3JCUQ

Cryo-em structure of spinach psii-lhcii supercomplex at 3.2 angstrom resolution
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
148
structure length
148
Chain Sequence
EARPIVVGPPPPLSGGLPGTENSDQARDGTLPYTKDRFYLQPLPPTEAAQRAKVSASEILNVKQFIDRKAWPSLQNDLRLRASYLRYDLKTVISAKPKDEKKSLQELTSKLFSSIDNLDHAAKIKSPTEAEKYYGQTVSNINEVLAKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem II protein D1
publication title Structure of spinach photosystem II-LHCII supercomplex at 3.2 A resolution
doi rcsb
molecule tags Membrane protein
total genus 40
structure length 148
sequence length 148
chains with identical sequence q
ec nomenclature
pdb deposition date 2016-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF05757 PsbQ Oxygen evolving enhancer protein 3 (PsbQ)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.290 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3jcuQ00
1NZEA 3JCUQ 3LS1A 2MWQA 3LS0A 1VYKA 3ZSUA 3RFYA
chains in the Genus database with same CATH superfamily
1FMWA 1R4TA 1HMOA 2IBFA 3HNKA 4OIQF 1C17M 2QTVA 3L34A 3HNJA 5A6BD 4I1MA 4IGGA 2KQ9A 1ORSC 2ZPAA 2IYLD 1UFBA 4ANJA 2NUTB 3FOOA 1OQCA 2GDCA 2ETSA 1ORYA 1NU7D 1VLSA 3Q6NA 3FVYA 4Q5SF 1K05A 2HV6A 2NSFA 4H4KC 4IWBA 2HZ8A 5D92A 4CDVA 4J32B 2OQMA 4XLNF 3O39A 3SXKA 4DRHB 5JVEA 5L0DA 3U8PA 2Y69C 4AE4B 4D4XA 2YQYA 4L6RA 1HY5A 3W8IA 2J45A 5DLJA 3G50A 4FAPB 3VF0A 1JR8A 2R7OA 3EZIA 1FTSA 3K1IA 1D0XA 2CDQA 3C8GD 4XTKA 2HMZA 5E33A 5B1AC 1Z3IX 3HTKC 1H6GA 4QI0A 2CNWD 2JX0A 3CEXA 5KYUA 4A2NB 4E17A 3DD7A 2FFHA 3A11A 4PR9A 3UMIA 4CJGA 4AL0A 5KYYA 2E87A 3N24A 5BUOA 3EHMA 1WATA 3AGTA 3B0UX 2VCBA 3B9QA 4MW3A 2I8BA 4CS7A 4XLPF 4YL1A 4E18A 1QPUA 2G3KA 4U5GA 3L8IA 5L0HA 1R5ID 2OEXA 3K7DA 3NYLA 4CDAA 2J7PA 2R25A 1FMVA 4O79A 4CDYA 3S29A 3U3BA 1FFHA 1D0ZA 4WJ0A 3A9CA 4JJFA 4LLCA 1DOWA 1RJ9A 3L8JA 3G4ZA 2IOQA 4GQHA 4LDKA 2J9BA 4PJLA 5AGFA 4DOZA 4YT8A 3JCUQ 3UGOA 3QW1A 1VTMP 3UNGC 4CS9C 5JRAA 2W4MA 2QLAA 5T3TA 3UMHA 1OCRC 1TFOB 1YVIA 1HW1A 1LE4A 5K0IA 5KYWB 2YL3A 1YARO 3EJNA 5A69A 1JPNA 3ZSUA 5JS5A 3RF3A 2PX3A 1HMDA 1Z6AA 4U9EA 3S90A 1AEPA 4LDQA 1HE1A 2J0WA 3NYJA 1ZHWA 2LSEA 5F28E 1ZHTA 3EGXB 1FNTc 1EA8A 3SZRA 1PCXA 3LNMB 1APCA 1LVKA 2WVNA 3K1HA 4KC9A 4YL0A 3TOLA 1EQ1A 3UR3C 2CYDA 4DJ9A 1G4US 2BL2A 2OJQA 4JCHA 1OW6A 1AUEA 1L7CA 3NG1A 4HE8D 4YL3A 4AX2A 4EIYA 4JIOA 3NDBB 4G7OF 4U5CE 4CS9A 1WOLA 2YEVA 3BRJA 3L1MA 1QQ3A 5CI8A 3JTLO 3E9VA 1GS9A 4CBEA 1E86A 1VLTA 2FGYA 5BQIA 4EBKA 2OCCC 1VYIA 3W8HA 5A6KA 2XXAA 3U2MA 4N6CA 4Z9HA 2ZXRA 1D0YA 3TQOA 3LJBA 3PHF2 1NZEA 2P1AA 2VCCA 3EFOA 1YYXA 4J30B 3I5QA 4XEKA 2V3CC 1OCCC 4RBNA 3TJ6A 1ZW3A 3AOUA 3IHUA 1KNYA 4U5DE 1V54C 5BQGA 3NMKA 2BC5A 3DXJF 1I4YA 3RW0A 4BJ1A 1CPRA 2XL8A 4CIPA 2YLIA 3JRTA 1EI7A 4NTAA 2VB6A 4O6MA 3AG4C 2LQGA 3QW0A 2FAPB 5AC5A 1MMAA 2KC3A 3UMKA 3GEHA 4CIHA 1RMVA 3DAFA 3JRMO 3PMRA 3U3FA 2KYHA 4HEAJ 4JZAA 2TMVP 3C8ZA 3K33A 4G7ZF 2LFFA 2NUTA 1M2OA 3K6BA 4EBBA 4BJ5A 2JPUA 3B29A 3LLIA 3SXYA 3S27A 1A7VA 3S0XA 1FR0A 1HW2A 4XQ1A 5F5FA 3VYWA 1A7EA 2A0UA 2NG1A 3IQ6A 4C3EA 4NTFA 4CJOA 1Q0DA 4IB4A 4AE4A 2D4UA 3IPMO 3LS1A 3JSZA 4IJJA 3T4RA 4E0HA 4G7HF 2J8WA 1LE2A 1UG7A 2XL4A 3VRCA 2A0BA 1GGQA 2P0NA 3DE9A 4DVZA 3ZDLA 2XSEA 2KW3C 3OWTA 3AJMA 3V5ZA 1BR2A 2X0CA 2C03A 4G0HA 4P9FA 256BA 1RXQA 1IW7F 5FZTA 3W4YA 3WG7C 3SNHA 5L0FA 3FOPA 1I5NA 5E2QA 4OINF 2YRFA 2EPLX 1YDIA 2IXMA 3NMJA 4K1OA 3POVA 4CSAA 1U89A 1ZHXA 2OOCA 3Q6MA 3ZIBA 1E85A 2W4BA 2XS1A 3QVYA 4O6NA 4YT5A 1K04A 3VM6A 1U0BB 5CIVA 1T6UA 1VOMA 1ZYRF 2Q9BA 3EZHA 2NPUA 2Y39A 1QVXA 2PNOA 3EG9B 1LM3B 2H7VC 2QY9A 1KTMA 3MLGA 2R7QA 4PACA 2KGOA 4JEBA 3DWWA 4R32A 2L6FA 3HNLA 3GM1A 4XPYA 3M15A 1TFKB 4YN0B 2OKUA 3C8GB 4C7OB 4MQ9F 2R7TA 2R9RB 3MYFA 2YLGA 1TWGA 4IARA 5KYWA 1ZU4A 1AVOB 2HS5A 2OU6A 3HNIA 4GYTA 4QDLA 2EIMC 1ST6A 3GEIA 2YLDA 4HFKB 4M63A 3KPHA 3C63A 2M4EA 2NUPB 1TKNA 1TWCA 1GQAA 1XWJA 3RQEA 3EGXA 2H8AA 3DM5A 1A41A 3N2ZB 1M57C 1PD0A 4NY3A 2J9VA 1CPQA 1NU9C 3Q7GA 1N1CA 4LDRA 3GEEA 4MS2A 3S28A 2ASRA 2H7BA 4IRUA 2KK1A 3G4XA 4J7YA 1L3PA 3ZTMA 2R7SA 1EKYA 1JMWA 5L0CA 3GM3A 1LI5A 4MVSA 2L6HA 4JKVA 5L3QA 1E83A 1M56C 2KNHA 5AC4A 2PX0A 4U5FE 2YL0A 4PJMA 1TWAA 4JJGA 2B0HA 2QE9A 3V5YA 1T6IA 3W2VA 4OIRF 2V26A 2MYSA 4MVRA 3FMSA 3IQCA 3Q7LA 5COFA 4DBRA 1OW7A 4JTDB 4KNWA 4XPWA 3NKDA 4W8KA 4YK5A 4BEMJ 1OXKA 2Z15A 4BJTA 2GFHA 3CZ6A 1H9GA 1A7DA 3KH2A 3S9OA 1QLEC 1OKKA 2OJED 3NRHA 2WZFA 1YYJA 4XWJA 1WWPA 2VC9A 5B3SC 1GM5A 2P6VA 2J9UA 1OR2A 2DYSC 5F5HA 2YKZA 2L7AA 3R7CA 1Y6DA 3PCVA 2XLHA 1D1CA 1ORJA 1JOGA 2R03A 3ABLC 3R2PA 5DS4A 3QMKA 4PJJA 4CS8A 3FHDA 2A69F 5JUAA 3LLKA 3IEEA 2GA0A 5B1BC 1NSGB 2VASA 2LD6A 3GWNA 4MW8A 4N4WA 1Z63A 1SMYF 1SF8A 1Y4CA 1W2WA 2R05A 3HJCA 4NTBA 3JYHA 4PK4A 5B3IA 1MNEA 1V4AA 4FWVA 2L9JA 1ZHZA 1DOVA 2G3VA 5TJ5E 3T6GB 4ZLDA 3I5PA 4MVQA 4RD9A 3AQCA 2Q9AA 4NQFA 4IAQA 1T6QA 3OA1A 4OD4A 2Y3HA 4JTCB 3AGUA 2LIGA 4U5HA 1G8XA 2L81A 1NG1A 4O6YA 5A6BA 3U9MA 1D1AA 4OIPF 2BE5F 2HSBA 4PFPA 5FCLA 3ASNC 1M2VB 3NMIA 2IM8A 3RH3A 4UDVA 2OEVA 2XLOA 4JURI 2XS8A 4KBLA 5D91A 5GPGB 1CGNA 1CGOA 3EG9A 3N0TA 5T1DB 4NCQA 2HMQA 2W9YA 5KYYB 3JYYA 4FESA 2XM0A 4WABA 1H7IA 1MMGA 2XM4A 4BJ6C 2AP3A 4E7ZA 4JCZA 4CX9A 3DAGA 5COMA 4KI2A 2Q00A 3OEOA 3C8GA 3L0IA 4C7OA 3T6JA 4RDAA 2OG2A 2W45A 3NKEA 1C02A 5KYXB 4Q4ZF 4JW1A 4WGYA 1SZIA 5A6AA 4YT2A 3AQBA 2JD3A 1LIHA 1O87A 1JPJA 3DE8A 2B0JA 1OR3A 2NUPA 3AG1C 1E2XA 2RSEB 2J46A 5T3WA 3RKOF 3C62A 1PD1A 4EUKB 4OD5A 3ZQVA 4Z9IA 1MMDA 5KYUB 3LESA 2YL1A 4QI2A 3PDMP 2EILC 4OIOF 3H2UA 2AWCA 3M1CB 4GEHA 2LK4A 4P9TA 4MTFA 4BJ6A 5L0IA 2Q4FA 2EIJC 2YVKA 5KYNA 2UUHA 3DMDA 2J7PD 3RYLA 4EWCA 1JAFA 5IY5C 4ULVA 3RVYA 3X2QC 1JRAA 1HE9A 3QZCA 1FAPB 3U8VA 2A68F 1ZZPA 1TR2A 2VH3A 4Q7CA 3RFYA 1WGWA 2XLMA 1OKKD 1S7ZA 2L6GA 2XLWA 2HJ3A 2AVKA 4F4BA 3SYNA 1MMNA 1SR2A 3V7OA 1LI7A 3AG2C 2EINC 2EPKX 5DQZA 3IQ5A 1YAUO 3KMIA 3EH2A 1BBHA 1VMAA 2DI3A 4LACB 4JRZA 4E7SA 1XZQA 1Z7Qc 4E0IA 1J8MF 3ABMC 3ECSA 4U5BE 1B68A 3EGDB 4N6HA 1Q0KA 4MVOA 1K40A 3U9JA 3ZTZA 3W2WA 1MQVA 4I1OB 3O6XA 4C3BA 4D4NA 4DVYP 2ZXWC 2HSQA 1BR1A 3O10A 2GWWA 3LS0A 3LUTB 3M4CA 1Q0MA 2Y3BA 5DS5A 3SP1A 2F22A 4YWQA 4BJ5C 3ABKC 1YZCA 4XEVA 3B0VC 1BZ4A 1YJGA 1OCOC 2ZD9A 4DXWA 2A6EF 3HLZA 4J7TA 2PP4A 1RKEB 1TQGA 1Z5ZA 2QUPA 2X51A 1T5OA 1FFTC 2R7RA 1C03A 3KYJA 1V55C 2KJGA 3GODA 3IQTA 3FAJA 2D5RB 2MHRA 4U5EE 5JLIA 1H9TA 4O7GA 3DKAA 2AWYA 3LNRA 3H2VA 4DRJB 4H54A 1F1MA 1ZU5A 2EPMX 3DJNB 1M2VA 2HJMA 2ZXOA 1LS1A 4EBJA 4Z9JA 3EQLF 1QSPA 1Q0FA 2DYRC 2C04A 1VK5A 3FDQA 1BR4A 4G78A 1E84A 2YWAA 2XL6A 4K0DA 2WZGA 1CGME 3RIPA 5HSWA 1BDJB 1NFOA 5CI9A 4ULWA 3T6BA 5E3AA 2IXPA 1YZAA 2Q9CA 1OCZC 2DB4A 3B71A 5KYXA 2ZXPA 1IZMA 2Y3GA 2G62A 3US6A 3I4UA 2M64A 5L0GA 3TD7A 1QKRA 3JSEO 2HV7A 5E3CA 3RVZA 3F46A 4ER9A 5EHHA 3E70C 1V74B 5DQTA 2CGEA 2I15A 3DM9B 2XLEA 2Q7RA 3KYIA 1TWHA 4EKWA 5BQHA 2HKVA 4JE9A 5A6JA 3U0CA 3ZC4A 1O3UA 3UGPA 1SYQA 4JTAB 4MVMA 2J0XA 3C7JA 1T9KA 1XZPA 3ITFA 2IXOA 2IXNA 3M79A 4U9DA 3JT1A 3DI5A 1VYKA 3QTHA 1WN0A 3SXMA 2XLVA 3M4BA 4LERA 3ZVRA 1A0BA 2VCAA 3CAXA 1I4ZA 1LKXA 3H65A 3K66A 3B0PA 3GM2A 4DBQA 4XPXA 1MNDA 1U6HA 2HUJA 3V5XA 1J8YF 4AK9A 3J06A 2P7VA 1NFNA 3MYIA 4MTGA 1O5HA 2CW0F 5EK0A 2EPOA 3LEVA 1LS4A 1D1BA 3BEHA 4XEFA 4MTOA 3VAYA 3RQGA 2R7VA 3JZ0A 3S84A 5L3VA 3ZQYA 4MNDA 1OW8A 2NSGA 2P61A 3MX3A 3SXZA 2R7UA 3C18A 2ICWG 3AG3C 4I3MA 2WVQA 3RQFA 4JVSA 4BG0A 2H7OA 4CS8C 3TULA 2QNLA 4BPMA 3CSKA 3FXHA 5JT4A 1ZW2A 2EIKC 3U2LA 2KSFA 4LLEA 1NBBA 3WHNA 1Z23A 3WAQA 2A1DD 4JC7A 4HFFB 3EGDA 5DVWA 2CNWA 1NLXA 3NYMA 3GWLA 2O9XA 5EGYA 2R7WA 1WTYA 2AU5A 5COGA 4BEJA 2HFIA 3DJUB 4P6IC 1YLMA 1RJ9B 2YL7A 2YZSA 3QVZA 4N06A 1RKCA 3WODF 4DRIB 2LCHA 4MVUA 4PJNA 3GANA 3ASOC 3EHNA 2YHSA 3EH1A 3LEOA 3MFNA 3EPVA 1M6TA 2WZLA 1S05A 4JEAA 4I44A 2DGJA 1PV3A 4B6IA 1RKEA 3CQZA 4YJWA 1ZVZA 3ZWIA 4WGZA 3KL4A 3TOMA 5JSLA 4X0RA 1RCPA 4FX5A 2GAQA 2Y3DA 2J9WA 2UUIA 2XRHA 4CSAC 2PFDA 4NC3A 1ZHYA 2R02A 4AL1A 2WL8A 4EHPA 3GORA 4PFOA 2WB7A 2XLDA 3F47A 2LFDA 1T01A 2RD9A 3O55A 2Q3TA 1Q0GA 2CCYA 3X1OA 4W8PA 4ZLCA 3TJ5A 5L0JA 1OXBA 2A6HF 3MBGA 3TK0A 3T9OA 4K7BA 2EPNA 1YA9A 1WASA 1QZXA 3LAYA 5HV9A 2WVOA 2XXAB 4C3DA 1G5ZA 4MVZA 4IAOA 4A4AA 3U5SA 1KU2A 3ATPA 5DS6A 1G4WR 1LPEA 3ZG1A 3EFOB 3FAPB 2MWQA 4KNVA 1YA7O 1VB5A 4ONSA 5JP7A 2LP4A 2PF4E 2R7XA 4YT4A 3KKBA 3DZAA 2PBEA 3K1IC 3HKKA 3SEOA
chains in the Genus database with same CATH topology
1FMWA 4OIQF 2QTVA 3L34A 4I1MA 2KQ9A 2ZPAA 2IYLD 4ANJA 2NUTB 3Q6NA 1NU7D 3FVYA 4Q5SF 2HV6A 4H4KC 4IWBA 5D92A 4J32B 4XLNF 3O39A 2Y69C 4AE4B 3W8IA 2J45A 5DLJA 2R7OA 3EZIA 1FTSA 5B1AC 1D0XA 2CDQA 4XTKA 4BJ5A 5E33A 1Z3IX 3HTKC 4QI0A 4A2NB 2CNWD 2R7WA 3DD7A 2FFHA 5KYYA 3UMIA 2E87A 3N24A 5BUOA 3EHMA 3B0UX 3B9QA 4XLPF 2I8BA 4CS7A 2G3KA 4U5GA 3NYLA 3K7DA 2J7PA 1FMVA 4O79A 3S29A 1FFHA 1D0ZA 4WJ0A 4JJFA 4LLCA 1RJ9A 4PJLA 2IOQA 4DOZA 4YT8A 3JCUQ 3UGOA 3UNGC 4CS9C 2W4MA 5T3TA 3UMHA 1OCRC 5KYWB 3EJNA 1JPNA 3ZSUA 2PX3A 1Z6AA 2J0WA 3NYJA 1ZHWA 2LSEA 1ZHTA 3EGXB 3SZRA 1PCXA 1LVKA 2WVNA 3K1HA 4KC9A 3UR3C 4AX2A 4JCHA 3NG1A 4G7OF 4HE8D 3NDBB 4U5CE 4CS9A 2YEVA 5CI8A 4CBEA 3E9VA 2FGYA 2OCCC 1VYIA 3W8HA 2XXAA 2ZXRA 1D0YA 3LJBA 3PHF2 1NZEA 3EFOA 4J30B 3I5QA 2V3CC 1OCCC 4RBNA 4U5DE 1V54C 4CS8A 3DXJF 4BJ1A 3JRTA 2VB6A 4O6MA 3AG4C 4CIHA 1MMAA 3UMKA 3DAFA 3PMRA 4JZAA 4HEAJ 3K33A 4G7ZF 2NUTA 1M2OA 3K6BA 4EBBA 3S0XA 3LLIA 3S27A 5F5FA 3VYWA 2NG1A 4C3EA 4AE4A 3LS1A 3JSZA 4IJJA 3T4RA 4G7HF 2XL4A 4DVZA 2XSEA 2KW3C 3OWTA 1BR2A 2C03A 4G0HA 3WG7C 1IW7F 3SNHA 5E2QA 4OINF 2IXMA 3POVA 4CSAA 1ZHXA 3ZIBA 3Q6MA 2W4BA 4O6NA 4YT5A 1VOMA 1ZYRF 2Q9BA 3EZHA 2Y39A 3EG9B 2H7VC 2QY9A 3MLGA 2R7QA 2KGOA 4C7OB 4YN0B 2R7TA 4MQ9F 5KYWA 1TWGA 1ZU4A 4GYTA 4QDLA 2EIMC 1ST6A 4HFKB 4M63A 2M4EA 2NUPB 1TKNA 1TWCA 3EGXA 3DM5A 3N2ZB 1M57C 1PD0A 4NY3A 2J9VA 1NU9C 3Q7GA 1N1CA 3S28A 2H7BA 4IRUA 2R7SA 5L3QA 1M56C 2KNHA 2PX0A 4U5FE 4PJMA 1TWAA 4JJGA 3W2VA 4OIRF 2V26A 2MYSA 3Q7LA 4DBRA 4KNWA 3NKDA 4W8KA 2Z15A 4BJTA 2GFHA 3CZ6A 3KH2A 1QLEC 1OKKA 3NRHA 2WZFA 4XWJA 5B3SC 2P6VA 2J9UA 5F5HA 2DYSC 1D1CA 3ABLC 5DS4A 3QMKA 4PJJA 3FHDA 2A69F 3LLKA 3IEEA 5B1BC 2VASA 1Z63A 1SMYF 1SF8A 1W2WA 3HJCA 3JYHA 4PK4A 1MNEA 4FWVA 2L9JA 1ZHZA 2G3VA 4ZLDA 3I5PA 4RD9A 3AQCA 2Q9AA 3OA1A 4OD4A 2Y3HA 4U5HA 1G8XA 2L81A 1NG1A 4O6YA 1D1AA 4OIPF 2BE5F 4PFPA 5FCLA 3ASNC 1M2VB 3RH3A 4JURI 4KBLA 5D91A 3N0TA 3EG9A 5T1DB 2W9YA 5KYYB 4FESA 1MMGA 4BJ6C 4E7ZA 3DAGA 4KI2A 4C7OA 3OEOA 3L0IA 3T6JA 4RDAA 2OG2A 2W45A 3NKEA 5KYXB 4Q4ZF 4JW1A 1SZIA 4YT2A 3AQBA 2JD3A 1O87A 1JPJA 2B0JA 2NUPA 3AG1C 5T3WA 2J46A 3RKOF 1PD1A 4OD5A 1MMDA 5KYUB 3LESA 4QI2A 2EILC 4OIOF 3M1CB 4GEHA 4BJ6A 2EIJC 5KYNA 3DMDA 3RYLA 2J7PD 4EWCA 5IY5C 3X2QC 3QZCA 2A68F 1TR2A 2VH3A 4Q7CA 3RFYA 1WGWA 1OKKD 1S7ZA 4F4BA 3SYNA 1MMNA 3V7OA 3AG2C 2EINC 5DQZA 3KMIA 3EH2A 1VMAA 4LACB 4E7SA 1J8MF 3ABMC 3ECSA 4U5BE 3EGDB 3W2WA 4I1OB 3O6XA 4C3BA 4DVYP 2ZXWC 1BR1A 3LS0A 2Y3BA 5DS5A 3SP1A 4YWQA 4BJ5C 3ABKC 3B0VC 1OCOC 2A6EF 3HLZA 2PP4A 1Z5ZA 2X51A 1FFTC 2R7RA 1V55C 2KJGA 3GODA 3FAJA 2D5RB 4U5EE 4O7GA 3LNRA 1ZU5A 3DJNB 1M2VA 2ZXOA 1LS1A 3EQLF 2DYRC 2C04A 1VK5A 3FDQA 1BR4A 4K0DA 2WZGA 3RIPA 5HSWA 5CI9A 4ULWA 3T6BA 5E3AA 2IXPA 2Q9CA 1OCZC 5KYXA 2ZXPA 1IZMA 2Y3GA 2G62A 3I4UA 3TD7A 5EHHA 2HV7A 5E3CA 3F46A 3E70C 5DQTA 2CGEA 3DM9B 1TWHA 3ZC4A 3UGPA 5KYUA 2J0XA 3ITFA 2IXOA 2IXNA 3JT1A 1VYKA 4LERA 3ZVRA 3H65A 1LKXA 3K66A 4DBQA 3B0PA 1MNDA 1J8YF 4AK9A 2P7VA 1O5HA 2CW0F 3LEVA 1D1BA 2R7VA 3VAYA 5L3VA 4MNDA 3MX3A 2R7UA 3AG3C 4BG0A 4I3MA 2WVQA 4JVSA 4CS8C 2H7OA 3CSKA 2EIKC 4LLEA 1Z23A 2A1DD 4HFFB 3EGDA 5DVWA 2CNWA 3NYMA 2O9XA 5EGYA 4BEJA 3DJUB 4P6IC 1RJ9B 2YZSA 4N06A 3WODF 4PJNA 3GANA 3ASOC 3EHNA 2YHSA 3EH1A 3EPVA 2WZLA 4I44A 2DGJA 4B6IA 3CQZA 4YJWA 3KL4A 4X0RA 4FX5A 2Y3DA 2J9WA 2XRHA 4CSAC 2PFDA 1ZHYA 2WL8A 4PFOA 2WB7A 3F47A 2Q3TA 3X1OA 4ZLCA 2A6HF 4K7BA 3LAYA 1QZXA 2WVOA 2XXAB 4C3DA 4IAOA 1KU2A 5DS6A 3ZG1A 3EFOB 2MWQA 4KNVA 2PF4E 2R7XA 4YT4A 3KKBA 3DZAA 3K1IC 3SEOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NZE A;  3JCU Q;  3LS1 A;  2MWQ A;  3LS0 A;  1VYK A;  3ZSU A;  3RFY A; 
#chains in the Genus database with same CATH topology
 1FMW A;  1R4T A;  1HMO A;  2IBF A;  3HNK A;  4OIQ F;  1C17 M;  2QTV A;  3L34 A;  3HNJ A;  5A6B D;  4I1M A;  4IGG A;  2KQ9 A;  1ORS C;  2ZPA A;  2IYL D;  1UFB A;  4ANJ A;  2NUT B;  3FOO A;  1OQC A;  2GDC A;  2ETS A;  1ORY A;  1NU7 D;  1VLS A;  3Q6N A;  3FVY A;  4Q5S F;  1K05 A;  2HV6 A;  2NSF A;  4H4K C;  4IWB A;  2HZ8 A;  5D92 A;  4CDV A;  4J32 B;  2OQM A;  4XLN F;  3O39 A;  3SXK A;  4DRH B;  5JVE A;  5L0D A;  3U8P A;  2Y69 C;  4AE4 B;  4D4X A;  2YQY A;  4L6R A;  1HY5 A;  3W8I A;  2J45 A;  5DLJ A;  3G50 A;  4FAP B;  3VF0 A;  1JR8 A;  2R7O A;  3EZI A;  1FTS A;  3K1I A;  1D0X A;  2CDQ A;  3C8G D;  4XTK A;  2HMZ A;  5E33 A;  5B1A C;  1Z3I X;  3HTK C;  1H6G A;  4QI0 A;  2CNW D;  2JX0 A;  3CEX A;  5KYU A;  4A2N B;  4E17 A;  3DD7 A;  2FFH A;  3A11 A;  4PR9 A;  3UMI A;  4CJG A;  4AL0 A;  5KYY A;  2E87 A;  3N24 A;  5BUO A;  3EHM A;  1WAT A;  3AGT A;  3B0U X;  2VCB A;  3B9Q A;  4MW3 A;  2I8B A;  4CS7 A;  4XLP F;  4YL1 A;  4E18 A;  1QPU A;  2G3K A;  4U5G A;  3L8I A;  5L0H A;  1R5I D;  2OEX A;  3K7D A;  3NYL A;  4CDA A;  2J7P A;  2R25 A;  1FMV A;  4O79 A;  4CDY A;  3S29 A;  3U3B A;  1FFH A;  1D0Z A;  4WJ0 A;  3A9C A;  4JJF A;  4LLC A;  1DOW A;  1RJ9 A;  3L8J A;  3G4Z A;  2IOQ A;  4GQH A;  4LDK A;  2J9B A;  4PJL A;  5AGF A;  4DOZ A;  4YT8 A;  3JCU Q;  3UGO A;  3QW1 A;  1VTM P;  3UNG C;  4CS9 C;  5JRA A;  2W4M A;  2QLA A;  5T3T A;  3UMH A;  1OCR C;  1TFO B;  1YVI A;  1HW1 A;  1LE4 A;  5K0I A;  5KYW B;  2YL3 A;  1YAR O;  3EJN A;  5A69 A;  1JPN A;  3ZSU A;  5JS5 A;  3RF3 A;  2PX3 A;  1HMD A;  1Z6A A;  4U9E A;  3S90 A;  1AEP A;  4LDQ A;  1HE1 A;  2J0W A;  3NYJ A;  1ZHW A;  2LSE A;  5F28 E;  1ZHT A;  3EGX B;  1FNT c;  1EA8 A;  3SZR A;  1PCX A;  3LNM B;  1APC A;  1LVK A;  2WVN A;  3K1H A;  4KC9 A;  4YL0 A;  3TOL A;  1EQ1 A;  3UR3 C;  2CYD A;  4DJ9 A;  1G4U S;  2BL2 A;  2OJQ A;  4JCH A;  1OW6 A;  1AUE A;  1L7C A;  3NG1 A;  4HE8 D;  4YL3 A;  4AX2 A;  4EIY A;  4JIO A;  3NDB B;  4G7O F;  4U5C E;  4CS9 A;  1WOL A;  2YEV A;  3BRJ A;  3L1M A;  1QQ3 A;  5CI8 A;  3JTL O;  3E9V A;  1GS9 A;  4CBE A;  1E86 A;  1VLT A;  2FGY A;  5BQI A;  4EBK A;  2OCC C;  1VYI A;  3W8H A;  5A6K A;  2XXA A;  3U2M A;  4N6C A;  4Z9H A;  2ZXR A;  1D0Y A;  3TQO A;  3LJB A;  3PHF 2;  1NZE A;  2P1A A;  2VCC A;  3EFO A;  1YYX A;  4J30 B;  3I5Q A;  4XEK A;  2V3C C;  1OCC C;  4RBN A;  3TJ6 A;  1ZW3 A;  3AOU A;  3IHU A;  1KNY A;  4U5D E;  1V54 C;  5BQG A;  3NMK A;  2BC5 A;  3DXJ F;  1I4Y A;  3RW0 A;  4BJ1 A;  1CPR A;  2XL8 A;  4CIP A;  2YLI A;  3JRT A;  1EI7 A;  4NTA A;  2VB6 A;  4O6M A;  3AG4 C;  2LQG A;  3QW0 A;  2FAP B;  5AC5 A;  1MMA A;  2KC3 A;  3UMK A;  3GEH A;  4CIH A;  1RMV A;  3DAF A;  3JRM O;  3PMR A;  3U3F A;  2KYH A;  4HEA J;  4JZA A;  2TMV P;  3C8Z A;  3K33 A;  4G7Z F;  2LFF A;  2NUT A;  1M2O A;  3K6B A;  4EBB A;  4BJ5 A;  2JPU A;  3B29 A;  3LLI A;  3SXY A;  3S27 A;  1A7V A;  3S0X A;  1FR0 A;  1HW2 A;  4XQ1 A;  5F5F A;  3VYW A;  1A7E A;  2A0U A;  2NG1 A;  3IQ6 A;  4C3E A;  4NTF A;  4CJO A;  1Q0D A;  4IB4 A;  4AE4 A;  2D4U A;  3IPM O;  3LS1 A;  3JSZ A;  4IJJ A;  3T4R A;  4E0H A;  4G7H F;  2J8W A;  1LE2 A;  1UG7 A;  2XL4 A;  3VRC A;  2A0B A;  1GGQ A;  2P0N A;  3DE9 A;  4DVZ A;  3ZDL A;  2XSE A;  2KW3 C;  3OWT A;  3AJM A;  3V5Z A;  1BR2 A;  2X0C A;  2C03 A;  4G0H A;  4P9F A;  256B A;  1RXQ A;  1IW7 F;  5FZT A;  3W4Y A;  3WG7 C;  3SNH A;  5L0F A;  3FOP A;  1I5N A;  5E2Q A;  4OIN F;  2YRF A;  2EPL X;  1YDI A;  2IXM A;  3NMJ A;  4K1O A;  3POV A;  4CSA A;  1U89 A;  1ZHX A;  2OOC A;  3Q6M A;  3ZIB A;  1E85 A;  2W4B A;  2XS1 A;  3QVY A;  4O6N A;  4YT5 A;  1K04 A;  3VM6 A;  1U0B B;  5CIV A;  1T6U A;  1VOM A;  1ZYR F;  2Q9B A;  3EZH A;  2NPU A;  2Y39 A;  1QVX A;  2PNO A;  3EG9 B;  1LM3 B;  2H7V C;  2QY9 A;  1KTM A;  3MLG A;  2R7Q A;  4PAC A;  2KGO A;  4JEB A;  3DWW A;  4R32 A;  2L6F A;  3HNL A;  3GM1 A;  4XPY A;  3M15 A;  1TFK B;  4YN0 B;  2OKU A;  3C8G B;  4C7O B;  4MQ9 F;  2R7T A;  2R9R B;  3MYF A;  2YLG A;  1TWG A;  4IAR A;  5KYW A;  1ZU4 A;  1AVO B;  2HS5 A;  2OU6 A;  3HNI A;  4GYT A;  4QDL A;  2EIM C;  1ST6 A;  3GEI A;  2YLD A;  4HFK B;  4M63 A;  3KPH A;  3C63 A;  2M4E A;  2NUP B;  1TKN A;  1TWC A;  1GQA A;  1XWJ A;  3RQE A;  3EGX A;  2H8A A;  3DM5 A;  1A41 A;  3N2Z B;  1M57 C;  1PD0 A;  4NY3 A;  2J9V A;  1CPQ A;  1NU9 C;  3Q7G A;  1N1C A;  4LDR A;  3GEE A;  4MS2 A;  3S28 A;  2ASR A;  2H7B A;  4IRU A;  2KK1 A;  3G4X A;  4J7Y A;  1L3P A;  3ZTM A;  2R7S A;  1EKY A;  1JMW A;  5L0C A;  3GM3 A;  1LI5 A;  4MVS A;  2L6H A;  4JKV A;  5L3Q A;  1E83 A;  1M56 C;  2KNH A;  5AC4 A;  2PX0 A;  4U5F E;  2YL0 A;  4PJM A;  1TWA A;  4JJG A;  2B0H A;  2QE9 A;  3V5Y A;  1T6I A;  3W2V A;  4OIR F;  2V26 A;  2MYS A;  4MVR A;  3FMS A;  3IQC A;  3Q7L A;  5COF A;  4DBR A;  1OW7 A;  4JTD B;  4KNW A;  4XPW A;  3NKD A;  4W8K A;  4YK5 A;  4BEM J;  1OXK A;  2Z15 A;  4BJT A;  2GFH A;  3CZ6 A;  1H9G A;  1A7D A;  3KH2 A;  3S9O A;  1QLE C;  1OKK A;  2OJE D;  3NRH A;  2WZF A;  1YYJ A;  4XWJ A;  1WWP A;  2VC9 A;  5B3S C;  1GM5 A;  2P6V A;  2J9U A;  1OR2 A;  2DYS C;  5F5H A;  2YKZ A;  2L7A A;  3R7C A;  1Y6D A;  3PCV A;  2XLH A;  1D1C A;  1ORJ A;  1JOG A;  2R03 A;  3ABL C;  3R2P A;  5DS4 A;  3QMK A;  4PJJ A;  4CS8 A;  3FHD A;  2A69 F;  5JUA A;  3LLK A;  3IEE A;  2GA0 A;  5B1B C;  1NSG B;  2VAS A;  2LD6 A;  3GWN A;  4MW8 A;  4N4W A;  1Z63 A;  1SMY F;  1SF8 A;  1Y4C A;  1W2W A;  2R05 A;  3HJC A;  4NTB A;  3JYH A;  4PK4 A;  5B3I A;  1MNE A;  1V4A A;  4FWV A;  2L9J A;  1ZHZ A;  1DOV A;  2G3V A;  5TJ5 E;  3T6G B;  4ZLD A;  3I5P A;  4MVQ A;  4RD9 A;  3AQC A;  2Q9A A;  4NQF A;  4IAQ A;  1T6Q A;  3OA1 A;  4OD4 A;  2Y3H A;  4JTC B;  3AGU A;  2LIG A;  4U5H A;  1G8X A;  2L81 A;  1NG1 A;  4O6Y A;  5A6B A;  3U9M A;  1D1A A;  4OIP F;  2BE5 F;  2HSB A;  4PFP A;  5FCL A;  3ASN C;  1M2V B;  3NMI A;  2IM8 A;  3RH3 A;  4UDV A;  2OEV A;  2XLO A;  4JUR I;  2XS8 A;  4KBL A;  5D91 A;  5GPG B;  1CGN A;  1CGO A;  3EG9 A;  3N0T A;  5T1D B;  4NCQ A;  2HMQ A;  2W9Y A;  5KYY B;  3JYY A;  4FES A;  2XM0 A;  4WAB A;  1H7I A;  1MMG A;  2XM4 A;  4BJ6 C;  2AP3 A;  4E7Z A;  4JCZ A;  4CX9 A;  3DAG A;  5COM A;  4KI2 A;  2Q00 A;  3OEO A;  3C8G A;  3L0I A;  4C7O A;  3T6J A;  4RDA A;  2OG2 A;  2W45 A;  3NKE A;  1C02 A;  5KYX B;  4Q4Z F;  4JW1 A;  4WGY A;  1SZI A;  5A6A A;  4YT2 A;  3AQB A;  2JD3 A;  1LIH A;  1O87 A;  1JPJ A;  3DE8 A;  2B0J A;  1OR3 A;  2NUP A;  3AG1 C;  1E2X A;  2RSE B;  2J46 A;  5T3W A;  3RKO F;  3C62 A;  1PD1 A;  4EUK B;  4OD5 A;  3ZQV A;  4Z9I A;  1MMD A;  5KYU B;  3LES A;  2YL1 A;  4QI2 A;  3PDM P;  2EIL C;  4OIO F;  3H2U A;  2AWC A;  3M1C B;  4GEH A;  2LK4 A;  4P9T A;  4MTF A;  4BJ6 A;  5L0I A;  2Q4F A;  2EIJ C;  2YVK A;  5KYN A;  2UUH A;  3DMD A;  2J7P D;  3RYL A;  4EWC A;  1JAF A;  5IY5 C;  4ULV A;  3RVY A;  3X2Q C;  1JRA A;  1HE9 A;  3QZC A;  1FAP B;  3U8V A;  2A68 F;  1ZZP A;  1TR2 A;  2VH3 A;  4Q7C A;  3RFY A;  1WGW A;  2XLM A;  1OKK D;  1S7Z A;  2L6G A;  2XLW A;  2HJ3 A;  2AVK A;  4F4B A;  3SYN A;  1MMN A;  1SR2 A;  3V7O A;  1LI7 A;  3AG2 C;  2EIN C;  2EPK X;  5DQZ A;  3IQ5 A;  1YAU O;  3KMI A;  3EH2 A;  1BBH A;  1VMA A;  2DI3 A;  4LAC B;  4JRZ A;  4E7S A;  1XZQ A;  1Z7Q c;  4E0I A;  1J8M F;  3ABM C;  3ECS A;  4U5B E;  1B68 A;  3EGD B;  4N6H A;  1Q0K A;  4MVO A;  1K40 A;  3U9J A;  3ZTZ A;  3W2W A;  1MQV A;  4I1O B;  3O6X A;  4C3B A;  4D4N A;  4DVY P;  2ZXW C;  2HSQ A;  1BR1 A;  3O10 A;  2GWW A;  3LS0 A;  3LUT B;  3M4C A;  1Q0M A;  2Y3B A;  5DS5 A;  3SP1 A;  2F22 A;  4YWQ A;  4BJ5 C;  3ABK C;  1YZC A;  4XEV A;  3B0V C;  1BZ4 A;  1YJG A;  1OCO C;  2ZD9 A;  4DXW A;  2A6E F;  3HLZ A;  4J7T A;  2PP4 A;  1RKE B;  1TQG A;  1Z5Z A;  2QUP A;  2X51 A;  1T5O A;  1FFT C;  2R7R A;  1C03 A;  3KYJ A;  1V55 C;  2KJG A;  3GOD A;  3IQT A;  3FAJ A;  2D5R B;  2MHR A;  4U5E E;  5JLI A;  1H9T A;  4O7G A;  3DKA A;  2AWY A;  3LNR A;  3H2V A;  4DRJ B;  4H54 A;  1F1M A;  1ZU5 A;  2EPM X;  3DJN B;  1M2V A;  2HJM A;  2ZXO A;  1LS1 A;  4EBJ A;  4Z9J A;  3EQL F;  1QSP A;  1Q0F A;  2DYR C;  2C04 A;  1VK5 A;  3FDQ A;  1BR4 A;  4G78 A;  1E84 A;  2YWA A;  2XL6 A;  4K0D A;  2WZG A;  1CGM E;  3RIP A;  5HSW A;  1BDJ B;  1NFO A;  5CI9 A;  4ULW A;  3T6B A;  5E3A A;  2IXP A;  1YZA A;  2Q9C A;  1OCZ C;  2DB4 A;  3B71 A;  5KYX A;  2ZXP A;  1IZM A;  2Y3G A;  2G62 A;  3US6 A;  3I4U A;  2M64 A;  5L0G A;  3TD7 A;  1QKR A;  3JSE O;  2HV7 A;  5E3C A;  3RVZ A;  3F46 A;  4ER9 A;  5EHH A;  3E70 C;  1V74 B;  5DQT A;  2CGE A;  2I15 A;  3DM9 B;  2XLE A;  2Q7R A;  3KYI A;  1TWH A;  4EKW A;  5BQH A;  2HKV A;  4JE9 A;  5A6J A;  3U0C A;  3ZC4 A;  1O3U A;  3UGP A;  1SYQ A;  4JTA B;  4MVM A;  2J0X A;  3C7J A;  1T9K A;  1XZP A;  3ITF A;  2IXO A;  2IXN A;  3M79 A;  4U9D A;  3JT1 A;  3DI5 A;  1VYK A;  3QTH A;  1WN0 A;  3SXM A;  2XLV A;  3M4B A;  4LER A;  3ZVR A;  1A0B A;  2VCA A;  3CAX A;  1I4Z A;  1LKX A;  3H65 A;  3K66 A;  3B0P A;  3GM2 A;  4DBQ A;  4XPX A;  1MND A;  1U6H A;  2HUJ A;  3V5X A;  1J8Y F;  4AK9 A;  3J06 A;  2P7V A;  1NFN A;  3MYI A;  4MTG A;  1O5H A;  2CW0 F;  5EK0 A;  2EPO A;  3LEV A;  1LS4 A;  1D1B A;  3BEH A;  4XEF A;  4MTO A;  3VAY A;  3RQG A;  2R7V A;  3JZ0 A;  3S84 A;  5L3V A;  3ZQY A;  4MND A;  1OW8 A;  2NSG A;  2P61 A;  3MX3 A;  3SXZ A;  2R7U A;  3C18 A;  2ICW G;  3AG3 C;  4I3M A;  2WVQ A;  3RQF A;  4JVS A;  4BG0 A;  2H7O A;  4CS8 C;  3TUL A;  2QNL A;  4BPM A;  3CSK A;  3FXH A;  5JT4 A;  1ZW2 A;  2EIK C;  3U2L A;  2KSF A;  4LLE A;  1NBB A;  3WHN A;  1Z23 A;  3WAQ A;  2A1D D;  4JC7 A;  4HFF B;  3EGD A;  5DVW A;  2CNW A;  1NLX A;  3NYM A;  3GWL A;  2O9X A;  5EGY A;  2R7W A;  1WTY A;  2AU5 A;  5COG A;  4BEJ A;  2HFI A;  3DJU B;  4P6I C;  1YLM A;  1RJ9 B;  2YL7 A;  2YZS A;  3QVZ A;  4N06 A;  1RKC A;  3WOD F;  4DRI B;  2LCH A;  4MVU A;  4PJN A;  3GAN A;  3ASO C;  3EHN A;  2YHS A;  3EH1 A;  3LEO A;  3MFN A;  3EPV A;  1M6T A;  2WZL A;  1S05 A;  4JEA A;  4I44 A;  2DGJ A;  1PV3 A;  4B6I A;  1RKE A;  3CQZ A;  4YJW A;  1ZVZ A;  3ZWI A;  4WGZ A;  3KL4 A;  3TOM A;  5JSL A;  4X0R A;  1RCP A;  4FX5 A;  2GAQ A;  2Y3D A;  2J9W A;  2UUI A;  2XRH A;  4CSA C;  2PFD A;  4NC3 A;  1ZHY A;  2R02 A;  4AL1 A;  2WL8 A;  4EHP A;  3GOR A;  4PFO A;  2WB7 A;  2XLD A;  3F47 A;  2LFD A;  1T01 A;  2RD9 A;  3O55 A;  2Q3T A;  1Q0G A;  2CCY A;  3X1O A;  4W8P A;  4ZLC A;  3TJ5 A;  5L0J A;  1OXB A;  2A6H F;  3MBG A;  3TK0 A;  3T9O A;  4K7B A;  2EPN A;  1YA9 A;  1WAS A;  1QZX A;  3LAY A;  5HV9 A;  2WVO A;  2XXA B;  4C3D A;  1G5Z A;  4MVZ A;  4IAO A;  4A4A A;  3U5S A;  1KU2 A;  3ATP A;  5DS6 A;  1G4W R;  1LPE A;  3ZG1 A;  3EFO B;  3FAP B;  2MWQ A;  4KNV A;  1YA7 O;  1VB5 A;  4ONS A;  5JP7 A;  2LP4 A;  2PF4 E;  2R7X A;  4YT4 A;  3KKB A;  3DZA A;  2PBE A;  3K1I C;  3HKK A;  3SEO A; 
#chains in the Genus database with same CATH homology
 1FMW A;  4OIQ F;  2QTV A;  3L34 A;  4I1M A;  2KQ9 A;  2ZPA A;  2IYL D;  4ANJ A;  2NUT B;  3Q6N A;  1NU7 D;  3FVY A;  4Q5S F;  2HV6 A;  4H4K C;  4IWB A;  5D92 A;  4J32 B;  4XLN F;  3O39 A;  2Y69 C;  4AE4 B;  3W8I A;  2J45 A;  5DLJ A;  2R7O A;  3EZI A;  1FTS A;  5B1A C;  1D0X A;  2CDQ A;  4XTK A;  4BJ5 A;  5E33 A;  1Z3I X;  3HTK C;  4QI0 A;  4A2N B;  2CNW D;  2R7W A;  3DD7 A;  2FFH A;  5KYY A;  3UMI A;  2E87 A;  3N24 A;  5BUO A;  3EHM A;  3B0U X;  3B9Q A;  4XLP F;  2I8B A;  4CS7 A;  2G3K A;  4U5G A;  3NYL A;  3K7D A;  2J7P A;  1FMV A;  4O79 A;  3S29 A;  1FFH A;  1D0Z A;  4WJ0 A;  4JJF A;  4LLC A;  1RJ9 A;  4PJL A;  2IOQ A;  4DOZ A;  4YT8 A;  3JCU Q;  3UGO A;  3UNG C;  4CS9 C;  2W4M A;  5T3T A;  3UMH A;  1OCR C;  5KYW B;  3EJN A;  1JPN A;  3ZSU A;  2PX3 A;  1Z6A A;  2J0W A;  3NYJ A;  1ZHW A;  2LSE A;  1ZHT A;  3EGX B;  3SZR A;  1PCX A;  1LVK A;  2WVN A;  3K1H A;  4KC9 A;  3UR3 C;  4AX2 A;  4JCH A;  3NG1 A;  4G7O F;  4HE8 D;  3NDB B;  4U5C E;  4CS9 A;  2YEV A;  5CI8 A;  4CBE A;  3E9V A;  2FGY A;  2OCC C;  1VYI A;  3W8H A;  2XXA A;  2ZXR A;  1D0Y A;  3LJB A;  3PHF 2;  1NZE A;  3EFO A;  4J30 B;  3I5Q A;  2V3C C;  1OCC C;  4RBN A;  4U5D E;  1V54 C;  4CS8 A;  3DXJ F;  4BJ1 A;  3JRT A;  2VB6 A;  4O6M A;  3AG4 C;  4CIH A;  1MMA A;  3UMK A;  3DAF A;  3PMR A;  4JZA A;  4HEA J;  3K33 A;  4G7Z F;  2NUT A;  1M2O A;  3K6B A;  4EBB A;  3S0X A;  3LLI A;  3S27 A;  5F5F A;  3VYW A;  2NG1 A;  4C3E A;  4AE4 A;  3LS1 A;  3JSZ A;  4IJJ A;  3T4R A;  4G7H F;  2XL4 A;  4DVZ A;  2XSE A;  2KW3 C;  3OWT A;  1BR2 A;  2C03 A;  4G0H A;  3WG7 C;  1IW7 F;  3SNH A;  5E2Q A;  4OIN F;  2IXM A;  3POV A;  4CSA A;  1ZHX A;  3ZIB A;  3Q6M A;  2W4B A;  4O6N A;  4YT5 A;  1VOM A;  1ZYR F;  2Q9B A;  3EZH A;  2Y39 A;  3EG9 B;  2H7V C;  2QY9 A;  3MLG A;  2R7Q A;  2KGO A;  4C7O B;  4YN0 B;  2R7T A;  4MQ9 F;  5KYW A;  1TWG A;  1ZU4 A;  4GYT A;  4QDL A;  2EIM C;  1ST6 A;  4HFK B;  4M63 A;  2M4E A;  2NUP B;  1TKN A;  1TWC A;  3EGX A;  3DM5 A;  3N2Z B;  1M57 C;  1PD0 A;  4NY3 A;  2J9V A;  1NU9 C;  3Q7G A;  1N1C A;  3S28 A;  2H7B A;  4IRU A;  2R7S A;  5L3Q A;  1M56 C;  2KNH A;  2PX0 A;  4U5F E;  4PJM A;  1TWA A;  4JJG A;  3W2V A;  4OIR F;  2V26 A;  2MYS A;  3Q7L A;  4DBR A;  4KNW A;  3NKD A;  4W8K A;  2Z15 A;  4BJT A;  2GFH A;  3CZ6 A;  3KH2 A;  1QLE C;  1OKK A;  3NRH A;  2WZF A;  4XWJ A;  5B3S C;  2P6V A;  2J9U A;  5F5H A;  2DYS C;  1D1C A;  3ABL C;  5DS4 A;  3QMK A;  4PJJ A;  3FHD A;  2A69 F;  3LLK A;  3IEE A;  5B1B C;  2VAS A;  1Z63 A;  1SMY F;  1SF8 A;  1W2W A;  3HJC A;  3JYH A;  4PK4 A;  1MNE A;  4FWV A;  2L9J A;  1ZHZ A;  2G3V A;  4ZLD A;  3I5P A;  4RD9 A;  3AQC A;  2Q9A A;  3OA1 A;  4OD4 A;  2Y3H A;  4U5H A;  1G8X A;  2L81 A;  1NG1 A;  4O6Y A;  1D1A A;  4OIP F;  2BE5 F;  4PFP A;  5FCL A;  3ASN C;  1M2V B;  3RH3 A;  4JUR I;  4KBL A;  5D91 A;  3N0T A;  3EG9 A;  5T1D B;  2W9Y A;  5KYY B;  4FES A;  1MMG A;  4BJ6 C;  4E7Z A;  3DAG A;  4KI2 A;  4C7O A;  3OEO A;  3L0I A;  3T6J A;  4RDA A;  2OG2 A;  2W45 A;  3NKE A;  5KYX B;  4Q4Z F;  4JW1 A;  1SZI A;  4YT2 A;  3AQB A;  2JD3 A;  1O87 A;  1JPJ A;  2B0J A;  2NUP A;  3AG1 C;  5T3W A;  2J46 A;  3RKO F;  1PD1 A;  4OD5 A;  1MMD A;  5KYU B;  3LES A;  4QI2 A;  2EIL C;  4OIO F;  3M1C B;  4GEH A;  4BJ6 A;  2EIJ C;  5KYN A;  3DMD A;  3RYL A;  2J7P D;  4EWC A;  5IY5 C;  3X2Q C;  3QZC A;  2A68 F;  1TR2 A;  2VH3 A;  4Q7C A;  3RFY A;  1WGW A;  1OKK D;  1S7Z A;  4F4B A;  3SYN A;  1MMN A;  3V7O A;  3AG2 C;  2EIN C;  5DQZ A;  3KMI A;  3EH2 A;  1VMA A;  4LAC B;  4E7S A;  1J8M F;  3ABM C;  3ECS A;  4U5B E;  3EGD B;  3W2W A;  4I1O B;  3O6X A;  4C3B A;  4DVY P;  2ZXW C;  1BR1 A;  3LS0 A;  2Y3B A;  5DS5 A;  3SP1 A;  4YWQ A;  4BJ5 C;  3ABK C;  3B0V C;  1OCO C;  2A6E F;  3HLZ A;  2PP4 A;  1Z5Z A;  2X51 A;  1FFT C;  2R7R A;  1V55 C;  2KJG A;  3GOD A;  3FAJ A;  2D5R B;  4U5E E;  4O7G A;  3LNR A;  1ZU5 A;  3DJN B;  1M2V A;  2ZXO A;  1LS1 A;  3EQL F;  2DYR C;  2C04 A;  1VK5 A;  3FDQ A;  1BR4 A;  4K0D A;  2WZG A;  3RIP A;  5HSW A;  5CI9 A;  4ULW A;  3T6B A;  5E3A A;  2IXP A;  2Q9C A;  1OCZ C;  5KYX A;  2ZXP A;  1IZM A;  2Y3G A;  2G62 A;  3I4U A;  3TD7 A;  5EHH A;  2HV7 A;  5E3C A;  3F46 A;  3E70 C;  5DQT A;  2CGE A;  3DM9 B;  1TWH A;  3ZC4 A;  3UGP A;  5KYU A;  2J0X A;  3ITF A;  2IXO A;  2IXN A;  3JT1 A;  1VYK A;  4LER A;  3ZVR A;  3H65 A;  1LKX A;  3K66 A;  4DBQ A;  3B0P A;  1MND A;  1J8Y F;  4AK9 A;  2P7V A;  1O5H A;  2CW0 F;  3LEV A;  1D1B A;  2R7V A;  3VAY A;  5L3V A;  4MND A;  3MX3 A;  2R7U A;  3AG3 C;  4BG0 A;  4I3M A;  2WVQ A;  4JVS A;  4CS8 C;  2H7O A;  3CSK A;  2EIK C;  4LLE A;  1Z23 A;  2A1D D;  4HFF B;  3EGD A;  5DVW A;  2CNW A;  3NYM A;  2O9X A;  5EGY A;  4BEJ A;  3DJU B;  4P6I C;  1RJ9 B;  2YZS A;  4N06 A;  3WOD F;  4PJN A;  3GAN A;  3ASO C;  3EHN A;  2YHS A;  3EH1 A;  3EPV A;  2WZL A;  4I44 A;  2DGJ A;  4B6I A;  3CQZ A;  4YJW A;  3KL4 A;  4X0R A;  4FX5 A;  2Y3D A;  2J9W A;  2XRH A;  4CSA C;  2PFD A;  1ZHY A;  2WL8 A;  4PFO A;  2WB7 A;  3F47 A;  2Q3T A;  3X1O A;  4ZLC A;  2A6H F;  4K7B A;  3LAY A;  1QZX A;  2WVO A;  2XXA B;  4C3D A;  4IAO A;  1KU2 A;  5DS6 A;  3ZG1 A;  3EFO B;  2MWQ A;  4KNV A;  2PF4 E;  2R7X A;  4YT4 A;  3KKB A;  3DZA A;  3K1I C;  3SEO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...