3JQ7A

Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor (nadp+) and inhibitor 6-phenylpteridine-2,4,7-triamine (dx2)
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
267
structure length
247
Chain Sequence
b'EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQSNLSIVNLCDAMVDQPMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pteridine reductase 1
molecule tags Oxidoreductase
source organism Trypanosoma brucei
publication title Structure-based design of pteridine reductase inhibitors targeting african sleeping sickness and the leishmaniases.
pubmed doi rcsb
total genus 93
structure length 247
sequence length 267
chains with identical sequence C, D
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2009-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3jq7A00
4MIEA 4DLAA 3RUFA 2F00A 4Q3DA 4F3YA 4NZ9A 4MPDA 4URFA 5L45A 1IULA 1CF2O 1DIAA 1ZSYA 3FCOA 3QLJA 1N7GA 3GR6A 1VJ1A 2C5AA 1E1NA 4GVXA 5G2OA 4HP8A 3WOHA 5CPBA 4NDNE 4TRRA 2AG8A 4ZQBA 3IUSA 1WP4A 1SEPA 2PZKA 5IN4A 4CM4A 3IQDB 5HRUA 4P4GA 1P3DA 3GNSA 3ICCA 2AG5A 5BSHA 4GI2A 3NYWA 2P2SA 2C2YA 2WYWA 4I5EA 4J91A 1S6YA 3VTZA 3WS7A 1PZFA 4D45A 4J9VA 4FFNA 5JXWA 2EJVA 2C29D 1VL0A 2QG4A 3H4VA 3EGOA 2PKQP 1AN9A 4XA8A 5AYVA 4RVHA 1VRWA 4U6SA 2GF2A 4MVJD 3NEPX 2FR8A 3UKOA 3L6EA 4A7PA 4MDHA 1XKQA 2NWQA 4JIGA 2Z5LA 1ZK2A 4BO3A 1MUUA 3E5RA 1T1SA 4CM6A 4Z9FA 1QYVA 4QX6A 1EVIA 4XCVA 3TJRA 3MTGA 5DBFA 4BGEA 5JSFA 1BWSA 1HL3A 3VTFA 5DBGA 4YBZA 4AJ1A 1J5PA 3P19A 1ZIDA 3OA2A 4RPLA 4B4UA 1CQIA 1M6WA 4D3DA 5I7VA 1EMDA 5HBRA 3JD2A 2FSSA 4H7PA 2E82A 1F8GA 4KP7A 3DBHB 5G4KB 1Z6ZA 3GC6A 1P33A 1I33A 5ICSA 2JJYA 5THQA 1W4ZA 4EUFA 1GYRA 1UXJA 4FGWA 4JGBA 3TL2A 2ZQYA 4XX0A 1E7YA 2EGGA 3AY7A 2JKVA 3NT4A 3LK7A 4CV3A 1NAHA 1O95A 2VT3A 3W4KA 1R6DA 1ULUA 4FJ2A 4XQGA 1VSVA 1ZBQA 4MKRA 4NIMA 2PH5A 4Q3EA 5DN9A 1Z7EA 4LMRA 1YDEA 2GRAA 5AXAA 4EYEA 4P38A 2EP7A 5DCUA 4TRJA 1YONA 1ZXBA 4CLRA 2CF5A 1L1FA 3T4XA 3L4BA 3HB4X 1Y9AA 3LLVA 1WPQA 1LLQA 3G79A 2PD4A 3V1TC 4HNHA 1ZK0A 1NQTA 2GN8A 3QE3A 3TOXA 3ZNPA 3GH3A 4KUHA 4CLOA 1LDNA 2OL4A 2VZ8A 1BXGA 2YDXA 1JWAB 3ANLA 2Y1OA 3C85A 4D42A 3U5TA 3K96A 3RFXA 1KEVA 1Y1PA 5JO9A 4BV8A 2IYPA 4J3FA 3T4EA 2Y66A 4QXMA 4YJHB 4U5QA 3PJGA 3GMSA 1F14A 4BO9A 1T1RA 2D8AA 3NDIA 3ZN2A 2DPGA 1CWUA 4GPD1 1CDOA 2GCGA 2O2YA 4RQUA 4ZU3A 4W4TA 1WVGA 3PIDA 2AEMA 3DAFA 2AE1A 1M75A 3NKLA 3R6DA 1QMGA 3PXXA 4IS2A 1IHXA 1PEDA 1YGYA 4BS9A 3OIGA 3EVNA 3TN7A 2Q49A 3MJSA 5GZ1A 1F06A 1B15A 3VVCA 1NPYA 4YR9A 4XD2A 5DULA 5JCJA 5JYEA 1QP8A 1B8VA 3CSDA 3BMNB 3DXFA 3BZUA 4A03A 1NFFA 3FR7A 5TIIA 3QV1A 5HTOA 4CUJA 5KJEA 3OQ6A 3N74A 1FMCA 4K26A 3ASUA 2OZPA 5TJHA 3CTMA 5DCWA 2B4TO 1BXKA 4AJIA 3RD5A 4WCFA 4B4OA 3GVPA 4IDCA 1KVSA 1SMKA 4PRKA 3V1UA 3GRKA 1DIBA 1HDYA 1PGJA 1T26A 4IIVA 2OBNA 4TVOA 4CLDA 4ALNA 1EZ4A 3QVXA 2VZ0A 4J16A 4CMIA 3Q9NA 4P4NA 1SB8A 1XELA 3DTTA 4LRTB 4BHTA 4YJGA 1HTBA 5JCJD 3NDRA 3NX4A 1GL3A 1KIFA 2RH8A 4NNJA 3RSHA 1UDCA 4OOFA 4PLZA 5GZ3A 4H15A 1I3KA 3QWBA 3WLFA 3F4LA 2OOSA 4L9RA 4HX5A 2IXBA 2ZYDA 5L95A 2CVZA 2ILTA 4WLUA 2D0IA 1XQ6A 3WICA 1AGNA 2Q2QA 4O59O 4IDEA 4B7XA 4GWKA 2PA3A 3JQBA 1A9ZA 1LQTA 1LNQA 5TF4A 3ZCXA 2WMDA 2JCXA 1LXCA 1YQXA 2EG9A 1LRLA 5CPFA 1RYDA 1NXQA 4RF3A 3IAHA 3Q2KA 3GN1A 3KYCA 4J7UA 1CJCA 3AI1A 5TT0A 5F1PA 3MJVA 4GWGA 3JQAD 3R3JA 4ND2A 3GY0A 1PR9A 4CLRB 2A35A 3JQ8A 5JAIA 4WEOA 1LC0A 2VT2A 4F6LA 1DSSG 3KB6A 1YB4A 3ADOA 4WOJA 4AJLA 4ZHSA 4IPTA 3UF0A 3SXPA 3KEQA 5CEFA 5EESA 4QTZA 1OMOA 3G0OA 4W7HA 2EW2A 1YBAA 2VNAA 3B1FA 3ENKA 4ILKA 3FPLA 4IUYA 4QQRA 3UH1A 3GGOA 4OXNA 1PGQA 2J3HA 3GG2A 3ABIA 1UXHA 4MVJG 5I7SA 4ND4A 5ICMA 1GZ4A 4RO0A 2WD7A 3F1KA 2O2SA 3H65A 6LDHA 1TXGA 1I10A 2JCYA 3INTA 4E30A 4UAGA 1NFQA 5IG2A 2POQX 5CP8A 3ROKA 3A06A 2A94A 1LLUA 1ENYA 1H5QA 4M1QA 3GNQA 5KVCA 4NBTA 1P74A 2B0JA 2BF7A 2O7QA 3F9IA 4ZVVA 3V2GA 5HWSA 3PJDA 4QSMA 4PLGA 4W82A 1R0LA 5CEEA 1GADO 4MP8A 1IL0A 1V3VA 2DVMA 4DGSA 5A5EA 3QVTA 3WWZA 5JW6A 1KY4A 1GV0A 1MC4A 4NU5A 3Q9UA 4QO8A 5ILGA 2FN7A 2D3TA 1JTVA 3KVOA 1XDWA 4I08A 5JAQA 1Z75A 2CMDA 3UVEA 4XRRA 4M55A 4KMSA 4D79A 3ZHZA 1PIWA 2Y68A 2PGLA 4CM3A 3OHSX 1AE1A 2DFVA 5B4TA 5KWEA 4OXKA 1EQ2A 4CM8B 4RJTA 1JVBA 3D64A 4O1MA 4CODB 3PEFA 1XHLA 2D5AA 4RDHA 2H9IA 4J7XA 2WDZA 4GSLA 1DXYA 4Y67A 2P4HX 5T67A 3ONDA 4B79A 1PGNA 4MO2A 2B5VA 2FR0A 4FFMA 3KYDA 3ZWMA 2JAPA 2NU8A 3AOEC 2ZB3A 4JP2A 3CEAA 3S1LA 1E7WA 3W4IA 3WGTA 3WNVA 4A5OA 2HLPA 3OQ1A 1O89A 3N7UA 3GHYA 3L07A 4NK5A 1H6BA 1OAAA 4AJOA 5K6AA 3M1LA 1N1GA 2B5WA 4QEDA 3K9QO 1DB3A 3RKRA 5DT9A 5KVVA 4J1TA 1HDGO 4WLNA 3RJ5A 1HRDA 4XRGA 4O6VA 1HSZA 5IDWA 3ZV6A 1DOHA 1HDCA 1UH5A 3PJFA 2D59A 4FC7A 4NHEA 5I9MA 4CM4B 4ZGWA 3AWDA 1NPTO 2LDXA 2D2IA 3F46A 1GD1O 3RU9A 4AICA 2BMAA 2PK3A 4CQMA 4RPJA 4WCFC 1QYCA 2X9NA 3EZLA 3PYMA 3GEDA 1MA0A 2QQ5A 3TFQA 4BKRA 3DFUA 2WJPA 3G17A 2C07A 1TB4A 4P4LA 2VWQA 4PN3A 3PWZA 3E9NA 4CLOB 2VYVD 2QRKA 2DBVO 1IE3A 3OF2A 4XB1A 5JYDA 1K6JA 3AM3A 1UXIA 3O8QA 2AA3A 5FF9A 2W98A 4N5MA 4CV1A 3GMDA 3OP4A 3OMLA 3PQFA 4S3MA 3Q0EA 5CG2A 1UP7A 4II3A 2C2XA 4KOAA 3BHJA 3M2TA 4NFSA 2VCYA 5G0UA 2Y93A 5CDSA 3DBVO 2AEJA 3PDJA 3S8MA 2Y1EA 2FR1A 3LT0A 4N7RA 3TQHA 1VM6A 3ZNNA 4AVYA 4ZQGA 3WBFA 3VPSA 1JN0A 2WYUA 1Y9EA 5FI5A 1NWCA 3GFBA 2GLXA 3VZPA 4BO7A 5TLSA 4E0BA 3U0BA 4CM1A 1NASA 1ULSA 4YJGB 2GN9A 3ZWCA 5FEUA 1P1RA 1ZMOA 1IPEA 1DRWA 1KVTA 5C7IO 5ER9A 3T7CA 1ZFNA 3WJ7A 7MDHA 5JBIA 4R9RA 4J1NA 4RVDA 3G1UA 4YA6A 5T64A 1FDVA 5HS6A 4ALIA 5I7EA 4Z6KA 1E7MA 3FI9A 3K73O 3DFZA 5AXCA 2VHVA 1YL5A 1E1LA 5I8WA 4OH1A 1KEUA 2X5OA 4RGBA 3WGZA 3WIEA 4IQ8A 4D44A 4TWRA 3KSZO 1EK6A 2V7PA 4OKNA 2QZ9A 4JJIA 4BNJA 1LDYA 3I23A 2VUTA 1G0NA 3D0OA 5CHEA 3WGGA 2DAPA 1OFGA 3VH2A 5L51A 1LDBA 3AM5A 1R37A 3KYCB 5DOZA 4UUNA 4OSOA 2GD1O 1KVQA 3NGLA 2JD0A 1GYQA 3JD4A 2QRLA 2NV6A 2X8LA 3TZHA 1NPDA 2PZJA 4IMPA 4IDGA 1ZXLA 1N92A 4KQXA 2B69A 4E12A 2WSBA 5FYDA 4IJVA 3I5MA 4YVFA 3ICPA 4GGPA 1ZW1A 3TRIA 1X7GA 4NFYA 5H81A 2NSDA 1VSUA 3FR8A 2HMUA 1GQ2A 2NLOA 2HDHA 3FPCA 4TQGA 4DC0A 3JQAA 4E5YA 5A04A 2WD7B 1BMDA 3SBOA 4B8WA 2X5KO 4G65A 1SEVA 1FJHA 3GF4A 3VDQA 1GFSA 1UZMA 3VPFA 2QX7A 3ZHXA 5CEJA 3H9EO 4FJ1A 3GUYA 1U3WA 3SC4A 1ISMA 3ZH2A 4YPOA 4FW8A 4J0EA 1MV8A 1ISGA 3E82A 3SJUA 5BNTA 3MOGA 3JQFC 1LSOA 4BNHA 4PGFA 1OOEA 3PHGA 3LZ6A 1BTOA 1E6WA 1V6AA 2YQ4A 4NI5A 4YAEA 1LLCA 1LDEA 1AHHA 3RUCA 3R1IA 3TOZA 5DCYA 4IY1A 4YQYA 5JDIA 1I3MA 4U7WA 4U0KA 4W99A 2O7SA 2NVUB 4NJMA 1EBFA 2HMSA 3BMOA 2YHUA 3TDKA 3ZI0A 2W2KB 4BGIA 1GZ6A 1DAPA 2X4GA 3QHAA 1JKJA 1U4SA 3GQVA 4PCVA 4PVCA 2HRZA 4Z3DA 1Z45A 1I0ZA 1Z7BA 1EFKA 2HCTA 2X0NA 1ZK1A 2P5YA 4IDAA 1Q1NA 1YJQA 4IIUA 4L74A 1PJCA 1DFHA 3W1VA 3W8EA 1U3UA 2HK8A 4NH4A 1UJMA 5U4QA 2YY7A 1UDAA 1E3JA 3JQGB 2ZB8A 2I9PA 5F1KA 3FTNA 4IJKA 3F47A 1LQUA 1ZEJA 1E77A 1XR3A 4BKOA 2QZZA 2C82A 3JYNA 3W6UA 1HYHA 1A27A 2EP5A 3HSKA 4J0FA 2P5UA 3I4CA 1C1XA 4BQRA 4RVFA 4YAJA 3C1OA 1W0CA 3ENNA 4XYEA 2GR9A 4GX5A 3JQDA 3FD8A 3JQ7B 2UV8A 2A92A 1EUCA 4IGEA 1DC4A 1MC5A 3BTSA 3GPIA 4BOYA 4ZJUA 3RVDA 5IDYA 1FXSA 1LC3A 3VDRA 4BNXA 3LC7O 1B0AA 2YUTA 1QKIA 3DC2A 5TQVA 2VZ9A 1IZ9A 2GGSA 1OI7A 5C7LO 1Z82A 1C0IA 4XQCA 4EEZA 5H82A 3BMQB 1J0XO 5CFZA 1I30A 3AOEA 3IMFA 1AXEA 4EDFA 1GUFA 5KJ6A 3OECA 2B35A 1Y81A 1Y5MA 1XLTA 2QHXA 3JQ8B 3MWEB 3PTZA 4FJ0A 4WLVA 3ZU3A 1TT7A 4DIFA 5JO0A 4CM9A 4FBGA 4ZA2A 4CMEA 2ZB4A 2Y1FA 2UUOA 1YS4A 3M2PA 4R5MA 1UZLA 2E48A 5BSGA 2GERA 1P0CA 5THKA 3UOGA 4BNYA 4B3IA 2HSDA 1ZMTA 2EKLA 4J2HA 3S2EA 2PKQO 1OC2A 3M6IA 3CH6A 1ZSVA 4E13A 1ARZA 1CYDA 4DIBA 1V8BA 4IJWA 4EW6A 5DP2A 1T4BA 4RPKA 4NU6A 1QYWA 1QV6A 3L77A 3MJTA 3AU8A 3SJ7A 1RPNA 5EPOA 2O3SA 3IOYA 3BTOA 3PYLA 4GX0A 2WTBA 4CLHA 1RM4A 1KERA 4J43A 2UYYA 3WTBA 4J7CA 3QA9A 4EZBA 3JTMA 3SC6A 4DL9A 2O3RA 5C5IA 1EK5A 5F5NA 3U49A 4YQZA 3L0DA 3RKUA 5JNLA 4BO4A 2PTGA 3AFMA 4WLEA 5BNIA 4BNNA 1QSGA 3PQEA 4BGVA 5AXDA 3F1LA 4JQCA 4RLSA 4WNCA 4NR0A 2E49A 1GUYA 1MFPA 4NBUA 3ANNA 4KUEA 3HADA 1AXGA 4R51A 1H2BA 3ZWVA 1M76A 3KLPX 1W6UA 1MLDA 4CLXA 3OQBA 4FR5A 4D3SA 3UCEA 4GLLA 2I6TA 1SC6A 3S55A 2EIHA 4R3NA 5L9AA 4RZHA 5B37A 1DJNA 4JCOA 3SVTA 2VTDA 2ZJ1A 2O23A 4M49A 3UCXA 4MVJP 4DMLA 1H6DA 1N8KA 5U9CA 4F6CA 1ORRA 3GG9A 1D3AA 3EW7A 2YDYA 4IXWA 2DQ4A 2P4QA 2RHRA 3HB5X 2G0TA 5EQDA 5A9TA 4CQLB 2VWHA 1D4FA 2XPCA 2BFOA 4CMKA 1LSUA 1EVZA 4XIYA 5T8KC 3PJEA 1ONPA 5AQ1A 4IDFA 4RVGA 3ETDA 3I52A 3KEOA 1UR5A 1WDKA 3NT5A 4M86A 1T2DA 1U8XX 4A27A 5ENVA 1P1FA 2JHFA 4ZN6A 3AFNA 3U62A 4MJLA 4MVJE 1Q0QA 2Y0EA 1ONOA 3DBLB 4FSHA 3GZNB 1NM5A 3IC5A 5KOIA 1LI4A 1TLTA 3GLQA 4Y6PA 1H6CA 1I2BA 1HF3A 1OZAA 1R12A 3DOCA 3EMKA 4Z9XA 2Y1GA 2ZCUA 2VOEA 3TZKA 4OHUA 1JVSA 1NQ5A 4OQYA 5DZSA 3WGYA 2BD0A 4GMFA 3CMMA 4HY3A 1WZIA 1HZZA 4MINA 1SO8A 1HLPA 3EVTA 4BIIA 1PJSA 1PGOA 2CY0A 4DYVA 4TRMA 4BNIA 1U28A 3CINA 4UVGA 3FRJA 3OM9A 3BAZA 2ZCVA 5L3ZA 3VKUA 2WEKA 3SX2A 1Q0HA 1C3VA 1PS8A 3O03A 2RH4A 1T2FA 3BTUA 4N18A 5TSDA 4E2ZA 4MIOA 3RBZA 2Q2WA 2CF6A 3WSVA 3SLGA 1B7GO 3O4RA 3FNEA 4NJMB 2UAGA 5IZ4A 1DC3A 3O9ZA 4B3JA 5F3RA 3PK0A 1WDMA 1ADCA 4ZRMA 3DO5A 1PJBA 3H3FA 4JNKA 3R0IA 1PJ4A 3PWKA 4ZICA 2I66A 5G0WA 3ZNQA 1DBVO 1KVUA 5ES3A 3H6KA 4UVHA 2GYYA 1YL6A 1SB9A 1JLLA 3NV9A 3P7MA 4IBOA 5IAAA 1XQ1A 5JAMA 5I7FA 4C4OA 4R69A 4E5MA 1SNYA 3TFOA 3H5AA 3PFFA 1HETA 2FP4A 2B37A 4YTEA 3PHLA 4XWYA 1HE2A 2Z1MA 4YCAA 4UULA 5EQFA 5HA5A 3RBXA 5JAZA 5LDHA 1VKOA 3DBRA 4KTVE 1ID1A 5KNLA 2HJRA 4YJDA 5EIOA 3ZWPA 1TVEA 3GEMA 5IXYA 1N9GB 5JFOA 1GQYA 4P22A 2VRBA 4PVDA 1NHWA 3WGIA 4BNVA 1HYEA 4QO7A 5A9SA 3KLMX 3HN2A 1JWBB 4BL5A 2XAAA 1GDHA 1Q7GA 4XR4A 2YHIA 4UREA 5COAA 3RJ9A 1K0UA 1E6EA 2NUAA 3PZRA 1G1AA 1X14A 4JBIA 3N58A 4M87A 4E5PA 4B7UA 3COSA 5G0TA 4I1IA 2YQ5A 3FWZA 3PQDA 2DLDA 3PRJA 2UVDA 4X54A 2FRDA 3MJ4A 1VC2A 1Y8RA 3RFVA 4PLTA 3F3SA 5K9ZA 2CUKA 5JCXA 2YFHA 4ZQEA 2AW5A 3NJ8A 4FC6A 2CZCA 2HMVA 4JBHA 1TEHA 3EUWA 2P68A 4BO5A 1H0KA 4D46A 2I3AA 4FS3A 3T7EA 1YE3A 3B70A 1ZUD1 1YB5A 4BMVA 1LA2A 3WFJA 4YJHA 3PI7A 4ZQFA 3FBTA 4MVJH 3KYBA 1XEAA 5IXSA 4HKTA 1N5DA 3K31A 2G76A 3AI3A 1CEQA 4WE3A 1JA9A 3C3XA 4CR6A 2DUWA 1K89A 2VUUA 1QG6A 3OSUA 3ZU4A 4JBGA 4L0QA 3EY4A 1RKXA 3ITKA 1YO6A 1I24A 4YDRA 3VZQA 3U09A 1IHYA 3QVOA 4IZHA 1N7HA 3B6ZA 1BHSA 3JYPA 2Q4BA 1GCUA 3D4NA 3R3SA 2AQIA 1JU9A 3PIIA 1C14A 3W8FA 3V8BA 1YBVA 4N5LA 1LX6A 2I65A 4BNWA 4YJFA 1AUPA 1DDOA 3VC7A 3TF5A 2O3TA 2EXXA 1LUAA 2NVUA 3DZIA 4PLVA 3W6ZA 2EEZA 3CZMA 3LT2A 3Q11A 5LDGA 1ISHA 1TA4A 1LLDA 1ZKMA 4XYBA 4CMHA 3DMYA 3JV7A 4A26A 4A73A 3V1YA 4NMHA 1SCUA 1EBUA 1EQUA 3DZFA 5JY6A 2BFAA 4LGVA 4I8XA 4RPGA 2AQHA 1XA0A 4KWHA 1LSJA 2ZK7A 3MZ0A 2VWPA 5CDGA 4UUMA 1GEEA 2BKAA 2XOXA 3HZZA 5JMPA 3V5NA 3X2EA 1LU9A 1VL8A 1AHIA 4RF4A 1RM3A 2OHXA 5KKCA 5A5FA 5L4SA 2ZATA 4YT4A 2Q4EA 1E7QA 1ZK3A 2X23A 4R68A 4J4TA 4RPHA 4A2CA 1WXDA 4ALLA 4HNGA 3HG7A 4XIJA 1P1IA 4N5NA 2ZIZA 2X9VA 2ZTUA 4M8SA 3DOJA 2PY6A 2ZTVA 2C7VA 2C5EA 3D4OA 4FQ8A 2PD6A 1UZNA 4TZTA 1XYGA 4IDBA 4E21A 7ADHA 1YXMA 2VRCD 4NBWA 3BMNA 3ZWYA 2DM6A 3GRPA 3CIFA 4AJJA 3RROA 3DMTA 5TGDA 3ZV4A 2GZ2A 5L7TA 5A3JA 5KVQA 2DTEA 3HN7A 4M89A 1U2DA 2FZEA 2PZLA 3BIOA 4BVAA 4DBVO 4JN6B 3GK3A 4JXKA 1U8FO 4OOEA 3E18A 3HDHA 5B1YA 3MOIA 2NTNA 5IDQA 2NQ8A 3PYXA 3OEWA 4FFPA 3GVIA 2VHZA 4FFLA 4WPGA 1GU7A 3EDMA 3RUHA 4AJ2A 1ZO8A 1L7DA 4UEKA 3UUWA 3PLRA 1A72A 4OKIA 2XXBA 3MJCA 4D41A 1NVGA 2EGHA 3L6DA 1TI7A 3WGOA 4ALMA 4RDIA 1LRJA 2HRBA 5CDTA 3ZU2A 3D4PA 3DZGA 4RL6A 3V2HA 1D7OA 5F21A 4XYLA 4W6ZA 4UVEA 3TL3A 3V2UA 1CERA 5U1PA 1UXKA 1NR1A 1U1IA 4GH5A 3WR5A 1EUDA 2QYTA 1YKFA 4O5OA 3H8VA 4YAIA 4IM7A 1U7HA 3AW9A 4Z9YA 3WG9A 3CUKA 1YDWA 4G81A 4WASA 4BB5A 4BKQA 1UDBA 4R5HA 4BNUA 4BKPA 1PZEA 4IJUA 3PHIA 2J3KA 4D3FA 2CFCA 1J6UA 1I3NA 2JFHA 4FOSA 1IOLA 2IEBA 5BSEA 2VQ3A 4IS3A 1UAYA 1PX0A 4G5HA 2XF8A 1W73A 1UP4A 2XXJA 4GKVA 1PWZA 4BNMA 4FDAA 4TMFA 5G0SA 1YH3A 1YL7A 3E1KA 1XGKA 2DBQA 3AUUA 1KETA 3H9GA 2Z95A 4PLPA 2Q50A 4D0RA 4PG7A 4W9NA 3A1NA 1O9BA 2EKQA 2YYYA 4R1NA 3GHHA 1I3LA 2W90A 1ADGA 5L4NA 3ZU5A 3VZRA 4AJEA 1LDGA 4TVBA 4EI2A 1EUZA 2VYVA 1Y6JA 3UHAA 1LTHR 3ZV5A 2ZYGA 4XZ3A 3KV3O 5A9RA 5KJCA 1KS9A 1Y8RB 4DWVA 1JAXA 1T2AA 1HE5A 4BO1A 3QVWA 4D0SA 3VZSA 4EUHA 1DHTA 2OO5A 2P9GA 3KOUA 1YQGA 4Z0TA 2GNAA 4YEDA 2VHXA 3DBRB 2Q45A 5AXBA 3OIFA 4QUKA 5F5LA 1B16A 1T24A 2RIRA 3NTRA 1JW9B 3JQFA 2NM0A 3TZQA 2Y05A 3IIEA 1E3LA 1U4OA 3NT2A 3HQ4O 2PGJA 1H9BA 4WLOA 4B4WA 4DMMA 4F45A 4I9HA 2PFGA 2J5RA 1U7TA 2ZTMA 4FB5A 3ASVA 1C0KA 5ILOA 2NACA 1QORA 5FI3A 1E0DA 1XU7A 4XEHA 4AG3A 1C1DA 1Y8QB 2YZ7A 3JD0A 4MP3A 1DO8A 1U5AA 1M6HA 4MVJM 1ZEMA 4Y6RA 1ISFA 5DP1A 4ALJA 3FN4A 3KM0A 4OIMA 3GDFA 4Y9DA 3C7CB 2FSVA 4DIOA 4HV4A 1PGPA 3K92A 3FNGA 1GV1A 1WZEA 3VH1A 4XKJA 2D1YA 1E92A 1VJTA 3CMCO 1NHGA 1U2GA 1HDOA 1S7CA 3WSWA 1H94A 1DLJA 1GAEO 5FFFA 4WUVA 2HO5A 4BMSA 3C8MA 3JCZA 3PLNA 4ROSA 1FDTA 1PQUA 1GYPA 2W2LD 2EJWA 4ONEA 4WKGA 2D5CA 4DQUA 1I5RA 4WCDA 4ESOA 3P5SA 2EWMA 3KRTA 1VE9A 5IFLA 4TSKA 1NBOA 3TZ6A 3BYZA 3QJ5A 2FOIA 2BI8A 3RFTA 3HFSA 5JPIA 1KEWA 3AUTA 5LCXA 3ZW8A 5H83A 5A9SB 3ZHBA 1X1TA 2X7HA 1Z73A 2X58A 3DDNA 4CMJA 3DEYX 1MXHA 3QW2A 3ZWAA 1VKNA 2JCVA 4YWJA 4RF2A 4IQ0A 3VAZA 4B3HA 3IKTA 1HSOA 1M67A 2OBYA 2Q99A 3ON5A 4E33A 4ND5A 5LC1A 4E31A 2Z1NA 1H93A 3GPDG 3U4HA 3JD1A 4E2YA 1UAGA 1ZZEA 4AJHA 3GDGA 1H6AA 3GT0A 3JQBC 1T2EA 4GAEA 4E6PA 1GCOA 2IYOA 4J4HA 2VWGA 4FGSA 4XDYA 5B4VA 1R66A 3I9MA 1HT0A 3QSGA 1F0YA 4IINA 5IZCC 2J5KA 2Q3EA 4WNIA 1U3TA 4CMEC 4YT2A 4J1QA 4RCVA 1E3SA 3LQFA 4I9NA 1KEPA 3JSAA 1FF9A 1O0SA 2V65A 1SOVA 2G5CA 3LDHA 3C24A 2RAFA 1HYGA 4JP3A 2DU8A 4J4BA 4MIYA 2G82A 2FHSA 5G0VA 2I3GA 2BRUA 2CDBA 1Q2XA 2CDCA 3TZCA 5ER6A 4LISA 2HQ1A 4LW8A 3VHRA 5J23A 3NTQA 2PWZA 3EK2A 4AJKA 3ZGYA 1LBEA 3I6IA 3UICA 4BNTA 1YQDA 3SEFA 3WXBA 4CM5A 3G3EA 1R0KA 4KQWA 2VTEA 1OC4A 5IN5A 3KXDA 3BMCB 4ZRNA 1CRWG 5AVOA 4DREA 3QIVA 5K0ZA 2ZKLA 4YXFA 6ADHA 5KTKA 3LSYA 4EJ0A 2G1UA 5T6BA 3IUPA 1UXGA 3QWAA 3UCFA 2A4KA 2NU6A 3H5NA 4JJFA 5CG1A 2O3UA 1NAIA 3RBVA 4FCCA 4CM9D 5JY1A 4GX2A 4HUJA 3QWHA 4HFNA 4RVUA 4P8RA 4CQMD 3S2GA 3LC1O 4PLWA 2H1SA 5EN4A 3GGPA 4BNGA 3DAPA 1ISJA 2Q1UA 2Q1WA 3PHHA 4BNZA 3O8QB 4WK6A 2ZJ0A 5A02A 1ENPA 5IJZA 1H9AA 2JD1A 1A4IA 3D5QA 1EFLA 2YW9A 1WWKA 2Y67A 3WGHA 5ITWA 1ML3A 3BMQA 2HK7A 3GVHA 1P31A 1BSVA 1MG0A 4U8GA 2J8ZA 5DOVA 4DPKA 3RUAA 3NGXA 4E3ZA 3H5RA 1E3IA 4CMGA 1P77A 4OQZA 4R1SA 3GVCA 3K2EA 3VPHA 4FOOA 2PLAA 3RC1A 2VOJA 1CETA 3ZWOA 3I83A 4Z0HO 2BI7A 4YB8A 1F12A 4FIZA 5L7YA 2YV1A 2J3IA 2JHGA 4Y98A 3I4FA 5TC4A 3EYWA 2HK9A 4IQGA 4LCEA 3ETGA 1XU9A 1NNUA 4PG8A 1NFRA 1Y7TA 3K2BA 2CVOA 2Q2VA 4UVDA 3ANMA 4N54A 4OAQA 1VJ0A 4BQPA 4DC1A 2X0IA 1RM0A 1I01A 2HKIA 2FY8A 1O5IA 3DAGA 4OYRA 1QYDA 1ZK4A 1M2WA 5EERA 2FWMX 4LCJA 1QV7A 3JYLA 4MKXA 1MGOA 2NNLD 4R1UA 2SCUA 3JQ6A 2R00A 3AJRA 4CR8A 1V9LA 3WQRA 4H3VA 4QFCA 4AJNA 4HXYA 4XGIA 1V0JA 3KZVA 3O38A 3RWBA 3NUGA 1MG5A 2W4QA 1QXSA 2E37A 4BO0A 1T25A 1IB6A 1BW9B 3B1JA 2HMWA 1BXZA 1Y5RA 2OFPA 4NBRA 1MX3A 4CJXA 3NDJA 3ZW9A 2JAHA 1B8PA 3HDJA 4K9DA 4Q3BA 3H2ZA 1LSSA 3UGKA 1DAOA 3PP8A 2ZB7A 1DRUA 4LRSB 3UAGA 5JC1A 1VI2A 3I9NA 2RCYA 3AUSA 2GASA 4XYMA 4PLFA 5IDXA 2I99A 5IF3A 2IE0A 3M1AA 4II2A 3WGQA 1QRRA 5A1TA 3ZWBA 2DFDA 4CMBA 4EUEA 3ROMA 5DNAA 2H5LA 1JDJA 1FDWA 5I9NA 1HDZA 4DYDA 5IZCA 3NJ4A 3FNHA 4B7CA 4CV0A 3GN2A 3ZNOA 2DBRA 2VHYA 2D4AA 3E48A 4GKBA 4PZDA 3LVFO 4Q3CA 2OUIA 2Y0CA 4MP6A 4YT5A 2G17A 1DLIA 2DT5A 3ZWXA 1PZGA 3QRWA 3LT4A 4BV9A 4E4YA 3AU9A 1YOVB 4EEXA 5L7WA 4DQVA 2DUUA 1QYXA 1ADFA 1YBMA 4CPDA 4JX8A 4AJPA 3E9QA 2B36A 3PPIA 3PVZA 4PG5A 1DPGA 5ENDA 1I8TA 5AOVA 2YFQA 1HLDA 3DOOA 3CKYA 2I76A 3MEQA 2CDAA 3K8ZA 1NQAO 3BMOB 3WX0A 3D1LA 2ET6A 4CL3A 2I67A 4PG6A 4R01A 2PH3A 1V3UA 1IUKA 1R15A 1KVRA 3B20A 4DPMA 4L73A 9LDTA 5ADHA 2GZ3A 2RHCA 2IXAA 5K6AC 2C59A 1V3TA 4YRBA 5BNFA 3IP1A 1ZVMA 4OM8A 4EGFA 1E3WB 4OSPA 2WE8A 4J2OA 5GY7A 3GAZA 2FZWA 5TX7A 1WNTA 1ZJYA 4Q3AA 5JDCA 2JFGA 4EJ6A 4HBGA 2QYSA 4MVJA 4KDEA 4Y6SA 1C1XB 2CD9A 1SOWA 3RCBA 3LU1A 3KSDO 1PS0A 3QVSA 1WMBA 4LMPA 1KBZA 4UUOA 1VPDA 4RZIA 3GZ4A 4J49A 2NU7A 1RJWA 1NVTA 3DR3A 1X13A 1PSDA 4MOWA 3JD3A 4ALKA 2R00C 1A7AA 4QECA 2AMFA 5KIAA 1Z74A 1DJQA 3HJAA 3P2OA 4E2WA 1D1SA 3SLKA 4L75A 1DRVA 1G0OA 2J3JA 3RC2A 3ZHYA 4YRAA 1E5QA 1GPDG 1ONNA 4PZEA 3FTPA 4J9UE 4WJZA 1VL6A 3C1AA 3HHPA 4O0LA 4DLLA 1DIGA 3MJEA 4ND3A 4DXHA 3LF1A 3C1TA 5KJ1A 1B8UA 4AL4A 1WMAA 1U5CA 1PL6A 3DZKA 3JYQA 4XJSA 4RF5A 2BH9A 1OBFO 1A4UA 2Y1CA 4LK3A 3TNLA 1HXHA 1ZCJA 5A4DA 4HWKA 3STHA 1Q0LA 3IP3A 2O4UX 1U3VA 1ZH8A 1IY8A 4PLHA 1J49A 4IDDA 2YV3A 2NVBA 1EE2A 3CE6A 4XDZA 4XYGA 3CZRA 1DFGA 1BW9A 1E6UA 3WQSB 1PQWA 1LRKA 3EHEA 3I9OA 1G6KA 4BNLA 1R16A 4J6FA 1K6XA 2BFMA 5MGBA 1YB1A 3DB2A 3WMXA 4E5NA 4IZIA 3WJAA 2DKNA 3ONEA 1X0XA 1ADBA 1UUFA 1F17A 4ZQHA 1P44A 4R1TA 1W8DA 2O3JA 3BA1A 1KY5A 3KSUA 4GQAA 1GTMA 4BKUA 3VH4A 1PJ2A 1DEHA 3S2FA 4NBVA 1GEGA 4E5KA 1I2CA 1MP0A 1NVMB 2AXQA 2P91A 4HADA 4RORA 4CMAA 1R4MB 3HDYA 4XGNA 2C20A 1RYEA 3LLSA 5A05A 4K6FA 3E6AA 1DC5A 1T2CA 2V6BA 3FHLA 3L4SO 3PDUA 5TS3A 3WWYA 1ISIA 1ENOA 1SPXA 3OA0A 1VLLA 4WCFB 1PQPA 4IMRA 1HE4A 1K2WA 3FSRA 2GSDA 5EINA 3AM4A 3WLEA 2FPIA 3BXXA 4YAKA 2IZ0A 1LJ8A 5EJ2A 1LEHA 5GZ6A 1NP3A 1O94A 3WIDA 1GUZA 3I9LA 3WFIA 2QW8A 4TZKA 4OJNA 3ETEA 3ZWWA 2BHLA 3I6QA 4PG4A 3HWRA 2F1KA 2VNSA 4EBFA 4ID9A 4DTIA 4R16A 3IKVA 2BFPA 1E7SA 2CVQA 2EV9A 2PZMA 5KJFA 4JROA 3E8XA 1X7HA 3VH3A 3WQQA 2VYND 4G2NA 1PJQA 4YJFB 3QP9A 5JLAA 3DWFA 3GFGA 3DL2A 3GZNA 3L9WA 4MVJF 2BGKA 4WGGA 2H6EA 2E6UX 3HE3A 5JMWA 1X7DA 1C0LA 4NFHA 5EL0A 4ITUA 1E5LA 3H3JA 1HEUA 4JLWA 3X2FA 1JKFA 5C3MA 2PKRA 1EVYA 1CIVA 3A9WA 5T8KA 1MB4A 3RIHA 4BGUA 2NTVA 3AI2A 4K1LA 4UEOA 2NTJA 1HDXA 5L53A 1BVUA 4ND1A 5G4LA 2HUNA 3OBBA 4B8ZA 5B4UA 5HM8A 1A5ZA 4XQEA 1DFIA 5KKAA 3WB9A 2OORA 1J4AA 3U9LA 4PFJA 2CSUA 5JS6A 2BGMA 2O4CA 2Q1SA 3U4IA 5I8ZA 1ZNQO 5ITVA 5JE8A 1KC3A 3OFSA 2JD2A 4OO3A 3RC9A 2OXIA 3I1JA 4L76A 2BELA 3GUCA 4W7IA 1SZJG 1T4DA 2B83A 2ZYAA 1EEHA 1B3BA 5JDCC 1D1TA 5FWNA 1P45A 2O3QA 4J1SA 4K28A 2O48X 3GGGA 5CDUA 5EMHA 4FFRA 3B1KA 2NVWA 4GVLA 4MVJI 3WYBA 2OMEA 2P9CA 4OGWA 3VPXA 4AFNA 2GDZA 4DVJA 1YRLA 4GLOA 4OMUA 2WD8A 3DHEA 4C7JA 2EKPA 2NQTA 5C7OO 2Y1DA 2X6TA 2O50A 4KUGA 4KDFA 1PL7A 3D3WA 3QY9A 5I9LA 1GR0A 3VKVA 4RLHA 1A9YA 1MFZA 1A7KA 2GZ1A 2PNFA 1O6ZA 4K6CA 2FPPA 2NADA 2IZ1A 1XG5A 4HFMA 1MXFA 4CLEA 3RUDA 3VVBA 1I2ZA 3FBGA 1YOVA 4UEJA 3L6OO 2FMUA 3OJLA 5CDYA 3H9QA 4Q9NA 1R4NB 3AOGA 4CQMB 5BSFA 4R4JA 1HZJA 4TRNA 3S2IA 1WLYA 3C7DB 1XCBA 1I32A 4KTTE 3NAQA 4CV2A 4U0JA 1BRMA 1I36A 3ST7A 2W8ZA 1WDLA 2DC1A 1O8CA 5KVSA 3IS3A 4L8VA 4DBZA 3DZJA 5T57A 1P1JA 3JYOA 2IODA 4BUCA 2EW8A 2V6MA 3EZYA 2X0RA 3H9UA 1CQJA 4Z3KA 2CNBA 3I9KA 4F46A 3CXRA 2B4RO 1DIRA 3UN1A 8ADHA 3IL2A 4EJMA 2X86A 1PS9A 2E4AA 4B4VA 3BTVA 1R4NA 4LSWA 3NTOA 3E5MA 4O63O 2X5JO 5DBIA 1GPJA 1E3EA 1B3RA 1BG6A 2DBZA 3PHJA 3U4DA 4KZPA 3ITDA 4JK3A 4BO8A 9LDBA 1IYZA 2DPHA 3QWIA 4HFRA 1BDBA 4DRYA 3RQSA 3D3EA 1K3TA 1M66A 2VRCA 4XJTA 4YT8A 5BR7A 1HKUA 5BQFA 2NU9A 1L7EA 4UUPA 1X1EA 3ZV3A 4LSMA 3FNFA 1FK8A 3TPCA 3UW3A 2OP0A 1Q7CA 1E7RA 4L4SA 3ROQA 2GO1A 2IRWA 4CMCA 3RUEA 4YAGA 3INGA 3K5PA 1N1EA 3RU7A 4DUPA 5F1OA 4WECA 3LT1A 4GX1A 3L9XA 1NTOA 3U3XA 3W8DA 1A71A 3LC2O 3PWSA 4YYZA 4NJOA 1YVEI 4YACA 3KETA 3LF2A 5A3VA 3WTCA 1E1KA 1ZJZA 2WWRA 5COQA 1KC1A 1E3WA 3WNQA 3WDSA 4Z0PA 3DHYA 5JC8A 4XR9A 3DBLA 4BO6A 1JKIA 4U6QA 4CUZA 1DHRA 3JQ9C 5DDIP 1C1DB 1Y8QA 2WYVA 3UFXA 2LDBA 4TROA 5KCZA 1PJTA 3DONA 3ORFA 3PZBA 1EDZA 1TT5A 3F4BA 4XQ9A 3AUAA 2JFFA 1ENZA 4QT0A 3RI3A 3GDOA 4DA9A 2GPTA 2BLLA 3AK4A 2W2KA 3IJRA 3JQEA 3KTDA 5BT9A 2PD3A 3PGJA 3ZWNA 1NYTA 4GSKA 2X0JA 4ZD6A 3W4JA 4L4XA 1ZSNA 1RWBA 2UUPA 4PZCA 5A03A 1B14A 3AY3A 3RC7A 2ZQZA 2Q46A 3KBOA 4UVIA 1DIHA 3IDSA 3U4CA 2EHDA 4GGOA 3ZZNA 1PL8A 1PJLA 4I9UA 3KO8A 4PRLA 1QLHA 3O26A 4MKZA 4A0SA 5HS4A 1WAMA 4PLYA 3OH8A 1NWHA 2W2LA 4S1VA 3H2SA 2Q1TA 2R2GA 4FD3A 1WW8A 4BB6A 1K6IA 2TMGA 2QRJA 5G4KA 2C7GA 4BNKA 2PGDA 3LYLA 1KYQA 3GOHA 3KUXA 4IXTA 4R9SA 3WMWA 2OP1A 2X9GA 4W9NC 1KOLA 1F8FA 3JQ7A 4Q39A 1YJ8A 1QR6A 4D43A 2GN4A 4CR7A 4TKLA 1LDMA 2BGLA 3GVXA 3A4VA 3PGXA 3NRCA 4NK4A 1FDSA 4I5FA 4PIVA 1PJ3A 1JAYA 2AQKA 3OETA 1YWGO 3KHUA 4NPCA 4YRDA 3RUIA 1GQQA 4WEQA 3D7LA 3G1TA 4RQTA 3MTJA 2HAEA 4CM7A 3AY6A 2UDPA 5TNXA 1BVRA 2C54A 2PV7A 4DQXA 3A14A 1PZHA 3INRA 2VYNA 3ROPA 4E2XA 4DPLA 4LVCA 2WM3A 4BO2A 3JQAB 1D8AA 3WYEA 1BGVA 1P0FA 1GY8A 1P9LA 4LN1A 5B12A 2V6GA 4FN4A 3QWFA 1PTJA 4R3WA 4OL9A 3Q3CA 3EC7A 3MWDB 3QQPA 1XIVA 3MCVA 3OJFA 1JQBA 3IJPA 3PFWO 3OEYA 2DTDA 2IDZA 3VPGA 1R4MA 3F5SA 2ZTLA 4E32A 3E9MA 2VHWA 3H9JA 3UXYA 3ONFA 5L40A 3RAJA 1RM5A 5L4LA 2B4QA 2P9EA 1H2HA 3GNTA 4NQZA 1PWXA 4CM8A 1XSEA 2RBEA 3DZBA 1XWFA 4FPXA 4BMNA 5T5QA 4INAA 1GZ3A 1Q7BA 4KWIA 1P1HA 4C7KA 2AHRA 3GEGA 4NG5A 1X0VA 1C0PA 3TSCA 3KYDB 2GN6A 3I3OA 3K30A 2X1HA 3DMTC 4WLFA 3DZHA 1HE3A 1NX6A 1B26A 2EF1A 1EVJA 3GA0A 4I5DA 5A06A 3JQCA 4BNFA 1B2LA 1NQOA 2PR2A 3RASA 2C0CA 3WBBA 3DQPA 3F5QA 1HDRA 2IZZA 1FDUA 2TMDA 1BXGB 3HUDA 2Y99A 4PLCA 4R54A 5DF1A 3G49A 3HNPA 3JQGA 4DLBA 5JDIC 3OJOA 3I9JA 5C37A 2H63A 1EDOA 3DTYA 3D5TA 1BDMA 3VOSA 4I5GA 3ZDFA 2I5PO 5CAEA 4HFJA 2AE2A 4GMGA 1SAYA 3L4BC 1U9JA 4Q3NA 2OGUA 3OIDA 2V6FA 4GBJA 2HU2A 1P1KA 3FWNA 4QFDA 3CPSA 2HMTA 3DBHA 2DTXA 3GAFA 3OJEA 1TT5B 4WOKA 4R41A 4XB2A 5TRTA 3K6JA 4CMIB 2YV2A 3F6YA 1NR7A 1PU2A 2FPGA 3BHIA 3Q2IA 1E1MA 3C7AA 2HJSA 3Q6IA 3JQ9A 5TJ9A 3BMCA 4FFOA 2J6IA 3TWOA 1R0SA 3P2YA 1IPFA 4LVUA 3Q1LA 4RV9A 4EITA 4OXYA 4H16A 4TKMA 2IEDA 5MDHA 2VN8A 2EERA 1V35A 2GUGA 3A28A 4CL8A 1IZ0A 1N2SA 4A10A 3EAGA 5TT1A 1EE9A 5COBA 4CUKA 1N9GA 3ULKA 2YHIB 4L4RA 4J90A 2VUSA 2JL1A 3OICA 2X22A 1HWYA 3E03A 3H7AA 4CQLA 4IGFA 3WYCA 3DHNA 2Y0DA 3HDQA 2YJZA 4JJGA 2AQ8A 3OJ0A 5GMOA 8LDHA 1PR3A 1SBYA 3HFGA 2A9FA 3BHMA 1UP6A 3D3WB 2WE7A 4AJ4A 1DC6A 1K5HA 1QLJA 1X15A 2J5QA 4M54A 2R6JA 2QIOA 3FF4A 4XGKA 4RVSA 4D7AA 4Y8VA 2AEFA 4GL4A 3ADPA
chains in the Genus database with same CATH superfamily
1NL3A 3GA5A 3VHLB 2R48A 4DLAA 4URVR 5KDOA 2R6ZA 1SGWA 3K0SA 1QP4A 5L45A 3KQTA 3OPYB 3PXAA 5DWQA 3ZLUA 5MN4A 3QLJA 1CF2O 2BJWA 3S27A 4AUMA 4CKBA 1N7GA 1VJ1A 4AZ0B 1XDDA 2E1RA 4AUEA 4JYZA 1Z13A 4TGLA 1E1NA 1B8OA 2AMLA 3HCCA 2O0LA 3QEMB 5HM6A 1J2EA 4NDNE 1SHKA 4ZQBA 1FYEA 1WP4A 2PZKA 5ANRB 3PQ3A 4DIKA 1II8B 2QUKA 2JEOA 1EFRA 4P4GA 2H51A 5HRUA 1P3DA 3ICCA 4PZLA 5E7IA 2CFOA 4G0XA 5CVVA 3R0ZA 5BSHA 1N5RA 1UJCA 3IQEA 1IBSA 2B30A 3VR0A 3WP0A 4I5EA 3T3PB 1P2UA 3WIVA 5LQNA 2X0KA 4DOMA 1MABA 3LCCA 2A5JA 1RFGE 2AFVA 3VMMA 1E8DA 5FORA 5B7QA 1VL0A 2QG4A 1JIVA 4GT1A 1D1QA 4YCJA 2CXPA 4LOKA 4IX9A 3AY0A 1HH4A 1NDQA 1UJ2A 3LW7A 4K6GA 4D0GA 4WESA 4JBYA 4X97A 4MDHA 5LOVF 2GEDA 4BO3A 2LCIA 2CC2A 4DSUA 3MG9A 2E4VA 2JANA 2QSZA 2GPYA 1HZZC 1J2JA 1QYVA 5E4JA 3R7WA 5CHYA 4JP5A 1XP8A 3TJRA 5DBFA 4FE7A 4PCUA 1IMJA 4LXGA 4HZUA 4Z1OA 3I12A 5JNUA 1BWSA 3GBSA 3MBOA 2VQEB 4A36A 1E2LA 1LH0A 5FUBA 3BWXA 2HEGA 1RPAA 2GK3A 5DBGA 4AJ1A 2Q5JA 5I47A 4XWGA 4EG8A 3THXA 4H3KB 3BRWA 4FEGA 2YCLA 1UK9A 4ZKDA 3QV2A 3L7CA 3D59A 4KP7A 4PNHA 2BM9A 2QW1A 4QJBA 2H57A 2QN8A 3GC6A 1I33A 3BFXA 3CR8A 1SXIA 4MQMA 5D3KA 4N47A 4MYDA 1SVLA 2C3MA 1KMCA 1QGZA 3O2NA 1P2TA 3UIEA 4EZIA 4AS1A 1UXJA 1WXQA 2GWHA 2WMOB 4JJ7A 3WWCA 1M6VA 2X15A 3VHXA 1VSQA 1RWWA 1UM8A 4RTKA 3OPXA 4FYKA 3N3AC 2CLIB 2F3QA 1MD9A 3E22B 4HDCA 5LZ2A 1NAHA 3LUCA 4DJTA 1R6DA 3MAJA 3IXMA 2J08A 4FJ2A 3UJAA 4I1UA 1TQ8A 3NBMA 4XQGA 3RU2A 1TX4B 1VSVA 1ZBQA 4MKRA 3LRPA 1TO2E 4NIMA 3LUAA 4LMRA 4XCQA 4ZVTA 1BFKA 1YDEA 2JGDA 5FPKA 3WK9A 5DCUA 4A16A 4RMIA 2AXEA 2QPLA 3EXHC 1NUPA 4ZO7A 3DVAA 4FYIA 4ACBA 2BKEA 2OGZA 3RSQA 5CBPB 3HB4X 2E5WA 1FTGA 3HCOA 5EWMA 3WMRA 3ZC3A 1WPQA 4G09A 2R7NA 3WMFA 5KYNA 2E5LB 4CCAA 2XMCA 4FONA 1CUDA 3LMKA 3OD5A 1BHO1 3E0XA 1BHQ1 4OHXA 4R8RA 1V47A 1X8KA 1FNMA 4KUHA 4ZVNA 1LDNA 1BROA 2OL4A 4LJ5A 3CONA 1OXUA 1BXGA 4OHMA 2C84A 1U9CA 5EZ6B 3H1TA 3C85A 4J76A 1WCV1 1WKCA 4B46A 3AEYA 1YHNA 4BJHB 1KEVA 2WILA 5J5AA 3NH9A 4IICA 3CSUA 1GNSA 4J3FA 4OP2A 3T4EA 3TQTA 2ESRA 2CGEA 2Y66A 4PANA 3ZGZA 3HUUA 2I4OA 4KO4S 4YJHB 3ZOZA 2VNJA 4UOZA 2AJTA 1DINA 2DPGA 1VI5A 3W78A 2ZCJA 4GPD1 3SR4A 1GFWA 2GCGA 2EKDA 2L19A 1WVGA 4M1EA 4Y2RA 1OVGA 1CX9B 1E79A 1Z2EA 2AE1A 2OLKA 2OAEA 3DAFA 3K0KA 3MIIA 2MSKA 3NOQA 2JGKA 5AICA 1Y6FA 1QMGA 1LKZA 1N2CE 3PXXA 1D0SA 1VCHA 1XZNA 3LQYA 1IHXA 1Q1QA 4WY2A 3W2TA 3CSSA 3OEHA 1PEDA 2YJ6A 1YGYA 4KNVA 4QC2A 4QOIA 4QPDA 5C8ZA 5GJBA 3ZDDA 3TN7A 4HLQB 4D92A 4PQRA 4FW9A 5ICEA 1ZISA 1AK1A 2AV6A 2P3LA 2Q6LA 3G2HA 3MJSA 3PPVA 1T9KA 3IQHX 4Z1MA 1F06A 4J3NA 3HBFA 4DCOA 4S04A 3KQLA 3ICEA 4IDHA 3LM8A 2VBFA 3L18A 2JFZA 3L2OB 4RC9A 5BVHB 2QLNA 3VVCA 3V97A 1NV8A 4O3MA 3SYKA 3P45A 1ID8A 4FEYA 3AZQA 4I55A 4YLYA 1B8VA 3LLMA 1RQ7A 3NAZA 2JPDA 2P67A 3DXFA 2BCGY 1QZ3A 4H0FA 1WSDA 5HFNA 4E6EA 3L8CA 5TIIA 2FX5A 3QV1A 1Y7IA 1V5WA 1UF9A 1BXRA 3N2ZB 4FR2A 3OQ6A 3NBQA 4MEAA 3YASA 4DDVA 5L3VA 3EGXA 1XXLA 3NHKA 1W2HA 4H2DA 4DR2B 1ZM3A 5GONF 3U7IA 3MB5A 3CTMA 3GLGE 5AVSA 2B4TO 1T3SA 4E5DA 5FWXA 4L2IA 4B4OA 1KVSA 1SMKA 2HO4A 2OM6A 3BKXA 3G0IA 4LBYA 1T91A 1Q14A 3KOZA 1JHPA 3NOXA 1Z29A 2BEWA 2OBNA 1XRRA 1Z9BA 3H2GA 4HMOA 4Y18A 3VV2A 3QVXA 1L6RA 4CFZA 1JHXA 1P39A 1I80A 4CMIA 1SZPA 1DARA 3UAOA 4YY3B 4NCAA 2RBGA 2X4IA 3OC0A 1XELA 2A1UA 3DTTA 2D7DA 1RHQA 4D0NA 3DUFB 4YJGA 2VH1A 2CV1A 3KQHA 3NDRA 3U4QB 4F91B 1GL3A 1NBMA 3QVUA 4NAVA 1IBLB 2E89A 4B84A 2RH8A 5EJ6A 3RLFA 5KKNB 4LFAB 4J94A 3DVLA 1I3KA 3NVDA 1SM4A 2FLKA 4TXJA 4MGZR 1CDEA 5M7EA 3N2KB 2YWFA 3WLQA 1XQ6A 1LW6E 1Z37A 4NMLA 3T3GA 2R8RA 4UXHA 5EHNA 3EVCA 1AGNA 3ZGLA 2WVHA 4KX3A 2XWPA 4UUQA 3WYDA 3X1KA 1KQFA 3HWWA 4GWKA 1T0UA 2PA3A 3BCUA 3JQBA 3K8YA 2J09A 2NPFA 4E2FA 5B6PA 1LNQA 4IXNA 1Z8NA 4UHEA 1H0RA 2WMDA 3QXXA 2JCXA 1BWRA 2CNWA 4A3SA 1YQXA 2Y8EA 1LRLA 1KP9A 1QNFA 4C43A 3K71B 1RCUA 3W1WA 1FTYA 4LECA 4Q1BA 1W48A 1WHSA 2IHBA 5TT0A 5AKIA 2XITA 4OLBA 2ERYA 1DAHA 2FJUA 1PNVA 2P2LA 2REQB 4OK5A 1I7QB 1MC1A 1UMCA 4YUZA 2HNAA 1FJ2A 1U81A 3AETA 3KQVA 3JQ8A 4PAMA 5K0NA 3F6PA 3NHMA 4A0FA 2OHGA 1CY7A 3EBOA 4ZOAA 3WK7A 3R9WA 1N2ZA 3CURA 3KB6A 3WHLA 2OMKA 4AJLA 2C9MA 3H8JA 1Z6TA 3OOYA 2BRUC 1C9EA 1OXKB 3KEQA 4XM1A 5CEFA 2Q6KA 5JATA 5EESA 1M8GA 3ND6A 4UNRA 3EVBA 3O8DA 1X7ZB 2WWTA 4QQRA 1RE0A 1ZMRA 3AF1A 3FPLA 3OT1A 3FPKA 2B2XA 2P35A 4C07A 5BQPA 1CJSA 4A0RA 1RRGA 3ABIA 3OWXA 4J0KA 3EIXA 1MB2A 2ODEA 4ND4A 4K81B 4I2VA 2VNKA 2Q8NA 2O2SA 1G1MA 1TXGA 3OT4A 4GI7A 1JI0A 3MCAA 2V7BA 3AR6A 3E7DA 5DM0A 3UOAB 3VC1A 4E30A 5IG2A 5B57C 3OCCA 1FP1D 4JOSA 4P36A 1EFHA 1H5QA 4M1QA 2MINA 3IEIA 4NBTA 1E5TA 2O7QA 2Q9CA 5ECDA 3F9IA 3V2GA 3VPHA 4CNQA 4QSMA 1IOWA 1KXZA 5F78A 3WO1A 1ESCA 3DLTA 5G1NA 1GADO 5KYXA 3QVVA 3H2KA 4M6WA 2A14A 2D54A 2IHJA 1V3VA 1E0SA 2WU1A 3FDJA 3U7FB 3J7AC 3HP1A 4BXOB 6GPBA 1KY4A 1MC4A 4IUDS 5F2NA 1OGJA 4L78A 3C3YA 1TCVA 1P4SA 4NU5A 1T13A 5TEVA 2IYZA 2J0SA 1T6XA 1C7ZA 3H6GA 1MX9A 5ITZB 4B33A 1AG9A 1HGXA 4W5NA 3E9CA 1L5ZA 4BTVA 1SU4A 1YFZA 1CLEA 2BUCA 2XGSA 4UCFA 1DU4A 3HJUA 3H3XA 3UXHA 2VPQA 1POWA 2BFFB 1P91A 1JP7A 3AESA 4LQCA 2PGLA 3MXOA 2ECKA 4CM3A 4EA7A 4B34A 2A78A 2GCOA 3EIUA 1CD5A 1TU0A 2GA8A 1FNNA 1W59A 2ISCA 1TAHA 4HZGA 4Z49A 1X1AA 1ZNXA 2A88A 2I1LA 2O2EA 4NDAA 1KBOA 1MEOA 1XHLA 2D5AA 4ZC1A 1PW5A 2I2XB 4J7XA 2WDZA 3DMNA 3RM3A 2EYUA 4Y67A 2ZYUX 5T67A 3ONDA 5IKPA 3HFJA 2E4XA 3PUZA 3H2JA 2CK3D 2KW5A 1HPLA 3HA7A 2FR0A 4MO2A 1RYNA 3KYDA 2ZI5A 4B8YA 1VSTA 4QYXA 3E7WA 2OAQ1 4JCCA 2QTNA 2FRDC 3OQ1A 4P83A 3SOZA 1JB9A 3GHYA 1MO4A 2C9YA 3L07A 4D8XA 4HN4B 1KFKB 3OUUA 1JJFA 2IQ5A 3B7GA 5FOXA 4LYAA 2ORWA 1O54A 1P0MA 2B5WA 2CXSA 3QSYA 2WM9B 3K9QO 1DEKA 4ZCIA 3OZIA 1L5QA 3FROA 4JVMA 1WZ2A 1QDEA 2VJOA 4F3CA 3ABZA 3OLCX 1HRDA 2AKYA 3MXTA 4XRGA 3IAS1 4F9FA 5K0CA 3B38A 3K1AB 4YP9A 5D5QA 4PPQA 4IXDA 3ZV6A 3A26A 4FFSA 5EIHA 3EVEA 1Z5ZA 4FC7A 4IFBA 3HCAA 5FA5A 3KUUA 4X20B 4CM4B 4ZGWA 1MX1A 3TIIA 4F5EA 3KAJA 2LDXA 4PSKA 4P35A 4EHKA 3PR2B 3UMYA 3Q10A 3HMKA 3UK2A 3IAXA 2PK3A 2XD9A 2OY0A 2BV3A 3MUFA 3R9XA 3OIYA 2PEZA 4G9EA 1G7SA 3ONWA 3WWPA 1AKWA 4Y7CA 1UK7A 3VO2A 3GEDA 4XLZA 1UBLS 3N86A 2QQ5A 1VIAA 4WZAB 5CW2A 2MJLA 1O8BA 2WJPA 3G17A 3A4MA 4UFOA 4Y1RB 4Q03A 3ETNA 3OKPA 3CRNA 3UWOA 3B8EA 3USES 2XEXA 4PN3A 2VYVD 3FUVA 5I6DA 2QRKA 4HH4A 4R8LA 3G2QA 2XJ9A 4HWSA 4KQ9A 3CYFA 5TQJA 1T4CA 2YRXA 1GL6A 4N40A 3AM3A 3SYNA 1YQWA 2IYTA 2QLBA 4X45A 2G1PA 3GMDA 4LYDA 5A0TA 4KG7A 2WJJA 3IBFA 1P7ZA 2ZRDA 4QIHA 3Q0EA 3ZXXA 5H8WA 2BGWA 3I04A 4C0BA 2FPKA 2R9VA 3BHJA 4KVZA 4JNCA 3R6WA 2VCYA 4KQ1A 4RBNA 3W6PA 3Q7EA 2WHPA 2ZROA 3IELA 5CDSA 3KVNA 1KJZA 1L4GA 5TE9A 5L3QB 4EMSA 2P9FA 2OZLB 2ZR7A 3ZNNA 4EFDA 3VPSA 2NO6A 1JN0A 4EMBA 4TTRA 2XBMA 3W2IA 1V45E 4HQRA 2XUOA 3DXXA 2C8JA 3U19A 1NWCA 2BTOA 3OY2A 5TLSA 2IBTA 4F9EA 1B23P 1C0EA 2IOHA 1EI9A 3MLBA 3SS8A 3IBGA 3ZWCA 4BP1A 4WXHA 1P1RA 1XKTA 1NLYA 4XIFA 3SS7X 1IPEA 1K7EB 4JOQA 2CCKA 2KMLA 1NLZA 2B92A 4US1R 5ER9A 4DG8A 4YV7A 5C7IO 1L1QA 3AVVA 3Q7TA 2WYIA 1T1IA 3LXMA 3IV6A 4GPBA 1I2AA 1M1YB 3UWDA 4DKJA 1R4AA 3FHOA 5IT9A 4BFCA 5T64A 4CIXA 4Z6KA 1E7MA 2H4ZA 2HLDD 2XUGA 2CKMA 3WIUA 4DUGA 5I8WA 3WK8A 1UPAA 4OH1A 4QFBA 3T8YA 5KBYA 1AS2A 4KIUA 1QRTA 5AJVB 1Z5WA 4TWRA 3REQA 3RTDA 3PTLA 1C5KA 5DRTA 5IT4A 2PRKA 2XYGA 3AB7A 2PL3A 4MI1A 4ENWA 2VUTA 3B48A 1Z7GA 2CMKA 3DT9A 3OQNA 2DAPA 1WEKA 1OFGA 5L51A 3AIKA 4ZIRB 3A3OA 1EFPA 3KYCB 1F38A 3O9MA 5DOZA 4JLNA 4NOLA 3W8RA 1OREA 3N53A 4ARAA 4EFMA 3CVUA 4ZOCA 3EVAA 1T5SA 1M0TA 2IXTA 5ALPA 3T94A 3TMYA 1DKPA 3LDGA 3M9WA 1WCXA 1WXGA 2SCUB 1EXWA 1H2WA 2QRLA 4DJAA 1YUBA 2WQ7A 2X8LA 4O08A 4RZ3A 1CS0A 1X9HA 4HDMB 1CNMA 1K63A 3IILA 2B69A 5F4ZA 3CWZA 5FYDA 2O8FA 2VPIA 1LB1B 4R0NA 2ATVA 3B5IA 4L22A 1QE3A 5ALHA 4YVFA 3ICPA 2YC4C 4YDSA 4IKEA 4NFYA 2NSDA 8ABPA 4QQKA 3FR8A 2HMUA 4TQGA 4IOLA 4DC0A 1ZL2A 3SEAA 4BJ6A 4E5YA 4G9BA 1DKMA 1ULTA 1NVXQ 2WD7B 1BMDA 4IV0A 4K9OA 2X5KO 4B3CA 4YCMA 4WVFA 4M0UA 1NKVA 5LP6B 4GKKB 3CEMA 2NO0A 4D98A 1LBTA 3I5AA 3M7IA 1BMFD 3RRXA 5AT1A 3H9EO 1NX9A 3AYXB 1NIJA 1O58A 1TM3E 3OO0A 2MSEB 4UNSA 3L8DA 1ISMA 5M3BA 2PJRA 1N4DA 4L07A 3OZWA 3OIUA 5JS2A 3GJ4A 1MV8A 1OGYA 1ISGA 4HNRA 5K4AA 1W5TA 4MMYB 3UGJA 3JQFC 5EXEA 3R3WA 5CVDA 4R9VA 3H5LA 4CIVA 3S0JA 1OOEA 1ZU4A 2OORC 1E6MA 4KPUB 5EJ8A 2BKXA 3NHUA 3SX4A 5HOQA 1M2OA 3LZ6A 4P4SB 5E4FA 1NJ6A 1E2FA 1U3CA 3W5IA 3R1IA 3TOZA 5DCYA 4KKXB 4P32A 2XCRB 3HPQA 3Q8LA 5EKTA 1M34A 4G2TA 1JFSA 5G3YA 5HMMA 1JHDA 2ZE8A 3AILA 3RK0A 1P5FA 1G8GA 2IXGA 3AVXA 1A8SA 3T99A 3TDKA 4BC1A 1PVDA 1A50B 1OX4B 3OHMA 3QU7A 4O2RA 4TKZA 5GP1A 1GZ6A 3VOBA 4PIMA 2A5DA 4QQFA 1O4WA 3T7RA 3TNYA 5CB4F 1XMSA 4PCVA 4JOCA 2HRZA 4WSOA 4Z3DA 2HCTA 3UH1A 4EBBA 1PYOA 4IDAA 2P5YA 4GVPA 5KHAA 4QDZA 1KU6A 1PJCA 5HE9A 3HGMA 3NG1A 4B74A 5U4QA 4J6EA 2G9UA 3FPBA 4A0QA 4KR3A 1G5QA 2RFLA 4IHKA 2I9PA 2JHCA 1N0VC 1ZEJA 1XR3A 1Q83A 2QZZA 1EB8A 1D5WA 2HMAA 3UANA 1UOEA 1OV6A 2EP5A 2VSYA 1YR2A 2V7VA 4J0FA 5DYTA 3RNOA 3SIXA 3SX0A 4JITA 1Z0SA 4QUEA 1C1XA 5TR9A 4C03A 3T5TA 3AH8A 3C1OA 5C51B 1D4AA 2HV9A 2A2ZA 2FQQA 2SHKA 2VYQA 1PEKE 2WTXA 3ENNA 3WK4A 3LUJA 4EG5A 1BA3A 2PZFA 3B3GA 3JQDA 3NOOA 4GX5A 3HYCA 3TXYA 5JHGB 3AF5A 5KOHB 3IGFA 4FMBB 3FTCA 1DC4A 1JKJB 1MC5A 2ZBDA 2H2GA 3GPIA 4BOYA 4ZHQF 3BE6A 1KH1A 1LC3A 2W2OA 2UYOA 5IDYA 1PLLA 2Q2OA 1I1QB 1YS6A 3SZRA 3THSA 4BNXA 4BVJA 3CBGA 1EAMA 2HA6A 1AHPA 5TQVA 2VZ9A 4N8EA 1QQ5A 2OYRA 1OI7A 3AJDA 1OSNA 5H82A 3E9ZA 2Y4NA 1J0XO 1R5NA 2WFZA 3ESZA 3G2JA 4MQ6A 3AOEA 5J63A 3EC2A 2FR8C 1YUNA 1TMGE 1V8ZA 3KOMA 2FHPA 3QENA 1Y81A 4V02A 2CSXA 4QUHA 1TT7A 3PFHA 2XB4A 1VLJA 4P92A 4RIFA 3G0CA 5JO0A 3GUUA 2I1WA 1P72A 5CXUA 5KYKA 2Y1FA 2G9ZA 3BRSA 5HUQA 5BSGA 1UZLA 2E48A 1CQWA 1L5OA 2CL7X 2GERA 3AX6A 3QBTA 4DR5B 2RGYA 4IJ5A 3I3SR 2HSDA 5DLPA 5HP4A 1GNTA 4ZZ0A 1NN5A 4YLGA 4JC4A 2PKQO 3WRXA 2IWHA 2HSEA 1W94A 1HYQA 3ORRA 2FKAA 3ZPXA 1JNXX 5EE5B 3PT9A 3SJZA 4DIBA 4EW6A 2FFJA 1TM7E 2ECOA 5E6SB 1T4BA 4RPKA 4FILA 3JWPA 1QV6A 3L7AA 2I4MA 3IH5A 3L4EA 4M9QA 4AB1A 3AU8A 4V38A 4D1YA 1NW9B 1SKBA 4BZQA 2CBGA 4D0LB 3IOYA 5JR3A 3C2QA 4G37A 2WLSA 3EB9A 4NU0A 3UW1A 3H84A 4DV3B 2PRSA 5FQNA 2O2DA 4J43A 2UYYA 4C0AC 4UTVA 4YIKA 4EZBA 5FAXA 1K4YA 1QO7A 1QCDA 1N7IA 4Q3LA 2ZBUA 4M98A 1QG0A 3L0DA 3PDIB 3HV2A 2PTGA 2QMHA 4QTUB 3RKUA 4E5VA 5BNIA 4BNNA 4DGQA 4JQCA 4BMCA 3W9BA 2OM2A 2XKAA 4C4TA 2CHQA 1XUOA 4NBUA 1AMNA 1GAXA 4FYHA 4KUEA 3QLVA 4NWIA 1OKKA 4ZARA 5C2JB 3IDOA 1H2BA 1M74A 3OOWA 1M76A 4QTYA 1UFQA 1PEYA 4CLXA 1F0KA 1K8XB 2FSHA 5EUBA 2QMOA 3F5DA 5IX8A 2WBLC 2I6TA 2P27A 2ZUSA 3H7IA 2PO7A 3S55A 4TLAA 4D8TA 5L9AA 4RZHA 5I9TA 4NATA 4Y9UA 4A8PA 4ZCRA 4KODA 1TVKB 4DB2A 4M49A 3ZXSA 1EDDA 1L3CA 3L7DA 1U5BA 3IEPA 3UCXA 4B45A 1KR5A 1TA0A 3QKRA 1H6DA 1N8KA 3F2IA 4HAIA 5E8JA 1MAVA 3PR3A 2PMEA 4F6CA 1XOIA 3R9IA 1SBTA 4IIJA 1COWD 3FPFA 2L42A 2XDQA 1WU7A 3LPCA 4WXRA 5CFRA 4BJ5A 3E3NA 3LHSA 3W77A 2YDYA 1Q0UA 4TUYF 2AR0A 4D9MA 1OBOA 5A9TA 5BN4B 2G0TA 4CQLB 1EWKA 1N5KA 2BPOA 3VFDA 1PUIA 3R7SA 2BFOA 4QFMA 3AKYA 1PAUA 5D51S 2JIPA 4U7HA 5AQ1A 2HRDA 5EGSA 4QZVA 1XZKA 4HSEA 5IYZB 1D07A 1U8XX 2AT1A 1YRAA 1IQ0A 2CB9A 2W43A 3LQKA 2ZJ6A 5ENVA 4A27A 1NY6A 5AUNB 3N2GB 4HAVA 2PL5A 2QOEA 3IHTA 1D9ZA 4Y7DA 4FR0A 4JAVC 4RTSA 2BTQB 3IC5A 1JFRA 2EX0A 4NV3A 1RKBA 1W36C 1G9TA 3IR7A 3GLQA 4XWWA 5A5DA 4UE2A 1DX9A 2H2DA 4PHCA 4EY6A 4Z9XA 4W7SA 3R3XA 3I76A 3TECE 4M7OA 4Z86A 3TZKA 4OHUA 1JVSA 4L4YA 1CZUA 1NQ5A 1D7AA 5JZOA 4GMFA 2WF6A 5FYQA 4HY3A 2FNAA 5EFOA 3EVTA 2JI4A 2O07A 2CY0A 4DYVA 1ABFA 1V8PA 1ADYA 4TRMA 1U28A 3DWEX 2FN3A 4JC5A 4YHBA 2NZUG 3FRJA 3OM9A 2WI8A 4KNWA 2TSYB 5L3ZA 3VKUA 4DCPA 5K0JA 3NVKI 1SQGA 1Q0HA 2DJIA 4KBFA 3D3JA 2RH4A 1T2FA 5ALXA 3BTUA 2JGMA 3BWVA 1X7WB 1H5UA 1SURA 4XW2A 3RSGA 4I4TA 3B3QA 5IF9A 2ATCA 1Y7PA 4QBTA 1Q84A 4XSVA 2AJLI 4B40A 5CNJA 3OVMA 1D1PA 2Q5QA 1PV1A 3ED1A 4F1WA 4U6NA 4FKMA 1TCBA 3VBEA 1B7GO 4RHTA 2PBZA 2UAGA 4TV8B 4YRCA 3WL8A 2BMVA 3G02A 1R8SA 1W30A 2NUPA 2BUAA 5F3RA 2OXFA 1UC5B 1UMBA 1WDMA 3KQOA 3OZDA 4KIJA 5IP5A 4WFQA 3SNHA 4EGQA 4JNKA 1RYHA 1Z0ZA 2R87A 4D9EA 2UU9B 3PWKA 3CW2A 4AI6A 2Z09A 4QGHA 2FPOA 5J2UB 1RXWA 3OE4A 1NBAA 3HZHA 3FVQA 1YL6A 2J9FA 2ZITA 4M8LA 3NV9A 4HNSA 3WMGA 1QPGA 2HPHA 5IAAA 3LE8A 4P2BA 3LUDA 4KQMA 5CFNA 5KEIA 1ZCBA 4R69A 3C3WA 3FNRA 3GNLA 3H0KA 1VE7A 3H5AA 4KC0A 2I3BA 4JI1B 2B37A 4EA8A 5A62A 4V0LA 5J4KA 5GINE 2R7LA 3LW8A 5KI6A 1RLTA 2G3YA 4CF6A 5EQFA 3GGCA 1P62B 3W3AD 2HCRA 1BN6A 3DBRA 2V7XA 4B3TB 3DPSA 5EIOA 1SRRA 2QDXA 3GEMA 5JFOA 1ULHA 3K05A 4M8IA 3LFUA 2Z8YA 5B4TA 5EQTA 1NHWA 1G20E 2JH8A 1SA0A 2ZSBA 5MFPA 3HK2A 2EZ8A 3AONB 1FFDA 3B12A 3HN2A 3KLMX 3OEED 3JR7A 4EKIA 5WRFA 4GFDA 2XAAA 3PRKE 1GDHA 5COAA 4IH9A 5SZKB 4D9CA 3BHNA 3K5IA 1QQ6A 1RRVA 1G1AA 3VQTA 1X14A 5ABPA 1D2CA 4D4LA 1CUIA 2QGNA 1XZCA 2AFIB 1U9YA 3FSEA 1L4HA 5AD1A 5BSTA 3COSA 5C32A 4I1IA 3H0EA 4DLKA 3T3MB 1U3GA 4MWTA 2FWPA 4FM9A 1LBHA 1Z2DA 3MJ4A 2AJBA 3RFVA 1XB2A 121PA 3PGA1 3L41A 4JLUA 2F3SA 1YASA 3G8AA 3GJTA 5KYYB 2XCSB 1XCMA 3GCWA 4IMJB 4KXVA 3C3DA 5JXIA 2FRVA 1G4AE 4JBHA 4KQGA 1UKBA 4L6CA 2I7DA 4HT3B 3ZTWA 3BIFA 1KR2A 2FJ0A 2I3AA 3W9UA 4FS3A 4RTLA 3B70A 1CNFA 4XOIA 4B7ZA 3N8HA 1YB5A 2VATA 3H0CA 3MUNA 3PI7A 2XZPA 1D6MA 2V4MA 1DBQA 4YJHA 3FBTA 4MVJH 5KO2A 3K0AB 4P3YA 3PV0A 2OV8A 2IL1A 3AI3A 2EZUA 3QEMA 4JUIA 3C3XA 1W5FA 4KRXA 4ND8A 1U8YA 3KQQA 4DA0A 5B6JA 1GSHA 1K89A 1O9HA 2RAUA 2FPPB 3W2FA 3VO9A 5FWYA 3DWIA 1APBA 1FRZA 5D6NA 4L0QA 1ZQ9A 1TRKA 1RRKA 1NW5A 4INJA 2FWJA 1XYYA 3AQIA 3IULA 3NIFB 3QLUC 3VZQA 1FFEA 4BMDA 3AVPA 3VPCA 4GRAA 1V96A 3B6ZA 4WERA 1BHSA 3JYPA 1P7CA 1DG3A 2ONCA 2Q4BA 4Y2YA 1F3OA 4ZCQA 4R84A 3MBKA 2LKDA 3D4NA 1VHQA 3D8TA 5FI1B 2BGTA 4HLDA 2ZWMA 3UAZA 2GUWA 1YBVA 3I30X 2QI9C 4JJ6A 4ZEXA 4YJFA 3VC7A 2O3TA 2EXXA 2NG1A 3UC9A 1N8TA 3DE2X 1NI3A 3DM5A 4PLVA 3UHJA 3GLIE 1LLDA 2IOYA 1ULBA 4XYBA 4B3FX 2CHEA 4KXWA 4M36A 4QARA 3DMYA 5JD6A 4AKHA 1NBIA 2ASEA 2YXDA 4ZEVA 3FCCA 1J70A 4PRZA 2WTMA 4QWWA 1FUUA 1B00A 1SCUA 3IXLA 1Q0ZA 4RUKA 4E4TA 3GIDA 3UFXB 2AQHA 1XXHB 4TM8A 2VXYA 4BAUA 1P6QA 4LDZA 3UC5A 2BSXA 4UUMA 2ZJ2A 1Z33A 2XOXA 5AFSA 3LKBA 3EMVA 4KXXA 1SVKA 2C2BA 1WIWA 5J4HA 4RF4A 2FAXA 2G70A 5KKCA 2D1FA 4RTRA 5L4SA 2ZATA 2Q4TA 2Q4EA 3OQPA 3PQ2A 3A4IA 3CZ9A 4XX0B 1H23A 1M3SA 1G98A 1WXDA 4ZZ3A 2DBYA 1S3IA 2X5XA 1HEIA 5C0OE 4N5NA 3R41A 3M3PA 4Q7JB 3EQ8A 1F7UA 2MSLA 2V03A 3DW1X 1HQDA 3VR4D 3DOJA 5ERGB 2KI5A 2PY6A 4B32A 2GZAA 1KNXA 3SS9X 3Q8KA 3TD2A 1UZNA 4IG4A 2QQFA 4TZTA 4BAZA 3W7VA 1Z36A 1N6LA 4OGFA 1I1HA 3BMNA 4MUYA 2GJ8A 2DM6A 5E6RA 5H02A 3DKVA 2XLBA 2HIHA 3QPBA 1YR1A 4RQBA 5L7TA 3KOYA 3BCRA 4OEHA 4M89A 4GF5A 2FDXA 1U2DA 1RXSA 5DE3A 4MRNA 5EJGA 4A2PA 4C4XA 4YMVA 4GEKA 3T6KA 3KVYA 1OAOC 4GPIB 4JN6B 4MV5A 3P0FA 1UMDB 4UOQA 4PPGA 3TVTA 4NFLA 1O4VA 1Z8DA 1ULZA 2RGXA 1Z0UA 5B1YA 3P1JA 1PZXA 2OCGA 4HL6A 1QIHA 1FP4B 1VIVA 4CKEB 4G84A 2O8BB 1J25A 2VHZA 4WFJA 1GU7A 3SYRA 5B5SA 1DG9A 4QTTB 1L7DA 2BFFA 3UUWA 1C1HA 1J9GA 2IPLA 4GL2A 1JE0A 3LVBA 4BQQA 4ARZB 1G20B 2C31A 1WHSB 1R9JA 2W8BA 1NVGA 3L6DA 1TI7A 3IAFA 3WGOA 1E1CB 3K1JA 3KD2A 5BWCA 4Z0NA 1G42A 5HIAA 5CDTA 1WM1A 4BX2A 3ZU2A 3PXEA 1ZMXA 1EHCA 1LNSA 2HQBA 3DZGA 4RL6A 1Y63A 5FTJA 2BGGA 3V2HA 4MW0A 5F21A 2HHHB 1ZITA 2QZJA 1SVNA 5KHLB 4L8WB 3TL3A 3QVGB 4S05A 3AIMA 3KDAA 1K8YB 1UXKA 4PC3A 4ZO4A 1U31A 3MFYA 3KFVA 4GH5A 4NOKA 2QYTA 2D06A 1XA4A 4DM4A 1YKFA 5IU6A 1A1VA 4DV0B 1FP6A 4B6QA 3GELA 4AF6A 3RVLA 3M1YA 2ZREA 2I1VB 3JZAA 1MJGM 4CETA 3AW9A 1OTXA 3GDHA 1JT2A 4RZUA 4HDKA 3ACCA 1E2EA 1QKJA 4M0PA 1GKLA 4NS4A 1Z5GA 2VUHB 2YXEA 4BKQA 4RULA 1FQJA 3HBMA 2G7ZA 3GD5A 4HPJB 2XTAA 1IWOA 4FI3F 3CVWA 1CRZA 3HFRA 3ED5A 4D99A 2BP7B 1MRSA 3D0RA 4D3FA 2E7ZA 3SCZA 3KZCA 1PYGA 3M6VA 1I3NA 2JFHA 1PWEA 4P0PB 1EFVA 4FOSA 4DCSA 3HLYA 2C1EA 3ZHVA 1SXGA 2APJA 4C0KA 1G38A 2VQ3A 3GFTA 4A2QA 4OHPA 4TWAA 5BN1A 4KO2S 1XA3A 4K88A 5D3MA 5I7HA 3EFBA 1UP4A 1OWLA 3OE7A 3DL4A 4MK4A 2WSSD 5C8YA 4GKJB 3PC4A 1YL7A 2WJZB 5FWXB 2UUBB 5AVQA 2DBQA 4IDPA 1KETA 4I6JA 1LZKA 2XMPA 3BSFA 2Q50A 1YZTA 2NZJA 1L7NA 1GARA 2IX3A 1O9BA 3GJ8A 1HT1E 5LQDA 4R1NA 5L4NA 2W90A 4CEIA 1ADGA 4TMVA 2VPXA 1RBZA 5LVAA 1RSZA 1CUYA 2NXCA 3FFXA 4NG4A 2XYRA 1LTHR 5DYNA 3ZV5A 2H4WA 2XE4A 5ENZA 2ZYGA 1JDSA 4HNVA 1JR4A 3BK7A 1Y42X 4J0JA 1D03A 2IQIA 5EXPA 3TAXA 5JS8A 1IDN1 2QJFA 2GOYA 2ZAYA 1A97A 1N5MA 1P2DA 5HTKA 3ZGXA 2OO5A 1QVAA 3OPQA 1FYFA 4EHHA 2GNAA 1BRTA 2VHXA 3HV0A 2YC2C 4RANA 3UMMA 3S8YA 2WAOA 5AXBA 1E1QA 4EQZA 4QU5A 4H6VA 2ZJAA 3EYAA 4MR7B 4PYRA 5JFGA 1H8EA 4ZAZA 1SC1A 3IIEA 4P34A 2QGZA 1USVA 4HB4A 4YMTA 1G5IA 1RPJA 1WVIA 1ZBDA 2JGIA 3HQ4O 2PGJA 1H9BA 1JB1A 4YPFA 3F78A 1U7TA 2C88A 2VAMA 1KO5A 1BX0A 1C0KA 5ILOA 3WYFA 2C9ZA 1Y1SA 2NACA 5FI3A 1SOMA 1W4AA 2ZS8A 4XEHA 3MT8A 4AG3A 4AZTA 1RAAA 1Y8QB 1YS2X 2YZ7A 1QRUA 1U7WA 4QXAA 2YVAA 3NPMA 4TVKA 1DO8A 3SXUA 3DKRA 5ECWA 1JILA 1HURA 1TTPB 4ALJA 3MRSA 4DHEA 1U1EA 2I34A 4AZSA 5EJEA 1KPHA 3VR2D 4RMNA 3EXG2 1IQRA 5EE3A 5B7PA 2A9QA 3OLXA 4TYNA 3QXGA 3BZBA 4H0NA 5E0OA 4I14A 5DYWA 2ZETA 2WJ4A 1GV1A 5DHPA 1WZEA 3T5CA 4L7QA 3FDFA 1I0LA 3UATA 2DUNA 2KLHA 3P4UA 1DC8A 1E92A 5J2UA 2C04A 3RHFA 3CMCO 2QY9A 3FETA 4RLQA 4YUAA 1SKMA 1S7CA 3AJ8A 3RNLA 3WSWA 3IIIA 5FNVA 5C8YF 4IR7A 2O8NA 1Y9JA 2IDKA 1Q92A 3IVRA 3JCZA 4ROSA 2GAOA 3SQLA 1PQUA 3BWDD 3HXMA 4CGZA 2M98A 3RV4A 1DZIA 3F74A 4W5WA 2D5CA 3JQRA 4Z5XA 3P5SA 3N6RA 1V8FA 2GB4A 5A2GA 2QK4A 3MSXA 2CKDA 2I62A 2O14A 3LKZA 4LRUA 3FPJA 2HU8A 4TSKA 3MWKA 4N5IX 4CKWB 4DCUA 1HYBA 2FOIA 3ESAA 1DQPA 1SBQA 1U6IA 3P97A 4JZYA 3AUTA 2QR5A 4N8SA 4PXSA 5LCXA 2AH5A 3ZW8A 3VR3D 4ZCPA 3ZHBA 2X7HA 1XLWA 4LJ6A 5FXMA 3B6EA 3SSOA 3DDNA 1VJRA 3DEYX 3ZWAA 1VKNA 4DEXA 4JI3B 2HB6A 2QVZX 4IQ0A 4N82A 1EHIA 1RHRA 1T29A 1HSOA 1WO8A 3ON5A 2CJWA 4I8DA 4MPRA 4UHFA 3V4OA 3TB6A 3GPDG 2I55A 2EL9A 4IFIA 4E2YA 1UAGA 4NHOA 5JNWA 5KOJA 3Q6MA 4IWNA 3QPVA 4HDNA 1FJGB 1XN4A 3JQBC 3O3MB 1T2EA 5CYFA 2X4DA 4BDTA 1JKMA 1KQOA 3LUFA 4FFVA 5LYYA 3B60A 4GYKA 2ZM5A 1WL8A 1JALA 1R66A 3QSGA 5IZCC 2YJTD 4JB2A 4O1HA 4FZ3A 4F8EA 4JI5B 4RCVA 3PUVA 1K68A 4GRIA 4KJZA 2ETXA 3HCNA 3FB1A 3TLMA 2QTBA 1FB5A 2OD7A 2P40A 3JSAA 1FF9A 1SOVA 4DRXB 3TR5A 3I09A 2F4NA 3AVUA 1ZH4A 4AKSA 1OLOA 3DTVD 4V0OA 4DJ5X 2RAFA 1N5LA 4HRYA 4HWPA 4YI5A 3PNOA 4I4NA 2BRUA 2C61A 2JRLA 2CNKA 2CDCA 3I2FA 4LDJA 3KEGA 4NYJR 3EMBA 3LBAA 4WRRA 4P82A 5ER6A 3AZPA 2AN4A 1XRSB 1CUSA 1X39A 2MYNA 3GJ6A 1YOBA 4C7VA 2XE7A 2PWZA 2Q5EA 2Y77A 1FW8A 3EK2A 1QCYA 4LMBA 1LBEA 3I2YX 4DZZA 4MLZA 1K2VN 1IJKA 2KSQA 3AEUB 2OUKA 3O1HB 1JHOA 4BNTA 3A11A 1MTOA 3VPBA 4CZ2A 3CNBA 4NBLA 4X6UA 4YRGA 4ZZ1A 3DYIA 1RCFA 1J0CA 1EEXB 5EHQA 1JYFA 3RVKA 5IN5A 3KXDA 4NDZA 1I3CA 4F2WA 1NBEA 3V3KA 4D9BA 4DREA 4QJ5A 2YJ4A 3NKVA 5GM1A 4YXFA 1SBIA 4E51A 3QLVC 3OQOA 4M21A 1UXGA 3B6MA 2DUJA 5EZYB 1F2UB 5H3LA 3ZUGA 5JJLA 5LP6A 3C3EA 1QVWA 1VGQA 3O3NB 4RH3A 4CM9D 4EHNA 4FEAA 1V7ZA 5CFOA 4DCNA 2VHQA 4UAUA 3F3KA 3DT8A 3U44A 2HNKA 3EZ6A 3PQCA 2IUFA 3T3OA 3IPCA 2IW1A 3KZOA 3LC1O 1YB7A 3S2GA 1O5OA 1EH5A 1TM2A 4DV2B 4A92A 1IN7A 3P94A 4FN5A 4Y0VA 4HVTA 1U63A 4Z54A 2J7PD 2N9UA 3FYCA 4F96A 1XLVA 1YS1X 5T4BA 3RS9A 4F8JA 2ZRHA 3GCDA 5A02A 3VAYA 4XARA 2IC5A 1S4QA 2DY0A 2YW9A 3WGHA 3DDZX 1TM4E 1ML3A 3FA2A 1B6TA 3GVHA 2HK7A 2Z5GA 3AV0B 1BSVA 1MG0A 1W25A 3NWPA 4U8GA 2C3OA 3ZDRA 3NCTA 5K8LA 4BXOA 1TCCA 3NGXA 3MTQA 1NF9A 5F2KA 3AUXA 1E3IA 3B51X 1A8PA 4JZKA 1IUNA 2Z98A 4PZZA 4X8LA 5EJAA 4BFVA 1C8BA 1PUXA 1OGIA 4OQZA 1HFWA 1L7AA 3T15A 1DQNA 3BK2A 4POOA 2FPLA 2VOJA 3RC1A 3WLOA 3ZWOA 3WLAA 5C9ZA 2LUOA 2BI7A 1W0KD 3LOPA 3SKVA 1GTZA