E;  1DEB A;  3H25 A;  2OGU A;  1L0N E;  2R3S A;  2XDJ A;  4Y99 B;  2GUV A;  2JJL A;  3B8E B;  1URQ C;  1RE3 C;  2V7Q H;  1JY3 P;  4W80 A;  5B66 E;  2FFD A;  2N1T D;  1QL1 A;  2WSE H;  3BCC J;  1LTJ B;  3CX5 I;  2ZYG A;  2IYP A;  3MHV A;  5AW1 B;  3B5N A;  3CC4 P;  3S1K A;  3I55 P;  4GOF A;  1IK9 A;  2W6A A;  4Z1M H;  3H1K D;  2ZXX A;  3RBX A;  1VQP P;  3L71 J;  3O8Z A;  5BU5 A;  1NU1 E;  2OAR A;  2WQY C;  4K3A A;  5TJH A;  5AVW B;  4JQ0 D;  1SQP K;  4PD4 E;  2QVA A;  1OW7 A;  3C8V A;  2M0B A;  1FDO A;  1D7M A;  1PGJ A;  1N7S A;  4LLH A;  3RK3 C;  1JO5 A;  2QA4 P;  3WU2 E;  1QLE D;  5KJ7 A;  5TIS H;  1S2E A;  3M9Q A;  3AEE C;  2I1J A;  1BCC J;  1BGY D;  5APU A;  1EDL A;  5CBN A;  1CZQ A;  1L0L K;  1L0N J;  1K9M Q;  3R2P A;  5AW3 B;  1YTZ T;  2BCC G;  3CXH D;  1BSH A;  1NHL A;  2H88 C;  4QMA A;  1LTJ A;  4AUW A;  3TNU B;  1BE3 D;  2HLO A;  1YJW P;  4H0L B;  3H1I J;  1KD1 Q;  1VL2 A;  4LGD E;  4LC1 A;  3B71 A;  1M1J C;  1KIL C;  2MKV A;  1J2J B;  1JY3 O;  1GU4 A;  1SQQ D;  2QG4 A;  1YHQ P;  1KQF B;  2BEQ D;  5APW A;  2JDI H;  2KOG A;  3MP7 B;  4KHX A;  3I56 P;  2IYO A;  3HTK B;  4YTP C;  1EXI A;  2YIU B;  3CMA P;  2AEF A;  1N8R Q;  1JOC A;  2KI7 B;  1GW3 A;  1L0L D;  1SQP E;  2KZI A;  3L70 D;  1NH4 A;  3P8C E;  1KQS O;  1XTG B;  2ZYA A;  2R5D A;  2FXP A;  2ZT9 C;  3II6 A;  3QH9 A;  3CCM P;  4PJ0 H;  2BCC E;  1SFC A;  4U3F G;  1CI6 B;  3CCR P;  2BCC J;  1S1C X;  3TGU J;  2Z4E A;  2AXC A;  2RMZ A;  2RH0 A;  5B5E H;  2Y9Z A;  2FYU D;  4UB6 E;  2HR3 A;  3H1L G;  3LIE A;  3NXS A;  1QVG O;  3Q2Y A;  1M8O B;  3G4S P;  3UIA A;  1KIL D;  2YXQ B;  4H44 D;  5AVR B;  2HOD B;  3AE8 C;  4HKZ H;  4U3F J;  5H2F H;  2Q3E A;  1U57 A;  5CCH C;  3CLQ A;  1PP9 D;  3CCQ P;  1R8E A;  3AEG C;  1FZA A;  3AEB C;  3GG2 A;  2N1T A;  2A45 G;  3N4X A;  4U3F E;  2XND H;  3HE4 B;  4YPC A;  2E5Y A;  3H1J G;  3GW6 A;  4BXL A;  3D6Y A;  1CI6 A;  1JMM A;  3HD7 D;  3H1J J;  2QIW A;  3A3Y B;  3C9I A;  3HE5 A;  1WRG A;  3PLN A;  4I6M C;  4OGQ C;  5KLV D;  3RL0 g;  3FX0 A;  2PAJ A;  2E74 C;  3GF7 A;  3L35 A;  3RGU A;  4H13 B;  1P84 D;  3VTP C;  1KFM A;  4OH8 B;  2AEJ A;  1T8Z A;  3L70 J;  3ITK A;  1URQ B;  3KZI E;  3KZI H;  3AEA C;  2Q3I A;  5KLI C;  4ZKP A;  2O01 H;  1Q81 Q;  1SQV D;  1SVF A;  2OYO A;  2OYI A;  2E43 A;  4D6T D;  2QM7 A;  1FS0 E;  1S9K D;  3H1I G;  1HJB A;  2M8R A;  2G8Y A;  3P7K A;  2N9B A;  2WIT A;  1BSN A;  1NJI Q;  1KB9 I;  2B9B A;  2M5A B;  4IFF A;  3TNU A;  4I7Z B;  2B88 A;  2MJZ A;  3L74 G;  2FYN B;  1SQX D;  3M0A A;  1GTW A;  3H1H E;  2FYU E;  2M3B A;  1IJD B;  2HPC B;  1ZXG A;  2KSJ A;  1KIL A;  2K9Y A;  3IR9 A;  1OIP A;  1CSB A;  1G1J A;  1NO4 A;  3B5N D;  3VYI A;  4BRY A;  1HH0 A;  2NPS C;  1PP9 J;  2P2U A;  1AVO A;  1L4A D;  1S4X A;  4PV1 C;  1FU1 A;  1H89 A;  4JYC A;  5C39 A;  4C7N B;  1W2E A;  5CJ0 A;  1KOR A;  1LTB C;  1OXZ A;  1NKZ B;  1L0L E;  1LWU C;  3RK3 B;  3SFD C;  1G2C A;  3VN0 A;  3WMM 0;  3T97 A;  4EYY Q;  1N7S D;  1NAY A;  1M1K Q;  1HWT C;  1CW5 A;  3MZW B;  2D2C C;  2KB7 P;  3VMZ A;  1M1J B;  2CK3 H;  2KZJ A;  3L72 G;  4GOD A;  3TYY A;  1SQX J;  5AVU B;  1K05 A;  4I1L A;  1IFM A;  1T3J A;  3KXD A;  2IZ0 A;  2K1A A;  4R4M A;  2XNX A;  1Z56 A;  1IZN B;  1PL5 A;  2NPS D;  2E5T A;  1GU5 A;  3D70 A;  3PHL A;  3F5H A;  2JO1 A;  1LTI C;  4L73 A;  2IX7 C;  4JPZ B;  2ZT9 D;  1KYO H;  1VDF A;  3BCC E;  4WY4 A;  1KYO E;  1SFC B;  5AVV B;  2A06 G;  2M3E A;  3AE5 C;  4GT1 A;  1FZG A;  2FFD C;  1N7L A;  4PD4 H;  1FZF A;  3RBZ A;  1KN7 A;  4PD4 I;  3VMY A;  1HJ0 A;  3BRT B;  1GL2 C;  2AXT H;  1HGV A;  1KQL A;  2Q5U A;  1NTM J;  3AEF C;  1KYO I;  1MFZ A;  3CX5 D;  5CHX A;  1NGM B;  2WPV B;  1G2C B;  1EZV E;  1ZRT D;  3AE3 C;  3H1I D;  2YKQ A;  5AVQ B;  5CCH A;  2WT7 B;  2HPC A;  2WSS H;  4C7N A;  1SQV G;  2OTL P;  1JY2 P;  2HFE D;  3SSU A;  3VP9 A;  2P10 A;  4GKG A;  4CPG A;  3EWK A;  2K9J A;  1PPJ G;  2Q1K A;  5KLI B;  2YO3 A;  2KSE A;  1A02 J;  4ZMD A;  3CWB G;  4AYC A;  3IAO A;  2QJY C;  1S72 P;  1LTS C;  1JY2 N;  5APV A;  3BAS A;  1OWA A;  3BCC G;  1PIX A;  1UIX A;  1GW4 A;  3B5N B;  4IL6 H;  4IL6 E;  1NTK K;  3GHG C;  4OGQ B;  4UB8 E;  2C9N Y;  1NTZ E;  1VQL P;  1R5S A;  1ZOY C;  3CL3 D;  1OFC X;  2XKM A;  2E75 D;  1P84 E;  1DH3 A;  2WTY A;  3AE1 C;  1JMB A;  3P8C D;  3I5C A;  1FZE A;  5CCH D;  1QGK B;  2N9Y B;  5AW9 B;  3BCC D;  2KK7 A;  5E79 E;  5BU8 B;  2ZAE B;  2D2C D;  4B86 A;  1DD3 A;  3MGN A;  2W27 A;  3BVH A;  2JP3 A;  1OZH A;  1KQG B;  2YNY A;  2ZVN B;  2FKW B;  3SWK A;  1PPJ E;  4D6T G;  1SQQ E;  1KB9 H;  3SFE C;  2RKL A;  3ZDM A;  1T3U A;  3AE9 C;  3CX5 H;  3RL0 B;  1RF1 C;  2XZR A;  1M90 Q;  3NTN A;  2O1K A;  4NPF X;  3CC7 P;  1M57 D;  2YO2 A;  1G1I A;  1SQB D;  1BE3 E;  3CCU P;  1PGP A;  2FYU J;  2VRS A;  3IN6 A;  1VQ6 P;  1YQ3 C;  3H32 A;  3L36 A;  2AXT E;  2KLU A;  3Q5R A;  3HRN A;  1EXJ A;  3Q5S A;  1BCC D;  1BGY J;  1JY2 O;  2IFN A;  3KPE A;  4L75 A;  5AVX B;  1JY3 N;  2Q7C A;  1KFN A;  3L75 E;  2KXP B;  3CCL P;  1LT9 C;  1HGZ A;  2W90 A;  3L72 J;  2QJK B;  3JCU H;  1SQV J;  1LT1 A;  1Q2N A;  1HBW A;  1SFC C;  2ZFC A;  2M5A A;  2BCC D;  3FXD A;  1FZC B;  2IPP A;  1IFD A;  1H8A A;  1VF5 D;  4HYT B;  3L71 D;  1LWU B;  2GA1 A;  4WB4 A;  2FFD B;  2E42 A;  1R5L A;  1IFJ A;  3AE4 C;  3H1H D;  2J58 A;  3M06 A;  3RL0 D;  1SQX E;  5APQ A;  1A02 F;  1X79 B;  1LP1 A;  1ZN5 A;  3HUS B;  2FYZ A;  3C1L A;  4H0L D;  3U1A A;  1RH5 B;  1L4A A;  1SQP G;  5TIS E;  4D6T J;  5KLV G;  2B89 A;  3G71 P;  1JEK A;  1LWU A;  1EDK A;  2KS1 A;  5KLV J;  1GD2 E;  3M91 A;  4H0L C;  3A7O A;  3H1J D;  2B87 A;  2KNC B;  4DZO A;  4U7J A;  3H6P A;  3G6E P;  1S9K E;  3L75 G;  1AQ5 A;  2RN0 A;  4OGQ D;  2O3J A;  2WSF J;  1L0N D;  1NVO A;  1SFC D;  1SQB E;  2E75 B;  1RF0 C;  1NTM D;  1FE6 A;  1SQV K;  5BVZ A;  5GTH E;  1NOH A;  1FAV A;  3HE4 A;  1KB9 E;  1SQB J;  3GHG B;  2N1T B;  3GF3 A;  3NMD A;  4NPD A;  1OX3 A;  1GL2 D;  1Y47 A;  1KMI Z;  1L4A C;  3L4F A;  4PV1 D;  1KV4 A;  1VQ4 P;  1RY3 A;  2ZVO B;  2V4H A;  4H44 C;  3WUT A;  2Q6Q A;  2PFX A;  2BAS A;  1YIJ P;  3GMA A;  2W6B A;  3MD0 A;  2OYI C;  1X9V A;  5CJ4 A;  3AE7 C;  3V2R A;  1ZR4 A;  2OYH B;  1U7M A;  1XTC C;  4PJ0 E;  1NYH A;  4IL6 X;  3CPW O;  1SQB G;  2E74 B;  3A2A A;  1KZU B;  5KJ7 D;  4WVZ A;  3W68 A;  4UB8 H;  1FZC C;  3EFF K;  3V6I A;  2ZXE B;  3TGU D;  1L0L J;  2QM8 A;  1KIL E;  1OVV A;  3RK3 E;  1PGQ A;  3NFQ A;  3VOP A;  1X0T A;  5KKZ C;  1FDM A;  2YXR B;  2XV5 A;  3B4S A;  4L76 A;  4RJT A;  4EOT A;  2XU6 A;  1SP4 A;  1JNM A;  4HH2 A;  2NPS A;  2PRR A;  1DEE G;  2W6J H;  3FXE A;  1Y9B A;  4R4L A;  1J1D B;  5CCG C;  4M3L A;  2WSF H;  1NTZ K;  3E1R A;  4WWI A;  1HTL C;  1N73 B;  4WY4 D;  1VQ7 P;  2P1J A;  3H1I E;  1VQO P;  1ZLL A;  1TU3 F;  1BE3 J;  2FYN C;  1W5C E;  2I1K A;  2P67 A;  1E79 H;  2FBW C;  3CX5 E;  3P32 A;  1K04 A;  5KAI E;  1N7S B;  1SQP D;  3CWB J;  3HD7 C;  1FJK A;  1VPC A;  4I2L C;  1SQQ J;  3E1I A;  3H1H G;  1VQM P;  3FGA D;  4TLF A;  3MIW A;  3G3Z A;  1LNQ A;  2WPS A;  4PV1 B;  4W7Z A;  5GTH H;  3RL0 C;  1JCD A;  3PRJ A;  1OMI A;  2NZ2 A;  2POH A;  3V4W A;  2HOD A;  1DD4 A;  1PZQ A;  1NU1 J;  2K88 A;  2Y9Y A;  2E76 B;  1M56 D;  2YKP A;  3EQ2 A;  1NKN A;  1LTA C;  3WUU A;  2IFM A;  4WY4 B;  1NTZ J;  2J59 M;  1NTK G;  2ZYD A;  1AQT A;  1GDT A;  1LGH B;  1ZP0 C;  5CCG D;  1SQP J;  2LKM A;  3CWB D;  3H1J E;  3L73 J;  3G9R A;  1USD A;  3D6Z A;  1S3J A;  3USS A;  2FY8 A;  2G3A A;  3L73 G;  1ZME C;  1HVV A;  2UWJ E;  3OA7 A;  2Q9I A;  5B5E E;  2N1T C;  1OVR A;  2NPS B;  4DOJ A;  1HUC A;  2BEZ F;  4W7Y A;  4PD4 D;  1NU1 G;  1FDI A;  3HUS C;  2FXO A;  2AEM A;  2LR2 A;  5M1B A;  5KAF H;  1YJN P;  3IFM A;  1JTH A;  1RHZ B;  3PTZ A;  1NWQ A;  1VQ9 P;  2A06 E;  4XA4 A;  1NTK E;  1IFN A;  3L75 D;  2IBZ E;  3JC2 2;  3OW2 O;  1ZW0 A;  3CCV P;  2GM4 A;  1BCC E;  4JBZ A;  2OYH A;  2E75 C;  3TGU E;  1AV1 A;  1WT6 A;  2Z5H A;  3RK2 D;  1PP9 G;  1EZV G;  4XFJ A;  2OTJ P;  3L74 E;  3LW5 H;  2QJP B;  2QSI A;  1MFT A;  3L73 E;  4KT0 J;  4RES B;  1YIT P;  2OQQ A;  1SQV E;  4OVN F;  3T97 B;  2J5U A;  1L4A B;  2WWW A;  1PPJ D;  3PJS K;  4GDO A;  4O9B A;  3S4R A;  3OAK A;  1FC2 C;  3L74 J;  3QWO C;  4JF7 A;  1S5L X;  1M7L A;  2QE7 H;  3B5N C;  5AW6 B;  1Q86 Q;  1N73 C;  5GTI H;  1SLQ A;  5GTI E;  2OYI B;  1GK6 A;  5H2F E;  2W8Z A;  1QL2 A;  3SWF A;  1LT9 A;  5AVZ B;  2OYH C;  1USE A;  3BRV B;  1BCC G;  1RE3 A;  1URQ A;  1KB9 D;  1MKM A;  2R32 A;  2YMY A;  4GIF A;  5KLV K;  3TDK A;  1NTK J;  5AW7 B;  5KAI H;  4BWN A;  3CME P;  4DT0 A;  3H1L J;  3R4Y A;  4WBA A;  5APT A;  4ASW A;  1DX7 A;  3FWL A;  1X8Y A;  1EDJ A;  1NAF A;  2KS1 B;  3TGU G;  3V2Q A;  3L70 G;  3P8M C;  2KLV A;  1YQ4 C;  2KIK A;  3M0D C;  1PP9 E;  4A7P A;  1FJP A;  3CCJ P;  3MTU E;  3H1L E;  3L73 D;  5AW2 B;  1N2D C;  2FXM A;  2O1J A;  3L74 D;  5DJU B;  3VP8 A;  1W2B O;  1RF1 B;  2E76 C;  1VQK P;  1J1D C;  2JWA A;  3H1H J;  1SQX K;  5KJ7 C;  1T2K C;  1J1E B;  2WPR A;  1AVY A;  1JM0 A;  3MUD A;  5AW5 B;  1P84 I;  3TSI A;  3CC2 P;  1L0N K;  1S5L H;  1BE3 G;  5APY A;  2A06 D;  2C0W A;  3L71 E;  1SS1 A;  2L91 A;  1RQV A;  1YJ9 P;  1LT9 B;  2A45 H;  2K9J B;  1EQ7 A;  2QJK C;  1ZR2 A;  4EDF A;  2JWD A;  2ZT9 B;  2CPB A;  2QEX P;  2P58 A;  1OVU A;  3E7K A;  3A0H E;  3L70 E;  2R44 A;  4DCK A;  1KTM A;  1LTT C;  1H0T A;  1KYO D;  4EI2 A;  3OJA B;  2HYN A;  1IFP A;  2WSE J;  3CI9 A;  1LJ2 A;  3M9B A;  4L74 A;  5AW0 B;  3S9O A;  5AW8 B;  1OW6 A;  5DJT B;  1FOS F;  3CXH I;  4MN4 C;  3V2N A;  3CWB E;  2WVR A;  1QVF O;  3HD7 A;  3ABV C;  3U1C A;  1IFI A;  1LTG C;  3FWN A;  1U7J A;  2WSC J;  1MV8 A;  4JYB A;  3SWY A;  1URQ D;  2YIU C;  4Y28 J;  1Q7Y Q;  1AJY A;  5KAF E;  2W83 C;  3HTK A;  1NTZ G;  4C46 A;  1BDD A;  2QJP C;  5CCG A;  3L71 G;  1GL2 A;  3U59 A;  3M9H A;  2Z5I A;  2E76 D;  2ITA A;  2V7Q J;  1Y8A A;  1JB0 J;  2QRX A;  2WPQ A;  1N86 A;  2YKO A;  4IFD K;  5B66 H;  4H13 D;  3VMX A;  4HB1 A;  1PFI A;  4HJG H;  2FYU G;  2PGD A;  1VQ8 P;  2NRG A;  3WU2 H;  4N78 D;  2Y0D A;  1YBK A;  1NTZ D;  2CPS A;  2Y0E A;  1YTZ I;  5AVY B;  1RE4 A;  1SQQ G;  4H44 B;  1IO4 A;  1IK7 A;  2IZ1 A;  1NU1 D;  4H13 C;  2OTK E;  4YXD C;  1SQQ K;  5CMZ A;  3TF5 A;  3MUD C;  3K5B A;  4XE5 B;  1L0L G;  3BAT A;  2IDB A;  3L72 D;  1JTH B;  4AQR D;  2HG5 D;  2I8D A;  3L72 E;  1FBM A;  3H1K J;  1FZB A;  1T6A A;  2E74 D;  3L75 J;  4N3Y B;  4Y99 C;  3RK3 D;  2IBZ D;  3O6Q A;  1YI2 P;  1YYC A;  3CXH H;  1M1J A;  1NTK D;  1WMK A;  5KTB A;  3A5T A;  1EZV D;  1ZRT E;  2KNC A;  3M0D A;  5KKZ B;  1VF5 B;  1LTJ C;  2WSC H;  1AA0 A;  4NPE A;  1RF0 A;  1QX8 A;  4ZNC A;  4N78 E;  1NU1 K;  3HUS A;  5AVT B;  3L37 A;  2C9L Y;  1AFO A;  1PGO A;  1H88 A;  3IF4 A;  1MZ9 A;  1EC5 A;  1SQX G;  3PH0 A;  2A45 I;  3CCE P;  1QEX A;  2R5B A;  1GZL A;  4K35 A;  4DJG A;  2SPZ A;  5KLV E;  3AEC C;  4N6J A;  3RK2 C;  2IBZ I;  1VQ5 P;  1N7S C;  3CD6 P;  3HD7 B;  1Q82 Q;  1P84 H;  1N73 A;  3GLM A;  2ZJS E;  3TK1 A;  2K3R A;  3O6Q B;  5APS A;  1VQN P;  1RE4 C;  3AED C;  5CBO A;  2H89 C;  2K37 A;  2D2C B;  3Q5P A;  1OW8 A;  1X22 A;  1H0T B;  2WMM A;  1T2K D;  3KHU A;  2JKV A;  1J1E C;  1HF9 A;  3H32 B;  3GHG A;  4I7Z C;  1Q90 D;  1KC8 Q;  2H43 A;  1JUN A;  1SQB K;  4IFM A;  4YXW H;  4RKU J;  1EZV I;  3Q3D A;  1E5W A;  1IC2 A;  3AE6 C;  3A0H H;  3KDP B;  1KIL B;  3WUV A;  4IOI H;  4BRY B;  1BGY E;  5L8R J;  2KYV A;  3V5B A;  3V2P A;  4ZKU A;  3F89 A;  1FOS E;  3LW5 J;  1BDC A;  1K8A Q; 
#chains in the Genus database with same CATH homology
 5B5E E;  1W5C E;  5GTI E;  5H2F E;  5KAI E;  3WU2 E;  5E79 E;  3A0H E;  3A0B E;  3JCU E;  4PJ0 E;  5TIS E;  4UB6 E;  3KZI E;  5B66 E;  2AXT E;  5KAF E;  4IL6 E;  5GTH E;  4UB8 E;  1S5L E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...