3JCUQ

Cryo-em structure of spinach psii-lhcii supercomplex at 3.2 angstrom resolution
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
148
structure length
148
Chain Sequence
b'EARPIVVGPPPPLSGGLPGTENSDQARDGTLPYTKDRFYLQPLPPTEAAQRAKVSASEILNVKQFIDRKAWPSLQNDLRLRASYLRYDLKTVISAKPKDEKKSLQELTSKLFSSIDNLDHAAKIKSPTEAEKYYGQTVSNINEVLAKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem II protein D1
publication title Structure of spinach photosystem II-LHCII supercomplex at 3.2 A resolution
doi rcsb
molecule tags Membrane protein
total genus 40
structure length 148
sequence length 148
chains with identical sequence q
ec nomenclature
pdb deposition date 2016-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF05757 PsbQ Oxygen evolving enhancer protein 3 (PsbQ)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.290 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3jcuQ00
3LS1A 2MWQA 3ZSUA 3RFYA 3LS0A 1VYKA 3JCUQ 1NZEA
chains in the Genus database with same CATH superfamily
1DOWA 3MX3A 3UNGC 1VLSA 3S9OA 3POVA 5TJ5E 2CNWD 1U6HA 1XZQA 1LVKA 3RH3A 5CI9A 3T6BA 2Y3DA 1U0BB 3FHDA 3B0UX 1QSPA 1T01A 4DBRA 4WJ0A 4YWQA 3ZSUA 2XLDA 1H6GA 3AQCA 3F47A 4EBJA 5JUAA 4KI2A 1VB5A 3B9QA 2R25A 5B1BC 2J0WA 1MMGA 3FOPA 3ZDLA 2CYDA 2XXAB 2EIKC 2DB4A 2A6EF 1NU9C 1T6QA 2XL8A 4FESA 3UR3C 1ZVZA 2PBEA 2B0JA 4JJFA 4JVSA 1FR0A 3K1IC 1E84A 2R03A 2P61A 2L6GA 1M6TA 3DAGA 1V55C 5E33A 3TOMA 2KGOA 1RXQA 3V7OA 3GM3A 2DYRC 3G4ZA 2ZXRA 3VM6A 1MMNA 4HE8D 2YL3A 1FAPB 3F46A 5L0DA 2AWYA 2L6FA 2IXPA 4HFFB 3FXHA 2ZPAA 1APCA 1IZMA 1SMYF 1GGQA 4BJ6C 4D4XA 1NFNA 2Q9AA 3L0IA 1VMAA 2OJQA 5DS6A 3LEOA 4CSAA 2XM4A 3HLZA 1PD0A 1QPUA 2EPLX 2XLMA 4PR9A 3LJBA 5IY5C 5D91A 2XS8A 1FFHA 2YRFA 2LFDA 3ABLC 3JT1A 1K40A 4U5CE 2B0HA 3B29A 2A0BA 3U8VA 4CS9A 3U8PA 2HJ3A 2HS5A 4IAQA 4AK9A 2CDQA 2HMZA 4O7GA 2XS1A 2R7VA 2G3VA 2KYHA 1J8YF 2KJGA 1RCPA 1OW8A 3MFNA 2QLAA 3O6XA 4JEBA 5JVEA 5KYYA 2XXAA 3OWTA 1OCZC 4XWJA 5F28E 2WVOA 1VYKA 1ZHXA 2A68F 3KMIA 3EHNA 4FWVA 3UMHA 2EPKX 4Q4ZF 1JMWA 3US6A 1OCCC 4WGZA 3RW0A 3TULA 1YDIA 4LLCA 5COGA 4ER9A 1M57C 4ZLDA 3UMIA 4EBBA 2CNWA 1W2WA 2ETSA 1M2VB 1TWCA 4MTOA 4EKWA 3VYWA 5B1AC 2R7OA 4IRUA 4U9EA 1R5ID 1ZU5A 2O9XA 4XPYA 5JP7A 3C8GB 4U5GA 4BEJA 3DE8A 4CX9A 2ICWG 2IXOA 2WZGA 3BRJA 1H9GA 1NU7D 256BA 2J9BA 3QVZA 2LK4A 5GPGB 1ZHZA 2EPOA 2Y3HA 2Q4FA 4JE9A 2W4BA 3C63A 2G3KA 4GEHA 2OJED 3QZCA 1MQVA 3T6JA 3U9JA 4E0HA 4IWBA 3JYHA 4NY3A 4PFOA 4CIPA 2LD6A 3AJMA 4H54A 2ASRA 5KYWB 4XLPF 3W2WA 2LP4A 3A11A 3EFOA 1U89A 2JD3A 3DJUB 1GM5A 1QKRA 4C3EA 2NUPB 3ASOC 1FMWA 4CS9C 4BEMJ 4CS8A 5FZTA 3C8ZA 4U5EE 4I3MA 1NSGB 4XPWA 4BJ5A 2VH3A 2NUTA 1TFKB 2IBFA 3GANA 3S0XA 3EQLF 4XEVA 4NTAA 5T3WA 2HV7A 1VOMA 1DOVA 3LNMB 4U5DE 1CGME 1TWGA 2KC3A 1HW1A 3H2UA 4I1OB 5T3TA 2I15A 3QVYA 4A4AA 3IQCA 4PK4A 4RDAA 3SEOA 4EBKA 4JTCB 1ZU4A 3R7CA 2BC5A 3C18A 3QW0A 1OXBA 2VASA 5DLJA 2XM0A 3K7DA 2EPNA 2C03A 1M2OA 2VB6A 1A7DA 4LDQA 5DQTA 5EGYA 4FX5A 1AVOB 2J45A 1WOLA 1L7CA 2P0NA 4LACB 2OEXA 1TQGA 2YL7A 1A0BA 3RFYA 3Q7LA 1G5ZA 4KBLA 3K66A 3NRHA 3U9MA 4MVZA 3WAQA 1VK5A 2LCHA 1BDJB 2A0UA 4JRZA 3I5QA 4DRIB 1KU2A 4DBQA 4YK5A 5A6AA 3NKEA 3O55A 1BBHA 4BJ6A 1M56C 2AWCA 2KW3C 3EGXA 3NYMA 1FTSA 3DM9B 1D1BA 4AE4B 5JSLA 1KNYA 2XL4A 4ONSA 3U3BA 3JSEO 4BJ5C 3HNKA 5L3VA 3B0VC 1RKCA 3ZC4A 1YAUO 2QNLA 2R7QA 3LLKA 3RVYA 3FOOA 4N6CA 1ZZPA 2EILC 1L3PA 2XLVA 3E70C 1RKEA 2AVKA 2GWWA 2J9WA 3GODA 2R7WA 3QMKA 1OCRC 3GWNA 4PACA 5A6JA 4U5BE 4LERA 1T9KA 1K05A 2PFDA 2J9UA 3RVZA 3WG7C 1Q0DA 4CS7A 2FFHA 3KYJA 3SNHA 2YEVA 3KPHA 4JURI 3V5YA 2M64A 2OEVA 3RQEA 1YYJA 1S05A 4BJTA 3NG1A 4GQHA 3Q7GA 2HV6A 5KYXA 3NMJA 3DJNB 4CBEA 1VYIA 2QUPA 4JIOA 4N4WA 3SYNA 4IARA 4YN0B 1OW6A 3T6GB 4OIPF 1EA8A 3MBGA 2Y3BA 3NKDA 4G0HA 2YL0A 1OQCA 2H7VC 1I4ZA 5KYNA 4H4KC 2YWAA 4DVYP 3DD7A 3QTHA 4YL1A 3RF3A 5JLIA 3DAFA 2KQ9A 5EK0A 2D4UA 2DI3A 1MNEA 4IAOA 5COFA 1OR2A 3DZAA 2FAPB 3JTLO 3EH2A 4N6HA 2ZXPA 5FCLA 2PNOA 3WODF 2YLGA 1VLTA 1OKKD 2WL8A 3DXJF 4R32A 1SR2A 5E3AA 1JAFA 3M4CA 3TJ5A 5F5FA 3DMDA 3DWWA 4K7BA 3GEIA 4Z9JA 4EUKB 4C7OA 3GEHA 2A6HF 1I5NA 2RSEB 2UUIA 1BR2A 2PP4A 2HUJA 4K0DA 4ULWA 3S28A 4RBNA 2L9JA 2XLOA 2MHRA 4CDAA 4ZLCA 5JT4A 1UG7A 2AU5A 3AQBA 1WATA 2J46A 3CZ6A 4MNDA 1LE2A 4BG0A 4FAPB 2X0CA 3RKOF 4D4NA 1RMVA 4I44A 3JZ0A 3MLGA 3EZHA 2XLEA 3MYIA 4JEAA 3HNIA 4PJMA 2YKZA 4Z9HA 3W8HA 1TKNA 3IQ5A 3H65A 4UDVA 2OKUA 1G8XA 1LS1A 4YT2A 3Q6NA 2R7UA 1MMDA 2PX0A 3C8GD 4ANJA 1EQ1A 1HMDA 2P7VA 5B3IA 3HJCA 3FDQA 2DYSC 3KH2A 4JJGA 3U5SA 3L8IA 4QI0A 4BPMA 2E87A 5L0JA 3ATPA 4MVMA 5E2QA 2J9VA 1EKYA 2IXNA 2XRHA 4J32B 1A41A 3IQ6A 3LEVA 4I1MA 1YA9A 2HFIA 1J8MF 1D0ZA 2JPUA 4KC9A 3AG2C 4AL0A 2R7TA 1HY5A 3BEHA 3M1CB 1SZIA 1Y4CA 2Y69C 4IGGA 4OIOF 1HE1A 4U5HA 4OINF 2GA0A 1Z63A 1EI7A 3ZQVA 1HMOA 4J7TA 1Q0FA 2HSBA 3CAXA 3JCUQ 3PDMP 5E3CA 3SXMA 3X1OA 1WN0A 2W9YA 2DGJA 2WZLA 4WGYA 1ORYA 1CGNA 3W8IA 4EIYA 1QQ3A 3Q6MA 1YZAA 3FMSA 1E2XA 3DM5A 4J7YA 1D1CA 3UGOA 4JKVA 1OKKA 3NMKA 3EGXB 2H7OA 3AG1C 4XLNF 1WWPA 3S84A 5T1DB 1SYQA 1WTYA 4G7ZF 2A1DD 3O10A 1LI7A 1C17M 3JRTA 1ZW3A 4MW8A 3G50A 3NMIA 1CPQA 2W45A 1NFOA 2OOCA 2QY9A 4XPXA 3T9OA 1CPRA 2BE5F 3GM2A 4E18A 3W2VA 3PHF2 1HW2A 2Z15A 3AGUA 4M63A 1Q0KA 2HSQA 2HKVA 1YJGA 3L34A 4Q5SF 1PD1A 2V26A 4OD5A 2Y3GA 3IHUA 1ORSC 1TWAA 1CGOA 3UMKA 1MMAA 2Q9BA 5L0GA 1BZ4A 1M2VA 2G62A 3IEEA 3SXKA 4MQ9F 2OG2A 1YLMA 4RD9A 1V54C 3O39A 4X0RA 4MVUA 1V74B 3WHNA 3C8GA 3NYJA 3W4YA 3LS1A 1OW7A 1XZPA 2XSEA 3IQTA 1LIHA 4O6YA 4QDLA 1LKXA 1MNDA 4YL3A 4O79A 3ZIBA 1ZW2A 3HNLA 2R9RB 3I4UA 3LESA 1GQAA 1JOGA 1ZHWA 2WVQA 4G78A 4NTBA 5EHHA 1LS4A 2CCYA 4NQFA 4MTFA 5HV9A 4DJ9A 5COMA 1S7ZA 3SXZA 5A69A 3J06A 2GFHA 4DXWA 3FVYA 4AX2A 2PX3A 4F4BA 3ZWIA 4CJGA 3GEEA 2L81A 2BL2A 3ABMC 2J8WA 4P9TA 2EPMX 3EG9A 3TJ6A 4E7ZA 2VC9A 3LLIA 1K04A 5L0FA 1D0YA 4O6MA 1TWHA 1T5OA 3B0PA 2KK1A 3M15A 1BR1A 3DKAA 1KTMA 2R7SA 2YVKA 1NG1A 2EIMC 3DI5A 1N1CA 2AP3A 3ITFA 4U9DA 4A2NB 4CJOA 3UGPA 4BJ1A 4N06A 3X2QC 3ZG1A 2OU6A 4KNVA 1C03A 3HKKA 3C7JA 4O6NA 3FAPB 3HNJA 3ASNC 1HE9A 2YZSA 1LI5A 1LPEA 1Z23A 3N0TA 5KYYB 4L6RA 4HEAJ 5JRAA 2IXMA 1D0XA 5B3SC 3EJNA 2J7PD 2WZFA 1OCOC 2Y39A 4MW3A 2M4EA 3K33A 2TMVP 4PJLA 2YLDA 1FNTc 2H7BA 4MVSA 3KYIA 5L0HA 2VCAA 3DE9A 5AGFA 4YJWA 3EGDA 2UUHA 1O5HA 1Z3IX 2YQYA 3I5PA 4C3DA 2V3CC 5CI8A 1Y6DA 2NSGA 1LE4A 1ZHTA 1RJ9A 2ZXWC 2CW0F 1VTMP 5BQHA 2ZXOA 3PCVA 4MVOA 3C62A 2OCCC 4GYTA 4Z9IA 3JSZA 1UFBA 1E86A 4MVQA 2OQMA 5JS5A 3K1HA 3KL4A 1C02A 3SZRA 1O3UA 3V5ZA 4AL1A 5L0CA 2H8AA 3TOLA 3EZIA 2LQGA 4AE4A 3U2MA 3VRCA 4JCZA 3EFOB 1JPJA 4YT8A 4JZAA 2I8BA 4MVRA 5KYUA 1QLEC 3MYFA 2NSFA 5AC4A 5L0IA 3EH1A 3G4XA 1IW7F 1Q0GA 1TFOB 2YHSA 3K6BA 2VCCA 3RIPA 1XWJA 3AGTA 3RYLA 4OIQF 2NUTB 1SF8A 3NDBB 3N24A 1ZHYA 1JRAA 3RQFA 5K0IA 3NYLA 5F5HA 2NPUA 3L1MA 1LM3B 3M79A 2EIJC 4JC7A 4YL0A 1JR8A 1WGWA 2MYSA 4XEFA 1F1MA 2CGEA 5DS4A 1V4AA 1T6IA 3V5XA 2F22A 3AOUA 4LLEA 4B6IA 1A7EA 4DRJB 1E85A 1ORJA 1OXKA 2Q00A 2PF4E 3E9VA 3VF0A 1BR4A 2XL6A 4IB4A 5A6BD 4J30B 2P6VA 3EPVA 4IJJA 4W8KA 2LSEA 2J7PA 3QW1A 2ZD9A 2IOQA 1Z7Qc 3U2LA 2FGYA 2Q3TA 2QE9A 1YA7O 2R02A 4P6IC 4Q7CA 2R05A 3T4RA 4HFKB 4KNWA 1A7VA 4U5FE 2LFFA 2J0XA 3VAYA 3ZTZA 4NC3A 1FFTC 2C04A 4G7OF 4PFPA 5A6KA 3SP1A 4DVZA 3S27A 1O87A 4XEKA 1T6UA 3PMRA 2R7XA 1NBBA 2XLWA 4CIHA 3EHMA 1JPNA 4YT4A 2D5RB 4EWCA 4OIRF 3ZTMA 5L3QA 4NTFA 4ULVA 3S90A 3OA1A 2GAQA 2IM8A 3U0CA 3AG4C 5DVWA 1YZCA 2LIGA 1Z5ZA 1Z6AA 4JCHA 1I4YA 4K1OA 4CSAC 3ECSA 3LNRA 2NG1A 1AUEA 5BQGA 3A9CA 2MWQA 2R7RA 4JW1A 2HJMA 3EG9B 1RKEB 3LUTB 2VCBA 4C3BA 3S29A 1AEPA 1B68A 3CSKA 3L8JA 2EINC 4CDVA 5D92A 1QVXA 2WB7A 3N2ZB 1H7IA 3TK0A 4E17A 4E0IA 3CQZA 1YVIA 4W8PA 3GORA 1D1AA 4JTDB 4XQ1A 4PJNA 1TR2A 1ZYRF 3LAYA 3LS0A 4NCQA 3TD7A 1GS9A 3JRMO 3OEOA 4LDKA 5KYXB 5CIVA 2P1AA 3U3FA 4LDRA 1Q0MA 4JTAB 3H2VA 4OD4A 4WABA 1E83A 3M4BA 3ZVRA 4P9FA 3RQGA 2L6HA 2XLHA 2QTVA 4CDYA 3JYYA 1PCXA 4E7SA 1YARO 2KSFA 3EGDB 4XTKA 5A6BA 5KYWA 4QI2A 3AG3C 3CEXA 3K1IA 1R4TA 4PJJA 4DOZA 2NUPA 1RJ9B 3FAJA 3GM1A 3HTKC 1FMVA 2Q9CA 2HZ8A 5HSWA 3R2PA 1OR3A 2IYLD 1YYXA 2RD9A 2YL1A 3B71A 3IPMO 1G4WR 1NLXA 4MS2A 5DQZA 1QZXA 2YLIA 1NZEA 2X51A 3ABKC 4DRHB 4EHPA 5AC5A 1H9TA 2JX0A 4C7OB 4G7HF 2WVNA 2GDCA 2KNHA 5DS5A 2A69F 2W4MA 1WASA 3GWLA 3KKBA 4MTGA 3SXYA 1G4US 4CS8C 1PV3A 1ST6A 5BQIA 2L7AA 5BUOA 4YT5A 2Q7RA 3TQOA 3ZQYA 5KYUB 2HMQA
chains in the Genus database with same CATH topology
3UNGC 3MX3A 2CNWD 1LVKA 3RH3A 5CI9A 3T6BA 2Y3DA 3FHDA 3B0UX 4DBRA 4WJ0A 4YWQA 3ZSUA 3AQCA 3F47A 4KI2A 3B9QA 5B1BC 2J0WA 1MMGA 2XXAB 2EIKC 2A6EF 1NU9C 4FESA 3UR3C 2B0JA 4JJFA 4JVSA 3K1IC 3DAGA 1V55C 5E33A 2KGOA 3V7OA 2DYRC 2ZXRA 1MMNA 4HE8D 3F46A 2IXPA 4HFFB 2ZPAA 1IZMA 1SMYF 4BJ6C 5DS6A 2Q9AA 3L0IA 4CSAA 1VMAA 3HLZA 1PD0A 3LJBA 5IY5C 5D91A 1FFHA 3JT1A 3ABLC 4U5CE 4CS9A 2R7VA 4AK9A 2CDQA 4O7GA 2G3VA 3POVA 1J8YF 2KJGA 3O6XA 5KYYA 3OWTA 1OCZC 4XWJA 2WVOA 1VYKA 1ZHXA 2A68F 3KMIA 3EHNA 4FWVA 3UMHA 4Q4ZF 1OCCC 4LLCA 1M57C 4ZLDA 3UMIA 4EBBA 2CNWA 1W2WA 1TWCA 1M2VB 3VYWA 5B1AC 2R7OA 4IRUA 1ZU5A 2O9XA 4U5GA 4BEJA 2IXOA 2WZGA 1NU7D 1ZHZA 2Y3HA 2W4BA 2G3KA 4GEHA 3QZCA 3T6JA 4IWBA 3JYHA 4NY3A 4PFOA 5KYWB 3W2WA 3EFOA 2JD3A 3DJUB 4C3EA 2NUPB 3ASOC 1FMWA 4CS9C 4CS8A 4U5EE 4I3MA 4BJ5A 2VH3A 2NUTA 3GANA 3S0XA 3EQLF 5T3WA 2HV7A 1VOMA 4U5DE 1TWGA 5T3TA 4I1OB 4PK4A 4RDAA 3SEOA 1ZU4A 2VASA 5DLJA 3K7DA 2C03A 1M2OA 2VB6A 5DQTA 5EGYA 4FX5A 2J45A 4LACB 3RFYA 3Q7LA 4KBLA 3K66A 3NRHA 1VK5A 3I5QA 1KU2A 4DBQA 3NKEA 4BJ6A 1M56C 3EGXA 2KW3C 3NYMA 1FTSA 3DM9B 1D1BA 4AE4B 2XL4A 4BJ5C 3B0VC 5L3VA 3ZC4A 2R7QA 3LLKA 2EILC 3E70C 2R7WA 2J9WA 3GODA 3QMKA 1OCRC 4U5BE 4LERA 2PFDA 2J9UA 3WG7C 4CS7A 2FFHA 3SNHA 2YEVA 4JURI 4BJTA 3NG1A 3Q7GA 2HV6A 5KYXA 3DJNB 4CBEA 1VYIA 3SYNA 4YN0B 4OIPF 3NKDA 2Y3BA 4G0HA 2H7VC 5KYNA 4H4KC 4DVYP 3DD7A 3DAFA 2KQ9A 1MNEA 4IAOA 3DZAA 5FCLA 3EH2A 2ZXPA 3WODF 1OKKD 2WL8A 3DXJF 5E3AA 5F5FA 3DMDA 4K7BA 4C7OA 2A6HF 4K0DA 3W8HA 1BR2A 2PP4A 4ULWA 3S28A 4RBNA 2L9JA 4ZLCA 3AQBA 2J46A 3CZ6A 4MNDA 4BG0A 3RKOF 4I44A 3MLGA 3EZHA 4PJMA 1TKNA 3H65A 1G8XA 1LS1A 4YT2A 3Q6NA 2R7UA 1MMDA 2PX0A 4ANJA 2P7VA 3FDQA 3HJCA 2DYSC 3KH2A 4JJGA 4QI0A 2E87A 5E2QA 2J9VA 2IXNA 2XRHA 4J32B 3LEVA 4I1MA 1J8MF 1D0ZA 4KC9A 3AG2C 2R7TA 3M1CB 1SZIA 2Y69C 4OIOF 4U5HA 4OINF 1Z63A 3JCUQ 5E3CA 3X1OA 2W9YA 2DGJA 2WZLA 3W8IA 3Q6MA 3DM5A 1D1CA 3UGOA 1OKKA 4XLNF 3EGXB 2H7OA 3AG1C 4G7ZF 5T1DB 2A1DD 3JRTA 2W45A 3PHF2 2QY9A 2BE5F 3W2VA 2Z15A 4M63A 3L34A 4Q5SF 1PD1A 2V26A 4OD5A 2Y3GA 1TWAA 3UMKA 1MMAA 2Q9BA 1M2VA 3IEEA 2G62A 4XLPF 4MQ9F 2OG2A 4X0RA 4RD9A 1V54C 3O39A 3NYJA 3LS1A 2XSEA 4O6YA 4QDLA 1LKXA 1MNDA 4O79A 3ZIBA 3I4UA 3LESA 1ZHWA 2WVQA 5EHHA 1S7ZA 2GFHA 3FVYA 4AX2A 2PX3A 4F4BA 2L81A 3ABMC 3EG9A 4E7ZA 3LLIA 1D0YA 4O6MA 1TWHA 3B0PA 1BR1A 2R7SA 1NG1A 2EIMC 1N1CA 3ITFA 4A2NB 3UGPA 4BJ1A 4N06A 3X2QC 3ZG1A 4KNVA 4O6NA 5KYYB 3ASNC 3N0TA 2YZSA 1Z23A 4HEAJ 2IXMA 1D0XA 5B3SC 3EJNA 2J7PD 2WZFA 1OCOC 2Y39A 2M4EA 3K33A 4PJLA 2H7BA 4YJWA 3EGDA 1O5HA 1Z3IX 3I5PA 4C3DA 2V3CC 5CI8A 1ZHTA 1RJ9A 2ZXWC 2CW0F 2ZXOA 2OCCC 4GYTA 3JSZA 3K1HA 3KL4A 3SZRA 3EZIA 4AE4A 3EFOB 1JPJA 4YT8A 4JZAA 2I8BA 5KYUA 1QLEC 3EH1A 1IW7F 2YHSA 3K6BA 3RIPA 3RYLA 2NUTB 1SF8A 3NDBB 3N24A 1ZHYA 3NYLA 5F5HA 2EIJC 4OIQF 2XXAA 1WGWA 2MYSA 2CGEA 5DS4A 4LLEA 4B6IA 2PF4E 3E9VA 1BR4A 4J30B 2P6VA 3EPVA 4IJJA 4W8KA 2LSEA 2J7PA 2IOQA 2FGYA 2Q3TA 4P6IC 4Q7CA 3T4RA 3VAYA 4HFKB 4KNWA 4U5FE 2J0XA 1FFTC 2C04A 4G7OF 4PFPA 3SP1A 4DVZA 3S27A 1O87A 3PMRA 2R7XA 4CIHA 3EHMA 1JPNA 4YT4A 2D5RB 4EWCA 4OIRF 5L3QA 3OA1A 3AG4C 5DVWA 1Z5ZA 1Z6AA 4JCHA 4CSAC 3ECSA 3LNRA 2NG1A 2MWQA 2R7RA 4JW1A 3EG9B 4C3BA 3S29A 3CSKA 2EINC 5D92A 2WB7A 3N2ZB 3CQZA 1D1AA 4PJNA 1TR2A 1ZYRF 3LAYA 3LS0A 3TD7A 3OEOA 5KYXB 4OD4A 3ZVRA 2QTVA 5KYWA 1PCXA 4E7SA 4QI2A 3EGDB 4XTKA 3AG3C 4PJJA 4DOZA 2NUPA 1RJ9B 3FAJA 3HTKC 1FMVA 2Q9CA 5HSWA 2IYLD 5DQZA 1QZXA 1NZEA 2X51A 3ABKC 4C7OB 4G7HF 2WVNA 2KNHA 5DS5A 2A69F 2W4MA 3KKBA 4CS8C 1ST6A 5BUOA 4YT5A 5KYUB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LS1 A;  2MWQ A;  3ZSU A;  3RFY A;  3LS0 A;  1VYK A;  3JCU Q;  1NZE A; 
#chains in the Genus database with same CATH topology
 1DOW A;  3MX3 A;  3UNG C;  1VLS A;  3S9O A;  3POV A;  5TJ5 E;  2CNW D;  1U6H A;  1XZQ A;  1LVK A;  3RH3 A;  5CI9 A;  3T6B A;  2Y3D A;  1U0B B;  3FHD A;  3B0U X;  1QSP A;  1T01 A;  4DBR A;  4WJ0 A;  4YWQ A;  3ZSU A;  2XLD A;  1H6G A;  3AQC A;  3F47 A;  4EBJ A;  5JUA A;  4KI2 A;  1VB5 A;  3B9Q A;  2R25 A;  5B1B C;  2J0W A;  1MMG A;  3FOP A;  3ZDL A;  2CYD A;  2XXA B;  2EIK C;  2DB4 A;  2A6E F;  1NU9 C;  1T6Q A;  2XL8 A;  4FES A;  3UR3 C;  1ZVZ A;  2PBE A;  2B0J A;  4JJF A;  4JVS A;  1FR0 A;  3K1I C;  1E84 A;  2R03 A;  2P61 A;  2L6G A;  1M6T A;  3DAG A;  1V55 C;  5E33 A;  3TOM A;  2KGO A;  1RXQ A;  3V7O A;  3GM3 A;  2DYR C;  3G4Z A;  2ZXR A;  3VM6 A;  1MMN A;  4HE8 D;  2YL3 A;  1FAP B;  3F46 A;  5L0D A;  2AWY A;  2L6F A;  2IXP A;  4HFF B;  3FXH A;  2ZPA A;  1APC A;  1IZM A;  1SMY F;  1GGQ A;  4BJ6 C;  4D4X A;  1NFN A;  2Q9A A;  3L0I A;  1VMA A;  2OJQ A;  5DS6 A;  3LEO A;  4CSA A;  2XM4 A;  3HLZ A;  1PD0 A;  1QPU A;  2EPL X;  2XLM A;  4PR9 A;  3LJB A;  5IY5 C;  5D91 A;  2XS8 A;  1FFH A;  2YRF A;  2LFD A;  3ABL C;  3JT1 A;  1K40 A;  4U5C E;  2B0H A;  3B29 A;  2A0B A;  3U8V A;  4CS9 A;  3U8P A;  2HJ3 A;  2HS5 A;  4IAQ A;  4AK9 A;  2CDQ A;  2HMZ A;  4O7G A;  2XS1 A;  2R7V A;  2G3V A;  2KYH A;  1J8Y F;  2KJG A;  1RCP A;  1OW8 A;  3MFN A;  2QLA A;  3O6X A;  4JEB A;  5JVE A;  5KYY A;  2XXA A;  3OWT A;  1OCZ C;  4XWJ A;  5F28 E;  2WVO A;  1VYK A;  1ZHX A;  2A68 F;  3KMI A;  3EHN A;  4FWV A;  3UMH A;  2EPK X;  4Q4Z F;  1JMW A;  3US6 A;  1OCC C;  4WGZ A;  3RW0 A;  3TUL A;  1YDI A;  4LLC A;  5COG A;  4ER9 A;  1M57 C;  4ZLD A;  3UMI A;  4EBB A;  2CNW A;  1W2W A;  2ETS A;  1M2V B;  1TWC A;  4MTO A;  4EKW A;  3VYW A;  5B1A C;  2R7O A;  4IRU A;  4U9E A;  1R5I D;  1ZU5 A;  2O9X A;  4XPY A;  5JP7 A;  3C8G B;  4U5G A;  4BEJ A;  3DE8 A;  4CX9 A;  2ICW G;  2IXO A;  2WZG A;  3BRJ A;  1H9G A;  1NU7 D;  256B A;  2J9B A;  3QVZ A;  2LK4 A;  5GPG B;  1ZHZ A;  2EPO A;  2Y3H A;  2Q4F A;  4JE9 A;  2W4B A;  3C63 A;  2G3K A;  4GEH A;  2OJE D;  3QZC A;  1MQV A;  3T6J A;  3U9J A;  4E0H A;  4IWB A;  3JYH A;  4NY3 A;  4PFO A;  4CIP A;  2LD6 A;  3AJM A;  4H54 A;  2ASR A;  5KYW B;  4XLP F;  3W2W A;  2LP4 A;  3A11 A;  3EFO A;  1U89 A;  2JD3 A;  3DJU B;  1GM5 A;  1QKR A;  4C3E A;  2NUP B;  3ASO C;  1FMW A;  4CS9 C;  4BEM J;  4CS8 A;  5FZT A;  3C8Z A;  4U5E E;  4I3M A;  1NSG B;  4XPW A;  4BJ5 A;  2VH3 A;  2NUT A;  1TFK B;  2IBF A;  3GAN A;  3S0X A;  3EQL F;  4XEV A;  4NTA A;  5T3W A;  2HV7 A;  1VOM A;  1DOV A;  3LNM B;  4U5D E;  1CGM E;  1TWG A;  2KC3 A;  1HW1 A;  3H2U A;  4I1O B;  5T3T A;  2I15 A;  3QVY A;  4A4A A;  3IQC A;  4PK4 A;  4RDA A;  3SEO A;  4EBK A;  4JTC B;  1ZU4 A;  3R7C A;  2BC5 A;  3C18 A;  3QW0 A;  1OXB A;  2VAS A;  5DLJ A;  2XM0 A;  3K7D A;  2EPN A;  2C03 A;  1M2O A;  2VB6 A;  1A7D A;  4LDQ A;  5DQT A;  5EGY A;  4FX5 A;  1AVO B;  2J45 A;  1WOL A;  1L7C A;  2P0N A;  4LAC B;  2OEX A;  1TQG A;  2YL7 A;  1A0B A;  3RFY A;  3Q7L A;  1G5Z A;  4KBL A;  3K66 A;  3NRH A;  3U9M A;  4MVZ A;  3WAQ A;  1VK5 A;  2LCH A;  1BDJ B;  2A0U A;  4JRZ A;  3I5Q A;  4DRI B;  1KU2 A;  4DBQ A;  4YK5 A;  5A6A A;  3NKE A;  3O55 A;  1BBH A;  4BJ6 A;  1M56 C;  2AWC A;  2KW3 C;  3EGX A;  3NYM A;  1FTS A;  3DM9 B;  1D1B A;  4AE4 B;  5JSL A;  1KNY A;  2XL4 A;  4ONS A;  3U3B A;  3JSE O;  4BJ5 C;  3HNK A;  5L3V A;  3B0V C;  1RKC A;  3ZC4 A;  1YAU O;  2QNL A;  2R7Q A;  3LLK A;  3RVY A;  3FOO A;  4N6C A;  1ZZP A;  2EIL C;  1L3P A;  2XLV A;  3E70 C;  1RKE A;  2AVK A;  2GWW A;  2J9W A;  3GOD A;  2R7W A;  3QMK A;  1OCR C;  3GWN A;  4PAC A;  5A6J A;  4U5B E;  4LER A;  1T9K A;  1K05 A;  2PFD A;  2J9U A;  3RVZ A;  3WG7 C;  1Q0D A;  4CS7 A;  2FFH A;  3KYJ A;  3SNH A;  2YEV A;  3KPH A;  4JUR I;  3V5Y A;  2M64 A;  2OEV A;  3RQE A;  1YYJ A;  1S05 A;  4BJT A;  3NG1 A;  4GQH A;  3Q7G A;  2HV6 A;  5KYX A;  3NMJ A;  3DJN B;  4CBE A;  1VYI A;  2QUP A;  4JIO A;  4N4W A;  3SYN A;  4IAR A;  4YN0 B;  1OW6 A;  3T6G B;  4OIP F;  1EA8 A;  3MBG A;  2Y3B A;  3NKD A;  4G0H A;  2YL0 A;  1OQC A;  2H7V C;  1I4Z A;  5KYN A;  4H4K C;  2YWA A;  4DVY P;  3DD7 A;  3QTH A;  4YL1 A;  3RF3 A;  5JLI A;  3DAF A;  2KQ9 A;  5EK0 A;  2D4U A;  2DI3 A;  1MNE A;  4IAO A;  5COF A;  1OR2 A;  3DZA A;  2FAP B;  3JTL O;  3EH2 A;  4N6H A;  2ZXP A;  5FCL A;  2PNO A;  3WOD F;  2YLG A;  1VLT A;  1OKK D;  2WL8 A;  3DXJ F;  4R32 A;  1SR2 A;  5E3A A;  1JAF A;  3M4C A;  3TJ5 A;  5F5F A;  3DMD A;  3DWW A;  4K7B A;  3GEI A;  4Z9J A;  4EUK B;  4C7O A;  3GEH A;  2A6H F;  1I5N A;  2RSE B;  2UUI A;  1BR2 A;  2PP4 A;  2HUJ A;  4K0D A;  4ULW A;  3S28 A;  4RBN A;  2L9J A;  2XLO A;  2MHR A;  4CDA A;  4ZLC A;  5JT4 A;  1UG7 A;  2AU5 A;  3AQB A;  1WAT A;  2J46 A;  3CZ6 A;  4MND A;  1LE2 A;  4BG0 A;  4FAP B;  2X0C A;  3RKO F;  4D4N A;  1RMV A;  4I44 A;  3JZ0 A;  3MLG A;  3EZH A;  2XLE A;  3MYI A;  4JEA A;  3HNI A;  4PJM A;  2YKZ A;  4Z9H A;  3W8H A;  1TKN A;  3IQ5 A;  3H65 A;  4UDV A;  2OKU A;  1G8X A;  1LS1 A;  4YT2 A;  3Q6N A;  2R7U A;  1MMD A;  2PX0 A;  3C8G D;  4ANJ A;  1EQ1 A;  1HMD A;  2P7V A;  5B3I A;  3HJC A;  3FDQ A;  2DYS C;  3KH2 A;  4JJG A;  3U5S A;  3L8I A;  4QI0 A;  4BPM A;  2E87 A;  5L0J A;  3ATP A;  4MVM A;  5E2Q A;  2J9V A;  1EKY A;  2IXN A;  2XRH A;  4J32 B;  1A41 A;  3IQ6 A;  3LEV A;  4I1M A;  1YA9 A;  2HFI A;  1J8M F;  1D0Z A;  2JPU A;  4KC9 A;  3AG2 C;  4AL0 A;  2R7T A;  1HY5 A;  3BEH A;  3M1C B;  1SZI A;  1Y4C A;  2Y69 C;  4IGG A;  4OIO F;  1HE1 A;  4U5H A;  4OIN F;  2GA0 A;  1Z63 A;  1EI7 A;  3ZQV A;  1HMO A;  4J7T A;  1Q0F A;  2HSB A;  3CAX A;  3JCU Q;  3PDM P;  5E3C A;  3SXM A;  3X1O A;  1WN0 A;  2W9Y A;  2DGJ A;  2WZL A;  4WGY A;  1ORY A;  1CGN A;  3W8I A;  4EIY A;  1QQ3 A;  3Q6M A;  1YZA A;  3FMS A;  1E2X A;  3DM5 A;  4J7Y A;  1D1C A;  3UGO A;  4JKV A;  1OKK A;  3NMK A;  3EGX B;  2H7O A;  3AG1 C;  4XLN F;  1WWP A;  3S84 A;  5T1D B;  1SYQ A;  1WTY A;  4G7Z F;  2A1D D;  3O10 A;  1LI7 A;  1C17 M;  3JRT A;  1ZW3 A;  4MW8 A;  3G50 A;  3NMI A;  1CPQ A;  2W45 A;  1NFO A;  2OOC A;  2QY9 A;  4XPX A;  3T9O A;  1CPR A;  2BE5 F;  3GM2 A;  4E18 A;  3W2V A;  3PHF 2;  1HW2 A;  2Z15 A;  3AGU A;  4M63 A;  1Q0K A;  2HSQ A;  2HKV A;  1YJG A;  3L34 A;  4Q5S F;  1PD1 A;  2V26 A;  4OD5 A;  2Y3G A;  3IHU A;  1ORS C;  1TWA A;  1CGO A;  3UMK A;  1MMA A;  2Q9B A;  5L0G A;  1BZ4 A;  1M2V A;  2G62 A;  3IEE A;  3SXK A;  4MQ9 F;  2OG2 A;  1YLM A;  4RD9 A;  1V54 C;  3O39 A;  4X0R A;  4MVU A;  1V74 B;  3WHN A;  3C8G A;  3NYJ A;  3W4Y A;  3LS1 A;  1OW7 A;  1XZP A;  2XSE A;  3IQT A;  1LIH A;  4O6Y A;  4QDL A;  1LKX A;  1MND A;  4YL3 A;  4O79 A;  3ZIB A;  1ZW2 A;  3HNL A;  2R9R B;  3I4U A;  3LES A;  1GQA A;  1JOG A;  1ZHW A;  2WVQ A;  4G78 A;  4NTB A;  5EHH A;  1LS4 A;  2CCY A;  4NQF A;  4MTF A;  5HV9 A;  4DJ9 A;  5COM A;  1S7Z A;  3SXZ A;  5A69 A;  3J06 A;  2GFH A;  4DXW A;  3FVY A;  4AX2 A;  2PX3 A;  4F4B A;  3ZWI A;  4CJG A;  3GEE A;  2L81 A;  2BL2 A;  3ABM C;  2J8W A;  4P9T A;  2EPM X;  3EG9 A;  3TJ6 A;  4E7Z A;  2VC9 A;  3LLI A;  1K04 A;  5L0F A;  1D0Y A;  4O6M A;  1TWH A;  1T5O A;  3B0P A;  2KK1 A;  3M15 A;  1BR1 A;  3DKA A;  1KTM A;  2R7S A;  2YVK A;  1NG1 A;  2EIM C;  3DI5 A;  1N1C A;  2AP3 A;  3ITF A;  4U9D A;  4A2N B;  4CJO A;  3UGP A;  4BJ1 A;  4N06 A;  3X2Q C;  3ZG1 A;  2OU6 A;  4KNV A;  1C03 A;  3HKK A;  3C7J A;  4O6N A;  3FAP B;  3HNJ A;  3ASN C;  1HE9 A;  2YZS A;  1LI5 A;  1LPE A;  1Z23 A;  3N0T A;  5KYY B;  4L6R A;  4HEA J;  5JRA A;  2IXM A;  1D0X A;  5B3S C;  3EJN A;  2J7P D;  2WZF A;  1OCO C;  2Y39 A;  4MW3 A;  2M4E A;  3K33 A;  2TMV P;  4PJL A;  2YLD A;  1FNT c;  2H7B A;  4MVS A;  3KYI A;  5L0H A;  2VCA A;  3DE9 A;  5AGF A;  4YJW A;  3EGD A;  2UUH A;  1O5H A;  1Z3I X;  2YQY A;  3I5P A;  4C3D A;  2V3C C;  5CI8 A;  1Y6D A;  2NSG A;  1LE4 A;  1ZHT A;  1RJ9 A;  2ZXW C;  2CW0 F;  1VTM P;  5BQH A;  2ZXO A;  3PCV A;  4MVO A;  3C62 A;  2OCC C;  4GYT A;  4Z9I A;  3JSZ A;  1UFB A;  1E86 A;  4MVQ A;  2OQM A;  5JS5 A;  3K1H A;  3KL4 A;  1C02 A;  3SZR A;  1O3U A;  3V5Z A;  4AL1 A;  5L0C A;  2H8A A;  3TOL A;  3EZI A;  2LQG A;  4AE4 A;  3U2M A;  3VRC A;  4JCZ A;  3EFO B;  1JPJ A;  4YT8 A;  4JZA A;  2I8B A;  4MVR A;  5KYU A;  1QLE C;  3MYF A;  2NSF A;  5AC4 A;  5L0I A;  3EH1 A;  3G4X A;  1IW7 F;  1Q0G A;  1TFO B;  2YHS A;  3K6B A;  2VCC A;  3RIP A;  1XWJ A;  3AGT A;  3RYL A;  4OIQ F;  2NUT B;  1SF8 A;  3NDB B;  3N24 A;  1ZHY A;  1JRA A;  3RQF A;  5K0I A;  3NYL A;  5F5H A;  2NPU A;  3L1M A;  1LM3 B;  3M79 A;  2EIJ C;  4JC7 A;  4YL0 A;  1JR8 A;  1WGW A;  2MYS A;  4XEF A;  1F1M A;  2CGE A;  5DS4 A;  1V4A A;  1T6I A;  3V5X A;  2F22 A;  3AOU A;  4LLE A;  4B6I A;  1A7E A;  4DRJ B;  1E85 A;  1ORJ A;  1OXK A;  2Q00 A;  2PF4 E;  3E9V A;  3VF0 A;  1BR4 A;  2XL6 A;  4IB4 A;  5A6B D;  4J30 B;  2P6V A;  3EPV A;  4IJJ A;  4W8K A;  2LSE A;  2J7P A;  3QW1 A;  2ZD9 A;  2IOQ A;  1Z7Q c;  3U2L A;  2FGY A;  2Q3T A;  2QE9 A;  1YA7 O;  2R02 A;  4P6I C;  4Q7C A;  2R05 A;  3T4R A;  4HFK B;  4KNW A;  1A7V A;  4U5F E;  2LFF A;  2J0X A;  3VAY A;  3ZTZ A;  4NC3 A;  1FFT C;  2C04 A;  4G7O F;  4PFP A;  5A6K A;  3SP1 A;  4DVZ A;  3S27 A;  1O87 A;  4XEK A;  1T6U A;  3PMR A;  2R7X A;  1NBB A;  2XLW A;  4CIH A;  3EHM A;  1JPN A;  4YT4 A;  2D5R B;  4EWC A;  4OIR F;  3ZTM A;  5L3Q A;  4NTF A;  4ULV A;  3S90 A;  3OA1 A;  2GAQ A;  2IM8 A;  3U0C A;  3AG4 C;  5DVW A;  1YZC A;  2LIG A;  1Z5Z A;  1Z6A A;  4JCH A;  1I4Y A;  4K1O A;  4CSA C;  3ECS A;  3LNR A;  2NG1 A;  1AUE A;  5BQG A;  3A9C A;  2MWQ A;  2R7R A;  4JW1 A;  2HJM A;  3EG9 B;  1RKE B;  3LUT B;  2VCB A;  4C3B A;  3S29 A;  1AEP A;  1B68 A;  3CSK A;  3L8J A;  2EIN C;  4CDV A;  5D92 A;  1QVX A;  2WB7 A;  3N2Z B;  1H7I A;  3TK0 A;  4E17 A;  4E0I A;  3CQZ A;  1YVI A;  4W8P A;  3GOR A;  1D1A A;  4JTD B;  4XQ1 A;  4PJN A;  1TR2 A;  1ZYR F;  3LAY A;  3LS0 A;  4NCQ A;  3TD7 A;  1GS9 A;  3JRM O;  3OEO A;  4LDK A;  5KYX B;  5CIV A;  2P1A A;  3U3F A;  4LDR A;  1Q0M A;  4JTA B;  3H2V A;  4OD4 A;  4WAB A;  1E83 A;  3M4B A;  3ZVR A;  4P9F A;  3RQG A;  2L6H A;  2XLH A;  2QTV A;  4CDY A;  3JYY A;  1PCX A;  4E7S A;  1YAR O;  2KSF A;  3EGD B;  4XTK A;  5A6B A;  5KYW A;  4QI2 A;  3AG3 C;  3CEX A;  3K1I A;  1R4T A;  4PJJ A;  4DOZ A;  2NUP A;  1RJ9 B;  3FAJ A;  3GM1 A;  3HTK C;  1FMV A;  2Q9C A;  2HZ8 A;  5HSW A;  3R2P A;  1OR3 A;  2IYL D;  1YYX A;  2RD9 A;  2YL1 A;  3B71 A;  3IPM O;  1G4W R;  1NLX A;  4MS2 A;  5DQZ A;  1QZX A;  2YLI A;  1NZE A;  2X51 A;  3ABK C;  4DRH B;  4EHP A;  5AC5 A;  1H9T A;  2JX0 A;  4C7O B;  4G7H F;  2WVN A;  2GDC A;  2KNH A;  5DS5 A;  2A69 F;  2W4M A;  1WAS A;  3GWL A;  3KKB A;  4MTG A;  3SXY A;  1G4U S;  4CS8 C;  1PV3 A;  1ST6 A;  5BQI A;  2L7A A;  5BUO A;  4YT5 A;  2Q7R A;  3TQO A;  3ZQY A;  5KYU B;  2HMQ A; 
#chains in the Genus database with same CATH homology
 3UNG C;  3MX3 A;  2CNW D;  1LVK A;  3RH3 A;  5CI9 A;  3T6B A;  2Y3D A;  3FHD A;  3B0U X;  4DBR A;  4WJ0 A;  4YWQ A;  3ZSU A;  3AQC A;  3F47 A;  4KI2 A;  3B9Q A;  5B1B C;  2J0W A;  1MMG A;  2XXA B;  2EIK C;  2A6E F;  1NU9 C;  4FES A;  3UR3 C;  2B0J A;  4JJF A;  4JVS A;  3K1I C;  3DAG A;  1V55 C;  5E33 A;  2KGO A;  3V7O A;  2DYR C;  2ZXR A;  1MMN A;  4HE8 D;  3F46 A;  2IXP A;  4HFF B;  2ZPA A;  1IZM A;  1SMY F;  4BJ6 C;  5DS6 A;  2Q9A A;  3L0I A;  4CSA A;  1VMA A;  3HLZ A;  1PD0 A;  3LJB A;  5IY5 C;  5D91 A;  1FFH A;  3JT1 A;  3ABL C;  4U5C E;  4CS9 A;  2R7V A;  4AK9 A;  2CDQ A;  4O7G A;  2G3V A;  3POV A;  1J8Y F;  2KJG A;  3O6X A;  5KYY A;  3OWT A;  1OCZ C;  4XWJ A;  2WVO A;  1VYK A;  1ZHX A;  2A68 F;  3KMI A;  3EHN A;  4FWV A;  3UMH A;  4Q4Z F;  1OCC C;  4LLC A;  1M57 C;  4ZLD A;  3UMI A;  4EBB A;  2CNW A;  1W2W A;  1TWC A;  1M2V B;  3VYW A;  5B1A C;  2R7O A;  4IRU A;  1ZU5 A;  2O9X A;  4U5G A;  4BEJ A;  2IXO A;  2WZG A;  1NU7 D;  1ZHZ A;  2Y3H A;  2W4B A;  2G3K A;  4GEH A;  3QZC A;  3T6J A;  4IWB A;  3JYH A;  4NY3 A;  4PFO A;  5KYW B;  3W2W A;  3EFO A;  2JD3 A;  3DJU B;  4C3E A;  2NUP B;  3ASO C;  1FMW A;  4CS9 C;  4CS8 A;  4U5E E;  4I3M A;  4BJ5 A;  2VH3 A;  2NUT A;  3GAN A;  3S0X A;  3EQL F;  5T3W A;  2HV7 A;  1VOM A;  4U5D E;  1TWG A;  5T3T A;  4I1O B;  4PK4 A;  4RDA A;  3SEO A;  1ZU4 A;  2VAS A;  5DLJ A;  3K7D A;  2C03 A;  1M2O A;  2VB6 A;  5DQT A;  5EGY A;  4FX5 A;  2J45 A;  4LAC B;  3RFY A;  3Q7L A;  4KBL A;  3K66 A;  3NRH A;  1VK5 A;  3I5Q A;  1KU2 A;  4DBQ A;  3NKE A;  4BJ6 A;  1M56 C;  3EGX A;  2KW3 C;  3NYM A;  1FTS A;  3DM9 B;  1D1B A;  4AE4 B;  2XL4 A;  4BJ5 C;  3B0V C;  5L3V A;  3ZC4 A;  2R7Q A;  3LLK A;  2EIL C;  3E70 C;  2R7W A;  2J9W A;  3GOD A;  3QMK A;  1OCR C;  4U5B E;  4LER A;  2PFD A;  2J9U A;  3WG7 C;  4CS7 A;  2FFH A;  3SNH A;  2YEV A;  4JUR I;  4BJT A;  3NG1 A;  3Q7G A;  2HV6 A;  5KYX A;  3DJN B;  4CBE A;  1VYI A;  3SYN A;  4YN0 B;  4OIP F;  3NKD A;  2Y3B A;  4G0H A;  2H7V C;  5KYN A;  4H4K C;  4DVY P;  3DD7 A;  3DAF A;  2KQ9 A;  1MNE A;  4IAO A;  3DZA A;  5FCL A;  3EH2 A;  2ZXP A;  3WOD F;  1OKK D;  2WL8 A;  3DXJ F;  5E3A A;  5F5F A;  3DMD A;  4K7B A;  4C7O A;  2A6H F;  4K0D A;  3W8H A;  1BR2 A;  2PP4 A;  4ULW A;  3S28 A;  4RBN A;  2L9J A;  4ZLC A;  3AQB A;  2J46 A;  3CZ6 A;  4MND A;  4BG0 A;  3RKO F;  4I44 A;  3MLG A;  3EZH A;  4PJM A;  1TKN A;  3H65 A;  1G8X A;  1LS1 A;  4YT2 A;  3Q6N A;  2R7U A;  1MMD A;  2PX0 A;  4ANJ A;  2P7V A;  3FDQ A;  3HJC A;  2DYS C;  3KH2 A;  4JJG A;  4QI0 A;  2E87 A;  5E2Q A;  2J9V A;  2IXN A;  2XRH A;  4J32 B;  3LEV A;  4I1M A;  1J8M F;  1D0Z A;  4KC9 A;  3AG2 C;  2R7T A;  3M1C B;  1SZI A;  2Y69 C;  4OIO F;  4U5H A;  4OIN F;  1Z63 A;  3JCU Q;  5E3C A;  3X1O A;  2W9Y A;  2DGJ A;  2WZL A;  3W8I A;  3Q6M A;  3DM5 A;  1D1C A;  3UGO A;  1OKK A;  4XLN F;  3EGX B;  2H7O A;  3AG1 C;  4G7Z F;  5T1D B;  2A1D D;  3JRT A;  2W45 A;  3PHF 2;  2QY9 A;  2BE5 F;  3W2V A;  2Z15 A;  4M63 A;  3L34 A;  4Q5S F;  1PD1 A;  2V26 A;  4OD5 A;  2Y3G A;  1TWA A;  3UMK A;  1MMA A;  2Q9B A;  1M2V A;  3IEE A;  2G62 A;  4XLP F;  4MQ9 F;  2OG2 A;  4X0R A;  4RD9 A;  1V54 C;  3O39 A;  3NYJ A;  3LS1 A;  2XSE A;  4O6Y A;  4QDL A;  1LKX A;  1MND A;  4O79 A;  3ZIB A;  3I4U A;  3LES A;  1ZHW A;  2WVQ A;  5EHH A;  1S7Z A;  2GFH A;  3FVY A;  4AX2 A;  2PX3 A;  4F4B A;  2L81 A;  3ABM C;  3EG9 A;  4E7Z A;  3LLI A;  1D0Y A;  4O6M A;  1TWH A;  3B0P A;  1BR1 A;  2R7S A;  1NG1 A;  2EIM C;  1N1C A;  3ITF A;  4A2N B;  3UGP A;  4BJ1 A;  4N06 A;  3X2Q C;  3ZG1 A;  4KNV A;  4O6N A;  5KYY B;  3ASN C;  3N0T A;  2YZS A;  1Z23 A;  4HEA J;  2IXM A;  1D0X A;  5B3S C;  3EJN A;  2J7P D;  2WZF A;  1OCO C;  2Y39 A;  2M4E A;  3K33 A;  4PJL A;  2H7B A;  4YJW A;  3EGD A;  1O5H A;  1Z3I X;  3I5P A;  4C3D A;  2V3C C;  5CI8 A;  1ZHT A;  1RJ9 A;  2ZXW C;  2CW0 F;  2ZXO A;  2OCC C;  4GYT A;  3JSZ A;  3K1H A;  3KL4 A;  3SZR A;  3EZI A;  4AE4 A;  3EFO B;  1JPJ A;  4YT8 A;  4JZA A;  2I8B A;  5KYU A;  1QLE C;  3EH1 A;  1IW7 F;  2YHS A;  3K6B A;  3RIP A;  3RYL A;  2NUT B;  1SF8 A;  3NDB B;  3N24 A;  1ZHY A;  3NYL A;  5F5H A;  2EIJ C;  4OIQ F;  2XXA A;  1WGW A;  2MYS A;  2CGE A;  5DS4 A;  4LLE A;  4B6I A;  2PF4 E;  3E9V A;  1BR4 A;  4J30 B;  2P6V A;  3EPV A;  4IJJ A;  4W8K A;  2LSE A;  2J7P A;  2IOQ A;  2FGY A;  2Q3T A;  4P6I C;  4Q7C A;  3T4R A;  3VAY A;  4HFK B;  4KNW A;  4U5F E;  2J0X A;  1FFT C;  2C04 A;  4G7O F;  4PFP A;  3SP1 A;  4DVZ A;  3S27 A;  1O87 A;  3PMR A;  2R7X A;  4CIH A;  3EHM A;  1JPN A;  4YT4 A;  2D5R B;  4EWC A;  4OIR F;  5L3Q A;  3OA1 A;  3AG4 C;  5DVW A;  1Z5Z A;  1Z6A A;  4JCH A;  4CSA C;  3ECS A;  3LNR A;  2NG1 A;  2MWQ A;  2R7R A;  4JW1 A;  3EG9 B;  4C3B A;  3S29 A;  3CSK A;  2EIN C;  5D92 A;  2WB7 A;  3N2Z B;  3CQZ A;  1D1A A;  4PJN A;  1TR2 A;  1ZYR F;  3LAY A;  3LS0 A;  3TD7 A;  3OEO A;  5KYX B;  4OD4 A;  3ZVR A;  2QTV A;  5KYW A;  1PCX A;  4E7S A;  4QI2 A;  3EGD B;  4XTK A;  3AG3 C;  4PJJ A;  4DOZ A;  2NUP A;  1RJ9 B;  3FAJ A;  3HTK C;  1FMV A;  2Q9C A;  5HSW A;  2IYL D;  5DQZ A;  1QZX A;  1NZE A;  2X51 A;  3ABK C;  4C7O B;  4G7H F;  2WVN A;  2KNH A;  5DS5 A;  2A69 F;  2W4M A;  3KKB A;  4CS8 C;  1ST6 A;  5BUO A;  4YT5 A;  5KYU B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...