3JCUZ

Cryo-em structure of spinach psii-lhcii supercomplex at 3.2 angstrom resolution
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
61
structure length
61
Chain Sequence
TIAFQLAVFALIATSSILLISVPVVFASPDGWSSNKNIVFSGTSLWLGLVFLVGILNSLIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem II protein D1
publication title Structure of spinach photosystem II-LHCII supercomplex at 3.2 A resolution
doi rcsb
molecule tags Membrane protein
total genus 23
structure length 61
sequence length 61
chains with identical sequence z
ec nomenclature
pdb deposition date 2016-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01737 Ycf9 YCF9
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.740 Mainly Alpha Orthogonal Bundle Helix Hairpins Photosystem II PsbZ, reaction centre 3jcuZ00
3WU2Z 3A0HZ 3KZIZ 5B5EZ 3JCUZ 5GTHZ 5KAIZ 5KAFZ 5TISZ 3A0BZ 5B66Z 4PJ0Z 4IL6Z 5H2FZ 4UB6Z 4UB8Z 1S5LZ 5GTIZ 2AXTZ 5E79Z
chains in the Genus database with same CATH superfamily
1IURA 4LC1A 4JI7B 2O57A 3CWBH 2AGAA 1HR0B 3JAWA 4CZZA 5B3SC 1FJGB 1XILA 3CCLV 5B1AB 1WPBA 5LMUO 2E5LO 4FLTA 4OPHA 4CS4A 3DXRB 1QVFU 1HNZB 2QKSA 3ASOC 2P6JA 4FZ1A 2EIKB 2OIEA 4U3JA 2EIJB 4HBNA 1GM9A 4O2BA 1OJHA 3J80N 4X62B 4LF6B 4IIJA 1M93A 1G1XB 3JD0A 3E35A 5LGNA 2WLKA 1M5IA 1RM1B 1MZFA 3BVOA 4YIOA 1F7YA 1VQ5V 3G71V 3BA8A 4UCOA 5BR8O 3Q4HB 1GO3F 3JD2A 3SPIA 5KHKA 3OUFA 5E79Z 2AW9A 4TUYB 1WB7A 2PTMA 1JCHA 3P3PA 4P30A 1XOUA 4MVRA 1R3LC 2A3QA 3CCRV 4TV9B 4FLWA 4LF5O 1K33A 4KXRA 3UCSC 1V55C 2DWEC 2JJ1G 2JGDB 3RYIB 3G6BA 1HNWB 1MSWD 4Z1VA 1ZL8B 3E8HA 1EZVH 2HJFC 5CBHA 4ZIBA 1YF2A 1MZEA 4JAVA 3G4SV 1NZ6A 2ADQB 3EHBB 1DTOA 4O4HB 1MSDA 1FXVA 2WLLB 3E8FA 4DXWA 4X20A 3HB3B 4DR7B 2ZM6O 2ZIOA 4CC5A 3CYOA 3C90A 1SQQH 4GX1A 4ABMA 1N34B 2LQTA 2VRZA 4TT3G 3NXSA 3N2GA 3HKBB 2A79B 1VQ4V 4FZ0A 4DO2A 1R73A 1BL8A 4B3TB 4J9ZB 4UVAA 1H2LA 4X1KA 1YDXA 1YCIA 4I5SA 1YSCA 1G4YB 5BY1A 5IYZA 4CBCA 3CRQA 5J9PC 5L3CA 4WBNA 2W0XA 5EC1C 2BE3A 2X7RB 5KUMA 1NTKH 2GHYA 3ZBHA 2E74B 5H2FZ 1FKAO 2DYRC 4I0XB 4MTOA 4C7UA 1QQCA 3DXRA 3U0ZA 2OCHA 3OFNG 1MOFA 3ABMC 2Q9LA 1B6QA 5J2TB 3ZIAG 2VWKA 3BA9A 3AG3B 4RWUA 1YJNV 3BEHA 1Q6IA 4JYBA 2WLMA 1VQ6V 1Z5VA 4PA6A 1Y4MA 2A9HA 3Q4HA 5ITZB 4PDVA 4QGPA 2V4DA 1WP7A 3VQVA 1LR1A 2XNDG 4ZI7B 3CHXA 1FFXB 4TUYA 1F4NA 2F1MA 2CH7B 4DV3B 3LDDA 1N32B 4IYIA 1BT8A 1VARA 2ZDIA 5EIBC 4DR3O 1THZA 2IH3C 4PV1B 4I9QA 1GAXA 3RYIA 4JI1O 4ASUG 2UUAB 3X2QC 3UO3A 2DQ0A 1M4UA 4MS2A 3S3WA 4B3MO 4FVMA 4TQFA 5IT9N 4O4HA 1OCZB 5IY5B 4CS2A 2WLLA 1Y66A 1ZAUA 4UVCA 2EZPA 4L87A 1H8HG 3R65A 3MHHC 2EJ7A 3H1IH 1TAEA 1YHQV 1GMGA 3T1YO 3OW2U 4Z1MG 4PA7A 4LF7O 4DV6O 1GRJA 1KBHA 4PHZA 4NYKA 2QEXV 4TOIA 2C2AA 2IU0A 5IJ0B 3HKBA 1UPGA 2QKAA 3ASNC 2PYLA 1N36O 1QR8A 4JYAO 1Y76B 2DOSA 5HFLA 4WFBV 2UUBB 4A5UB 1NTMH 3L9DA 5B5EZ 1KQSU 3P32A 2ZD9A 3HKEB 1V54B 1Z2GA 2JS3A 4O4IB 3CEIA 2AHYA 2XAGA 2QTSA 1BHAA 1NS1A 3LNNA 3CB2A 4GCZA 5EIBD 1XL6A 4WFAV 3AG1C 4X65O 3ABKC 3E83A 1AILA 1RSOB 4DV2B 1COWG 4I0XA 2P7TC 5JH7B 1LNQA 5KUKA 5B1OA 2DYSC 4EEQA 2WLJA 2QJ1A 3CCMV 4K0KB 4IT5A 1TUBB 1XREA 4DR2O 3B2EE 5A9GA 3SYCA 4RQFA 4PA9A 4KP4A 2Q0AA 5J2TA 4NTWA 4LF8O 1MNGA 3CRRA 3STLC 1J5EB 4AHCA 4JV5B 1DK1A 1KD1W 5B3SB 4UUJC 1NH2B 5EC2C 4B7EA 1SRYA 4K8XA 4WFGA 4DUZB 1NR1A 1RPRA 2Y0IA 1XHZA 1BCCH 2IH1C 3RGBA 5DEDA 4NXMO 5ITZA 1H2KA 5L3GA 5CA0B 1FFXA 1I5XA 2GTAA 2QA4V 1PKXA 2CH7A 1HR0O 3H1HH 3R66A 1FJGO 2N04A 1D5AA 3QNEA 4UB6Z 4YY3O 3TJTA 1OCOC 1WA8B 2IM9A 2JVDA 3C3TA 2RQ6A 1XI1A 3E8GA 5JJJB 1SA0B 2BSKB 4KUMA 3L71H 4X62O 4JI8O 2NLJC 4HYOA 4Q6GA 3W7TA 4AI8A 3ABLB 4QE9A 2EILB 4BIOA 4DV0O 3RW0A 1KMIZ 3J7AU 4LNUB 2PI4A 2EINB 2PYJA 1IBKO 2FL4A 4MT8A 2X0LA 2CGOA 3JARB 2YDEA 2Q67A 3CRAA 2ZE7A 5K1XA 1H2SB 4I4TB 4X66B 1K97A 5KHHA 4LH6A 1B06A 1YTFD 4JYCA 2YXLA 5IJ0A 2ZR3A 4U7NA 2H94A 3K9SA 4BWAA 1PV0A 3SPHA 3G6EV 1Y76A 4UV9A 3CX5F 2GTSA 5IE9A 1VF5B 2YICA 4DV5B 1QLEC 1D2DA 2ODMA 3ML0A 3EFFK 4HAMA 1SQXH 1GM7A 2NN4A 3HKEA 4JAAA 5CA3A 2EIMB 4B7KA 2QWOB 2R9AA 3JASB 4O4IA 1NU1H 2UXBB 1S72V 2F95B 2CTWA 2DE0X 3UKMA 5LMNB 1RSOA 1R3IC 1SZXA 5JH7A 2P4KA 3ZHQA 1Q6HA 2A06H 1M9NA 1VF7A 1SQBH 2EZOA 3TGUH 4JASA 4JPRA 4PI0A 2ZIMA 2F23A 3FB6C 4J80A 1W59A 2B9ZA 3FYIB 1J95A 3O65A 2ITCC 2CGNA 1YJ9V 3IC9A 4B3TO 3BAAA 2JEXA 1EFRG 2XAHA 4D7TA 2AHZA 1ORQC 2IJJA 4JI0B 5A2QN 1Q8IA 1Y74B 1AR5A 2BOCC 1O9GA 1H38A 2Z5UA 5CA0A 1JA8A 1QU7A 3W7UA 3IFXA 2ATKC 3EXAA 3CC7V 1R1BA 5JJEB 4JI3O 3AG7A 5KHIA 1WLEA 1WA8A 4Z2WA 5B1BC 4DR1B 2Q7EA 1L8DA 1R3JC 4JAUA 4YIPA 5FLXN 4ZHQA 2BSKA 4UCRA 4DV1B 4J11A 3JSLA 5FNVA 2CUGA 4WFHA 1BSMA 3AG4B 1ZX3A 2Y0PA 3TXQA 1NQTA 4LNUA 3AG2C 2UU9O 4BW5A 4EFEA 4FM1A 2PZSA 4I7ZB 1RPOA 3JARA 3KCYA 1Q3EA 2F66C 2QWPB 4DV3O 1XMQB 1Q81W 4K3AA 1N32O 1Q82W 2QWQB 1XNQB 3L72H 1TGOA 1EN6A 2HR3A 4OGQB 1VQ7V 4NKGB 4RO2A 3RVYA 1QVGU 2UUAO 4FK5C 1SQFA 1JJ2U 1Y67A 2YC0A 1HW7A 4LF4B 1IBLO 3JASA 2GUZB 4J7KA 1F51A 4WBNB 1VQ9V 1QNMA 2HVJC 1CPYA 1FPOA 1VQ8V 3IGAC 2F43G 1JPXA 3F5WC 3ZJZA 4FFKA 3H1LH 2CTRA 5C93A 5EZYB 2BOBC 2NNUA 4WFEA 2QDOA 3M7MX 5DM6V 4JI4B 2CDYA 2FMLA 1AVMA 1W0KG 3WU2Z 1XUQA 2E75B 3H1JH 2Q73A 3G67A 5JJNB 1X4TA 1GH6A 4XDLA 1WN7A 3B4SA 4MTFA 3TCUA 1YZBA 5LP6B 2LO1A 2ZE5A 2F4VO 2QM4A 1IDSA 4DV7B 1Y74A 4QPKA 1OCRC 4PDRA 1S5LZ 3UO2A 3ZN1A 5LHGA 4TQDA 1K9MW 2K1EA 2ETNA 5JWPA 4MTGA 1Q6UA 4DV2O 4EB6B 2IJHA 1YIJV 4DUYO 1GKFA 4ICGA 3T1HB 5JCOA 5H6QA 1WNSA 5LHHA 1FXKB 1HP8A 1E1QG 4GYCB 4U7OA 4W4LA 1R6TA 3P30A 1PP9H 1DLBA 2JEUA 3SYOA 5KLVH 4LFCB 4JV5O 4RUEA 1YJWV 2H8PC 1QHTA 1N33O 4LP8A 1OCOB 4JTCB 5KX5A 1FYJA 4KHPB 4WFFA 2HFEC 4QPJA 2QGNA 1PL0A 3UQ8A 1S5HC 2KG7A 3K5OA 2PY5A 3M99B 4JI2B 4FLZA 1NJIW 3UT5B 1GK9A 1URFA 5DN6G 1K73W 3F7YC 5L3BA 3OAAG 5LXTB 1M57B 2LFSA 3BHPA 3SGIA 5TISZ 3G80A 2GV9A 2IBZH 3RWRD 4UV8A 1M56C 4LF9B 4DR6B 1KECA 1VP7A 1NI8A 1UFIA 1Q90D 4IHJA 1VF6C 1AR4A 1EM1A 4K35A 1N4CA 2Q7GA 3I56V 1ZUQA 2GUZA 5LGTA 4MVOA 4PA4A 2VQEB 4OX9O 3FYEB 3DC5A 5LYJB 1HDJA 5KAIZ 1IXBA 4X88A 1U96A 2XASA 2Y4UA 2OTJV 1L0NH 4X1YB 2F93B 3CC4V 4X64O 3T4ZA 5EZYA 5JVDB 2UXCB 4K8ZA 4LFBB 5IYDO 1GN2A 2KKWA 3B8MA 4X66O 3HKDB 4CH6A 3L75H 1Q43A 2YXYA 4JI5B 2OYQA 1IX9A 2UXDB 3SYQA 3RVZA 1AP6A 2ZCEA 4DK1A 2KB1A 5LP6A 1KYOF 4H44B 3QVNA 1AR1B 4LWSB 4GKKB 3JD1A 2YI8A 1XEQA 3A0HZ 3OTOO 3K58A 1VEWA 4MSWC 2UUCB 2LJ2A 3OEHG 4EB6A 1QBZA 1XDCA 4U3FH 4GKJB 3OR7C 3ZS8C 2ZINA 2B1IA 1FXKA 1M1KW 1MG1A 3K59A 2ZXWB 4IGGA 4JI6B 3ETGA 4GUNA 4FLXA 2M6YA 1VQMV 2QWNB 1GN4A 2FTKA 3DC6A 3CCQV 2ZNJA 3SJAC 3A8TA 4ZBMA 3K0GA 3ETEA 4X9QA 1KKDA 4MTXA 3UM7A 1Y6XA 4CH5A 3DGEA 4I9WA 3JCZA 3SJCC 3QF7A 3UT5A 2Q4PA 1EZJA 3BY6A 1JMKC 3QO7A 1WAZA 4MVZA 1HNXB 5CBFA 3ZX6A 4R50A 2LP7A 5LXTA 2FKXA 4BR6A 3AG2B 1ZLZA 4X89A 2LGWA 2OT5A 1K5QA 3FFQA 3ETQA 1PNMA 3LSUA 4KFMA 3W7WA 5LMUB 3SPGA 2XUMA 1OHHG 3CCUV 5LYJA 4DW0A 1ENVA 4G27B 3QG5A 1G6UA 4MW3A 3ZRXA 5H9CA 4B3SO 5CBGA 1I94O 4H33A 4X1YA 3A0RA 5B1AC 1LUVA 3N2KB 1XMQO 4HZ3A 4O4JB 5JVDA 1SQVH 1Z5WA 3HKDA 1K4DC 4LFAO 2EIKC 5C8YB 2QM7A 2EIJC 3ZMZA 4DW1A 4NVPA 3F7VC 3B8NA 3FB7C 4GT1A 4GX0A 4JTDB 3OMAB 5HFMA 4DR5B 1VMGA 3MDSA 2QKCA 2RNBA 3K0DA 3OTFA 4LWSA 5CB4B 2P67A 1V9PA 4MW8A 2HHHO 1KP3A 3ASOB 5KAFZ 1EBOA 1AI7A 4JI7O 2ILMA 5B66Z 1YXBA 3ZHVA 3SDLA 2ZDIC 4X8AA 1NTZH 3DTUB 2VS0A 5CMUA 2CK3G 4N23A 1IZ3A 1JJOA 1HNZO 1N0JA 2FYUH 1SC5B 3E8BA 4ZHQB 1DGSA 3H01A 1Q86W 2HP8A 3SPCA 3S3XA 5H6RA 2IJIA 3ZMUA 4LF6O 5FNVB 3E86A 5F2VO 2VQFB 4YHHB 5J2UB 3SR2C 5IDJA 1BQZA 2ZQMA 1V55B 4IYHA 2DW4A 1M90W 3K5LA 3J81N 1AI4A 4UCVA 3U10A 1WPXA 4UCUA 1QCEA 3FB8C 4H0LB 1AI6A 2D3OW 3JAKB 3FKSG 4I50B 4L8JA 1I7FA 1ZWIC 3STZC 1I5YA 1BHBA 1HNWO 2YIAA 3E2EA 1A32A 3F5TA 5LL6Y 1P84F 2QTOA 3JYCA 2QWRB 4LFCO 1DF4A 5FPOA 1L0LH 5L3DA 5DECA 2N05A 3CP1A 3OUSA 1E79G 1SS3A 1KU9A 2EBOA 3OM3B 3OMNB 4JYYA 4MVUA 2RN9A 4DR7O 4G28B 1PM9A 1M56B 3CMEV 1N0NA 4JI2O 4JZ2A 3N2KA 3QO8A 4O4JA 5GTHZ 1K4CC 3OGIB 3ABUA 2Y4TA 2XHBA 2P5OA 1JVMA 1S77D 1N34O 4TWKA 1PD3A 1MABG 5C8YA 3D36A 1K8AW 5GW7A 1E1RG 4DRXB 2JRIA 5KMGB 2V7QG 4PI2A 2EULA 1SQPH 5IYCO 1YEWA 1ZSPA 2R70A 1PNKA 2DYRB 5CB4A 1XQ8A 4YJ2A 4UCSA 2VQEO 4LR3A 4NXNB 3ABMB 3AK3A 1Q7YW 1RFYA 2P06A 4B3MB 1K3EA 2ZR2A 4R7CA 2RJZA 2W0FC 1L1FA 3RYFB 3EVKA 3CXHF 3RFRA 4DV4B 2G38A 2MK3A 2UXDO 3CD6V 4CC6A 4X1IB 1XNRB 1BGYH 3VBBA 3H1KH 4PA3A 4EFBA 4P9PA 3T1YB 5JQGB 5J2UA 1OCZC 4QIWF 2E3CA 1W2BU 1K7DA 2XT9A 5KX5B 4DYLA 5GONB 3RYCB 2IJKA 4UXNA 3I55V 3CSXA 2DQ3A 2YS8A 2CTPA 4JYAB 2KG7B 4KL1A 3X2QB 1SERA 1R3KC 4PJ0Z 3JAKA 2XAQA 5FPRA 4I50A 4GKJO 1HWYA 1S0VA 2LFRA 1ZTEA 2GSMB 2UXXA 4TV8B 3BFRA 3OEEG 2XAJA 4B3RB 2NR5A 4CH3A 4X65B 2Z3YA 2K9PA 4JI6O 1YITV 4J9YB 4IHJB 1UJWB 4J42A 4FIPC 1H2NA 1V54C 2Z0AA 3K06A 1JFFB 3E89A 3LSSA 3WG7C 2AXTZ 4DR2B 3FD9A 4O2AB 4GX5A 4BIUA 2A0LA 4Q20A 3ASNB 3D8CA 3CXCU 2Q6AA 4LF8B 1W0JG 3APQA 2DN9A 2Q8VA 1VQNV 1VF6A 4UVBA 1HNXO 5CN0A 1FS0G 3RBZA 4NXMB 4NTYA 4DRXA 5KMGA 1SETA 5LOVB 2RCVA 3AG1B 4WCEV 3ABKB 3GWOA 4YY3B 4YXWG 4G2KA 2DJVA 3B09A 2W6IG 3CE2A 4RQEA 2UUBO 1FAFA 2DWDC 3K9AA 3VQYA 1QLNA 2WLNA 4JZGA 2DYSB 4FLYA 1BZKA 3JAMN 4NR1A 3L70H 3RYHB 2R72A 2W6JG 1K92A 1R6NA 1H8EG 1WB8A 4JI8B 4O4LA 2OIGA 1K34A 4FJCC 1YTFB 3HKCB 3RYFA 1JR9A 4DV0B 3KKYA 4K0KO 3B77A 1IBKB 5L3EA 1T5EA 4X1IA 3FAVB 1J5EO 2QM8A 1K5SA 4CS3A 1KB9F 1OCCC 1SF9A 5JQGA 3ABLC 2JGUA 4DR5O 1FXHA 3APOA 4BW9A 2PI5A 2EILC 3ZRWB 4DUZO 5GONA 3RYCA 2M7WA 4J7JA 5AG2A 3ZCCA 2EINC 3K5MA 5L3FA 3QTCA 4F4LA 2OWOA 4FPPA 1I0HA 2QE7G 2ITDC 2Q7HA 3OT7A 4BIZA 2HJDA 3WB2A 3ZHRA 1P7GA 3T1CA 1CEZA 4JGSA 3K04A 2BTQB 2CTQA 2PUSA 4NB5A 5BZBA 3LDEA 5IWAB 1NH2D 1P49A 3T2MA 1G8MA 2EJRA 1LUWA 4TV8A 2CAZC 3W7XA 4FMTA 3ZMTA 3OE7G 4LH7A 4OPAA 1CP9A 2VQFO 2EIMC 1JFFA 3O9OA 3CJHB 4YHHO 5D5PA 3CCVV 3SJQC 3IAYA 4GZRB 4O2AA 4AQYB 1I08A 2X6AA 3JD4A 3LSQA 3CCJV 1VQKV 1OZ0A 2GBOA 1AJQA 1SQGA 3A2FA 2KQXA 2BTOA 2WLIB 4JF3A 4WF9V 1AJNA 1QLEB 1WJZA 2ADPA 3ZRVA 1X59A 2VWJA 3ABTA 1IBMB 4NTXA 3M8AA 3L74H 2RDCA 3VOUA 1KP2A 3GWKC 2JIZG 3CRCA 1XL4A 5KA6A 5LOVA 4I55B 1TVKB 4LBEC 3WFVA 4JI3B 4PDLA 4DV5O 1F4MA 4DK0A 3ZHSA 4R6ZA 3OGCC 1XBLA 1FFTB 3I5DA 4D7SA 3RYHA 2UXBO 2OCCC 1NVPD 5LMNO 1PPJH 5EBMC 5D5QA 3SPJA 3B40A 3GB7C 3K57A 2LW1A 2PGGA 3HKCA 5JCOC 3HPLC 2Q5ZA 2ZNIA 1H2GA 1AJPA 4QE7A 1NKDA 2H3OA 3BABA 2UU9B 2YXHA 2YIBD 4PD4F 1YVWA 4H13B 4F6EA 4XDKA 4UFZA 3TK1A 3FAVA 4F6RB 1BQ0A 2V1DA 4UCTA 1TUEB 2R9RB 2ZT9B 3AG4C 2MW2B 4E4EA 2AZ0A 5CA1B 4TV9A 3ZRWA 5B1BB 2JGDA 4PDMA 4JI0O 2QSAA 1ZL8A 1R6KA 1BMFG 4NXNO 5IJ9B 2BCCH 4AILC 2Y69C 2XTAA 4GX2A 4DR4B 3JCUZ 1XMOB 3ICXA 2BTQA 1IBLB 5EBWC 5EBLC 1PL4A 1VIBA 3N27A 2XAFA 2HG5C 2ZE6A 4DR1O 1BE3H 4DV4O 4DV1O 2JDIG 2L35A 2D2CB 1SESA 1GN6A 4YJ3B 3MHSC 3JALB 1XNRO 1MMMA 3JATB 5BMVB 2E5LB 3ZMVA 3CJHA 3K03A 1EN4A 5LA6B 4E2LA 3FB5C 2YEVB 4PELA 5KA5A 2X6BA 2LGQA 3OD4A 2OTLV 2A7WA 1S3JA 2WLIA 1NT2B 2Q0OC 4P2ZA 2N74A 3HR0A 4B08A 1KC8W 3RN4A 2UXNA 2R9IA 5LBQA 3IJ4A 3LUTB 2F4VB 1XNQO 4ZKIA 3GVMA 3NR7A 5BXZA 3TXSA 3WG7B 5BR8B 3ZEDA 3OR6C 2WA4A 4B3RO 3VQWA 4I55A 1TVKA 4LCUC 4R8CA 2DMXA 2JS5A 5LP6C 1S5JA 4DUYB 1GTOA 1RM1C 3ZHTA 4LF4O 3ETDA 3T4DA 4LF5B 4RUFA 4YJ2B 4FFBB 3BPZA 1FD9A 3A0BZ 2WPDG 2L6LA 3PJSK 1US6A 1B04A 1AROP 2EX3A 2WSSG 1QR9A 1B3QA 4BAYA 1N33B 4QJFB 2ZKOA 1FXKC 1OV9A 1P7BA 1PNLA 1O9HA 1CXZB 2RMKB 3D3QA 4JI4O 2ZM6B 1VQOV 1OCRB 4ZI7A 1RP3B 3MD0A 3THOA 4QNHB 4F6RA 4HNAB 3KCXA 3MAQA 1JOYA 1P4RA 2P4VA 5CA1A 1AI5A 3WB0A 2FB5A 4FM2A 3VQXA 2IU3A 1H2MA 4P9OA 3KZIZ 4DV7O 5IJ9A 5FL7G 3ZRSA 5K1PA 1XHXA 1MA1A 1AB3A 1OCCB 3K3WA 4IL6Z 3H9VA 4OX9B 5E1AC 1M57C 3T1HO 3QO5A 2HLDG 2GDSA 2JJ2G 4YJ3A 4X64B 3JALA 3K5NA 1F23A 3JATA 2ZE8A 5BMVA 4ZOLB 5LGUA 3W7SA 2WLHA 5LA6A 3JSNA 3D3IA 3L73H 2E76B 2YEVA 4TSFG 4KHPO 3RT3C 3LDCA 1NVPB 4XBFA 3E22B 3ZMSA 2KSDA 5LHIA 5EYPB 1IVSA 2PF4E 3BRCA 3ZHUA 3ZN0A 3SYPA 1KKCA 5IWAO 4J7ZA 3AEIA 1DF5A 2HKOA 3AK1A 3OTOB 3CS5A 2YI9A 4GLXA 3AG3C 4LF9O 4DR6O 2LW7A 2IW5A 3FX7A 4J10A 3JAWB 1NBMG 3C3SA 4DR3B 2WWWA 3KG2A 2JK5C 4FFBA 2B5UA 4JI1B 1TUBA 2Q69A 4CH4A 4JTAB 2Y48A 3LNMB 1SZTA 4AQYO 2Q68A 4U3JB 1S76D 1GM8A 4O2BB 3IC7A 4IIJB 4O4LB 3CC2V 3CRMA 4MVSA 2UXCO 4LFBO 2HVKC 4J41A 1IBMO 1ROPA 1BS3A 2ZXWC 5H5NA 4JI5O 4H37A 2HEPA 2YIDA 2YUAA 3PN1A 4W4KA 2OCCB 1GN3A 5KHGA 4HNAA 4MVQA 2WA3A 2B1GA 4D6TH 4LF7B 4DV6B 5IY5C 1SKVA 4GKKO 4FLVA 2YSUB 3CMAV 1EN5A 2X6CA 4EKWA 1SA0A 1N36B 1WP8A 5EK0A 1D5NA 1Q5OA 4FLUA 1VQLV 3K79A 3CCSV 2UUCO 1KUQA 4UB8Z 3SJBC 3P3NA 1VQPV 1YI2V 3K08A 4N21A 1JQ0A 1NR7A 3AK2A 2AZ2A 3TETA 2QR4A 2WAMA 4B3SB 1IXMA 4X20B 1I94B 3JD3A 3BCCH 2Y69B 3WB1A 4ZOLA 4I4TA 1JX9A 4MVMA 1TA8A 4LFAB 3DSQA 4XDJA 3SYAA 2P90A 3N2GB 5IYBO 2CE4A 4FM0A 3CCEV 1AP5A 3E22A 2XOKG 5KHJA 2P22C 4OXSA 4RAIA 5EYPA 4DR4O 4X1KB 5B1NA 1XMOO 3U11A 1U97A 5IYZB 3CPWU 3OMIB 2YIBA 3D36C 5GTIZ 1N8RW 2HHHB 2ARHA
chains in the Genus database with same CATH topology
3WU2Z 3A0HZ 3KZIZ 5B5EZ 3JCUZ 5GTHZ 5KAIZ 5KAFZ 5TISZ 3A0BZ 5B66Z 4PJ0Z 4IL6Z 5H2FZ 4UB6Z 4UB8Z 1S5LZ 5GTIZ 2AXTZ 5E79Z
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WU2 Z;  3A0H Z;  3KZI Z;  5B5E Z;  3JCU Z;  5GTH Z;  5KAI Z;  5KAF Z;  5TIS Z;  3A0B Z;  5B66 Z;  4PJ0 Z;  4IL6 Z;  5H2F Z;  4UB6 Z;  4UB8 Z;  1S5L Z;  5GTI Z;  2AXT Z;  5E79 Z; 
#chains in the Genus database with same CATH topology
 1IUR A;  4LC1 A;  4JI7 B;  2O57 A;  3CWB H;  2AGA A;  1HR0 B;  3JAW A;  4CZZ A;  5B3S C;  1FJG B;  1XIL A;  3CCL V;  5B1A B;  1WPB A;  5LMU O;  2E5L O;  4FLT A;  4OPH A;  4CS4 A;  3DXR B;  1QVF U;  1HNZ B;  2QKS A;  3ASO C;  2P6J A;  4FZ1 A;  2EIK B;  2OIE A;  4U3J A;  2EIJ B;  4HBN A;  1GM9 A;  4O2B A;  1OJH A;  3J80 N;  4X62 B;  4LF6 B;  4IIJ A;  1M93 A;  1G1X B;  3JD0 A;  3E35 A;  5LGN A;  2WLK A;  1M5I A;  1RM1 B;  1MZF A;  3BVO A;  4YIO A;  1F7Y A;  1VQ5 V;  3G71 V;  3BA8 A;  4UCO A;  5BR8 O;  3Q4H B;  1GO3 F;  3JD2 A;  3SPI A;  5KHK A;  3OUF A;  5E79 Z;  2AW9 A;  4TUY B;  1WB7 A;  2PTM A;  1JCH A;  3P3P A;  4P30 A;  1XOU A;  4MVR A;  1R3L C;  2A3Q A;  3CCR V;  4TV9 B;  4FLW A;  4LF5 O;  1K33 A;  4KXR A;  3UCS C;  1V55 C;  2DWE C;  2JJ1 G;  2JGD B;  3RYI B;  3G6B A;  1HNW B;  1MSW D;  4Z1V A;  1ZL8 B;  3E8H A;  1EZV H;  2HJF C;  5CBH A;  4ZIB A;  1YF2 A;  1MZE A;  4JAV A;  3G4S V;  1NZ6 A;  2ADQ B;  3EHB B;  1DTO A;  4O4H B;  1MSD A;  1FXV A;  2WLL B;  3E8F A;  4DXW A;  4X20 A;  3HB3 B;  4DR7 B;  2ZM6 O;  2ZIO A;  4CC5 A;  3CYO A;  3C90 A;  1SQQ H;  4GX1 A;  4ABM A;  1N34 B;  2LQT A;  2VRZ A;  4TT3 G;  3NXS A;  3N2G A;  3HKB B;  2A79 B;  1VQ4 V;  4FZ0 A;  4DO2 A;  1R73 A;  1BL8 A;  4B3T B;  4J9Z B;  4UVA A;  1H2L A;  4X1K A;  1YDX A;  1YCI A;  4I5S A;  1YSC A;  1G4Y B;  5BY1 A;  5IYZ A;  4CBC A;  3CRQ A;  5J9P C;  5L3C A;  4WBN A;  2W0X A;  5EC1 C;  2BE3 A;  2X7R B;  5KUM A;  1NTK H;  2GHY A;  3ZBH A;  2E74 B;  5H2F Z;  1FKA O;  2DYR C;  4I0X B;  4MTO A;  4C7U A;  1QQC A;  3DXR A;  3U0Z A;  2OCH A;  3OFN G;  1MOF A;  3ABM C;  2Q9L A;  1B6Q A;  5J2T B;  3ZIA G;  2VWK A;  3BA9 A;  3AG3 B;  4RWU A;  1YJN V;  3BEH A;  1Q6I A;  4JYB A;  2WLM A;  1VQ6 V;  1Z5V A;  4PA6 A;  1Y4M A;  2A9H A;  3Q4H A;  5ITZ B;  4PDV A;  4QGP A;  2V4D A;  1WP7 A;  3VQV A;  1LR1 A;  2XND G;  4ZI7 B;  3CHX A;  1FFX B;  4TUY A;  1F4N A;  2F1M A;  2CH7 B;  4DV3 B;  3LDD A;  1N32 B;  4IYI A;  1BT8 A;  1VAR A;  2ZDI A;  5EIB C;  4DR3 O;  1THZ A;  2IH3 C;  4PV1 B;  4I9Q A;  1GAX A;  3RYI A;  4JI1 O;  4ASU G;  2UUA B;  3X2Q C;  3UO3 A;  2DQ0 A;  1M4U A;  4MS2 A;  3S3W A;  4B3M O;  4FVM A;  4TQF A;  5IT9 N;  4O4H A;  1OCZ B;  5IY5 B;  4CS2 A;  2WLL A;  1Y66 A;  1ZAU A;  4UVC A;  2EZP A;  4L87 A;  1H8H G;  3R65 A;  3MHH C;  2EJ7 A;  3H1I H;  1TAE A;  1YHQ V;  1GMG A;  3T1Y O;  3OW2 U;  4Z1M G;  4PA7 A;  4LF7 O;  4DV6 O;  1GRJ A;  1KBH A;  4PHZ A;  4NYK A;  2QEX V;  4TOI A;  2C2A A;  2IU0 A;  5IJ0 B;  3HKB A;  1UPG A;  2QKA A;  3ASN C;  2PYL A;  1N36 O;  1QR8 A;  4JYA O;  1Y76 B;  2DOS A;  5HFL A;  4WFB V;  2UUB B;  4A5U B;  1NTM H;  3L9D A;  5B5E Z;  1KQS U;  3P32 A;  2ZD9 A;  3HKE B;  1V54 B;  1Z2G A;  2JS3 A;  4O4I B;  3CEI A;  2AHY A;  2XAG A;  2QTS A;  1BHA A;  1NS1 A;  3LNN A;  3CB2 A;  4GCZ A;  5EIB D;  1XL6 A;  4WFA V;  3AG1 C;  4X65 O;  3ABK C;  3E83 A;  1AIL A;  1RSO B;  4DV2 B;  1COW G;  4I0X A;  2P7T C;  5JH7 B;  1LNQ A;  5KUK A;  5B1O A;  2DYS C;  4EEQ A;  2WLJ A;  2QJ1 A;  3CCM V;  4K0K B;  4IT5 A;  1TUB B;  1XRE A;  4DR2 O;  3B2E E;  5A9G A;  3SYC A;  4RQF A;  4PA9 A;  4KP4 A;  2Q0A A;  5J2T A;  4NTW A;  4LF8 O;  1MNG A;  3CRR A;  3STL C;  1J5E B;  4AHC A;  4JV5 B;  1DK1 A;  1KD1 W;  5B3S B;  4UUJ C;  1NH2 B;  5EC2 C;  4B7E A;  1SRY A;  4K8X A;  4WFG A;  4DUZ B;  1NR1 A;  1RPR A;  2Y0I A;  1XHZ A;  1BCC H;  2IH1 C;  3RGB A;  5DED A;  4NXM O;  5ITZ A;  1H2K A;  5L3G A;  5CA0 B;  1FFX A;  1I5X A;  2GTA A;  2QA4 V;  1PKX A;  2CH7 A;  1HR0 O;  3H1H H;  3R66 A;  1FJG O;  2N04 A;  1D5A A;  3QNE A;  4UB6 Z;  4YY3 O;  3TJT A;  1OCO C;  1WA8 B;  2IM9 A;  2JVD A;  3C3T A;  2RQ6 A;  1XI1 A;  3E8G A;  5JJJ B;  1SA0 B;  2BSK B;  4KUM A;  3L71 H;  4X62 O;  4JI8 O;  2NLJ C;  4HYO A;  4Q6G A;  3W7T A;  4AI8 A;  3ABL B;  4QE9 A;  2EIL B;  4BIO A;  4DV0 O;  3RW0 A;  1KMI Z;  3J7A U;  4LNU B;  2PI4 A;  2EIN B;  2PYJ A;  1IBK O;  2FL4 A;  4MT8 A;  2X0L A;  2CGO A;  3JAR B;  2YDE A;  2Q67 A;  3CRA A;  2ZE7 A;  5K1X A;  1H2S B;  4I4T B;  4X66 B;  1K97 A;  5KHH A;  4LH6 A;  1B06 A;  1YTF D;  4JYC A;  2YXL A;  5IJ0 A;  2ZR3 A;  4U7N A;  2H94 A;  3K9S A;  4BWA A;  1PV0 A;  3SPH A;  3G6E V;  1Y76 A;  4UV9 A;  3CX5 F;  2GTS A;  5IE9 A;  1VF5 B;  2YIC A;  4DV5 B;  1QLE C;  1D2D A;  2ODM A;  3ML0 A;  3EFF K;  4HAM A;  1SQX H;  1GM7 A;  2NN4 A;  3HKE A;  4JAA A;  5CA3 A;  2EIM B;  4B7K A;  2QWO B;  2R9A A;  3JAS B;  4O4I A;  1NU1 H;  2UXB B;  1S72 V;  2F95 B;  2CTW A;  2DE0 X;  3UKM A;  5LMN B;  1RSO A;  1R3I C;  1SZX A;  5JH7 A;  2P4K A;  3ZHQ A;  1Q6H A;  2A06 H;  1M9N A;  1VF7 A;  1SQB H;  2EZO A;  3TGU H;  4JAS A;  4JPR A;  4PI0 A;  2ZIM A;  2F23 A;  3FB6 C;  4J80 A;  1W59 A;  2B9Z A;  3FYI B;  1J95 A;  3O65 A;  2ITC C;  2CGN A;  1YJ9 V;  3IC9 A;  4B3T O;  3BAA A;  2JEX A;  1EFR G;  2XAH A;  4D7T A;  2AHZ A;  1ORQ C;  2IJJ A;  4JI0 B;  5A2Q N;  1Q8I A;  1Y74 B;  1AR5 A;  2BOC C;  1O9G A;  1H38 A;  2Z5U A;  5CA0 A;  1JA8 A;  1QU7 A;  3W7U A;  3IFX A;  2ATK C;  3EXA A;  3CC7 V;  1R1B A;  5JJE B;  4JI3 O;  3AG7 A;  5KHI A;  1WLE A;  1WA8 A;  4Z2W A;  5B1B C;  4DR1 B;  2Q7E A;  1L8D A;  1R3J C;  4JAU A;  4YIP A;  5FLX N;  4ZHQ A;  2BSK A;  4UCR A;  4DV1 B;  4J11 A;  3JSL A;  5FNV A;  2CUG A;  4WFH A;  1BSM A;  3AG4 B;  1ZX3 A;  2Y0P A;  3TXQ A;  1NQT A;  4LNU A;  3AG2 C;  2UU9 O;  4BW5 A;  4EFE A;  4FM1 A;  2PZS A;  4I7Z B;  1RPO A;  3JAR A;  3KCY A;  1Q3E A;  2F66 C;  2QWP B;  4DV3 O;  1XMQ B;  1Q81 W;  4K3A A;  1N32 O;  1Q82 W;  2QWQ B;  1XNQ B;  3L72 H;  1TGO A;  1EN6 A;  2HR3 A;  4OGQ B;  1VQ7 V;  4NKG B;  4RO2 A;  3RVY A;  1QVG U;  2UUA O;  4FK5 C;  1SQF A;  1JJ2 U;  1Y67 A;  2YC0 A;  1HW7 A;  4LF4 B;  1IBL O;  3JAS A;  2GUZ B;  4J7K A;  1F51 A;  4WBN B;  1VQ9 V;  1QNM A;  2HVJ C;  1CPY A;  1FPO A;  1VQ8 V;  3IGA C;  2F43 G;  1JPX A;  3F5W C;  3ZJZ A;  4FFK A;  3H1L H;  2CTR A;  5C93 A;  5EZY B;  2BOB C;  2NNU A;  4WFE A;  2QDO A;  3M7M X;  5DM6 V;  4JI4 B;  2CDY A;  2FML A;  1AVM A;  1W0K G;  3WU2 Z;  1XUQ A;  2E75 B;  3H1J H;  2Q73 A;  3G67 A;  5JJN B;  1X4T A;  1GH6 A;  4XDL A;  1WN7 A;  3B4S A;  4MTF A;  3TCU A;  1YZB A;  5LP6 B;  2LO1 A;  2ZE5 A;  2F4V O;  2QM4 A;  1IDS A;  4DV7 B;  1Y74 A;  4QPK A;  1OCR C;  4PDR A;  1S5L Z;  3UO2 A;  3ZN1 A;  5LHG A;  4TQD A;  1K9M W;  2K1E A;  2ETN A;  5JWP A;  4MTG A;  1Q6U A;  4DV2 O;  4EB6 B;  2IJH A;  1YIJ V;  4DUY O;  1GKF A;  4ICG A;  3T1H B;  5JCO A;  5H6Q A;  1WNS A;  5LHH A;  1FXK B;  1HP8 A;  1E1Q G;  4GYC B;  4U7O A;  4W4L A;  1R6T A;  3P30 A;  1PP9 H;  1DLB A;  2JEU A;  3SYO A;  5KLV H;  4LFC B;  4JV5 O;  4RUE A;  1YJW V;  2H8P C;  1QHT A;  1N33 O;  4LP8 A;  1OCO B;  4JTC B;  5KX5 A;  1FYJ A;  4KHP B;  4WFF A;  2HFE C;  4QPJ A;  2QGN A;  1PL0 A;  3UQ8 A;  1S5H C;  2KG7 A;  3K5O A;  2PY5 A;  3M99 B;  4JI2 B;  4FLZ A;  1NJI W;  3UT5 B;  1GK9 A;  1URF A;  5DN6 G;  1K73 W;  3F7Y C;  5L3B A;  3OAA G;  5LXT B;  1M57 B;  2LFS A;  3BHP A;  3SGI A;  5TIS Z;  3G80 A;  2GV9 A;  2IBZ H;  3RWR D;  4UV8 A;  1M56 C;  4LF9 B;  4DR6 B;  1KEC A;  1VP7 A;  1NI8 A;  1UFI A;  1Q90 D;  4IHJ A;  1VF6 C;  1AR4 A;  1EM1 A;  4K35 A;  1N4C A;  2Q7G A;  3I56 V;  1ZUQ A;  2GUZ A;  5LGT A;  4MVO A;  4PA4 A;  2VQE B;  4OX9 O;  3FYE B;  3DC5 A;  5LYJ B;  1HDJ A;  5KAI Z;  1IXB A;  4X88 A;  1U96 A;  2XAS A;  2Y4U A;  2OTJ V;  1L0N H;  4X1Y B;  2F93 B;  3CC4 V;  4X64 O;  3T4Z A;  5EZY A;  5JVD B;  2UXC B;  4K8Z A;  4LFB B;  5IYD O;  1GN2 A;  2KKW A;  3B8M A;  4X66 O;  3HKD B;  4CH6 A;  3L75 H;  1Q43 A;  2YXY A;  4JI5 B;  2OYQ A;  1IX9 A;  2UXD B;  3SYQ A;  3RVZ A;  1AP6 A;  2ZCE A;  4DK1 A;  2KB1 A;  5LP6 A;  1KYO F;  4H44 B;  3QVN A;  1AR1 B;  4LWS B;  4GKK B;  3JD1 A;  2YI8 A;  1XEQ A;  3A0H Z;  3OTO O;  3K58 A;  1VEW A;  4MSW C;  2UUC B;  2LJ2 A;  3OEH G;  4EB6 A;  1QBZ A;  1XDC A;  4U3F H;  4GKJ B;  3OR7 C;  3ZS8 C;  2ZIN A;  2B1I A;  1FXK A;  1M1K W;  1MG1 A;  3K59 A;  2ZXW B;  4IGG A;  4JI6 B;  3ETG A;  4GUN A;  4FLX A;  2M6Y A;  1VQM V;  2QWN B;  1GN4 A;  2FTK A;  3DC6 A;  3CCQ V;  2ZNJ A;  3SJA C;  3A8T A;  4ZBM A;  3K0G A;  3ETE A;  4X9Q A;  1KKD A;  4MTX A;  3UM7 A;  1Y6X A;  4CH5 A;  3DGE A;  4I9W A;  3JCZ A;  3SJC C;  3QF7 A;  3UT5 A;  2Q4P A;  1EZJ A;  3BY6 A;  1JMK C;  3QO7 A;  1WAZ A;  4MVZ A;  1HNX B;  5CBF A;  3ZX6 A;  4R50 A;  2LP7 A;  5LXT A;  2FKX A;  4BR6 A;  3AG2 B;  1ZLZ A;  4X89 A;  2LGW A;  2OT5 A;  1K5Q A;  3FFQ A;  3ETQ A;  1PNM A;  3LSU A;  4KFM A;  3W7W A;  5LMU B;  3SPG A;  2XUM A;  1OHH G;  3CCU V;  5LYJ A;  4DW0 A;  1ENV A;  4G27 B;  3QG5 A;  1G6U A;  4MW3 A;  3ZRX A;  5H9C A;  4B3S O;  5CBG A;  1I94 O;  4H33 A;  4X1Y A;  3A0R A;  5B1A C;  1LUV A;  3N2K B;  1XMQ O;  4HZ3 A;  4O4J B;  5JVD A;  1SQV H;  1Z5W A;  3HKD A;  1K4D C;  4LFA O;  2EIK C;  5C8Y B;  2QM7 A;  2EIJ C;  3ZMZ A;  4DW1 A;  4NVP A;  3F7V C;  3B8N A;  3FB7 C;  4GT1 A;  4GX0 A;  4JTD B;  3OMA B;  5HFM A;  4DR5 B;  1VMG A;  3MDS A;  2QKC A;  2RNB A;  3K0D A;  3OTF A;  4LWS A;  5CB4 B;  2P67 A;  1V9P A;  4MW8 A;  2HHH O;  1KP3 A;  3ASO B;  5KAF Z;  1EBO A;  1AI7 A;  4JI7 O;  2ILM A;  5B66 Z;  1YXB A;  3ZHV A;  3SDL A;  2ZDI C;  4X8A A;  1NTZ H;  3DTU B;  2VS0 A;  5CMU A;  2CK3 G;  4N23 A;  1IZ3 A;  1JJO A;  1HNZ O;  1N0J A;  2FYU H;  1SC5 B;  3E8B A;  4ZHQ B;  1DGS A;  3H01 A;  1Q86 W;  2HP8 A;  3SPC A;  3S3X A;  5H6R A;  2IJI A;  3ZMU A;  4LF6 O;  5FNV B;  3E86 A;  5F2V O;  2VQF B;  4YHH B;  5J2U B;  3SR2 C;  5IDJ A;  1BQZ A;  2ZQM A;  1V55 B;  4IYH A;  2DW4 A;  1M90 W;  3K5L A;  3J81 N;  1AI4 A;  4UCV A;  3U10 A;  1WPX A;  4UCU A;  1QCE A;  3FB8 C;  4H0L B;  1AI6 A;  2D3O W;  3JAK B;  3FKS G;  4I50 B;  4L8J A;  1I7F A;  1ZWI C;  3STZ C;  1I5Y A;  1BHB A;  1HNW O;  2YIA A;  3E2E A;  1A32 A;  3F5T A;  5LL6 Y;  1P84 F;  2QTO A;  3JYC A;  2QWR B;  4LFC O;  1DF4 A;  5FPO A;  1L0L H;  5L3D A;  5DEC A;  2N05 A;  3CP1 A;  3OUS A;  1E79 G;  1SS3 A;  1KU9 A;  2EBO A;  3OM3 B;  3OMN B;  4JYY A;  4MVU A;  2RN9 A;  4DR7 O;  4G28 B;  1PM9 A;  1M56 B;  3CME V;  1N0N A;  4JI2 O;  4JZ2 A;  3N2K A;  3QO8 A;  4O4J A;  5GTH Z;  1K4C C;  3OGI B;  3ABU A;  2Y4T A;  2XHB A;  2P5O A;  1JVM A;  1S77 D;  1N34 O;  4TWK A;  1PD3 A;  1MAB G;  5C8Y A;  3D36 A;  1K8A W;  5GW7 A;  1E1R G;  4DRX B;  2JRI A;  5KMG B;  2V7Q G;  4PI2 A;  2EUL A;  1SQP H;  5IYC O;  1YEW A;  1ZSP A;  2R70 A;  1PNK A;  2DYR B;  5CB4 A;  1XQ8 A;  4YJ2 A;  4UCS A;  2VQE O;  4LR3 A;  4NXN B;  3ABM B;  3AK3 A;  1Q7Y W;  1RFY A;  2P06 A;  4B3M B;  1K3E A;  2ZR2 A;  4R7C A;  2RJZ A;  2W0F C;  1L1F A;  3RYF B;  3EVK A;  3CXH F;  3RFR A;  4DV4 B;  2G38 A;  2MK3 A;  2UXD O;  3CD6 V;  4CC6 A;  4X1I B;  1XNR B;  1BGY H;  3VBB A;  3H1K H;  4PA3 A;  4EFB A;  4P9P A;  3T1Y B;  5JQG B;  5J2U A;  1OCZ C;  4QIW F;  2E3C A;  1W2B U;  1K7D A;  2XT9 A;  5KX5 B;  4DYL A;  5GON B;  3RYC B;  2IJK A;  4UXN A;  3I55 V;  3CSX A;  2DQ3 A;  2YS8 A;  2CTP A;  4JYA B;  2KG7 B;  4KL1 A;  3X2Q B;  1SER A;  1R3K C;  4PJ0 Z;  3JAK A;  2XAQ A;  5FPR A;  4I50 A;  4GKJ O;  1HWY A;  1S0V A;  2LFR A;  1ZTE A;  2GSM B;  2UXX A;  4TV8 B;  3BFR A;  3OEE G;  2XAJ A;  4B3R B;  2NR5 A;  4CH3 A;  4X65 B;  2Z3Y A;  2K9P A;  4JI6 O;  1YIT V;  4J9Y B;  4IHJ B;  1UJW B;  4J42 A;  4FIP C;  1H2N A;  1V54 C;  2Z0A A;  3K06 A;  1JFF B;  3E89 A;  3LSS A;  3WG7 C;  2AXT Z;  4DR2 B;  3FD9 A;  4O2A B;  4GX5 A;  4BIU A;  2A0L A;  4Q20 A;  3ASN B;  3D8C A;  3CXC U;  2Q6A A;  4LF8 B;  1W0J G;  3APQ A;  2DN9 A;  2Q8V A;  1VQN V;  1VF6 A;  4UVB A;  1HNX O;  5CN0 A;  1FS0 G;  3RBZ A;  4NXM B;  4NTY A;  4DRX A;  5KMG A;  1SET A;  5LOV B;  2RCV A;  3AG1 B;  4WCE V;  3ABK B;  3GWO A;  4YY3 B;  4YXW G;  4G2K A;  2DJV A;  3B09 A;  2W6I G;  3CE2 A;  4RQE A;  2UUB O;  1FAF A;  2DWD C;  3K9A A;  3VQY A;  1QLN A;  2WLN A;  4JZG A;  2DYS B;  4FLY A;  1BZK A;  3JAM N;  4NR1 A;  3L70 H;  3RYH B;  2R72 A;  2W6J G;  1K92 A;  1R6N A;  1H8E G;  1WB8 A;  4JI8 B;  4O4L A;  2OIG A;  1K34 A;  4FJC C;  1YTF B;  3HKC B;  3RYF A;  1JR9 A;  4DV0 B;  3KKY A;  4K0K O;  3B77 A;  1IBK B;  5L3E A;  1T5E A;  4X1I A;  3FAV B;  1J5E O;  2QM8 A;  1K5S A;  4CS3 A;  1KB9 F;  1OCC C;  1SF9 A;  5JQG A;  3ABL C;  2JGU A;  4DR5 O;  1FXH A;  3APO A;  4BW9 A;  2PI5 A;  2EIL C;  3ZRW B;  4DUZ O;  5GON A;  3RYC A;  2M7W A;  4J7J A;  5AG2 A;  3ZCC A;  2EIN C;  3K5M A;  5L3F A;  3QTC A;  4F4L A;  2OWO A;  4FPP A;  1I0H A;  2QE7 G;  2ITD C;  2Q7H A;  3OT7 A;  4BIZ A;  2HJD A;  3WB2 A;  3ZHR A;  1P7G A;  3T1C A;  1CEZ A;  4JGS A;  3K04 A;  2BTQ B;  2CTQ A;  2PUS A;  4NB5 A;  5BZB A;  3LDE A;  5IWA B;  1NH2 D;  1P49 A;  3T2M A;  1G8M A;  2EJR A;  1LUW A;  4TV8 A;  2CAZ C;  3W7X A;  4FMT A;  3ZMT A;  3OE7 G;  4LH7 A;  4OPA A;  1CP9 A;  2VQF O;  2EIM C;  1JFF A;  3O9O A;  3CJH B;  4YHH O;  5D5P A;  3CCV V;  3SJQ C;  3IAY A;  4GZR B;  4O2A A;  4AQY B;  1I08 A;  2X6A A;  3JD4 A;  3LSQ A;  3CCJ V;  1VQK V;  1OZ0 A;  2GBO A;  1AJQ A;  1SQG A;  3A2F A;  2KQX A;  2BTO A;  2WLI B;  4JF3 A;  4WF9 V;  1AJN A;  1QLE B;  1WJZ A;  2ADP A;  3ZRV A;  1X59 A;  2VWJ A;  3ABT A;  1IBM B;  4NTX A;  3M8A A;  3L74 H;  2RDC A;  3VOU A;  1KP2 A;  3GWK C;  2JIZ G;  3CRC A;  1XL4 A;  5KA6 A;  5LOV A;  4I55 B;  1TVK B;  4LBE C;  3WFV A;  4JI3 B;  4PDL A;  4DV5 O;  1F4M A;  4DK0 A;  3ZHS A;  4R6Z A;  3OGC C;  1XBL A;  1FFT B;  3I5D A;  4D7S A;  3RYH A;  2UXB O;  2OCC C;  1NVP D;  5LMN O;  1PPJ H;  5EBM C;  5D5Q A;  3SPJ A;  3B40 A;  3GB7 C;  3K57 A;  2LW1 A;  2PGG A;  3HKC A;  5JCO C;  3HPL C;  2Q5Z A;  2ZNI A;  1H2G A;  1AJP A;  4QE7 A;  1NKD A;  2H3O A;  3BAB A;  2UU9 B;  2YXH A;  2YIB D;  4PD4 F;  1YVW A;  4H13 B;  4F6E A;  4XDK A;  4UFZ A;  3TK1 A;  3FAV A;  4F6R B;  1BQ0 A;  2V1D A;  4UCT A;  1TUE B;  2R9R B;  2ZT9 B;  3AG4 C;  2MW2 B;  4E4E A;  2AZ0 A;  5CA1 B;  4TV9 A;  3ZRW A;  5B1B B;  2JGD A;  4PDM A;  4JI0 O;  2QSA A;  1ZL8 A;  1R6K A;  1BMF G;  4NXN O;  5IJ9 B;  2BCC H;  4AIL C;  2Y69 C;  2XTA A;  4GX2 A;  4DR4 B;  3JCU Z;  1XMO B;  3ICX A;  2BTQ A;  1IBL B;  5EBW C;  5EBL C;  1PL4 A;  1VIB A;  3N27 A;  2XAF A;  2HG5 C;  2ZE6 A;  4DR1 O;  1BE3 H;  4DV4 O;  4DV1 O;  2JDI G;  2L35 A;  2D2C B;  1SES A;  1GN6 A;  4YJ3 B;  3MHS C;  3JAL B;  1XNR O;  1MMM A;  3JAT B;  5BMV B;  2E5L B;  3ZMV A;  3CJH A;  3K03 A;  1EN4 A;  5LA6 B;  4E2L A;  3FB5 C;  2YEV B;  4PEL A;  5KA5 A;  2X6B A;  2LGQ A;  3OD4 A;  2OTL V;  2A7W A;  1S3J A;  2WLI A;  1NT2 B;  2Q0O C;  4P2Z A;  2N74 A;  3HR0 A;  4B08 A;  1KC8 W;  3RN4 A;  2UXN A;  2R9I A;  5LBQ A;  3IJ4 A;  3LUT B;  2F4V B;  1XNQ O;  4ZKI A;  3GVM A;  3NR7 A;  5BXZ A;  3TXS A;  3WG7 B;  5BR8 B;  3ZED A;  3OR6 C;  2WA4 A;  4B3R O;  3VQW A;  4I55 A;  1TVK A;  4LCU C;  4R8C A;  2DMX A;  2JS5 A;  5LP6 C;  1S5J A;  4DUY B;  1GTO A;  1RM1 C;  3ZHT A;  4LF4 O;  3ETD A;  3T4D A;  4LF5 B;  4RUF A;  4YJ2 B;  4FFB B;  3BPZ A;  1FD9 A;  3A0B Z;  2WPD G;  2L6L A;  3PJS K;  1US6 A;  1B04 A;  1ARO P;  2EX3 A;  2WSS G;  1QR9 A;  1B3Q A;  4BAY A;  1N33 B;  4QJF B;  2ZKO A;  1FXK C;  1OV9 A;  1P7B A;  1PNL A;  1O9H A;  1CXZ B;  2RMK B;  3D3Q A;  4JI4 O;  2ZM6 B;  1VQO V;  1OCR B;  4ZI7 A;  1RP3 B;  3MD0 A;  3THO A;  4QNH B;  4F6R A;  4HNA B;  3KCX A;  3MAQ A;  1JOY A;  1P4R A;  2P4V A;  5CA1 A;  1AI5 A;  3WB0 A;  2FB5 A;  4FM2 A;  3VQX A;  2IU3 A;  1H2M A;  4P9O A;  3KZI Z;  4DV7 O;  5IJ9 A;  5FL7 G;  3ZRS A;  5K1P A;  1XHX A;  1MA1 A;  1AB3 A;  1OCC B;  3K3W A;  4IL6 Z;  3H9V A;  4OX9 B;  5E1A C;  1M57 C;  3T1H O;  3QO5 A;  2HLD G;  2GDS A;  2JJ2 G;  4YJ3 A;  4X64 B;  3JAL A;  3K5N A;  1F23 A;  3JAT A;  2ZE8 A;  5BMV A;  4ZOL B;  5LGU A;  3W7S A;  2WLH A;  5LA6 A;  3JSN A;  3D3I A;  3L73 H;  2E76 B;  2YEV A;  4TSF G;  4KHP O;  3RT3 C;  3LDC A;  1NVP B;  4XBF A;  3E22 B;  3ZMS A;  2KSD A;  5LHI A;  5EYP B;  1IVS A;  2PF4 E;  3BRC A;  3ZHU A;  3ZN0 A;  3SYP A;  1KKC A;  5IWA O;  4J7Z A;  3AEI A;  1DF5 A;  2HKO A;  3AK1 A;  3OTO B;  3CS5 A;  2YI9 A;  4GLX A;  3AG3 C;  4LF9 O;  4DR6 O;  2LW7 A;  2IW5 A;  3FX7 A;  4J10 A;  3JAW B;  1NBM G;  3C3S A;  4DR3 B;  2WWW A;  3KG2 A;  2JK5 C;  4FFB A;  2B5U A;  4JI1 B;  1TUB A;  2Q69 A;  4CH4 A;  4JTA B;  2Y48 A;  3LNM B;  1SZT A;  4AQY O;  2Q68 A;  4U3J B;  1S76 D;  1GM8 A;  4O2B B;  3IC7 A;  4IIJ B;  4O4L B;  3CC2 V;  3CRM A;  4MVS A;  2UXC O;  4LFB O;  2HVK C;  4J41 A;  1IBM O;  1ROP A;  1BS3 A;  2ZXW C;  5H5N A;  4JI5 O;  4H37 A;  2HEP A;  2YID A;  2YUA A;  3PN1 A;  4W4K A;  2OCC B;  1GN3 A;  5KHG A;  4HNA A;  4MVQ A;  2WA3 A;  2B1G A;  4D6T H;  4LF7 B;  4DV6 B;  5IY5 C;  1SKV A;  4GKK O;  4FLV A;  2YSU B;  3CMA V;  1EN5 A;  2X6C A;  4EKW A;  1SA0 A;  1N36 B;  1WP8 A;  5EK0 A;  1D5N A;  1Q5O A;  4FLU A;  1VQL V;  3K79 A;  3CCS V;  2UUC O;  1KUQ A;  4UB8 Z;  3SJB C;  3P3N A;  1VQP V;  1YI2 V;  3K08 A;  4N21 A;  1JQ0 A;  1NR7 A;  3AK2 A;  2AZ2 A;  3TET A;  2QR4 A;  2WAM A;  4B3S B;  1IXM A;  4X20 B;  1I94 B;  3JD3 A;  3BCC H;  2Y69 B;  3WB1 A;  4ZOL A;  4I4T A;  1JX9 A;  4MVM A;  1TA8 A;  4LFA B;  3DSQ A;  4XDJ A;  3SYA A;  2P90 A;  3N2G B;  5IYB O;  2CE4 A;  4FM0 A;  3CCE V;  1AP5 A;  3E22 A;  2XOK G;  5KHJ A;  2P22 C;  4OXS A;  4RAI A;  5EYP A;  4DR4 O;  4X1K B;  5B1N A;  1XMO O;  3U11 A;  1U97 A;  5IYZ B;  3CPW U;  3OMI B;  2YIB A;  3D36 C;  5GTI Z;  1N8R W;  2HHH B;  2ARH A; 
#chains in the Genus database with same CATH homology
 3WU2 Z;  3A0H Z;  3KZI Z;  5B5E Z;  3JCU Z;  5GTH Z;  5KAI Z;  5KAF Z;  5TIS Z;  3A0B Z;  5B66 Z;  4PJ0 Z;  4IL6 Z;  5H2F Z;  4UB6 Z;  4UB8 Z;  1S5L Z;  5GTI Z;  2AXT Z;  5E79 Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...