3JCUZ

Cryo-em structure of spinach psii-lhcii supercomplex at 3.2 angstrom resolution
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
61
structure length
61
Chain Sequence
b'TIAFQLAVFALIATSSILLISVPVVFASPDGWSSNKNIVFSGTSLWLGLVFLVGILNSLIS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem II protein D1
publication title Structure of spinach photosystem II-LHCII supercomplex at 3.2 A resolution
doi rcsb
molecule tags Membrane protein
total genus 23
structure length 61
sequence length 61
chains with identical sequence z
ec nomenclature
pdb deposition date 2016-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01737 Ycf9 YCF9
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.740 Mainly Alpha Orthogonal Bundle Helix Hairpins Photosystem II PsbZ, reaction centre 3jcuZ00
2AXTZ 3A0HZ 5B66Z 3JCUZ 5KAIZ 3KZIZ 4IL6Z 3WU2Z 5TISZ 1S5LZ 5GTHZ 5B5EZ 5H2FZ 4PJ0Z 5KAFZ 5E79Z 3A0BZ 4UB8Z 5GTIZ 4UB6Z
chains in the Genus database with same CATH superfamily
2E5LO 1W0JG 1JVMA 4WFGA 3VQVA 4QGPA 2JK5C 3GB7C 4X1YA 3M7MX 3OMIB 4X62O 2JVDA 4LF7B 5CA1A 3RYFB 2BSKB 1GO3F 2DE0X 1XHXA 2FL4A 1SQGA 1ZL8A 2VWJA 1N8RW 5EC1C 4PHZA 1PPJH 2ZM6B 3BEHA 1VF6A 3WG7B 2XAGA 2AXTZ 1GM9A 4P2ZA 5BR8O 2QWRB 5LOVA 1M90W 2ZQMA 3FKSG 1B3QA 2CH7A 3SYAA 1XMQB 1SA0B 1EN5A 5KHHA 3ZRWB 2QSAA 3SR2C 2A9HA 5ITZB 4TV8A 3RYCB 2N05A 3LDDA 4DV0O 3UM7A 1AI4A 1R6KA 1GM8A 4NXMB 2Y69C 4GKKO 2ZIOA 2CTPA 5LP6A 2RQ6A 5CA0B 4F6RA 3HKCB 4LF6B 3BVOA 3VQXA 3JASA 1YJ9V 2XTAA 4NVPA 5H2FZ 4H33A 2RMKB 2QM7A 3ZCCA 1KB9F 2EULA 2JDIG 3CMAV 3RVYA 1US6A 5CBFA 4I55B 4B7KA 4LFAO 2R9IA 3RGBA 2HR3A 3EFFK 2KB1A 1OZ0A 5J2UB 3OTOB 4QPKA 4W4LA 2IU0A 4TWKA 3APQA 3UT5B 5JJJB 3ZHVA 3ZEDA 1IZ3A 4I9QA 2OCHA 1VQOV 2BTQA 2R9RB 2ATKC 2P67A 3RWRD 4R8CA 4LFBB 1PV0A 3D36C 1SRYA 2WLJA 4YJ3A 1N36O 5LXTB 2ZDIC 2ZE7A 1YF2A 5IJ9A 5CB4B 4J80A 4MTOA 4NTYA 3ZMUA 5JH7B 4JF3A 3IJ4A 1VF5B 3C3TA 1K5QA 1VEWA 4U3JA 1HNXO 1VMGA 3G6EV 1WPXA 4IHJB 1D2DA 3ZHSA 4I7ZB 2KSDA 1Y6XA 2PY5A 1NR7A 1GN4A 1LR1A 5J9PC 2WLKA 1U96A 1XREA 1DF4A 4LF4O 2ZXWC 4OXSA 1R3KC 1NU1H 3K5MA 4FIPC 3KCXA 1GN6A 2Y0PA 3GWOA 3H1KH 4JYBA 1SZTA 4I0XB 2IW5A 1YJWV 3TJTA 2YDEA 4I5SA 1N0NA 2F4VO 3U10A 1N32O 5D5PA 4NTWA 3OW2U 2M7WA 3RW0A 1H2KA 1YEWA 4F6EA 5EBMC 3CC4V 4BIOA 4ZI7A 3J80N 3I56V 4LF5B 4WFAV 2QEXV 1H2NA 2EIJB 4AI8A 4JI0B 4H13B 4ZBMA 1YDXA 2PI5A 3EHBB 4DV7B 4QJFB 4LP8A 4MVZA 2P4KA 4OPAA 2CAZC 4NXMO 3HR0A 2YUAA 5K1PA 4O4LA 4UVAA 5BZBA 3AK3A 3AG3B 1NH2B 1IBMO 2ZD9A 4DYLA 4Z1VA 1NT2B 1J5EO 5KAFZ 3T1HO 1K7DA 1YZBA 1N34B 2YS8A 1PP9H 2F1MA 4YY3O 2P06A 4UV8A 3LNNA 4B3TB 3ZRXA 1VQMV 2A0LA 5EK0A 4GUNA 1QCEA 3CCQV 5B1AC 5L3BA 3JSNA 1P7BA 1FFXA 1TVKB 3UO3A 3R65A 2E75B 1JFFA 4UCRA 3ZBHA 2DN9A 3SDLA 4H37A 3AG2C 1AP5A 1IBKO 2PZSA 4NB5A 3E22A 4DR6B 2WLLB 3QF7A 1UPGA 4JYAB 1RP3B 4TOIA 4QE9A 3CP1A 2UU9B 1D5NA 4MVOA 3AK2A 4FPPA 4G27B 1NTMH 1Y76A 2LQTA 5A2QN 5FNVB 3SPCA 5H5NA 4ZHQB 3CCEV 4O4HB 4NXNB 2HLDG 3E83A 4AQYB 2EILB 1F51A 3ZIAG 4D7TA 1L1FA 3ZJZA 1F4NA 1SS3A 4Q20A 2DYSB 2F66C 4BW5A 4LR3A 4EB6B 2OT5A 4DV6O 1BL8A 1JQ0A 2ITDC 1BT8A 5J2TB 4IYHA 3DSQA 1FPOA 3CX5F 3T1CA 1XQ8A 1SERA 1MNGA 3UQ8A 3CJHA 1ROPA 1TA8A 4JTDB 2EIMC 3RVZA 1QHTA 2YI9A 4KL1A 1HP8A 5B1OA 1Q5OA 2X6CA 4MVQA 4YIPA 2EILC 4FLXA 2Q73A 2GUZB 2FTKA 3ABLB 1COWG 2IM9A 4MSWC 3D3IA 1HNWO 2EINC 4J41A 3WB1A 2WPDG 3P3NA 2IU3A 4GCZA 2GBOA 3RYIB 3THOA 4PDRA 5JQGA 4DV7O 3CCJV 4UB6Z 3H1LH 4I50A 2VQEB 5HFMA 5IT9N 2M6YA 1PL0A 1QLEB 3RYHA 4J11A 2MW2B 2Q5ZA 4MTFA 2E74B 1TUBA 2R72A 2CE4A 3VBBA 3M8AA 2UXDO 4WF9V 4KHPO 2RCVA 1KQSU 4LF8O 2E5LB 5EBLC 3ABLC 4GX0A 3ZRVA 4DR4O 4X62B 1XL6A 1LNQA 3KKYA 2QTSA 4LH6A 3CCMV 2BOCC 4YXWG 4DUYB 1YCIA 3CRMA 4WFEA 4RAIA 4GX5A 2QGNA 3AG4C 1SC5B 3IC7A 3AK1A 2JGDB 3DC6A 3CXHF 4MTGA 4G28B 4DW1A 3STZC 1BMFG 1QLEC 1CP9A 2FKXA 1OV9A 4JI7O 4L8JA 3JARB 3WU2Z 4JYAO 3L9DA 3ASNB 1Q6HA 1XMOO 4YJ2B 3A0RA 3CEIA 1JCHA 1NS1A 3MAQA 1IXMA 4TQFA 1XI1A 1ZSPA 1Q90D 3KG2A 1L0NH 2O57A 3JAWB 4DV0B 3L70H 1PNMA 1ZLZA 5LMUO 4XDLA 4GKKB 1XHZA 4TT3G 3JYCA 3BAAA 2KG7A 4MS2A 1TAEA 1AJPA 1S72V 4NKGB 4MW8A 1SESA 1VF7A 4NXNO 1BQ0A 2YSUB 1GN2A 1WJZA 5EYPB 4PA4A 5E79Z 4CC6A 4AILC 2L6LA 3FYIB 2IH3C 1AJNA 3X2QC 1JX9A 1GKFA 4LFAB 4LF9O 3OTFA 2G38A 1GRJA 3Q4HB 4UXNA 3P30A 3LDCA 2GTAA 3E8BA 3C3SA 4FMTA 4R50A 3MHSC 1IXBA 2YIBA 3W7WA 1YSCA 4JYCA 2HKOA 2WLNA 3CCSV 1KD1W 4HZ3A 3K0DA 4DR1O 4WFBV 1S5JA 2BSKA 2HVKC 3SJCC 4ASUG 2P6JA 2ZE6A 5TISZ 3T4ZA 1XNQO 2YIBD 1GTOA 1IVSA 2HFEC 4GX1A 1AI5A 2H3OA 5FL7G 1SA0A 4LWSB 1PM9A 3RBZA 3ZRWA 1KBHA 1NQTA 2XNDG 4P30A 5ITZA 5A9GA 1EM1A 4WCEV 4JI1O 4UCVA 3RYCA 1YHQV 3LUTB 1M9NA 1QR9A 3BCCH 3CCVV 3K0GA 1JJOA 3F5WC 4RO2A 3SPGA 2QM8A 3BHPA 3ZMZA 4B7EA 4JI2O 2FYUH 3HKCA 2YXLA 4J9YB 4LF4B 3FX7A 4O2BB 2XAHA 1NR1A 4JZGA 5L3EA 2Y69B 2XOKG 2ZINA 3N2KB 1FXKC 1S3JA 1BZKA 1WA8A 4I55A 4DUYO 2LW1A 5EIBD 3ZX6A 1OCRC 3G6BA 3E2EA 1NVPB 1XEQA 1Q81W 2F4VB 3UT5A 2E76B 1N32B 2LW7A 3I5DA 2Q9LA 2X7RB 3JSLA 2IJKA 3OR7C 2NNUA 1VQ7V 3SYQA 3U11A 1OHHG 3CC2V 3IGAC 1EN4A 4DR2O 4RQEA 4UFZA 1I5YA 4TQDA 1G6UA 4CBCA 4E4EA 4DRXB 2Q0OC 5LXTA 4K8XA 1GAXA 3ZN1A 2DWEC 2QWQB 3G80A 3ICXA 1IBMB 3K03A 2UXXA 1DF5A 5FPOA 1J5EB 3T1HB 3HKDB 5LGUA 4PDLA 4YY3B 2Y4TA 1F23A 3ETQA 4H0LB 2NLJC 5LGTA 4BIZA 2BCCH 1IDSA 4X1KB 1W2BU 2V4DA 2JIZG 1IBLO 5LMNB 1BS3A 4LCUC 1V54C 4JI8O 3ETGA 2IJHA 4MVMA 1K92A 2ZCEA 2HG5C 3VOUA 4X1YB 2EZPA 1UJWB 1IBKB 3FAVB 5DN6G 2HJDA 4Z2WA 4CZZA 2KKWA 1R73A 1M57B 4I0XA 1YJNV 2DMXA 2ZNIA 1SQFA 1YTFB 2W0XA 4X1IB 3VQYA 1AILA 1EZVH 4JI5B 3CXCU 3JD3A 1YIJV 3BABA 3FD9A 2ZXWB 5LHHA 3SYOA 3RN4A 3OGIB 1E1RG 2WAMA 1M56B 3A2FA 3RT3C 3C90A 3QNEA 5BMVB 3SYPA 1JR9A 2VRZA 4PJ0Z 5LOVB 1H2LA 3A0BZ 4N21A 2EJRA 1H8HG 3OEEG 2Y48A 4TV9B 4HNAB 4BIUA 5IY5C 1FYJA 2B1IA 1K97A 3ABUA 1KP2A 1K8AW 5KHKA 2L35A 2HP8A 3H9VA 3CCUV 3TETA 2W6JG 1M57C 2JEUA 4BR6A 4DV6B 2JEXA 1FJGO 5JCOA 3CC7V 2CK3G 1L0LH 3T4DA 3FB6C 3HKEB 1VQPV 2FMLA 4PI0A 1CPYA 2H94A 3HKBB 1G8MA 3NXSA 4HAMA 1VF6C 5HFLA 1M56C 4CS4A 1P7GA 5IJ0B 2YIDA 3PJSK 4FZ1A 4JI3O 1TVKA 4LNUA 1P49A 4PA3A 1Y74A 4U7NA 1X4TA 3QO7A 3CD6V 4K35A 5GONB 4Z1MG 4J7ZA 4JAUA 3S3XA 4X65O 5B1AB 5LP6C 2ZR2A 2RJZA 1HNWB 1ORQC 4LFCO 5KHGA 1MZEA 3N2GB 4B3MO 2WWWA 3AG2B 1H2SB 3LNMB 3QG5A 2DJVA 4IIJB 1KU9A 2EBOA 4UVCA 5FNVA 4TUYA 1M4UA 4ZHQA 5CA3A 3B8NA 3K5OA 4O4HA 2QWNB 3E8HA 4O4IB 1HR0O 1S77D 2UXDB 3DXRA 2YIAA 4KHPB 3BY6A 4U3JB 4LF8B 3FB7C 5E1AC 2Q8VA 1V55C 3CWBH 4MT8A 4D7SA 3DC5A 1O9GA 2YI8A 1VQKV 4DR4B 1Q86W 4EB6A 3H1JH 1E1QG 4DR5O 2WA3A 5LMNO 4PI2A 2RN9A 5J2TA 2HVJC 2LFSA 1ZTEA 4J7KA 5KA5A 1JOYA 2Z0AA 5K1XA 3GWKC 3OE7G 1SQBH 2UXBO 4PDMA 2Q6AA 4JI7B 1I5XA 1RM1C 1R6NA 1OCZC 1Q7YW 4X8AA 4NYKA 1XMOB 2PYJA 4JI5O 4QE7A 2OTJV 2XASA 1Q82W 2GUZA 2UXCO 1U97A 4JV5O 4DO2A 4LH7A 4R6ZA 5LMUB 3JALA 4F4LA 5GTIZ 1OCCB 2YICA 4JASA 1R3LC 3RYIA 1V9PA 2N74A 2EIMB 2OCCB 4B3RO 2AZ2A 4XDJA 1KYOF 1R1BA 1X59A 4ZOLA 4DV5B 1H2GA 2DQ0A 2LO1A 3OGCC 3HB3B 2DOSA 4IYIA 1IX9A 5CMUA 4O4LB 2EINB 3AG1C 1HW7A 1HWYA 4LF9B 2OWOA 2CTRA 4FFBB 5LYJB 4CH5A 3JD0A 1Y67A 4JTCB 4CS3A 2RNBA 1AR5A 5L3FA 4ABMA 1S76D 4E2LA 5EBWC 2V7QG 2A3QA 3ABTA 4I9WA 5B5EZ 1OCCC 3FYEB 4DR1B 3IC9A 1FFXB 3MHHC 4J10A 4UB8Z 1W59A 4P9PA 4DR3O 2OCCC 5C8YB 4DK0A 3CCLV 1B6QA 2UUBO 3K04A 5EZYB 4FM1A 1B04A 3ABKC 1YVWA 4MVSA 1XOUA 5KUMA 1MSWD 2WSSG 1XNQB 3IAYA 1K34A 2QA4V 2ADPA 3JARA 1WLEA 2YXHA 2VQFO 4O4JA 1XNRB 1VP7A 1AB3A 3AG4B 2IJIA 2F43G 4JI1B 5CBGA 4MVRA 4YIOA 1XUQA 3JAWA 5B3SB 4GT1A 4X64O 1M1KW 1URFA 3K5LA 1W0KG 3J81N 4FLZA 3ETDA 4X20B 1P84F 4WBNB 3A8TA 1Y76B 2X0LA 5L3CA 2BOBC 4PDVA 4JI2B 5GW7A 1Y4MA 5DECA 5KUKA 3L75H 1Q3EA 2ZE5A 2OIGA 3N27A 5EYPA 1AI7A 4RWUA 3KZIZ 2JJ1G 1BGYH 1OCOC 5IE9A 1IURA 4K3AA 1SQXH 1KP3A 1I7FA 1ZX3A 1D5AA 3F7YC 1VIBA 4DV2O 2VWKA 4QIWF 1NBMG 5AG2A 2LGWA 4NR1A 5B3SC 1WP8A 2QR4A 5CN0A 1H38A 3CJHB 5KAIZ 3CRRA 4U3FH 3X2QB 2IH1C 4DR2B 3UKMA 4DW0A 1BHBA 1N33O 1VQ6V 4UVBA 3CE2A 2EIKC 1JPXA 4HBNA 3QO8A 3UO2A 2Z5UA 1PKXA 4PV1B 3EXAA 3AG7A 1MSDA 1ZUQA 5JJEB 2XUMA 2YXYA 4CC5A 1EFRG 4LWSA 3OMAB 2QE7G 1HNZB 2E3CA 1KKDA 2XHBA 2OYQA 1AR4A 5KX5B 2OTLV 4DV5O 2QTOA 2B1GA 2D3OW 1QVFU 2X6BA 1N4CA 4BAYA 4HYOA 1MOFA 4O2AB 4W4KA 1YI2V 2HHHO 1IBLB 4FLVA 4O2BA 1BHAA 1VQNV 4JI8B 4BW9A 4I4TB 1QBZA 3CYOA 2R70A 3JAKB 1SQPH 1R3IC 3E8GA 4PA7A 3TXSA 2Z3YA 3N2KA 5LGNA 1GN3A 3RYFA 4YHHO 3ABMB 2ZR3A 4K0KO 5KMGB 2XAQA 2WLMA 2UXNA 1AR1B 3ML0A 3DGEA 4NTXA 1I0HA 2F93B 2A79B 4MTXA 1FXKB 4FM2A 2LJ2A 1XNRO 1OCRB 3CRQA 3ZS8C 4UCOA 3TCUA 1NVPD 1AROP 2Q4PA 2K9PA 5JVDB 4DRXA 2ETNA 3W7SA 1WN7A 4IGGA 2DW4A 5GTHZ 4JPRA 3FB8C 1K4CC 4JGSA 3OFNG 3CHXA 2WA4A 5CA0A 1FJGB 2PUSA 2CDYA 3ABMC 3D36A 2GTSA 3SPJA 5LA6B 2JRIA 3HKDA 2B5UA 4EFEA 3M99B 2QDOA 2ZDIA 5IYZB 4KXRA 4JI3B 1SQVH 4EKWA 3MD0A 2DYRC 5J2UA 2YEVB 1EZJA 3JD1A 5IYBO 2ZE8A 5CBHA 3LSUA 2YC0A 1VQ9V 1Q43A 1Q6UA 3FAVA 2PYLA 1G4YB 4DR7O 4X65B 1BSMA 3JATB 3OUFA 3E86A 4LFCB 4X1IA 4DUZO 3F5TA 3ZHQA 1V54B 1H2MA 2QWOB 4B3MB 2ZKOA 1ENVA 5L3DA 1NTKH 5B1BC 1UFIA 1M5IA 2LP7A 5BMVA 4TSFG 4GLXA 4X66B 4FLWA 1FXHA 2H8PC 1YTFD 5CB4A 1F4MA 1FFTB 4TV9A 3ASOC 2Q7EA 5JH7A 1HR0B 4HNAA 1HNZO 2Q69A 5KHIA 3K57A 4DV1O 4GX2A 3GVMA 1R3JC 2AHZA 1RSOB 1Q8IA 4OX9O 4IHJA 4PA9A 4DV3O 5FPRA 2DQ3A 4CS2A 3ZN0A 4DR5B 4JI4O 2ITCC 2QWPB 3R66A 2UUAO 2WLIB 4XBFA 3HKEA 1RFYA 3ZMSA 5IY5B 1L8DA 3HKBA 3WG7C 1VARA 3OT7A 1I08A 3G67A 3F7VC 2AW9A 1VQLV 2UXBB 5IJ0A 4AHCA 4EEQA 1WA8B 5KLVH 1I94O 3ZRSA 1NZ6A 5CA1B 4GKJO 3CMEV 3LDEA 1ZL8B 3FB5C 3BA8A 1KC8W 2UXCB 3VQWA 4CH3A 4JV5B 3JD4A 5GONA 1YITV 1S5HC 3B2EE 3SJQC 3NR7A 3STLC 4MVUA 4UCSA 4JYYA 4JZ2A 1MA1A 2CH7B 2GSMB 5EIBC 3SJAC 2R9AA 4B3SO 2ODMA 1SQQH 3K3WA 4N23A 3H1HH 3N2GA 4B3RB 1TUEB 4BWAA 3K5NA 4TV8B 3OMNB 1QU7A 4WFHA 2QKCA 5IYDO 2LFRA 3L74H 4U7OA 3OD4A 3APOA 4IIJA 3OEHG 2ZIMA 3BA9A 5LP6B 4KUMA 4F6RB 4O4IA 1GM7A 4PD4F 2JGUA 1Z5WA 2OIEA 3JASB 4FJCC 2AGAA 1QVGU 5JJNB 1SF9A 3T1YO 3ZMTA 1FAFA 1N0JA 1BQZA 2P7TC 1DK1A 4CH6A 2PF4E 3E89A 3B4SA 1NH2D 3T2MA 3J7AU 4Q6GA 4DR3B 2UUBB 3A0HZ 1SZXA 1DTOA 2BE3A 1WB7A 3EVKA 1QR8A 3H1IH 3L73H 2K1EA 1TGOA 1AVMA 1V55B 5LBQA 5DEDA 3BPZA 3E8FA 3WFVA 3IFXA 2WLLA 2BTQB 4UCUA 4LF7O 3L71H 2VQFB 1WNSA 5JWPA 2ZM6O 3K59A 1BCCH 2F23A 1NJIW 4YJ3B 4X64B 1PL4A 4X66O 1DGSA 1RM1B 1OCZB 2AHYA 1XMQO 1WP7A 5IJ9B 1EBOA 2KQXA 1THZA 3QO5A 1M93A 4DXWA 4JTAB 2Q68A 3CRAA 1E79G 4J42A 2IBZH 2ZT9B 4A5UB 2P5OA 1GK9A 1LUWA 2CTWA 2GDSA 4ICGA 4D6TH 2ZNJA 3G4SV 2Q7HA 4LF6O 1QNMA 1S5LZ 3SGIA 4FFBA 3K08A 5LYJA 4DV4B 4DV2B 4PELA 3E35A 5DM6V 3O9OA 4FK5C 1ZWIC 2PTMA 2BTOA 1FS0G 2F95B 1JMKC 3OAAG 3AEIA 4X89A 3P3PA 4GZRB 3AG1B 3B77A 2EIJC 3ZMVA 1MG1A 3UCSC 5C8YA 3SPIA 4LNUB 3OTOO 5EZYA 1Y74B 1N33B 2NR5A 3ZHTA 1BE3H 3W7TA 4ZI7B 3KCYA 1YXBA 1Z2GA 1OJHA 3CPWU 5B1NA 3AG3C 5JCOC 5KHJA 4LFBO 3WB0A 3OM3B 4J9ZB 5LL6Y 2Y0IA 1MZFA 3ABKB 3JD2A 2VS0A 3FFQA 2ADQB 1CXZB 4OGQB 2A7WA 4X20A 3H01A 4WBNA 3OR6C 3BFRA 2N04A 4TUYB 2JS3A 3D8CA 4JI6B 4C7UA 4ZKIA 2HHHB 3B40A 1RPRA 1Y66A 5IWAB 3LSQA 1VQ5V 1K73W 3DXRB 3QTCA 4UCTA 4UV9A 5F2VO 1XDCA 5H9CA 1NI8A 2JJ2G 3I55V 3PN1A 1ZAUA 4RUEA 1NTZH 5H6RA 4B08A 1K33A 4YHHB 1T5EA 1KMIZ 1MMMA 4K0KB 2ILMA 4RUFA 1JFFB 2JGDA 3LSSA 4IL6Z 3W7UA 1VQ8V 1WPBA 2UUCB 1KECA 2Q67A 4H44B 3U0ZA 3E22B 3CS5A 1OCOB 3K58A 2GHYA 4FZ0A 3OUSA 2V1DA 4YJ2A 2Y4UA 1PD3A 2QKAA 1G1XB 2W0FC 3WB2A 1PNLA 3TXQA 5C93A 5KA6A 4LF5O 4RQFA 2DYSC 1PNKA 3JALB 2CTQA 4JAVA 1B06A 4OPHA 2CUGA 1GMGA 4JI0O 4FVMA 4QNHB 5LHIA 2XAJA 4FLYA 3SJBC 2EX3A 2JS5A 1NKDA 3BRCA 3ZHUA 4ZIBA 5KX5A 2EIKB 5BY1A 4ZOLB 3P32A 1EN6A 3B09A 4O2AA 4J7JA 2XAFA 5BXZA 1J95A 3D3QA 3Q4HA 2B9ZA 4DV4O 2AZ0A 1N34O 4I4TA 1JJ2U 3SYCA 3CSXA 3JAKA 4B3TO 2QKSA 4DR7B 1A32A 5D5QA 2PI4A 4DUZB 5KMGA 2XT9A 2HJFC 5FLXN 4WFFA 3TGUH 4EFBA 2EZOA 1AJQA 3L72H 4K8ZA 3HPLC 2CGOA 1WAZA 1AP6A 2EJ7A 4DR6O 1SKVA 5BR8B 1FXKA 1AI6A 4G2KA 1CEZA 1K5SA 2WLHA 4FLTA 3ZHRA 4O4JB 1FD9A 5LHGA 2PGGA 5JQGB 4I50B 5JVDA 4DV1B 1XBLA 4FLUA 1JA8A 2UU9O 3K06A 1P4RA 2D2CB 3RYHB 1Z5VA 4OX9B 4X9QA 4FFKA 4LBEC 1TUBB 2QM4A 4DV3B 4MW3A 4R7CA 3JCUZ 2Q0AA 4JI4B 4JI6O 2W6IG 2FB5A 2X6AA 5IYCO 2UUAB 4AQYO 5IWAO 1KKCA 3MDSA 4LC1A 5LA6A 4DK1A 1XILA 1Q6IA 2DWDC 4KFMA 2NN4A 4XDKA 1HDJA 3ETEA 1QLNA 2GV9A 5IYZA 3K79A 1I94B 5B66Z 3ASNC 4GKJB 2IJJA 2CGNA 2YEVA 2C2AA 4P9OA 3JCZA 4PA6A 2P90A 3DTUB 1GH6A 2UUCO 4KP4A 3CRCA 2ARHA 5L3GA 4UUJC 3CB2A 1FXVA 1K9MW 3JATA 4X88A 2DYRB 4L87A 4B3SB 3K9AA 2RDCA 1K4DC 1R6TA 2LGQA 3JAMN 1O9HA 1MABG 1XL4A 3CCRV 1LUVA 1QQCA 3K9SA 3O65A 1N36B 4FM0A 5H6QA 3G71V 1KUQA 2MK3A 1WB8A 2KG7B 1FKAO 1DLBA 3B8MA 1H8EG 1SETA 3W7XA 4CH4A 2P4VA 3S3WA 3TK1A 4JAAA 2A06H 3RFRA 1F7YA 4QPJA 2VQEO 1HNXB 5B1BB 2HEPA 3T1YB 5EC2C 1RSOA 5IDJA 3SPHA 1K3EA 4GYCB 2QJ1A 2P22C 3QVNA 4X1KA 1VQ4V 1RPOA 1S0VA 2WLIA 4IT5A 3ASOB 2Q7GA
chains in the Genus database with same CATH topology
2AXTZ 3A0HZ 5B66Z 3JCUZ 5KAIZ 3KZIZ 4IL6Z 3WU2Z 5TISZ 1S5LZ 5GTHZ 5B5EZ 5H2FZ 4PJ0Z 5KAFZ 5E79Z 3A0BZ 4UB8Z 5GTIZ 4UB6Z
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AXT Z;  3A0H Z;  5B66 Z;  3JCU Z;  5KAI Z;  3KZI Z;  4IL6 Z;  3WU2 Z;  5TIS Z;  1S5L Z;  5GTH Z;  5B5E Z;  5H2F Z;  4PJ0 Z;  5KAF Z;  5E79 Z;  3A0B Z;  4UB8 Z;  5GTI Z;  4UB6 Z; 
#chains in the Genus database with same CATH topology
 2E5L O;  1W0J G;  1JVM A;  4WFG A;  3VQV A;  4QGP A;  2JK5 C;  3GB7 C;  4X1Y A;  3M7M X;  3OMI B;  4X62 O;  2JVD A;  4LF7 B;  5CA1 A;  3RYF B;  2BSK B;  1GO3 F;  2DE0 X;  1XHX A;  2FL4 A;  1SQG A;  1ZL8 A;  2VWJ A;  1N8R W;  5EC1 C;  4PHZ A;  1PPJ H;  2ZM6 B;  3BEH A;  1VF6 A;  3WG7 B;  2XAG A;  2AXT Z;  1GM9 A;  4P2Z A;  5BR8 O;  2QWR B;  5LOV A;  1M90 W;  2ZQM A;  3FKS G;  1B3Q A;  2CH7 A;  3SYA A;  1XMQ B;  1SA0 B;  1EN5 A;  5KHH A;  3ZRW B;  2QSA A;  3SR2 C;  2A9H A;  5ITZ B;  4TV8 A;  3RYC B;  2N05 A;  3LDD A;  4DV0 O;  3UM7 A;  1AI4 A;  1R6K A;  1GM8 A;  4NXM B;  2Y69 C;  4GKK O;  2ZIO A;  2CTP A;  5LP6 A;  2RQ6 A;  5CA0 B;  4F6R A;  3HKC B;  4LF6 B;  3BVO A;  3VQX A;  3JAS A;  1YJ9 V;  2XTA A;  4NVP A;  5H2F Z;  4H33 A;  2RMK B;  2QM7 A;  3ZCC A;  1KB9 F;  2EUL A;  2JDI G;  3CMA V;  3RVY A;  1US6 A;  5CBF A;  4I55 B;  4B7K A;  4LFA O;  2R9I A;  3RGB A;  2HR3 A;  3EFF K;  2KB1 A;  1OZ0 A;  5J2U B;  3OTO B;  4QPK A;  4W4L A;  2IU0 A;  4TWK A;  3APQ A;  3UT5 B;  5JJJ B;  3ZHV A;  3ZED A;  1IZ3 A;  4I9Q A;  2OCH A;  1VQO V;  2BTQ A;  2R9R B;  2ATK C;  2P67 A;  3RWR D;  4R8C A;  4LFB B;  1PV0 A;  3D36 C;  1SRY A;  2WLJ A;  4YJ3 A;  1N36 O;  5LXT B;  2ZDI C;  2ZE7 A;  1YF2 A;  5IJ9 A;  5CB4 B;  4J80 A;  4MTO A;  4NTY A;  3ZMU A;  5JH7 B;  4JF3 A;  3IJ4 A;  1VF5 B;  3C3T A;  1K5Q A;  1VEW A;  4U3J A;  1HNX O;  1VMG A;  3G6E V;  1WPX A;  4IHJ B;  1D2D A;  3ZHS A;  4I7Z B;  2KSD A;  1Y6X A;  2PY5 A;  1NR7 A;  1GN4 A;  1LR1 A;  5J9P C;  2WLK A;  1U96 A;  1XRE A;  1DF4 A;  4LF4 O;  2ZXW C;  4OXS A;  1R3K C;  1NU1 H;  3K5M A;  4FIP C;  3KCX A;  1GN6 A;  2Y0P A;  3GWO A;  3H1K H;  4JYB A;  1SZT A;  4I0X B;  2IW5 A;  1YJW V;  3TJT A;  2YDE A;  4I5S A;  1N0N A;  2F4V O;  3U10 A;  1N32 O;  5D5P A;  4NTW A;  3OW2 U;  2M7W A;  3RW0 A;  1H2K A;  1YEW A;  4F6E A;  5EBM C;  3CC4 V;  4BIO A;  4ZI7 A;  3J80 N;  3I56 V;  4LF5 B;  4WFA V;  2QEX V;  1H2N A;  2EIJ B;  4AI8 A;  4JI0 B;  4H13 B;  4ZBM A;  1YDX A;  2PI5 A;  3EHB B;  4DV7 B;  4QJF B;  4LP8 A;  4MVZ A;  2P4K A;  4OPA A;  2CAZ C;  4NXM O;  3HR0 A;  2YUA A;  5K1P A;  4O4L A;  4UVA A;  5BZB A;  3AK3 A;  3AG3 B;  1NH2 B;  1IBM O;  2ZD9 A;  4DYL A;  4Z1V A;  1NT2 B;  1J5E O;  5KAF Z;  3T1H O;  1K7D A;  1YZB A;  1N34 B;  2YS8 A;  1PP9 H;  2F1M A;  4YY3 O;  2P06 A;  4UV8 A;  3LNN A;  4B3T B;  3ZRX A;  1VQM V;  2A0L A;  5EK0 A;  4GUN A;  1QCE A;  3CCQ V;  5B1A C;  5L3B A;  3JSN A;  1P7B A;  1FFX A;  1TVK B;  3UO3 A;  3R65 A;  2E75 B;  1JFF A;  4UCR A;  3ZBH A;  2DN9 A;  3SDL A;  4H37 A;  3AG2 C;  1AP5 A;  1IBK O;  2PZS A;  4NB5 A;  3E22 A;  4DR6 B;  2WLL B;  3QF7 A;  1UPG A;  4JYA B;  1RP3 B;  4TOI A;  4QE9 A;  3CP1 A;  2UU9 B;  1D5N A;  4MVO A;  3AK2 A;  4FPP A;  4G27 B;  1NTM H;  1Y76 A;  2LQT A;  5A2Q N;  5FNV B;  3SPC A;  5H5N A;  4ZHQ B;  3CCE V;  4O4H B;  4NXN B;  2HLD G;  3E83 A;  4AQY B;  2EIL B;  1F51 A;  3ZIA G;  4D7T A;  1L1F A;  3ZJZ A;  1F4N A;  1SS3 A;  4Q20 A;  2DYS B;  2F66 C;  4BW5 A;  4LR3 A;  4EB6 B;  2OT5 A;  4DV6 O;  1BL8 A;  1JQ0 A;  2ITD C;  1BT8 A;  5J2T B;  4IYH A;  3DSQ A;  1FPO A;  3CX5 F;  3T1C A;  1XQ8 A;  1SER A;  1MNG A;  3UQ8 A;  3CJH A;  1ROP A;  1TA8 A;  4JTD B;  2EIM C;  3RVZ A;  1QHT A;  2YI9 A;  4KL1 A;  1HP8 A;  5B1O A;  1Q5O A;  2X6C A;  4MVQ A;  4YIP A;  2EIL C;  4FLX A;  2Q73 A;  2GUZ B;  2FTK A;  3ABL B;  1COW G;  2IM9 A;  4MSW C;  3D3I A;  1HNW O;  2EIN C;  4J41 A;  3WB1 A;  2WPD G;  3P3N A;  2IU3 A;  4GCZ A;  2GBO A;  3RYI B;  3THO A;  4PDR A;  5JQG A;  4DV7 O;  3CCJ V;  4UB6 Z;  3H1L H;  4I50 A;  2VQE B;  5HFM A;  5IT9 N;  2M6Y A;  1PL0 A;  1QLE B;  3RYH A;  4J11 A;  2MW2 B;  2Q5Z A;  4MTF A;  2E74 B;  1TUB A;  2R72 A;  2CE4 A;  3VBB A;  3M8A A;  2UXD O;  4WF9 V;  4KHP O;  2RCV A;  1KQS U;  4LF8 O;  2E5L B;  5EBL C;  3ABL C;  4GX0 A;  3ZRV A;  4DR4 O;  4X62 B;  1XL6 A;  1LNQ A;  3KKY A;  2QTS A;  4LH6 A;  3CCM V;  2BOC C;  4YXW G;  4DUY B;  1YCI A;  3CRM A;  4WFE A;  4RAI A;  4GX5 A;  2QGN A;  3AG4 C;  1SC5 B;  3IC7 A;  3AK1 A;  2JGD B;  3DC6 A;  3CXH F;  4MTG A;  4G28 B;  4DW1 A;  3STZ C;  1BMF G;  1QLE C;  1CP9 A;  2FKX A;  1OV9 A;  4JI7 O;  4L8J A;  3JAR B;  3WU2 Z;  4JYA O;  3L9D A;  3ASN B;  1Q6H A;  1XMO O;  4YJ2 B;  3A0R A;  3CEI A;  1JCH A;  1NS1 A;  3MAQ A;  1IXM A;  4TQF A;  1XI1 A;  1ZSP A;  1Q90 D;  3KG2 A;  1L0N H;  2O57 A;  3JAW B;  4DV0 B;  3L70 H;  1PNM A;  1ZLZ A;  5LMU O;  4XDL A;  4GKK B;  1XHZ A;  4TT3 G;  3JYC A;  3BAA A;  2KG7 A;  4MS2 A;  1TAE A;  1AJP A;  1S72 V;  4NKG B;  4MW8 A;  1SES A;  1VF7 A;  4NXN O;  1BQ0 A;  2YSU B;  1GN2 A;  1WJZ A;  5EYP B;  4PA4 A;  5E79 Z;  4CC6 A;  4AIL C;  2L6L A;  3FYI B;  2IH3 C;  1AJN A;  3X2Q C;  1JX9 A;  1GKF A;  4LFA B;  4LF9 O;  3OTF A;  2G38 A;  1GRJ A;  3Q4H B;  4UXN A;  3P30 A;  3LDC A;  2GTA A;  3E8B A;  3C3S A;  4FMT A;  4R50 A;  3MHS C;  1IXB A;  2YIB A;  3W7W A;  1YSC A;  4JYC A;  2HKO A;  2WLN A;  3CCS V;  1KD1 W;  4HZ3 A;  3K0D A;  4DR1 O;  4WFB V;  1S5J A;  2BSK A;  2HVK C;  3SJC C;  4ASU G;  2P6J A;  2ZE6 A;  5TIS Z;  3T4Z A;  1XNQ O;  2YIB D;  1GTO A;  1IVS A;  2HFE C;  4GX1 A;  1AI5 A;  2H3O A;  5FL7 G;  1SA0 A;  4LWS B;  1PM9 A;  3RBZ A;  3ZRW A;  1KBH A;  1NQT A;  2XND G;  4P30 A;  5ITZ A;  5A9G A;  1EM1 A;  4WCE V;  4JI1 O;  4UCV A;  3RYC A;  1YHQ V;  3LUT B;  1M9N A;  1QR9 A;  3BCC H;  3CCV V;  3K0G A;  1JJO A;  3F5W C;  4RO2 A;  3SPG A;  2QM8 A;  3BHP A;  3ZMZ A;  4B7E A;  4JI2 O;  2FYU H;  3HKC A;  2YXL A;  4J9Y B;  4LF4 B;  3FX7 A;  4O2B B;  2XAH A;  1NR1 A;  4JZG A;  5L3E A;  2Y69 B;  2XOK G;  2ZIN A;  3N2K B;  1FXK C;  1S3J A;  1BZK A;  1WA8 A;  4I55 A;  4DUY O;  2LW1 A;  5EIB D;  3ZX6 A;  1OCR C;  3G6B A;  3E2E A;  1NVP B;  1XEQ A;  1Q81 W;  2F4V B;  3UT5 A;  2E76 B;  1N32 B;  2LW7 A;  3I5D A;  2Q9L A;  2X7R B;  3JSL A;  2IJK A;  3OR7 C;  2NNU A;  1VQ7 V;  3SYQ A;  3U11 A;  1OHH G;  3CC2 V;  3IGA C;  1EN4 A;  4DR2 O;  4RQE A;  4UFZ A;  1I5Y A;  4TQD A;  1G6U A;  4CBC A;  4E4E A;  4DRX B;  2Q0O C;  5LXT A;  4K8X A;  1GAX A;  3ZN1 A;  2DWE C;  2QWQ B;  3G80 A;  3ICX A;  1IBM B;  3K03 A;  2UXX A;  1DF5 A;  5FPO A;  1J5E B;  3T1H B;  3HKD B;  5LGU A;  4PDL A;  4YY3 B;  2Y4T A;  1F23 A;  3ETQ A;  4H0L B;  2NLJ C;  5LGT A;  4BIZ A;  2BCC H;  1IDS A;  4X1K B;  1W2B U;  2V4D A;  2JIZ G;  1IBL O;  5LMN B;  1BS3 A;  4LCU C;  1V54 C;  4JI8 O;  3ETG A;  2IJH A;  4MVM A;  1K92 A;  2ZCE A;  2HG5 C;  3VOU A;  4X1Y B;  2EZP A;  1UJW B;  1IBK B;  3FAV B;  5DN6 G;  2HJD A;  4Z2W A;  4CZZ A;  2KKW A;  1R73 A;  1M57 B;  4I0X A;  1YJN V;  2DMX A;  2ZNI A;  1SQF A;  1YTF B;  2W0X A;  4X1I B;  3VQY A;  1AIL A;  1EZV H;  4JI5 B;  3CXC U;  3JD3 A;  1YIJ V;  3BAB A;  3FD9 A;  2ZXW B;  5LHH A;  3SYO A;  3RN4 A;  3OGI B;  1E1R G;  2WAM A;  1M56 B;  3A2F A;  3RT3 C;  3C90 A;  3QNE A;  5BMV B;  3SYP A;  1JR9 A;  2VRZ A;  4PJ0 Z;  5LOV B;  1H2L A;  3A0B Z;  4N21 A;  2EJR A;  1H8H G;  3OEE G;  2Y48 A;  4TV9 B;  4HNA B;  4BIU A;  5IY5 C;  1FYJ A;  2B1I A;  1K97 A;  3ABU A;  1KP2 A;  1K8A W;  5KHK A;  2L35 A;  2HP8 A;  3H9V A;  3CCU V;  3TET A;  2W6J G;  1M57 C;  2JEU A;  4BR6 A;  4DV6 B;  2JEX A;  1FJG O;  5JCO A;  3CC7 V;  2CK3 G;  1L0L H;  3T4D A;  3FB6 C;  3HKE B;  1VQP V;  2FML A;  4PI0 A;  1CPY A;  2H94 A;  3HKB B;  1G8M A;  3NXS A;  4HAM A;  1VF6 C;  5HFL A;  1M56 C;  4CS4 A;  1P7G A;  5IJ0 B;  2YID A;  3PJS K;  4FZ1 A;  4JI3 O;  1TVK A;  4LNU A;  1P49 A;  4PA3 A;  1Y74 A;  4U7N A;  1X4T A;  3QO7 A;  3CD6 V;  4K35 A;  5GON B;  4Z1M G;  4J7Z A;  4JAU A;  3S3X A;  4X65 O;  5B1A B;  5LP6 C;  2ZR2 A;  2RJZ A;  1HNW B;  1ORQ C;  4LFC O;  5KHG A;  1MZE A;  3N2G B;  4B3M O;  2WWW A;  3AG2 B;  1H2S B;  3LNM B;  3QG5 A;  2DJV A;  4IIJ B;  1KU9 A;  2EBO A;  4UVC A;  5FNV A;  4TUY A;  1M4U A;  4ZHQ A;  5CA3 A;  3B8N A;  3K5O A;  4O4H A;  2QWN B;  3E8H A;  4O4I B;  1HR0 O;  1S77 D;  2UXD B;  3DXR A;  2YIA A;  4KHP B;  3BY6 A;  4U3J B;  4LF8 B;  3FB7 C;  5E1A C;  2Q8V A;  1V55 C;  3CWB H;  4MT8 A;  4D7S A;  3DC5 A;  1O9G A;  2YI8 A;  1VQK V;  4DR4 B;  1Q86 W;  4EB6 A;  3H1J H;  1E1Q G;  4DR5 O;  2WA3 A;  5LMN O;  4PI2 A;  2RN9 A;  5J2T A;  2HVJ C;  2LFS A;  1ZTE A;  4J7K A;  5KA5 A;  1JOY A;  2Z0A A;  5K1X A;  3GWK C;  3OE7 G;  1SQB H;  2UXB O;  4PDM A;  2Q6A A;  4JI7 B;  1I5X A;  1RM1 C;  1R6N A;  1OCZ C;  1Q7Y W;  4X8A A;  4NYK A;  1XMO B;  2PYJ A;  4JI5 O;  4QE7 A;  2OTJ V;  2XAS A;  1Q82 W;  2GUZ A;  2UXC O;  1U97 A;  4JV5 O;  4DO2 A;  4LH7 A;  4R6Z A;  5LMU B;  3JAL A;  4F4L A;  5GTI Z;  1OCC B;  2YIC A;  4JAS A;  1R3L C;  3RYI A;  1V9P A;  2N74 A;  2EIM B;  2OCC B;  4B3R O;  2AZ2 A;  4XDJ A;  1KYO F;  1R1B A;  1X59 A;  4ZOL A;  4DV5 B;  1H2G A;  2DQ0 A;  2LO1 A;  3OGC C;  3HB3 B;  2DOS A;  4IYI A;  1IX9 A;  5CMU A;  4O4L B;  2EIN B;  3AG1 C;  1HW7 A;  1HWY A;  4LF9 B;  2OWO A;  2CTR A;  4FFB B;  5LYJ B;  4CH5 A;  3JD0 A;  1Y67 A;  4JTC B;  4CS3 A;  2RNB A;  1AR5 A;  5L3F A;  4ABM A;  1S76 D;  4E2L A;  5EBW C;  2V7Q G;  2A3Q A;  3ABT A;  4I9W A;  5B5E Z;  1OCC C;  3FYE B;  4DR1 B;  3IC9 A;  1FFX B;  3MHH C;  4J10 A;  4UB8 Z;  1W59 A;  4P9P A;  4DR3 O;  2OCC C;  5C8Y B;  4DK0 A;  3CCL V;  1B6Q A;  2UUB O;  3K04 A;  5EZY B;  4FM1 A;  1B04 A;  3ABK C;  1YVW A;  4MVS A;  1XOU A;  5KUM A;  1MSW D;  2WSS G;  1XNQ B;  3IAY A;  1K34 A;  2QA4 V;  2ADP A;  3JAR A;  1WLE A;  2YXH A;  2VQF O;  4O4J A;  1XNR B;  1VP7 A;  1AB3 A;  3AG4 B;  2IJI A;  2F43 G;  4JI1 B;  5CBG A;  4MVR A;  4YIO A;  1XUQ A;  3JAW A;  5B3S B;  4GT1 A;  4X64 O;  1M1K W;  1URF A;  3K5L A;  1W0K G;  3J81 N;  4FLZ A;  3ETD A;  4X20 B;  1P84 F;  4WBN B;  3A8T A;  1Y76 B;  2X0L A;  5L3C A;  2BOB C;  4PDV A;  4JI2 B;  5GW7 A;  1Y4M A;  5DEC A;  5KUK A;  3L75 H;  1Q3E A;  2ZE5 A;  2OIG A;  3N27 A;  5EYP A;  1AI7 A;  4RWU A;  3KZI Z;  2JJ1 G;  1BGY H;  1OCO C;  5IE9 A;  1IUR A;  4K3A A;  1SQX H;  1KP3 A;  1I7F A;  1ZX3 A;  1D5A A;  3F7Y C;  1VIB A;  4DV2 O;  2VWK A;  4QIW F;  1NBM G;  5AG2 A;  2LGW A;  4NR1 A;  5B3S C;  1WP8 A;  2QR4 A;  5CN0 A;  1H38 A;  3CJH B;  5KAI Z;  3CRR A;  4U3F H;  3X2Q B;  2IH1 C;  4DR2 B;  3UKM A;  4DW0 A;  1BHB A;  1N33 O;  1VQ6 V;  4UVB A;  3CE2 A;  2EIK C;  1JPX A;  4HBN A;  3QO8 A;  3UO2 A;  2Z5U A;  1PKX A;  4PV1 B;  3EXA A;  3AG7 A;  1MSD A;  1ZUQ A;  5JJE B;  2XUM A;  2YXY A;  4CC5 A;  1EFR G;  4LWS A;  3OMA B;  2QE7 G;  1HNZ B;  2E3C A;  1KKD A;  2XHB A;  2OYQ A;  1AR4 A;  5KX5 B;  2OTL V;  4DV5 O;  2QTO A;  2B1G A;  2D3O W;  1QVF U;  2X6B A;  1N4C A;  4BAY A;  4HYO A;  1MOF A;  4O2A B;  4W4K A;  1YI2 V;  2HHH O;  1IBL B;  4FLV A;  4O2B A;  1BHA A;  1VQN V;  4JI8 B;  4BW9 A;  4I4T B;  1QBZ A;  3CYO A;  2R70 A;  3JAK B;  1SQP H;  1R3I C;  3E8G A;  4PA7 A;  3TXS A;  2Z3Y A;  3N2K A;  5LGN A;  1GN3 A;  3RYF A;  4YHH O;  3ABM B;  2ZR3 A;  4K0K O;  5KMG B;  2XAQ A;  2WLM A;  2UXN A;  1AR1 B;  3ML0 A;  3DGE A;  4NTX A;  1I0H A;  2F93 B;  2A79 B;  4MTX A;  1FXK B;  4FM2 A;  2LJ2 A;  1XNR O;  1OCR B;  3CRQ A;  3ZS8 C;  4UCO A;  3TCU A;  1NVP D;  1ARO P;  2Q4P A;  2K9P A;  5JVD B;  4DRX A;  2ETN A;  3W7S A;  1WN7 A;  4IGG A;  2DW4 A;  5GTH Z;  4JPR A;  3FB8 C;  1K4C C;  4JGS A;  3OFN G;  3CHX A;  2WA4 A;  5CA0 A;  1FJG B;  2PUS A;  2CDY A;  3ABM C;  3D36 A;  2GTS A;  3SPJ A;  5LA6 B;  2JRI A;  3HKD A;  2B5U A;  4EFE A;  3M99 B;  2QDO A;  2ZDI A;  5IYZ B;  4KXR A;  4JI3 B;  1SQV H;  4EKW A;  3MD0 A;  2DYR C;  5J2U A;  2YEV B;  1EZJ A;  3JD1 A;  5IYB O;  2ZE8 A;  5CBH A;  3LSU A;  2YC0 A;  1VQ9 V;  1Q43 A;  1Q6U A;  3FAV A;  2PYL A;  1G4Y B;  4DR7 O;  4X65 B;  1BSM A;  3JAT B;  3OUF A;  3E86 A;  4LFC B;  4X1I A;  4DUZ O;  3F5T A;  3ZHQ A;  1V54 B;  1H2M A;  2QWO B;  4B3M B;  2ZKO A;  1ENV A;  5L3D A;  1NTK H;  5B1B C;  1UFI A;  1M5I A;  2LP7 A;  5BMV A;  4TSF G;  4GLX A;  4X66 B;  4FLW A;  1FXH A;  2H8P C;  1YTF D;  5CB4 A;  1F4M A;  1FFT B;  4TV9 A;  3ASO C;  2Q7E A;  5JH7 A;  1HR0 B;  4HNA A;  1HNZ O;  2Q69 A;  5KHI A;  3K57 A;  4DV1 O;  4GX2 A;  3GVM A;  1R3J C;  2AHZ A;  1RSO B;  1Q8I A;  4OX9 O;  4IHJ A;  4PA9 A;  4DV3 O;  5FPR A;  2DQ3 A;  4CS2 A;  3ZN0 A;  4DR5 B;  4JI4 O;  2ITC C;  2QWP B;  3R66 A;  2UUA O;  2WLI B;  4XBF A;  3HKE A;  1RFY A;  3ZMS A;  5IY5 B;  1L8D A;  3HKB A;  3WG7 C;  1VAR A;  3OT7 A;  1I08 A;  3G67 A;  3F7V C;  2AW9 A;  1VQL V;  2UXB B;  5IJ0 A;  4AHC A;  4EEQ A;  1WA8 B;  5KLV H;  1I94 O;  3ZRS A;  1NZ6 A;  5CA1 B;  4GKJ O;  3CME V;  3LDE A;  1ZL8 B;  3FB5 C;  3BA8 A;  1KC8 W;  2UXC B;  3VQW A;  4CH3 A;  4JV5 B;  3JD4 A;  5GON A;  1YIT V;  1S5H C;  3B2E E;  3SJQ C;  3NR7 A;  3STL C;  4MVU A;  4UCS A;  4JYY A;  4JZ2 A;  1MA1 A;  2CH7 B;  2GSM B;  5EIB C;  3SJA C;  2R9A A;  4B3S O;  2ODM A;  1SQQ H;  3K3W A;  4N23 A;  3H1H H;  3N2G A;  4B3R B;  1TUE B;  4BWA A;  3K5N A;  4TV8 B;  3OMN B;  1QU7 A;  4WFH A;  2QKC A;  5IYD O;  2LFR A;  3L74 H;  4U7O A;  3OD4 A;  3APO A;  4IIJ A;  3OEH G;  2ZIM A;  3BA9 A;  5LP6 B;  4KUM A;  4F6R B;  4O4I A;  1GM7 A;  4PD4 F;  2JGU A;  1Z5W A;  2OIE A;  3JAS B;  4FJC C;  2AGA A;  1QVG U;  5JJN B;  1SF9 A;  3T1Y O;  3ZMT A;  1FAF A;  1N0J A;  1BQZ A;  2P7T C;  1DK1 A;  4CH6 A;  2PF4 E;  3E89 A;  3B4S A;  1NH2 D;  3T2M A;  3J7A U;  4Q6G A;  4DR3 B;  2UUB B;  3A0H Z;  1SZX A;  1DTO A;  2BE3 A;  1WB7 A;  3EVK A;  1QR8 A;  3H1I H;  3L73 H;  2K1E A;  1TGO A;  1AVM A;  1V55 B;  5LBQ A;  5DED A;  3BPZ A;  3E8F A;  3WFV A;  3IFX A;  2WLL A;  2BTQ B;  4UCU A;  4LF7 O;  3L71 H;  2VQF B;  1WNS A;  5JWP A;  2ZM6 O;  3K59 A;  1BCC H;  2F23 A;  1NJI W;  4YJ3 B;  4X64 B;  1PL4 A;  4X66 O;  1DGS A;  1RM1 B;  1OCZ B;  2AHY A;  1XMQ O;  1WP7 A;  5IJ9 B;  1EBO A;  2KQX A;  1THZ A;  3QO5 A;  1M93 A;  4DXW A;  4JTA B;  2Q68 A;  3CRA A;  1E79 G;  4J42 A;  2IBZ H;  2ZT9 B;  4A5U B;  2P5O A;  1GK9 A;  1LUW A;  2CTW A;  2GDS A;  4ICG A;  4D6T H;  2ZNJ A;  3G4S V;  2Q7H A;  4LF6 O;  1QNM A;  1S5L Z;  3SGI A;  4FFB A;  3K08 A;  5LYJ A;  4DV4 B;  4DV2 B;  4PEL A;  3E35 A;  5DM6 V;  3O9O A;  4FK5 C;  1ZWI C;  2PTM A;  2BTO A;  1FS0 G;  2F95 B;  1JMK C;  3OAA G;  3AEI A;  4X89 A;  3P3P A;  4GZR B;  3AG1 B;  3B77 A;  2EIJ C;  3ZMV A;  1MG1 A;  3UCS C;  5C8Y A;  3SPI A;  4LNU B;  3OTO O;  5EZY A;  1Y74 B;  1N33 B;  2NR5 A;  3ZHT A;  1BE3 H;  3W7T A;  4ZI7 B;  3KCY A;  1YXB A;  1Z2G A;  1OJH A;  3CPW U;  5B1N A;  3AG3 C;  5JCO C;  5KHJ A;  4LFB O;  3WB0 A;  3OM3 B;  4J9Z B;  5LL6 Y;  2Y0I A;  1MZF A;  3ABK B;  3JD2 A;  2VS0 A;  3FFQ A;  2ADQ B;  1CXZ B;  4OGQ B;  2A7W A;  4X20 A;  3H01 A;  4WBN A;  3OR6 C;  3BFR A;  2N04 A;  4TUY B;  2JS3 A;  3D8C A;  4JI6 B;  4C7U A;  4ZKI A;  2HHH B;  3B40 A;  1RPR A;  1Y66 A;  5IWA B;  3LSQ A;  1VQ5 V;  1K73 W;  3DXR B;  3QTC A;  4UCT A;  4UV9 A;  5F2V O;  1XDC A;  5H9C A;  1NI8 A;  2JJ2 G;  3I55 V;  3PN1 A;  1ZAU A;  4RUE A;  1NTZ H;  5H6R A;  4B08 A;  1K33 A;  4YHH B;  1T5E A;  1KMI Z;  1MMM A;  4K0K B;  2ILM A;  4RUF A;  1JFF B;  2JGD A;  3LSS A;  4IL6 Z;  3W7U A;  1VQ8 V;  1WPB A;  2UUC B;  1KEC A;  2Q67 A;  4H44 B;  3U0Z A;  3E22 B;  3CS5 A;  1OCO B;  3K58 A;  2GHY A;  4FZ0 A;  3OUS A;  2V1D A;  4YJ2 A;  2Y4U A;  1PD3 A;  2QKA A;  1G1X B;  2W0F C;  3WB2 A;  1PNL A;  3TXQ A;  5C93 A;  5KA6 A;  4LF5 O;  4RQF A;  2DYS C;  1PNK A;  3JAL B;  2CTQ A;  4JAV A;  1B06 A;  4OPH A;  2CUG A;  1GMG A;  4JI0 O;  4FVM A;  4QNH B;  5LHI A;  2XAJ A;  4FLY A;  3SJB C;  2EX3 A;  2JS5 A;  1NKD A;  3BRC A;  3ZHU A;  4ZIB A;  5KX5 A;  2EIK B;  5BY1 A;  4ZOL B;  3P32 A;  1EN6 A;  3B09 A;  4O2A A;  4J7J A;  2XAF A;  5BXZ A;  1J95 A;  3D3Q A;  3Q4H A;  2B9Z A;  4DV4 O;  2AZ0 A;  1N34 O;  4I4T A;  1JJ2 U;  3SYC A;  3CSX A;  3JAK A;  4B3T O;  2QKS A;  4DR7 B;  1A32 A;  5D5Q A;  2PI4 A;  4DUZ B;  5KMG A;  2XT9 A;  2HJF C;  5FLX N;  4WFF A;  3TGU H;  4EFB A;  2EZO A;  1AJQ A;  3L72 H;  4K8Z A;  3HPL C;  2CGO A;  1WAZ A;  1AP6 A;  2EJ7 A;  4DR6 O;  1SKV A;  5BR8 B;  1FXK A;  1AI6 A;  4G2K A;  1CEZ A;  1K5S A;  2WLH A;  4FLT A;  3ZHR A;  4O4J B;  1FD9 A;  5LHG A;  2PGG A;  5JQG B;  4I50 B;  5JVD A;  4DV1 B;  1XBL A;  4FLU A;  1JA8 A;  2UU9 O;  3K06 A;  1P4R A;  2D2C B;  3RYH B;  1Z5V A;  4OX9 B;  4X9Q A;  4FFK A;  4LBE C;  1TUB B;  2QM4 A;  4DV3 B;  4MW3 A;  4R7C A;  3JCU Z;  2Q0A A;  4JI4 B;  4JI6 O;  2W6I G;  2FB5 A;  2X6A A;  5IYC O;  2UUA B;  4AQY O;  5IWA O;  1KKC A;  3MDS A;  4LC1 A;  5LA6 A;  4DK1 A;  1XIL A;  1Q6I A;  2DWD C;  4KFM A;  2NN4 A;  4XDK A;  1HDJ A;  3ETE A;  1QLN A;  2GV9 A;  5IYZ A;  3K79 A;  1I94 B;  5B66 Z;  3ASN C;  4GKJ B;  2IJJ A;  2CGN A;  2YEV A;  2C2A A;  4P9O A;  3JCZ A;  4PA6 A;  2P90 A;  3DTU B;  1GH6 A;  2UUC O;  4KP4 A;  3CRC A;  2ARH A;  5L3G A;  4UUJ C;  3CB2 A;  1FXV A;  1K9M W;  3JAT A;  4X88 A;  2DYR B;  4L87 A;  4B3S B;  3K9A A;  2RDC A;  1K4D C;  1R6T A;  2LGQ A;  3JAM N;  1O9H A;  1MAB G;  1XL4 A;  3CCR V;  1LUV A;  1QQC A;  3K9S A;  3O65 A;  1N36 B;  4FM0 A;  5H6Q A;  3G71 V;  1KUQ A;  2MK3 A;  1WB8 A;  2KG7 B;  1FKA O;  1DLB A;  3B8M A;  1H8E G;  1SET A;  3W7X A;  4CH4 A;  2P4V A;  3S3W A;  3TK1 A;  4JAA A;  2A06 H;  3RFR A;  1F7Y A;  4QPJ A;  2VQE O;  1HNX B;  5B1B B;  2HEP A;  3T1Y B;  5EC2 C;  1RSO A;  5IDJ A;  3SPH A;  1K3E A;  4GYC B;  2QJ1 A;  2P22 C;  3QVN A;  4X1K A;  1VQ4 V;  1RPO A;  1S0V A;  2WLI A;  4IT5 A;  3ASO B;  2Q7G A; 
#chains in the Genus database with same CATH homology
 2AXT Z;  3A0H Z;  5B66 Z;  3JCU Z;  5KAI Z;  3KZI Z;  4IL6 Z;  3WU2 Z;  5TIS Z;  1S5L Z;  5GTH Z;  5B5E Z;  5H2F Z;  4PJ0 Z;  5KAF Z;  5E79 Z;  3A0B Z;  4UB8 Z;  5GTI Z;  4UB6 Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...