3JCUQ

Cryo-em structure of spinach psii-lhcii supercomplex at 3.2 angstrom resolution
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
148
structure length
148
Chain Sequence
EARPIVVGPPPPLSGGLPGTENSDQARDGTLPYTKDRFYLQPLPPTEAAQRAKVSASEILNVKQFIDRKAWPSLQNDLRLRASYLRYDLKTVISAKPKDEKKSLQELTSKLFSSIDNLDHAAKIKSPTEAEKYYGQTVSNINEVLAKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem II protein D1
publication title Structure of spinach photosystem II-LHCII supercomplex at 3.2 A resolution
doi rcsb
molecule tags Membrane protein
total genus 40
structure length 148
sequence length 148
chains with identical sequence q
ec nomenclature
pdb deposition date 2016-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF05757 PsbQ Oxygen evolving enhancer protein 3 (PsbQ)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.290 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3jcuQ00
3RFYA 3LS0A 3ZSUA 1NZEA 3LS1A 3JCUQ 1VYKA 2MWQA
chains in the Genus database with same CATH superfamily
4BJTA 4YL1A 4ZLDA 1LE4A 2OKUA 3KMIA 2PX0A 3NYLA 2EPKX 1T9KA 1JRAA 1YA7O 3K7DA 4AX2A 3CZ6A 2Y3BA 1J8YF 4GQHA 3DZAA 2XLHA 2YWAA 5F28E 3LJBA 1RXQA 4X0RA 2UUHA 3HKKA 4YK5A 1KU2A 2O9XA 2LK4A 3HTKC 3W2VA 4I3MA 3GM2A 2NSGA 1BZ4A 1T6QA 1Q0DA 3F46A 3NMKA 2XM0A 1KNYA 1A7DA 1VLTA 1FNTc 1B68A 2R7UA 5FZTA 2LQGA 2YL3A 4HEAJ 4O6YA 3HNJA 1XZQA 4XEVA 1SMYF 4LLEA 1C02A 5F5HA 4QI0A 5DQTA 4Q5SF 3WODF 1TFKB 3G4ZA 1NFOA 3U8PA 3ABKC 2J9UA 4K0DA 4PJMA 4YT4A 3RVYA 3IPMO 1LPEA 3LLIA 4ER9A 4A2NB 4XWJA 3C8GA 2GAQA 3LLKA 3LS1A 4I1OB 5AGFA 3VM6A 1I5NA 2OU6A 3ITFA 2EIJC 1TR2A 3HLZA 2Q3TA 1ZU5A 4E7SA 2PF4E 3O39A 1PD1A 4MTGA 1BR4A 2ZXRA 1JOGA 2XL8A 4U5DE 1RKEA 1SR2A 1MMDA 3Q7LA 2QUPA 2YRFA 4AL1A 1UG7A 2I15A 2OJQA 2XLDA 5DS5A 2R7XA 1NFNA 3HNLA 4DRHB 3B29A 3NKDA 5L0IA 3O10A 2H7VC 2Q9BA 3GORA 1ZHZA 1ORYA 4OIPF 4QI2A 2VASA 3GANA 2PP4A 4LACB 1E84A 5COMA 3X2QC 1H9TA 2YLGA 3RQFA 3TD7A 4PACA 2IXNA 1Q0GA 1LI7A 2YKZA 1LM3B 1TWAA 3DE9A 2Y69C 3K1HA 3KYIA 2L6HA 3QTHA 1TKNA 5L0CA 5EGYA 2Q7RA 3ZTMA 2XLMA 3TQOA 5EHHA 2B0JA 2TMVP 1EKYA 3ASOC 1FMVA 1NSGB 2F22A 2R9RB 4JW1A 3U2LA 1G8XA 1U6HA 2A6EF 3W4YA 5KYWA 1IW7F 3CAXA 2ASRA 2AWYA 3KH2A 3N0TA 3M1CB 3VRCA 1HE1A 2AVKA 4EBKA 2IXMA 5A6JA 4DOZA 2YL1A 2XLEA 2Z15A 3UR3C 3IQ6A 4FAPB 2P6VA 1I4ZA 4AK9A 4BEJA 4OIRF 4HFKB 5T3WA 2UUIA 3O6XA 1M2VB 3RQGA 2R7RA 1G4US 4MQ9F 1RCPA 5IY5C 3EQLF 2NG1A 3PCVA 4YL3A 1TWGA 2GWWA 2EPOA 3HJCA 5KYUA 3EGXA 1S05A 3F47A 4U5HA 2Y3HA 3ZTZA 1BR2A 4U5FE 1QPUA 4CJOA 3S0XA 2Q00A 3EHMA 1S7ZA 2KK1A 3C18A 3J06A 2E87A 1WOLA 4EUKB 1LS4A 1QSPA 2X0CA 4OIOF 2YVKA 1F1MA 1K40A 4MVOA 3U2MA 4RDAA 1D1CA 3DAGA 3I4UA 3PMRA 5AC5A 1DOWA 4PJNA 2CDQA 2A0UA 3GM1A 5D92A 4EKWA 4OIQF 1MMAA 3FOPA 3JSZA 4XPWA 4N6CA 4CDVA 3FAJA 2RD9A 2J7PA 2A6HF 4FESA 2W4BA 5BQIA 2DB4A 1O3UA 3ECSA 1FFTC 2RSEB 4C7OA 3K1IA 2XS8A 2QNLA 3QZCA 2G3VA 4IB4A 1LE2A 1OW8A 3SYNA 1BBHA 2NPUA 2YLIA 5T1DB 5DLJA 1ZZPA 4JKVA 4XPXA 4MNDA 5CI8A 1WWPA 1ORJA 2YEVA 1G4WR 3OEOA 3B9QA 2NUTA 4CS9C 5B3IA 2XLOA 3NG1A 3DWWA 4MW8A 4MTOA 4RBNA 5A6KA 2EIKC 3RW0A 5F5FA 2IXPA 4UDVA 5GPGB 2XM4A 3JYHA 5BQGA 3TOLA 3LS0A 2L9JA 3WG7C 3IQ5A 3EG9A 3Q6MA 4DJ9A 1D0YA 1A7VA 4DBRA 1HW2A 1DOVA 2HUJA 3C8GB 4Q7CA 2XLWA 4JIOA 4NTAA 3H2VA 4H4KC 3MLGA 3HNKA 2XLVA 3MYIA 4YT2A 1XZPA 2YL7A 4PFPA 4O7GA 3KKBA 3T6JA 1LKXA 1OXKA 1Q0FA 4LDRA 3POVA 2A68F 2XSEA 2YHSA 4KC9A 1Z7Qc 5BUOA 1JPJA 4BG0A 1C03A 3ABMC 1JAFA 3SXZA 4JURI 2R7OA 3R7CA 1NU7D 4E0IA 3DJNB 3V5ZA 4NTFA 3V5XA 3FHDA 3AQBA 1T01A 1RJ9B 3ASNC 3S90A 2A1DD 3TK0A 4QDLA 2VC9A 256BA 4IGGA 5BQHA 5A6BA 3NMIA 5JT4A 4J7YA 2GA0A 2Y39A 3EJNA 1VK5A 2IOQA 4E0HA 2J0XA 2IM8A 1JMWA 1TQGA 5DVWA 3KYJA 3WAQA 1QKRA 2R7TA 1VOMA 2LIGA 2KSFA 3M79A 2HMQA 5E2QA 1APCA 3RH3A 3S9OA 5KYWB 2OQMA 3U9MA 5KYYA 2Q9CA 1WASA 2LFDA 2OCCC 1E85A 3T6BA 4R32A 3AG3C 4CS9A 4XEKA 2P1AA 3UGPA 4YWQA 3EGDA 4CBEA 1OQCA 3HNIA 4N4WA 1CPRA 3SXMA 2XXAA 3DM5A 5KYXA 3E70C 2V26A 4G0HA 1WTYA 3A11A 1GGQA 2D5RB 4XQ1A 1M2OA 5COFA 5KYUB 1Q0KA 1RKCA 4NC3A 3EGXB 2HKVA 1Q0MA 5L0JA 3UMKA 4JZAA 3ZSUA 3QVYA 1ZHYA 3IQTA 1N1CA 2H8AA 3AQCA 1GS9A 4DRJB 1MQVA 3AGTA 3C63A 4MVQA 3B0UX 3T4RA 3ZDLA 1V4AA 4CSAC 3LNRA 4W8KA 2AU5A 1YA9A 2LD6A 3CSKA 2OOCA 3DD7A 4B6IA 1OXBA 1VLSA 2IXOA 1QZXA 2NUPA 1RJ9A 2R05A 4GEHA 1O87A 4DBQA 5A6AA 3K1IC 5K0IA 1E83A 2HV6A 4PR9A 3EFOA 2EPLX 3ABLC 1Z5ZA 2R7WA 1OR2A 4I44A 4U5CE 4C3BA 3ATPA 2HJ3A 5JS5A 4C7OB 5B3SC 2WZGA 4U5EE 2VCAA 2D4UA 1VB5A 3DM9B 3RQEA 5L0FA 3TULA 4P6IC 3LEOA 1SZIA 2OEXA 5FCLA 2NUTB 2QY9A 3BRJA 2PBEA 4J32B 3S84A 2JD3A 3B0PA 4N6HA 3G4XA 3ZQVA 2PFDA 5JSLA 2C04A 4MTFA 4XTKA 2ICWG 3U0CA 1R4TA 2CNWA 3EG9B 4LLCA 4DVYP 3Q6NA 2C03A 3Q7GA 1VMAA 2I8BA 3L1MA 2R03A 3AG2C 4MVRA 2HSQA 4IAOA 4F4BA 4WGZA 3ZVRA 2R7VA 4PFOA 1TWHA 2ZD9A 2ZXPA 4H54A 3T9OA 5EK0A 3C8GD 3DE8A 1AEPA 1CGOA 1K04A 4PJLA 4D4XA 3S29A 4G78A 3KPHA 2FAPB 2J0WA 2R7QA 1XWJA 3IQCA 4BEMJ 3SZRA 1HMDA 3DAFA 2P0NA 2W4MA 3DXJF 4G7HF 1AVOB 1CGNA 4CSAA 3EZIA 3L8JA 2H7OA 1U89A 1ZU4A 2AWCA 3AOUA 2KW3C 2WVQA 4JC7A 4HFFB 4JVSA 4BJ1A 2BL2A 3C62A 2WZLA 3NDBB 2YL0A 1L7CA 2KNHA 5A69A 2YLDA 2EINC 4E17A 1FR0A 1PD0A 3MBGA 1ZW3A 1FAPB 1OKKA 1YVIA 2VCBA 2FGYA 2WVOA 3LAYA 4JJGA 2JX0A 4FX5A 3LNMB 4C3DA 3RVZA 3L0IA 3K33A 1C17M 2Y3GA 3EH2A 3VAYA 3W8HA 3WHNA 1YZAA 3ZC4A 5KYYB 3GODA 4AE4A 4BPMA 3NYJA 1MMNA 3EGDB 3DMDA 1NLXA 2Q4FA 1U0BB 1K05A 3US6A 1BR1A 2XL4A 5JP7A 2GFHA 5KYXB 4KI2A 2XXAB 3FAPB 5HSWA 2P61A 3TJ6A 2EILC 4JTAB 3V5YA 2ZPAA 3JCUQ 4CJGA 1VYKA 2JPUA 2NSFA 3CQZA 4EBJA 4EIYA 4I1MA 3S27A 3H2UA 5KYNA 1M57C 5JRAA 1YZCA 1VYIA 3AG1C 4U9EA 1JPNA 2A69F 3RKOF 2X51A 2A0BA 3C8ZA 4MVSA 1T6UA 5E3AA 5JLIA 3B0VC 3JT1A 2M4EA 3QVZA 1D1BA 4PK4A 2CCYA 2ZXOA 3IHUA 4FWVA 1FMWA 3JRMO 3OWTA 4LERA 3TJ5A 2HFIA 3I5PA 5DS4A 3K66A 2HV7A 3S28A 2NUPB 3O55A 4MVMA 2CW0F 4IAQA 4O6NA 4Z9JA 1HE9A 4DVZA 2PX3A 1LS1A 2YZSA 3EFOB 3EPVA 4CX9A 1V54C 4MW3A 4C3EA 4U5GA 1Y6DA 2IBFA 2MWQA 2Q9AA 1YYJA 2L6FA 3FXHA 5T3TA 4CDYA 1NU9C 2J7PD 3M15A 4CS8C 3UMIA 4J7TA 2CGEA 4Z9IA 3LUTB 1OCRC 2DYSC 3TOMA 5DQZA 2XL6A 4OD4A 1H7IA 2VH3A 4GYTA 5E3CA 2OEVA 2ETSA 1E2XA 4CS7A 3GEHA 2G62A 3IEEA 4IRUA 3W2WA 1D1AA 3PHF2 1PV3A 4BJ5C 1ZHTA 4K7BA 1OCZC 3JTLO 2VB6A 1M6TA 3SP1A 1ZHXA 2V3CC 3I5QA 2LSEA 4JEBA 3VF0A 1YYXA 2KQ9A 2R25A 4KNVA 5B1AC 4WGYA 5L0HA 2MHRA 5B1BC 3N24A 1EI7A 4AL0A 2OG2A 3EZHA 4MVZA 5CIVA 4YT5A 3UNGC 3RIPA 2W45A 3E9VA 2J9BA 2IYLD 2HJMA 3AG4C 4HE8D 4D4NA 2YQYA 4ONSA 4G7OF 2CYDA 1OW7A 1HMOA 2KC3A 2HS5A 2LFFA 4J30B 4L6RA 2KGOA 4NY3A 2FFHA 4P9FA 3PDMP 2LP4A 1TFOB 3L8IA 5TJ5E 4JCZA 3LEVA 4IARA 4A4AA 3LESA 3M4BA 3FVYA 3KL4A 3VYWA 3ZWIA 4DRIB 3SXKA 5CI9A 5A6BD 1G5ZA 1R5ID 1WN0A 1TWCA 3GEIA 4Z9HA 3UMHA 4E7ZA 4G7ZF 1IZMA 1LIHA 5E33A 2J9WA 2ZXWC 2WL8A 2BC5A 4NTBA 4U5BE 5DS6A 1JR8A 1LVKA 1QQ3A 3NRHA 4XEFA 4CS8A 2LCHA 3QW1A 4AE4B 2J8WA 4EBBA 1Y4CA 3GM3A 4JRZA 4YL0A 4KNWA 3FDQA 4XPYA 3T6GB 2HZ8A 4WJ0A 5L0DA 1SYQA 1OR3A 4BJ5A 2GDCA 3U3BA 3U5SA 1Z6AA 3JZ0A 2H7BA 3JYYA 4XLNF 1YLMA 1D0XA 2EPNA 2W9YA 2XRHA 3ZQYA 1M56C 2B0HA 4OINF 1FFHA 4CIPA 2KYHA 1NBBA 1MMGA 1T6IA 3SNHA 1ORSC 1SF8A 1L3PA 3K6BA 4LDKA 4PJJA 4IWBA 1VTMP 3DI5A 1T5OA 2J45A 3W8IA 1H9GA 4P9TA 3A9CA 1LI5A 1ZVZA 1KTMA 2WZFA 3V7OA 4BJ6C 5COGA 3DKAA 1YARO 1WATA 3RYLA 4WABA 2MYSA 4ZLCA 3U9JA 1YAUO 1YDIA 2Y3DA 2G3KA 3M4CA 4CDAA 1I4YA 4JJFA 2J9VA 4YJWA 1V74B 5D91A 2L7AA 3SEOA 2R02A 5L3VA 3G50A 3GWLA 3U8VA 1EA8A 2PNOA 3QMKA 3NKEA 1OCCC 3N2ZB 2DI3A 3MFNA 3R2PA 2AP3A 3AJMA 3QW0A 3H65A 3NMJA 4CIHA 4EHPA 1UFBA 3BEHA 2EIMC 3C7JA 2DGJA 2P7VA 4NCQA 4MS2A 3FMSA 2HSBA 1GQAA 3GEEA 3SXYA 4DXWA 3MX3A 2HMZA 2EPMX 3UGOA 4E18A 4W8PA 4EWCA 4KBLA 5L0GA 4O6MA 1E86A 4OD5A 2CNWD 1HY5A 4K1OA 3DJUB 4MVUA 2XS1A 4NQFA 4ANJA 4LDQA 1YJGA 2BE5F 3GWNA 2R7SA 1Z63A 1NZEA 1ST6A 1ZW2A 2KJGA 1AUEA 4Q4ZF 1A0BA 4YN0B 1QVXA 1A41A 4N06A 2OJED 2QE9A 4IJJA 4ULVA 3RFYA 3ZIBA 3CEXA 4JCHA 5JVEA 1GM5A 2DYRC 5HV9A 1MNDA 3L34A 1ZHWA 3NYMA 4YT8A 4JE9A 1HW1A 1MNEA 1WGWA 3JSEO 4XLPF 1PCXA 3MYFA 1W2WA 1EQ1A 3FOOA 3EHNA 1V55C 1OCOC 2QLAA 2J46A 2L81A 4JTCB 1M2VA 4U9DA 5AC4A 3JRTA 4BJ6A 2L6GA 2WB7A 3OA1A 4O79A 1CPQA 3AGUA 4JTDB 2QTVA 2VCCA 3EH1A 4M63A 4RD9A 3U3FA 5L3QA 1RKEB 1BDJB 1Z3IX 1CGME 1H6GA 1O5HA 1D0ZA 1QLEC 4JEAA 3ZG1A 2WVNA 5JUAA 2M64A 1RMVA 1NG1A 1OKKD 1A7EA 1Z23A 1OW6A 3B71A 4ULWA 3RF3A 1ZYRF 1FTSA 3X1OA 1J8MF
chains in the Genus database with same CATH topology
4BJTA 4ZLDA 3KMIA 2PX0A 3NYLA 3K7DA 4AX2A 3CZ6A 2Y3BA 1J8YF 3DZAA 3LJBA 4X0RA 1KU2A 2O9XA 3HTKC 3W2VA 4I3MA 3F46A 4HEAJ 4O6YA 4Q5SF 1SMYF 4LLEA 5F5HA 5DQTA 4QI0A 3WODF 3ABKC 2J9UA 4K0DA 4PJMA 4YT4A 3LLIA 4A2NB 4XWJA 3LLKA 3LS1A 4I1OB 3ITFA 2EIJC 1TR2A 3HLZA 2Q3TA 1ZU5A 4E7SA 2PF4E 3O39A 1PD1A 1BR4A 2ZXRA 4U5DE 1MMDA 3Q7LA 5DS5A 2R7XA 3NKDA 2H7VC 2Q9BA 1ZHZA 4OIPF 4QI2A 2VASA 3GANA 2PP4A 4LACB 3X2QC 3TD7A 2IXNA 1TWAA 3K1HA 2Y69C 1TKNA 5EGYA 5EHHA 2B0JA 3ASOC 1FMVA 4JW1A 1G8XA 2A6EF 5KYWA 1IW7F 3KH2A 3N0TA 3M1CB 2IXMA 4DOZA 2Z15A 3UR3C 2P6VA 4AK9A 4BEJA 4OIRF 4HFKB 5T3WA 3O6XA 1M2VB 2R7RA 4MQ9F 5IY5C 3EQLF 2NG1A 5KYUA 1TWGA 3VYWA 3HJCA 3EGXA 3F47A 4U5HA 2Y3HA 1BR2A 4U5FE 3S0XA 3EHMA 1S7ZA 2E87A 4OIOF 4RDAA 1D1CA 3DAGA 3I4UA 3PMRA 4PJNA 2CDQA 5D92A 4OIQF 1MMAA 3JSZA 3FAJA 2J7PA 2A6HF 4FESA 2W4BA 4C7OA 3ECSA 1FFTC 3QZCA 2G3VA 3SYNA 2R7WA 5DLJA 3UGOA 5T1DB 4MNDA 5CI8A 2YEVA 2NUTA 3OEOA 3B9QA 4CS9C 3NG1A 4RBNA 2EIKC 5F5FA 2IXPA 3JYHA 3WG7C 3LS0A 2L9JA 3Q6MA 3EG9A 1D0YA 4DBRA 4Q7CA 4H4KC 3MLGA 4PFPA 4O7GA 3KKBA 3T6JA 1LKXA 3POVA 2A68F 2XSEA 2YHSA 4KC9A 5BUOA 1J8MF 1JPJA 4BG0A 3ABMC 4JURI 2R7OA 1NU7D 3DJNB 3FHDA 3AQBA 3ASNC 1RJ9B 2A1DD 4QDLA 2Y39A 3EJNA 1VK5A 2IOQA 2J0XA 5DVWA 2R7TA 1VOMA 5E2QA 3RH3A 5KYWB 5KYYA 2Q9CA 2OCCC 3T6BA 3AG3C 4CS9A 3UGPA 4YWQA 3EGDA 4CBEA 2XXAA 3DM5A 5KYXA 3E70C 2V26A 4G0HA 2D5RB 1M2OA 5KYUB 3EGXB 3UMKA 4JZAA 3ZSUA 1ZHYA 1N1CA 3AQCA 3B0UX 3T4RA 4CSAC 3LNRA 4W8KA 3CSKA 3DD7A 4B6IA 2IXOA 1QZXA 2NUPA 1RJ9A 4GEHA 4DBQA 1O87A 3K1IC 2HV6A 3EFOA 3ABLC 1Z5ZA 4I44A 4U5CE 4C7OB 4C3BA 5B3SC 2WZGA 4U5EE 3DM9B 4P6IC 1SZIA 5FCLA 2NUTB 2QY9A 4J32B 2JD3A 3B0PA 2PFDA 2C04A 4XTKA 2CNWA 3EG9B 4LLCA 4DVYP 3Q6NA 2C03A 3Q7GA 1VMAA 2I8BA 3AG2C 4IAOA 4F4BA 3ZVRA 2R7VA 4PFOA 1TWHA 2ZXPA 4PJLA 3S29A 2J0WA 2R7QA 3SZRA 3DAFA 2W4MA 3DXJF 4G7HF 4CSAA 3EZIA 2H7OA 1ZU4A 2KW3C 2WVQA 4HFFB 4JVSA 4BJ1A 3NDBB 2WZLA 2KNHA 2EINC 1PD0A 1OKKA 2FGYA 2WVOA 3LAYA 4JJGA 4FX5A 4C3DA 3L0IA 3K33A 3VAYA 2Y3GA 3EH2A 3W8HA 3ZC4A 5KYYB 3GODA 4AE4A 3NYJA 1MMNA 3EGDB 3DMDA 1BR1A 2XL4A 4KI2A 2GFHA 5KYXB 2XXAB 5HSWA 2EILC 2ZPAA 3JCUQ 1VYKA 3CQZA 5KYNA 4I1MA 3S27A 1M57C 1VYIA 3AG1C 2R7UA 1JPNA 2A69F 3RKOF 2X51A 5E3AA 3B0VC 3JT1A 2M4EA 1D1BA 4PK4A 2ZXOA 4FWVA 1FMWA 3OWTA 4LERA 3I5PA 5DS4A 3K66A 2HV7A 3S28A 2NUPB 2CW0F 4O6NA 4DVZA 2PX3A 1LS1A 2YZSA 3EFOB 3EPVA 1V54C 4C3EA 4U5GA 2MWQA 2Q9AA 5T3TA 1NU9C 2J7PD 4CS8C 3UMIA 2CGEA 1OCRC 2DYSC 5DQZA 4OD4A 2VH3A 4GYTA 5E3CA 4CS7A 2G62A 3IEEA 4IRUA 3W2WA 1D1AA 3PHF2 4BJ5C 1ZHTA 4K7BA 1OCZC 2VB6A 3SP1A 1ZHXA 2V3CC 3I5QA 2LSEA 2KQ9A 5B1AC 4KNVA 5B1BC 3N24A 2OG2A 3EZHA 4YT5A 3UNGC 3RIPA 2W45A 3E9VA 2IYLD 3AG4C 4HE8D 4G7OF 4NY3A 4J30B 2KGOA 2FFHA 3LEVA 3LESA 3FVYA 3KL4A 5CI9A 1TWCA 4E7ZA 4G7ZF 3UMHA 1IZMA 5E33A 2J9WA 2ZXWC 2WL8A 4U5BE 5DS6A 1LVKA 4CS8A 3NRHA 4AE4B 4EBBA 4KNWA 3FDQA 4WJ0A 4BJ5A 4YT2A 1Z6AA 2H7BA 4XLNF 2XRHA 1D0XA 2W9YA 1M56C 4OINF 1FFHA 1MMGA 3SNHA 1SF8A 3K6BA 4PJJA 4IWBA 2J45A 3W8IA 2WZFA 3V7OA 4BJ6C 3RYLA 2MYSA 4ZLCA 2Y3DA 2G3KA 4JJFA 2J9VA 4YJWA 5D91A 3SEOA 5L3VA 3QMKA 3NKEA 1OCCC 3N2ZB 3H65A 4CIHA 2EIMC 2DGJA 3MX3A 4EWCA 4KBLA 4O6MA 4OD5A 2CNWD 3DJUB 4ANJA 2BE5F 2R7SA 1Z63A 1NZEA 1ST6A 2KJGA 4Q4ZF 4YN0B 4N06A 4IJJA 3RFYA 3ZIBA 4JCHA 2DYRC 1MNDA 3L34A 1ZHWA 3NYMA 4YT8A 1MNEA 1WGWA 4XLPF 1PCXA 1W2WA 3EHNA 1V55C 1OCOC 2J46A 2L81A 1M2VA 3JRTA 4BJ6A 2WB7A 3OA1A 4O79A 2QTVA 5L3QA 3EH1A 4M63A 4RD9A 1Z3IX 1O5HA 1D0ZA 1QLEC 3ZG1A 2WVNA 1NG1A 1OKKD 1Z23A 4ULWA 1ZYRF 1FTSA 3X1OA 2P7VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RFY A;  3LS0 A;  3ZSU A;  1NZE A;  3LS1 A;  3JCU Q;  1VYK A;  2MWQ A; 
#chains in the Genus database with same CATH topology
 4BJT A;  4YL1 A;  4ZLD A;  1LE4 A;  2OKU A;  3KMI A;  2PX0 A;  3NYL A;  2EPK X;  1T9K A;  1JRA A;  1YA7 O;  3K7D A;  4AX2 A;  3CZ6 A;  2Y3B A;  1J8Y F;  4GQH A;  3DZA A;  2XLH A;  2YWA A;  5F28 E;  3LJB A;  1RXQ A;  4X0R A;  2UUH A;  3HKK A;  4YK5 A;  1KU2 A;  2O9X A;  2LK4 A;  3HTK C;  3W2V A;  4I3M A;  3GM2 A;  2NSG A;  1BZ4 A;  1T6Q A;  1Q0D A;  3F46 A;  3NMK A;  2XM0 A;  1KNY A;  1A7D A;  1VLT A;  1FNT c;  1B68 A;  2R7U A;  5FZT A;  2LQG A;  2YL3 A;  4HEA J;  4O6Y A;  3HNJ A;  1XZQ A;  4XEV A;  1SMY F;  4LLE A;  1C02 A;  5F5H A;  4QI0 A;  5DQT A;  4Q5S F;  3WOD F;  1TFK B;  3G4Z A;  1NFO A;  3U8P A;  3ABK C;  2J9U A;  4K0D A;  4PJM A;  4YT4 A;  3RVY A;  3IPM O;  1LPE A;  3LLI A;  4ER9 A;  4A2N B;  4XWJ A;  3C8G A;  2GAQ A;  3LLK A;  3LS1 A;  4I1O B;  5AGF A;  3VM6 A;  1I5N A;  2OU6 A;  3ITF A;  2EIJ C;  1TR2 A;  3HLZ A;  2Q3T A;  1ZU5 A;  4E7S A;  2PF4 E;  3O39 A;  1PD1 A;  4MTG A;  1BR4 A;  2ZXR A;  1JOG A;  2XL8 A;  4U5D E;  1RKE A;  1SR2 A;  1MMD A;  3Q7L A;  2QUP A;  2YRF A;  4AL1 A;  1UG7 A;  2I15 A;  2OJQ A;  2XLD A;  5DS5 A;  2R7X A;  1NFN A;  3HNL A;  4DRH B;  3B29 A;  3NKD A;  5L0I A;  3O10 A;  2H7V C;  2Q9B A;  3GOR A;  1ZHZ A;  1ORY A;  4OIP F;  4QI2 A;  2VAS A;  3GAN A;  2PP4 A;  4LAC B;  1E84 A;  5COM A;  3X2Q C;  1H9T A;  2YLG A;  3RQF A;  3TD7 A;  4PAC A;  2IXN A;  1Q0G A;  1LI7 A;  2YKZ A;  1LM3 B;  1TWA A;  3DE9 A;  2Y69 C;  3K1H A;  3KYI A;  2L6H A;  3QTH A;  1TKN A;  5L0C A;  5EGY A;  2Q7R A;  3ZTM A;  2XLM A;  3TQO A;  5EHH A;  2B0J A;  2TMV P;  1EKY A;  3ASO C;  1FMV A;  1NSG B;  2F22 A;  2R9R B;  4JW1 A;  3U2L A;  1G8X A;  1U6H A;  2A6E F;  3W4Y A;  5KYW A;  1IW7 F;  3CAX A;  2ASR A;  2AWY A;  3KH2 A;  3N0T A;  3M1C B;  3VRC A;  1HE1 A;  2AVK A;  4EBK A;  2IXM A;  5A6J A;  4DOZ A;  2YL1 A;  2XLE A;  2Z15 A;  3UR3 C;  3IQ6 A;  4FAP B;  2P6V A;  1I4Z A;  4AK9 A;  4BEJ A;  4OIR F;  4HFK B;  5T3W A;  2UUI A;  3O6X A;  1M2V B;  3RQG A;  2R7R A;  1G4U S;  4MQ9 F;  1RCP A;  5IY5 C;  3EQL F;  2NG1 A;  3PCV A;  4YL3 A;  1TWG A;  2GWW A;  2EPO A;  3HJC A;  5KYU A;  3EGX A;  1S05 A;  3F47 A;  4U5H A;  2Y3H A;  3ZTZ A;  1BR2 A;  4U5F E;  1QPU A;  4CJO A;  3S0X A;  2Q00 A;  3EHM A;  1S7Z A;  2KK1 A;  3C18 A;  3J06 A;  2E87 A;  1WOL A;  4EUK B;  1LS4 A;  1QSP A;  2X0C A;  4OIO F;  2YVK A;  1F1M A;  1K40 A;  4MVO A;  3U2M A;  4RDA A;  1D1C A;  3DAG A;  3I4U A;  3PMR A;  5AC5 A;  1DOW A;  4PJN A;  2CDQ A;  2A0U A;  3GM1 A;  5D92 A;  4EKW A;  4OIQ F;  1MMA A;  3FOP A;  3JSZ A;  4XPW A;  4N6C A;  4CDV A;  3FAJ A;  2RD9 A;  2J7P A;  2A6H F;  4FES A;  2W4B A;  5BQI A;  2DB4 A;  1O3U A;  3ECS A;  1FFT C;  2RSE B;  4C7O A;  3K1I A;  2XS8 A;  2QNL A;  3QZC A;  2G3V A;  4IB4 A;  1LE2 A;  1OW8 A;  3SYN A;  1BBH A;  2NPU A;  2YLI A;  5T1D B;  5DLJ A;  1ZZP A;  4JKV A;  4XPX A;  4MND A;  5CI8 A;  1WWP A;  1ORJ A;  2YEV A;  1G4W R;  3OEO A;  3B9Q A;  2NUT A;  4CS9 C;  5B3I A;  2XLO A;  3NG1 A;  3DWW A;  4MW8 A;  4MTO A;  4RBN A;  5A6K A;  2EIK C;  3RW0 A;  5F5F A;  2IXP A;  4UDV A;  5GPG B;  2XM4 A;  3JYH A;  5BQG A;  3TOL A;  3LS0 A;  2L9J A;  3WG7 C;  3IQ5 A;  3EG9 A;  3Q6M A;  4DJ9 A;  1D0Y A;  1A7V A;  4DBR A;  1HW2 A;  1DOV A;  2HUJ A;  3C8G B;  4Q7C A;  2XLW A;  4JIO A;  4NTA A;  3H2V A;  4H4K C;  3MLG A;  3HNK A;  2XLV A;  3MYI A;  4YT2 A;  1XZP A;  2YL7 A;  4PFP A;  4O7G A;  3KKB A;  3T6J A;  1LKX A;  1OXK A;  1Q0F A;  4LDR A;  3POV A;  2A68 F;  2XSE A;  2YHS A;  4KC9 A;  1Z7Q c;  5BUO A;  1JPJ A;  4BG0 A;  1C03 A;  3ABM C;  1JAF A;  3SXZ A;  4JUR I;  2R7O A;  3R7C A;  1NU7 D;  4E0I A;  3DJN B;  3V5Z A;  4NTF A;  3V5X A;  3FHD A;  3AQB A;  1T01 A;  1RJ9 B;  3ASN C;  3S90 A;  2A1D D;  3TK0 A;  4QDL A;  2VC9 A;  256B A;  4IGG A;  5BQH A;  5A6B A;  3NMI A;  5JT4 A;  4J7Y A;  2GA0 A;  2Y39 A;  3EJN A;  1VK5 A;  2IOQ A;  4E0H A;  2J0X A;  2IM8 A;  1JMW A;  1TQG A;  5DVW A;  3KYJ A;  3WAQ A;  1QKR A;  2R7T A;  1VOM A;  2LIG A;  2KSF A;  3M79 A;  2HMQ A;  5E2Q A;  1APC A;  3RH3 A;  3S9O A;  5KYW B;  2OQM A;  3U9M A;  5KYY A;  2Q9C A;  1WAS A;  2LFD A;  2OCC C;  1E85 A;  3T6B A;  4R32 A;  3AG3 C;  4CS9 A;  4XEK A;  2P1A A;  3UGP A;  4YWQ A;  3EGD A;  4CBE A;  1OQC A;  3HNI A;  4N4W A;  1CPR A;  3SXM A;  2XXA A;  3DM5 A;  5KYX A;  3E70 C;  2V26 A;  4G0H A;  1WTY A;  3A11 A;  1GGQ A;  2D5R B;  4XQ1 A;  1M2O A;  5COF A;  5KYU B;  1Q0K A;  1RKC A;  4NC3 A;  3EGX B;  2HKV A;  1Q0M A;  5L0J A;  3UMK A;  4JZA A;  3ZSU A;  3QVY A;  1ZHY A;  3IQT A;  1N1C A;  2H8A A;  3AQC A;  1GS9 A;  4DRJ B;  1MQV A;  3AGT A;  3C63 A;  4MVQ A;  3B0U X;  3T4R A;  3ZDL A;  1V4A A;  4CSA C;  3LNR A;  4W8K A;  2AU5 A;  1YA9 A;  2LD6 A;  3CSK A;  2OOC A;  3DD7 A;  4B6I A;  1OXB A;  1VLS A;  2IXO A;  1QZX A;  2NUP A;  1RJ9 A;  2R05 A;  4GEH A;  1O87 A;  4DBQ A;  5A6A A;  3K1I C;  5K0I A;  1E83 A;  2HV6 A;  4PR9 A;  3EFO A;  2EPL X;  3ABL C;  1Z5Z A;  2R7W A;  1OR2 A;  4I44 A;  4U5C E;  4C3B A;  3ATP A;  2HJ3 A;  5JS5 A;  4C7O B;  5B3S C;  2WZG A;  4U5E E;  2VCA A;  2D4U A;  1VB5 A;  3DM9 B;  3RQE A;  5L0F A;  3TUL A;  4P6I C;  3LEO A;  1SZI A;  2OEX A;  5FCL A;  2NUT B;  2QY9 A;  3BRJ A;  2PBE A;  4J32 B;  3S84 A;  2JD3 A;  3B0P A;  4N6H A;  3G4X A;  3ZQV A;  2PFD A;  5JSL A;  2C04 A;  4MTF A;  4XTK A;  2ICW G;  3U0C A;  1R4T A;  2CNW A;  3EG9 B;  4LLC A;  4DVY P;  3Q6N A;  2C03 A;  3Q7G A;  1VMA A;  2I8B A;  3L1M A;  2R03 A;  3AG2 C;  4MVR A;  2HSQ A;  4IAO A;  4F4B A;  4WGZ A;  3ZVR A;  2R7V A;  4PFO A;  1TWH A;  2ZD9 A;  2ZXP A;  4H54 A;  3T9O A;  5EK0 A;  3C8G D;  3DE8 A;  1AEP A;  1CGO A;  1K04 A;  4PJL A;  4D4X A;  3S29 A;  4G78 A;  3KPH A;  2FAP B;  2J0W A;  2R7Q A;  1XWJ A;  3IQC A;  4BEM J;  3SZR A;  1HMD A;  3DAF A;  2P0N A;  2W4M A;  3DXJ F;  4G7H F;  1AVO B;  1CGN A;  4CSA A;  3EZI A;  3L8J A;  2H7O A;  1U89 A;  1ZU4 A;  2AWC A;  3AOU A;  2KW3 C;  2WVQ A;  4JC7 A;  4HFF B;  4JVS A;  4BJ1 A;  2BL2 A;  3C62 A;  2WZL A;  3NDB B;  2YL0 A;  1L7C A;  2KNH A;  5A69 A;  2YLD A;  2EIN C;  4E17 A;  1FR0 A;  1PD0 A;  3MBG A;  1ZW3 A;  1FAP B;  1OKK A;  1YVI A;  2VCB A;  2FGY A;  2WVO A;  3LAY A;  4JJG A;  2JX0 A;  4FX5 A;  3LNM B;  4C3D A;  3RVZ A;  3L0I A;  3K33 A;  1C17 M;  2Y3G A;  3EH2 A;  3VAY A;  3W8H A;  3WHN A;  1YZA A;  3ZC4 A;  5KYY B;  3GOD A;  4AE4 A;  4BPM A;  3NYJ A;  1MMN A;  3EGD B;  3DMD A;  1NLX A;  2Q4F A;  1U0B B;  1K05 A;  3US6 A;  1BR1 A;  2XL4 A;  5JP7 A;  2GFH A;  5KYX B;  4KI2 A;  2XXA B;  3FAP B;  5HSW A;  2P61 A;  3TJ6 A;  2EIL C;  4JTA B;  3V5Y A;  2ZPA A;  3JCU Q;  4CJG A;  1VYK A;  2JPU A;  2NSF A;  3CQZ A;  4EBJ A;  4EIY A;  4I1M A;  3S27 A;  3H2U A;  5KYN A;  1M57 C;  5JRA A;  1YZC A;  1VYI A;  3AG1 C;  4U9E A;  1JPN A;  2A69 F;  3RKO F;  2X51 A;  2A0B A;  3C8Z A;  4MVS A;  1T6U A;  5E3A A;  5JLI A;  3B0V C;  3JT1 A;  2M4E A;  3QVZ A;  1D1B A;  4PK4 A;  2CCY A;  2ZXO A;  3IHU A;  4FWV A;  1FMW A;  3JRM O;  3OWT A;  4LER A;  3TJ5 A;  2HFI A;  3I5P A;  5DS4 A;  3K66 A;  2HV7 A;  3S28 A;  2NUP B;  3O55 A;  4MVM A;  2CW0 F;  4IAQ A;  4O6N A;  4Z9J A;  1HE9 A;  4DVZ A;  2PX3 A;  1LS1 A;  2YZS A;  3EFO B;  3EPV A;  4CX9 A;  1V54 C;  4MW3 A;  4C3E A;  4U5G A;  1Y6D A;  2IBF A;  2MWQ A;  2Q9A A;  1YYJ A;  2L6F A;  3FXH A;  5T3T A;  4CDY A;  1NU9 C;  2J7P D;  3M15 A;  4CS8 C;  3UMI A;  4J7T A;  2CGE A;  4Z9I A;  3LUT B;  1OCR C;  2DYS C;  3TOM A;  5DQZ A;  2XL6 A;  4OD4 A;  1H7I A;  2VH3 A;  4GYT A;  5E3C A;  2OEV A;  2ETS A;  1E2X A;  4CS7 A;  3GEH A;  2G62 A;  3IEE A;  4IRU A;  3W2W A;  1D1A A;  3PHF 2;  1PV3 A;  4BJ5 C;  1ZHT A;  4K7B A;  1OCZ C;  3JTL O;  2VB6 A;  1M6T A;  3SP1 A;  1ZHX A;  2V3C C;  3I5Q A;  2LSE A;  4JEB A;  3VF0 A;  1YYX A;  2KQ9 A;  2R25 A;  4KNV A;  5B1A C;  4WGY A;  5L0H A;  2MHR A;  5B1B C;  3N24 A;  1EI7 A;  4AL0 A;  2OG2 A;  3EZH A;  4MVZ A;  5CIV A;  4YT5 A;  3UNG C;  3RIP A;  2W45 A;  3E9V A;  2J9B A;  2IYL D;  2HJM A;  3AG4 C;  4HE8 D;  4D4N A;  2YQY A;  4ONS A;  4G7O F;  2CYD A;  1OW7 A;  1HMO A;  2KC3 A;  2HS5 A;  2LFF A;  4J30 B;  4L6R A;  2KGO A;  4NY3 A;  2FFH A;  4P9F A;  3PDM P;  2LP4 A;  1TFO B;  3L8I A;  5TJ5 E;  4JCZ A;  3LEV A;  4IAR A;  4A4A A;  3LES A;  3M4B A;  3FVY A;  3KL4 A;  3VYW A;  3ZWI A;  4DRI B;  3SXK A;  5CI9 A;  5A6B D;  1G5Z A;  1R5I D;  1WN0 A;  1TWC A;  3GEI A;  4Z9H A;  3UMH A;  4E7Z A;  4G7Z F;  1IZM A;  1LIH A;  5E33 A;  2J9W A;  2ZXW C;  2WL8 A;  2BC5 A;  4NTB A;  4U5B E;  5DS6 A;  1JR8 A;  1LVK A;  1QQ3 A;  3NRH A;  4XEF A;  4CS8 A;  2LCH A;  3QW1 A;  4AE4 B;  2J8W A;  4EBB A;  1Y4C A;  3GM3 A;  4JRZ A;  4YL0 A;  4KNW A;  3FDQ A;  4XPY A;  3T6G B;  2HZ8 A;  4WJ0 A;  5L0D A;  1SYQ A;  1OR3 A;  4BJ5 A;  2GDC A;  3U3B A;  3U5S A;  1Z6A A;  3JZ0 A;  2H7B A;  3JYY A;  4XLN F;  1YLM A;  1D0X A;  2EPN A;  2W9Y A;  2XRH A;  3ZQY A;  1M56 C;  2B0H A;  4OIN F;  1FFH A;  4CIP A;  2KYH A;  1NBB A;  1MMG A;  1T6I A;  3SNH A;  1ORS C;  1SF8 A;  1L3P A;  3K6B A;  4LDK A;  4PJJ A;  4IWB A;  1VTM P;  3DI5 A;  1T5O A;  2J45 A;  3W8I A;  1H9G A;  4P9T A;  3A9C A;  1LI5 A;  1ZVZ A;  1KTM A;  2WZF A;  3V7O A;  4BJ6 C;  5COG A;  3DKA A;  1YAR O;  1WAT A;  3RYL A;  4WAB A;  2MYS A;  4ZLC A;  3U9J A;  1YAU O;  1YDI A;  2Y3D A;  2G3K A;  3M4C A;  4CDA A;  1I4Y A;  4JJF A;  2J9V A;  4YJW A;  1V74 B;  5D91 A;  2L7A A;  3SEO A;  2R02 A;  5L3V A;  3G50 A;  3GWL A;  3U8V A;  1EA8 A;  2PNO A;  3QMK A;  3NKE A;  1OCC C;  3N2Z B;  2DI3 A;  3MFN A;  3R2P A;  2AP3 A;  3AJM A;  3QW0 A;  3H65 A;  3NMJ A;  4CIH A;  4EHP A;  1UFB A;  3BEH A;  2EIM C;  3C7J A;  2DGJ A;  2P7V A;  4NCQ A;  4MS2 A;  3FMS A;  2HSB A;  1GQA A;  3GEE A;  3SXY A;  4DXW A;  3MX3 A;  2HMZ A;  2EPM X;  3UGO A;  4E18 A;  4W8P A;  4EWC A;  4KBL A;  5L0G A;  4O6M A;  1E86 A;  4OD5 A;  2CNW D;  1HY5 A;  4K1O A;  3DJU B;  4MVU A;  2XS1 A;  4NQF A;  4ANJ A;  4LDQ A;  1YJG A;  2BE5 F;  3GWN A;  2R7S A;  1Z63 A;  1NZE A;  1ST6 A;  1ZW2 A;  2KJG A;  1AUE A;  4Q4Z F;  1A0B A;  4YN0 B;  1QVX A;  1A41 A;  4N06 A;  2OJE D;  2QE9 A;  4IJJ A;  4ULV A;  3RFY A;  3ZIB A;  3CEX A;  4JCH A;  5JVE A;  1GM5 A;  2DYR C;  5HV9 A;  1MND A;  3L34 A;  1ZHW A;  3NYM A;  4YT8 A;  4JE9 A;  1HW1 A;  1MNE A;  1WGW A;  3JSE O;  4XLP F;  1PCX A;  3MYF A;  1W2W A;  1EQ1 A;  3FOO A;  3EHN A;  1V55 C;  1OCO C;  2QLA A;  2J46 A;  2L81 A;  4JTC B;  1M2V A;  4U9D A;  5AC4 A;  3JRT A;  4BJ6 A;  2L6G A;  2WB7 A;  3OA1 A;  4O79 A;  1CPQ A;  3AGU A;  4JTD B;  2QTV A;  2VCC A;  3EH1 A;  4M63 A;  4RD9 A;  3U3F A;  5L3Q A;  1RKE B;  1BDJ B;  1Z3I X;  1CGM E;  1H6G A;  1O5H A;  1D0Z A;  1QLE C;  4JEA A;  3ZG1 A;  2WVN A;  5JUA A;  2M64 A;  1RMV A;  1NG1 A;  1OKK D;  1A7E A;  1Z23 A;  1OW6 A;  3B71 A;  4ULW A;  3RF3 A;  1ZYR F;  1FTS A;  3X1O A;  1J8M F; 
#chains in the Genus database with same CATH homology
 4BJT A;  4ZLD A;  3KMI A;  2PX0 A;  3NYL A;  3K7D A;  4AX2 A;  3CZ6 A;  2Y3B A;  1J8Y F;  3DZA A;  3LJB A;  4X0R A;  1KU2 A;  2O9X A;  3HTK C;  3W2V A;  4I3M A;  3F46 A;  4HEA J;  4O6Y A;  4Q5S F;  1SMY F;  4LLE A;  5F5H A;  5DQT A;  4QI0 A;  3WOD F;  3ABK C;  2J9U A;  4K0D A;  4PJM A;  4YT4 A;  3LLI A;  4A2N B;  4XWJ A;  3LLK A;  3LS1 A;  4I1O B;  3ITF A;  2EIJ C;  1TR2 A;  3HLZ A;  2Q3T A;  1ZU5 A;  4E7S A;  2PF4 E;  3O39 A;  1PD1 A;  1BR4 A;  2ZXR A;  4U5D E;  1MMD A;  3Q7L A;  5DS5 A;  2R7X A;  3NKD A;  2H7V C;  2Q9B A;  1ZHZ A;  4OIP F;  4QI2 A;  2VAS A;  3GAN A;  2PP4 A;  4LAC B;  3X2Q C;  3TD7 A;  2IXN A;  1TWA A;  3K1H A;  2Y69 C;  1TKN A;  5EGY A;  5EHH A;  2B0J A;  3ASO C;  1FMV A;  4JW1 A;  1G8X A;  2A6E F;  5KYW A;  1IW7 F;  3KH2 A;  3N0T A;  3M1C B;  2IXM A;  4DOZ A;  2Z15 A;  3UR3 C;  2P6V A;  4AK9 A;  4BEJ A;  4OIR F;  4HFK B;  5T3W A;  3O6X A;  1M2V B;  2R7R A;  4MQ9 F;  5IY5 C;  3EQL F;  2NG1 A;  5KYU A;  1TWG A;  3VYW A;  3HJC A;  3EGX A;  3F47 A;  4U5H A;  2Y3H A;  1BR2 A;  4U5F E;  3S0X A;  3EHM A;  1S7Z A;  2E87 A;  4OIO F;  4RDA A;  1D1C A;  3DAG A;  3I4U A;  3PMR A;  4PJN A;  2CDQ A;  5D92 A;  4OIQ F;  1MMA A;  3JSZ A;  3FAJ A;  2J7P A;  2A6H F;  4FES A;  2W4B A;  4C7O A;  3ECS A;  1FFT C;  3QZC A;  2G3V A;  3SYN A;  2R7W A;  5DLJ A;  3UGO A;  5T1D B;  4MND A;  5CI8 A;  2YEV A;  2NUT A;  3OEO A;  3B9Q A;  4CS9 C;  3NG1 A;  4RBN A;  2EIK C;  5F5F A;  2IXP A;  3JYH A;  3WG7 C;  3LS0 A;  2L9J A;  3Q6M A;  3EG9 A;  1D0Y A;  4DBR A;  4Q7C A;  4H4K C;  3MLG A;  4PFP A;  4O7G A;  3KKB A;  3T6J A;  1LKX A;  3POV A;  2A68 F;  2XSE A;  2YHS A;  4KC9 A;  5BUO A;  1J8M F;  1JPJ A;  4BG0 A;  3ABM C;  4JUR I;  2R7O A;  1NU7 D;  3DJN B;  3FHD A;  3AQB A;  3ASN C;  1RJ9 B;  2A1D D;  4QDL A;  2Y39 A;  3EJN A;  1VK5 A;  2IOQ A;  2J0X A;  5DVW A;  2R7T A;  1VOM A;  5E2Q A;  3RH3 A;  5KYW B;  5KYY A;  2Q9C A;  2OCC C;  3T6B A;  3AG3 C;  4CS9 A;  3UGP A;  4YWQ A;  3EGD A;  4CBE A;  2XXA A;  3DM5 A;  5KYX A;  3E70 C;  2V26 A;  4G0H A;  2D5R B;  1M2O A;  5KYU B;  3EGX B;  3UMK A;  4JZA A;  3ZSU A;  1ZHY A;  1N1C A;  3AQC A;  3B0U X;  3T4R A;  4CSA C;  3LNR A;  4W8K A;  3CSK A;  3DD7 A;  4B6I A;  2IXO A;  1QZX A;  2NUP A;  1RJ9 A;  4GEH A;  4DBQ A;  1O87 A;  3K1I C;  2HV6 A;  3EFO A;  3ABL C;  1Z5Z A;  4I44 A;  4U5C E;  4C7O B;  4C3B A;  5B3S C;  2WZG A;  4U5E E;  3DM9 B;  4P6I C;  1SZI A;  5FCL A;  2NUT B;  2QY9 A;  4J32 B;  2JD3 A;  3B0P A;  2PFD A;  2C04 A;  4XTK A;  2CNW A;  3EG9 B;  4LLC A;  4DVY P;  3Q6N A;  2C03 A;  3Q7G A;  1VMA A;  2I8B A;  3AG2 C;  4IAO A;  4F4B A;  3ZVR A;  2R7V A;  4PFO A;  1TWH A;  2ZXP A;  4PJL A;  3S29 A;  2J0W A;  2R7Q A;  3SZR A;  3DAF A;  2W4M A;  3DXJ F;  4G7H F;  4CSA A;  3EZI A;  2H7O A;  1ZU4 A;  2KW3 C;  2WVQ A;  4HFF B;  4JVS A;  4BJ1 A;  3NDB B;  2WZL A;  2KNH A;  2EIN C;  1PD0 A;  1OKK A;  2FGY A;  2WVO A;  3LAY A;  4JJG A;  4FX5 A;  4C3D A;  3L0I A;  3K33 A;  3VAY A;  2Y3G A;  3EH2 A;  3W8H A;  3ZC4 A;  5KYY B;  3GOD A;  4AE4 A;  3NYJ A;  1MMN A;  3EGD B;  3DMD A;  1BR1 A;  2XL4 A;  4KI2 A;  2GFH A;  5KYX B;  2XXA B;  5HSW A;  2EIL C;  2ZPA A;  3JCU Q;  1VYK A;  3CQZ A;  5KYN A;  4I1M A;  3S27 A;  1M57 C;  1VYI A;  3AG1 C;  2R7U A;  1JPN A;  2A69 F;  3RKO F;  2X51 A;  5E3A A;  3B0V C;  3JT1 A;  2M4E A;  1D1B A;  4PK4 A;  2ZXO A;  4FWV A;  1FMW A;  3OWT A;  4LER A;  3I5P A;  5DS4 A;  3K66 A;  2HV7 A;  3S28 A;  2NUP B;  2CW0 F;  4O6N A;  4DVZ A;  2PX3 A;  1LS1 A;  2YZS A;  3EFO B;  3EPV A;  1V54 C;  4C3E A;  4U5G A;  2MWQ A;  2Q9A A;  5T3T A;  1NU9 C;  2J7P D;  4CS8 C;  3UMI A;  2CGE A;  1OCR C;  2DYS C;  5DQZ A;  4OD4 A;  2VH3 A;  4GYT A;  5E3C A;  4CS7 A;  2G62 A;  3IEE A;  4IRU A;  3W2W A;  1D1A A;  3PHF 2;  4BJ5 C;  1ZHT A;  4K7B A;  1OCZ C;  2VB6 A;  3SP1 A;  1ZHX A;  2V3C C;  3I5Q A;  2LSE A;  2KQ9 A;  5B1A C;  4KNV A;  5B1B C;  3N24 A;  2OG2 A;  3EZH A;  4YT5 A;  3UNG C;  3RIP A;  2W45 A;  3E9V A;  2IYL D;  3AG4 C;  4HE8 D;  4G7O F;  4NY3 A;  4J30 B;  2KGO A;  2FFH A;  3LEV A;  3LES A;  3FVY A;  3KL4 A;  5CI9 A;  1TWC A;  4E7Z A;  4G7Z F;  3UMH A;  1IZM A;  5E33 A;  2J9W A;  2ZXW C;  2WL8 A;  4U5B E;  5DS6 A;  1LVK A;  4CS8 A;  3NRH A;  4AE4 B;  4EBB A;  4KNW A;  3FDQ A;  4WJ0 A;  4BJ5 A;  4YT2 A;  1Z6A A;  2H7B A;  4XLN F;  2XRH A;  1D0X A;  2W9Y A;  1M56 C;  4OIN F;  1FFH A;  1MMG A;  3SNH A;  1SF8 A;  3K6B A;  4PJJ A;  4IWB A;  2J45 A;  3W8I A;  2WZF A;  3V7O A;  4BJ6 C;  3RYL A;  2MYS A;  4ZLC A;  2Y3D A;  2G3K A;  4JJF A;  2J9V A;  4YJW A;  5D91 A;  3SEO A;  5L3V A;  3QMK A;  3NKE A;  1OCC C;  3N2Z B;  3H65 A;  4CIH A;  2EIM C;  2DGJ A;  3MX3 A;  4EWC A;  4KBL A;  4O6M A;  4OD5 A;  2CNW D;  3DJU B;  4ANJ A;  2BE5 F;  2R7S A;  1Z63 A;  1NZE A;  1ST6 A;  2KJG A;  4Q4Z F;  4YN0 B;  4N06 A;  4IJJ A;  3RFY A;  3ZIB A;  4JCH A;  2DYR C;  1MND A;  3L34 A;  1ZHW A;  3NYM A;  4YT8 A;  1MNE A;  1WGW A;  4XLP F;  1PCX A;  1W2W A;  3EHN A;  1V55 C;  1OCO C;  2J46 A;  2L81 A;  1M2V A;  3JRT A;  4BJ6 A;  2WB7 A;  3OA1 A;  4O79 A;  2QTV A;  5L3Q A;  3EH1 A;  4M63 A;  4RD9 A;  1Z3I X;  1O5H A;  1D0Z A;  1QLE C;  3ZG1 A;  2WVN A;  1NG1 A;  1OKK D;  1Z23 A;  4ULW A;  1ZYR F;  1FTS A;  3X1O A;  2P7V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...