3JQ7A

Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor (nadp+) and inhibitor 6-phenylpteridine-2,4,7-triamine (dx2)
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
267
structure length
247
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQSNLSIVNLCDAMVDQPMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Pteridine reductase 1
publication title Structure-based design of pteridine reductase inhibitors targeting african sleeping sickness and the leishmaniases.
pubmed doi rcsb
source organism Trypanosoma brucei
total genus 93
structure length 247
sequence length 267
chains with identical sequence C, D
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2009-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3jq7A00
4DMMA 2P5YA 2BGLA 2H9IA 2GERA 5EN4A 1LDNA 2X9VA 4BGIA 3SVTA 1P9LA 3IL2A 1YS4A 3M2TA 1NNUA 1SCUA 3OIFA 4J16A 4WJZA 1TEHA 4WE3A 2O50A 1DXYA 4Z9FA 4UVGA 4N5MA 1LEHA 5IDYA 1B3BA 4QEDA 4MIOA 4M1QA 1RYEA 1T4DA 2W2KB 5A3VA 1Y8QA 3GHYA 4K6FA 2C20A 2EGGA 4XYGA 1KC1A 4AJOA 3DOOA 3NX4A 4CQLA 3G79A 5CFZA 1ISGA 4XDYA 3S2EA 5HBRA 3EW7A 5F21A 4IZHA 4WKGA 4AJLA 4D7AA 4QO7A 5IXSA 1B7GO 1O89A 2VHXA 1YJQA 3U4IA 3CE6A 5CDSA 4R9SA 3CUKA 4Y6PA 1I3LA 2WD7B 3DONA 4NIMA 4AJHA 4XYLA 2X9GA 2VHYA 3GGPA 3DOCA 4DYDA 4CQMA 3GFBA 2ZJ0A 5C5IA 4FC7A 3O03A 1O0SA 1M66A 4GL4A 3BTUA 1A9ZA 3NGXA 3GMSA 4CM5A 1Z74A 2OBYA 3BXXA 4BNIA 3PDJA 2Q50A 4ZRMA 4RPKA 3CEAA 2JJYA 4TKMA 4YCAA 2AXQA 2G76A 1OOEA 2P91A 3ZW8A 4WCDA 4U6QA 3GDOA 4O5OA 3JQFA 3EVTA 4GX5A 4URFA 3RROA 4D42A 5BQFA 3SEFA 3HJAA 1GCUA 4TKLA 3R0IA 1UAGA 1EMDA 1YL5A 4GVXA 1H6BA 4LRSB 1B3RA 5ER6A 1LBEA 1H0KA 1IHXA 1GD1O 1IY8A 1SOWA 1R4MA 4HNHA 4KDEA 4CMEC 3GEGA 2JL1A 3IKVA 1Q0QA 1T26A 1LI4A 3EGOA 4D3SA 4DXHA 1SPXA 3I9OA 1PZGA 4JXKA 4E0BA 4HFRA 3CMMA 2F1KA 4IIUA 4DWVA 1QV6A 1ENZA 3I3OA 3TZHA 1PQWA 1KBZA 1LDGA 3L4BA 1E7WA 2D4AA 5G0UA 1YL6A 4GAEA 2P4QA 1ADFA 4N18A 3NDRA 2VOEA 3I4CA 3LT4A 3P5SA 3OECA 2VZ9A 4DL9A 3UN1A 3QQPA 2Y93A 1YO6A 1P33A 1ONOA 3KSZO 1AHHA 1J5PA 3CXRA 1SEVA 1GV0A 3DZFA 4Q3NA 1I3MA 1NPYA 2X0IA 3H9UA 2P4HX 3ONDA 1ISMA 2WM3A 3DBHB 3P7MA 3WBBA 5C3MA 4WECA 3Q2KA 4BNYA 1DLJA 3OF2A 2CMDA 1NQ5A 2O2SA 1Q1NA 3F6YA 1N5DA 3MJCA 3F4LA 5T8KA 3ZW9A 4QTZA 4J1TA 2JD0A 2B0JA 4RCVA 2DM6A 3ZWAA 1GU7A 1MFZA 4J91A 4TRNA 3NJ4A 3FSRA 1B26A 5AVOA 1ENOA 1U4SA 2Q4EA 1EQ2A 3BHMA 3H3JA 4E5NA 2HKIA 3GVHA 1QYDA 2EERA 5G0WA 4F45A 4RF3A 1P1RA 4GI2A 3QVXA 3P2YA 4I5FA 4J3FA 4KZPA 1OC4A 1I01A 2PGJA 1MG5A 1QP8A 2G0TA 4UUNA 3WICA 2YV1A 2ZCVA 1QXSA 1U28A 2IODA 3FCOA 4AJNA 1LC0A 5GZ6A 3AOGA 3ZWXA 1EUCA 3NTOA 1Y81A 3L07A 1MA0A 2IYOA 1E7YA 4CV3A 3D1LA 3U0BA 2HUNA 3CPSA 4BNJA 2HRZA 2PWZA 4IGEA 2NADA 4XJSA 1QSGA 1PJQA 3RBZA 5CEJA 3DEYX 3HDJA 2BHLA 4UAGA 4XIYA 5BSGA 3O8QA 5I7FA 1FMCA 3OH8A 2H1SA 2QIOA 1TXGA 3AUTA 5ICMA 1LLDA 4CV1A 3EYWA 3TZKA 3DO5A 2UYYA 3WGOA 4D3DA 1A4IA 5DZSA 1DC6A 3ZH2A 1KVTA 2RAFA 1TVEA 1T1SA 3KRTA 4RL6A 3U4DA 5JC8A 3E18A 2HLPA 2YFHA 3LDHA 1XDWA 1DB3A 1EBUA 2PKRA 3MOIA 3L6OO 1VKOA 3ON5A 4L73A 4RQTA 3OQ6A 4YA6A 3RUCA 3TPCA 5JMWA 2HQ1A 1WDMA 1I32A 4PG7A 1R6DA 3FR8A 3PHLA 4XYEA 4Y8VA 1CQIA 3GDFA 3RFVA 2PK3A 3JQAB 3DHEA 3DHNA 3Q3CA 4IPTA 2WD8A 1B8VA 4I9HA 4ND4A 1NFFA 5COBA 3UF0A 4RQUA 2QRJA 5JSFA 3CH6A 3VH2A 1FF9A 2G17A 1GADO 3PYLA 4RVGA 2RBEA 2DT5A 4BNWA 2ZB8A 1P0CA 1V6AA 3TRIA 5L40A 5G0TA 4IUYA 1BTOA 1ZXBA 3PEFA 1H2HA 1FDTA 4L4SA 2FSVA 2HU2A 4OIMA 4UREA 4IDEA 4NDNE 3ZV4A 1HKUA 4B8WA 2RCYA 1PS9A 3TNLA 4J0FA 1AE1A 3RFXA 1C1XB 1I3NA 3T7EA 3UCEA 5TF4A 1G1AA 5BT9A 5KJ1A 2NUAA 3JCZA 3VDRA 2BGMA 4YJHA 3VH4A 4DIOA 1NHWA 1RPNA 1Y8RA 4AG3A 2PZJA 1ML3A 2YV3A 3CIFA 1JA9A 1NWCA 1ZSNA 4IBOA 4IJKA 4UVIA 2NTJA 3ZNNA 4KTVE 5G2OA 1SC6A 5DBIA 5I8WA 1DJNA 2O3TA 5T5QA 3HNPA 1IZ9A 1KY5A 2AQHA 2WYUA 1DPGA 4YJGA 3UXYA 9LDBA 2G82A 3GGOA 1YGYA 3KTDA 4MP3A 3CTMA 4NBTA 1BW9A 2NM0A 2EKQA 3NRCA 4FJ2A 5JNLA 1S7CA 4CL3A 2C7GA 4MJLA 3UW3A 4H3VA 1LQTA 5CP8A 3HADA 1ISHA 2Q1WA 1PL7A 3AK4A 4RDHA 4IINA 4K9DA 4CMEA 4IDBA 3ULKA 1ZK2A 1KS9A 3NT5A 2ZYAA 3BMNA 3PHJA 4HADA 2OZPA 5T6BA 4N7RA 5L51A 3ZWBA 3PQFA 1EVYA 3O26A 3B1FA 4QUKA 4TWRA 3RU7A 5JS6A 4K6CA 3VVCA 5JC1A 1D3AA 4KQXA 3MJ4A 4Q3DA 1W6UA 3V1UA 5CAEA 4JN6B 1L7EA 3KLMX 3GAZA 4R3WA 5C7OO 2B37A 2B69A 4J2HA 2TMDA 1E3JA 1ZNQO 1YDEA 1U3VA 1CWUA 3DFZA 4AVYA 3OEWA 1IZ0A 4OQZA 1I2CA 1OFGA 3JQBC 1HLPA 3WLEA 4FCCA 1XELA 1C1DB 1DAOA 5IZ4A 3ZU3A 3OJ0A 3HG7A 1E3SA 2PA3A 1F8FA 3ZI0A 1HTBA 2CVOA 4Q3AA 1V3TA 1ENPA 4JX8A 3GNQA 3OHSX 2JD1A 1LSJA 1U2GA 4MKRA 1N2SA 4O59O 1J6UA 4EJMA 4EW6A 5A4DA 1K6IA 1PGPA 3E03A 3O4RA 4YJHB 3CZRA 3EZYA 4A03A 3KEQA 3DBRA 2EHDA 3RIHA 1Y8RB 3I9NA 4BKRA 1HE5A 4EZBA 3FWZA 1RM0A 3ROMA 3FI9A 1GCOA 2R2GA 3GG2A 2NVUA 4YJDA 2HK7A 2XF8A 2BRUA 1LRKA 2BFMA 3RD5A 3BHIA 1C14A 4HY3A 1VL8A 1L1FA 4B7UA 3ETEA 2J3KA 4XB2A 4M49A 4XYMA 3WJAA 4J7UA 1Y1PA 3H9GA 4CMKA 1WLYA 3FWNA 4PLWA 1GYQA 4Q3BA 4EJ0A 3DBLB 2J5QA 3K5PA 2IZZA 2VWQA 3AUAA 1QLHA 1I2BA 5L7TA 2VHZA 1A27A 2H5LA 3TFQA 3JYLA 4B3HA 4N54A 2EW8A 3C24A 4TQGA 3QWAA 8LDHA 1BSVA 1ADBA 5JCJD 3NJ8A 3I4FA 1ZW1A 3ADOA 4A26A 4D41A 5BSEA 1R16A 3I9KA 4QECA 4WLVA 3JQ8B 3LC1O 4B3JA 2HDHA 3KYBA 2D5CA 2OBNA 4D44A 5JXWA 4UVHA 5ENVA 4OKNA 3AU8A 1H5QA 1JVBA 5AYVA 1Y7TA 2E4AA 3S2IA 3OEYA 4A27A 3F9IA 4OKIA 1QRRA 3ZWMA 4FJ0A 2NU6A 1NTOA 4NJMB 4OJNA 5KVQA 3F1KA 1E7QA 2AQKA 1E5LA 1VL0A 2WSBA 1G0OA 3LK7A 4L4RA 1JAYA 4BMSA 3OMLA 2EJWA 4O1MA 1E7MA 1YQGA 3R6DA 2DTEA 4FB5A 4BS9A 1ORRA 3U3XA 1H9BA 2IZ0A 1V35A 5JBIA 3OETA 4IXWA 4WK6A 3BIOA 3B6ZA 4YT8A 4P4LA 4KWIA 3DBRB 3KYDB 4MPDA 4ZRNA 5I7EA 2R6JA 1D8AA 3OP4A 3C1OA 1HE3A 3GH3A 4E32A 3Q0EA 1VJ0A 3VH3A 5IZCA 3W4IA 5U1PA 3TOXA 5BSFA 4DTIA 1BVUA 2VZ8A 3K2BA 4IIVA 3NTQA 1WNTA 1H93A 3NTRA 4BNHA 2CY0A 4BQPA 5TGDA 3GF4A 1YBAA 3KO8A 3C8MA 3MCVA 4GLOA 3PHIA 4NBVA 1E3WB 3RAJA 4J90A 4YXFA 4YQYA 3LF1A 3E6AA 4UVEA 2EV9A 1LQUA 1KOLA 4OSPA 3GRKA 3VZSA 3VTFA 1JDJA 3RSHA 4P38A 3DAFA 5G4KB 4IS2A 2A4KA 8ADHA 2FP4A 3TL3A 5CDUA 4XZ3A 1B15A 2VNAA 4FD3A 4FJ1A 4A73A 4NFSA 3HB5X 4G65A 1VE9A 3DZIA 4IMRA 4II2A 3JYQA 3UH1A 3L0DA 4AJ2A 1GYRA 2YHIA 2HK9A 5F1KA 2BELA 3FNFA 3NUGA 2J8ZA 3ETDA 1IHYA 4GPD1 2D3TA 1YJ8A 4IS3A 1E1KA 2GF2A 3AFMA 1Y6JA 3QVSA 4G81A 2OFPA 4E2WA 1ZUD1 2WE7A 5EESA 5JFOA 3PIDA 3K30A 5JW6A 2X8LA 4YTEA 1IE3A 1UP6A 1WZEA 4LW8A 4B3IA 1H2BA 3A28A 3GFGA 3H2ZA 1D7OA 2W4QA 3PXXA 5COQA 3RBXA 5CDGA 1X13A 2VWGA 5JCJA 1ID1A 1OC2A 1WDLA 4OXKA 2EGHA 2Q2WA 2G1UA 4CM4A 3JQ7B 5A03A 5CDTA 3ZCXA 3AUUA 5GZ3A 3WG9A 4EEXA 3WSWA 1X7GA 3C7AA 3HSKA 2QQ5A 4R1SA 1LSSA 3W8FA 3GT0A 3SJ7A 1RM3A 4II3A 1BXKA 5I9LA 1UP4A 4GX0A 4J49A 3ROKA 4K28A 4ALKA 4CQMD 2AEJA 3OA2A 1EDZA 2FMUA 3GNTA 3QWBA 1KYQA 1PQPA 2Q3EA 3DR3A 1E7SA 3KLPX 1XU9A 2FOIA 3OM9A 5DBFA 5THKA 4ALMA 4BNVA 2ET6A 4AJJA 4YVFA 1A7AA 5T8KC 3C85A 2R00C 5AXAA 4D3FA 4ND1A 4WUVA 3HDHA 3MJEA 1XCBA 1R0SA 1VC2A 5A04A 2HMSA 2EG9A 2ZTLA 1DC4A 1PTJA 4IDCA 1EE9A 3PJFA 4OM8A 1CEQA 5IG2A 3PFFA 4U5QA 3D4OA 4DYVA 1N9GB 3DWFA 3AOEC 4BL5A 3RASA 3PDUA 3I6QA 4MKZA 3WYBA 1Z7BA 3ZWOA 4I08A 1IOLA 1JU9A 3RC2A 3ONFA 3WMXA 4F3YA 4M55A 3E5MA 1PJ2A 2VHWA 5TC4A 1LA2A 5H83A 2C07A 2XPCA 2D5AA 4XGKA 2DFVA 1S6YA 2C0CA 4ZQHA 3ZU4A 2NSDA 2ZB7A 1OI7A 3BMCB 3V2GA 1T1RA 1PZFA 2EP7A 3AI2A 1D4FA 3DL2A 4QFDA 5B4TA 2ZYGA 1SBYA 4RVUA 1HDZA 3CZMA 4NG5A 1GL3A 5TT0A 3OJEA 3GVXA 1KVRA 4KTTE 5BNIA 5T64A 3JV7A 1LSUA 1I33A 3DTTA 3EVNA 3WGZA 3JD4A 4XR4A 3AWDA 4RO0A 1FJHA 3DAGA 2AG8A 4CUKA 3RJ5A 5CHEA 3UOGA 4CM4B 3JQEA 2E6UX 2OUIA 2ZB3A 3Q2IA 4PZCA 4WCFC 5ICSA 5L53A 4PIVA 4KUEA 4LVUA 1N1GA 4ZA2A 4AJ4A 3MTGA 3K73O 1E3LA 2CDBA 2OP1A 3QHAA 5JDIC 1X0XA 4GX2A 4W99A 4BNKA 1GPJA 1SB9A 1XKQA 3IUSA 1HRDA 3I6IA 5JO9A 4M54A 5L3ZA 3N74A 2B5WA 2BD0A 3NAQA 4JBIA 2WEKA 2P9CA 1I3KA 2Y1EA 4CLRA 4D45A 3H5RA 1E6UA 5KJFA 3AFNA 2O48X 3QVWA 2GCGA 2X5OA 1OBFO 1TB4A 3COSA 5COAA 1ADCA 3PFWO 4Z3KA 4NFHA 3WNVA 1ADGA 4A0SA 2OO5A 4BO0A 6LDHA 3LC2O 3IUPA 5J23A 1HL3A 1NR1A 4EEZA 5KIAA 3UGKA 1PJLA 4D0SA 1L7DA 5IXYA 3TZQA 3WWZA 5CG2A 4IZIA 4WEQA 3R3JA 1P1IA 4MP8A 1XQ6A 3LT1A 3M1AA 3S2GA 4IM7A 1BXGB 4GWGA 4UUMA 4CM9A 2D8AA 4LCJA 4Q3EA 3BMOA 2Y1DA 4AJ1A 2J5KA 1T2AA 4GGPA 1HE2A 5EMHA 1PJSA 3AW9A 2Q45A 4R69A 2NACA 4WEOA 5EPOA 5DCYA 3TDKA 2D59A 2C5AA 1ZVMA 3L9WA 4E5YA 1PS8A 5FEUA 4GQAA 3WX0A 2YY7A 3KETA 4R5MA 3DQPA 5ADHA 3FBGA 2H6EA 4G2NA 4W6ZA 2JAHA 3PPIA 2X0JA 3M2PA 3F1LA 2E49A 4R9RA 2C2YA 2F00A 3H9EO 1PL6A 3ROPA 3RQSA 3WQRA 1CQJA 1PWZA 1W73A 1YBMA 1BHSA 1Q7CA 4CR8A 2O4UX 4P4GA 1LNQA 2AA3A 4IDDA 1O95A 1TT5A 4AJIA 1YOVA 2JAPA 2A92A 4EUFA 4H7PA 4MVJD 3SLGA 3BMQA 1PSDA 1W4ZA 4RZIA 1K2WA 4IDFA 4TZTA 3F5QA 1IUKA 1ZK4A 4IJWA 3A06A 4HNGA 1UDAA 3BZUA 2E37A 1N1EA 4J4BA 5KVSA 1NQAO 2QW8A 3PTZA 5A05A 1ZSVA 2CFCA 4XQEA 2VYVD 4RZHA 1I24A 3GDGA 4DUPA 1UDCA 3LLSA 1Q7BA 1J0XO 1IPFA 4FBGA 1MXHA 5JAZA 4NJOA 2JCXA 2VUTA 5BNFA 4GSKA 4OOEA 4I8XA 3UFXA 3ZNOA 3W4JA 4BKQA 1UZNA 5F1PA 4CLRB 5ER9A 4DPMA 1HLDA 4YWJA 3WB9A 2W90A 4BNFA 1DC5A 2Q1TA 2YDYA 1U1IA 1PGJA 1X1TA 2AQ8A 4OXNA 1Y8QB 4E3ZA 2P68A 2P2SA 4DLLA 1A7KA 1HXHA 3QJ5A 4CQLB 2Y1GA 1NAIA 3K6JA 2Q49A 2A9FA 4JBHA 2IE0A 4AJPA 2X0NA 3WGQA 4XCVA 3HE3A 2FY8A 2R00A 2X6TA 3FD8A 4HBGA 1BDMA 1M6WA 5A3JA 1IL0A 1AN9A 2NV6A 2VNSA 3G1UA 5A5FA 2J3IA 4NPCA 1VPDA 1O94A 3SXPA 4CQMB 4FQ8A 3ANNA 3VTZA 5CEEA 4TROA 1LXCA 3WGGA 1RM5A 1IB6A 4N5NA 1ARZA 3RVDA 2ILTA 1XGKA 3AOEA 3GZNA 2I99A 2VYNA 3RUFA 4A10A 5DP1A 1T2EA 3VPXA 1Z75A 5JYDA 1O9BA 4HV4A 1EVZA 3IJRA 1C0PA 2BH9A 1PL8A 4NK4A 2PLAA 1GR0A 3F46A 1FDUA 3JQ6A 3DOJA 3N58A 4LCEA 4RVHA 3D4PA 4KOAA 5C7IO 4MVJG 1LLCA 1X14A 4RDIA 3WGHA 4YT5A 3ROQA 3B70A 2AEFA 1GAEO 1C3VA 1WMBA 2XOXA 2Z1MA 1R4MB 1U4OA 3NEPX 3WQQA 4JIGA 3B20A 3NGLA 3GC6A 3OIGA 3EDMA 1EQUA 3F4BA 2PR2A 2PV7A 3K96A 5B4VA 1YH3A 4D43A 4GGOA 5F5NA 3PLNA 1AXEA 3K92A 3Q11A 4JNKA 3ZV5A 5JAQA 3KXDA 2UUOA 1TI7A 5L7YA 1HDCA 4HUJA 3RFTA 1PIWA 4WCFA 3BTSA 3LT2A 3SLKA 3GUYA 1PJBA 3HN2A 2V6FA 4IJUA 4FSHA 5JDIA 1R37A 2O4CA 4L74A 1E5QA 1XR3A 2TMGA 4NBRA 4YT2A 3UAGA 1JQBA 4R41A 2C29D 1E3IA 5KVVA 3FR7A 4UUPA 4N5LA 4Z9YA 4P8RA 4MVJA 3VKUA 1GPDG 3ABIA 3QW2A 3IP1A 1ONPA 1LU9A 1ZXLA 3S55A 1KY4A 3JD1A 4QO8A 5AQ1A 4CLOA 1V0JA 3ZGYA 5IN4A 1XA0A 1HDGO 1ULUA 2VYVA 3GLQA 1WPQA 3T7CA 5KJ6A 3GY0A 4YAEA 3VZPA 1QMGA 1FDSA 2D1YA 2QHXA 2ZYDA 3D5QA 4GSLA 4QT0A 3IDSA 3O9ZA 4B4UA 5IZCC 1PR9A 3DZHA 1JW9B 2FR8A 1EVJA 1SO8A 2PNFA 2DLDA 4GLLA 4XGNA 3G0OA 2DKNA 2ZCUA 2QRKA 5L9AA 1U9JA 4LVCA 4FW8A 4ONEA 4J0EA 4MIYA 3ZHBA 4MVJF 4HWKA 4RVFA 2PGLA 1B14A 4LN1A 4Q39A 1R4NA 2CD9A 4EJ6A 4O0LA 3EC7A 1XU7A 1ISIA 1YKFA 5TLSA 4PLCA 2NU7A 4ZN6A 2PH5A 4DIBA 2PD3A 3W6ZA 4DC1A 4WOJA 5JDCC 4BKPA 1ENYA 2DQ4A 3EHEA 1H6CA 3O8QB 3OIDA 2PD4A 3JQCA 4PVCA 4WLUA 1SEPA 4FN4A 2I5PO 1UXJA 1MV8A 5FI5A 4CV2A 3BHJA 5T57A 4J9UE 2DTDA 3BAZA 4FFMA 1C0KA 2I3AA 2J3HA 3QV1A 4LISA 5HM8A 5ILOA 1PZEA 4PLGA 2Z1NA 2DPHA 4CM1A 3ICPA 5ES3A 1K6XA 4BNNA 4CMIA 4Q3CA 1LX6A 4WCFB 4DLAA 1YRLA 3WWYA 1GEEA 1SAYA 4IQ0A 4QSMA 1QLJA 2Y1FA 3VDQA 1Q7GA 3GN1A 2DUUA 4K26A 3LYLA 3RKRA 4HX5A 2HRBA 4ESOA 2B83A 3LT0A 3WFIA 4PLPA 2UUPA 1GQQA 3ENKA 1RYDA 3IIEA 4JQCA 1LDYA 4PGFA 3HDQA 2VRCD 1ZKMA 2CSUA 1QR6A 4IDGA 5AXBA 2GASA 3GVIA 3WQSB 2YQ4A 4OOFA 1DIBA 4Z0HO 5A06A 3V8BA 4CM8A 4B7XA 4AFNA 2DAPA 4RLHA 4R1TA 4J2OA 1PJ3A 5LC1A 3DZKA 3GPIA 1V8BA 1B8PA 3HHPA 4QX6A 4UULA 5DCWA 3RI3A 3VAZA 4MVJP 2AE1A 2Q46A 1HETA 4KDFA 4YEDA 2Y1CA 1NP3A 4YAKA 3OJFA 4MVJI 3F3SA 1VLLA 4Z0PA 4Y6SA 2EKLA 1ZJZA 1LDBA 2QYSA 4CMJA 3I9MA 3OBBA 1JTVA 4PRLA 3GR6A 4PZDA 3FF4A 2X23A 1DRUA 3D3WA 5DOVA 5F5LA 4Y6RA 5EIOA 3W1VA 2GZ2A 3ZHZA 1SOVA 1X0VA 3DC2A 1U7HA 2PZLA 4FC6A 2RHCA 4ND2A 1B2LA 4MINA 1WMAA 3WLFA 2DFDA 4ALJA 5AOVA 3GZ4A 1CERA 3JQGA 3A4VA 1XHLA 1GUZA 3ITDA 3RUAA 4YJFA 3UICA 3Q1LA 3PWZA 1AGNA 4YJGB 4B7CA 4XX0A 1EZ4A 3LVFO 2PFGA 5IJZA 3W6UA 4ALNA 2OOSA 1R15A 1UZLA 4IMPA 1BW9B 1XYGA 4FDAA 1XIVA 1PZHA 2UV8A 2NU8A 4NZ9A 3R1IA 1IULA 3VKVA 1ZK1A 1N7GA 1R0LA 1SZJG 5TJ9A 3FTNA 1BDBA 1F0YA 3DXFA 4Z6KA 2VHVA 2WTBA 2VZ0A 1WP4A 4ZVVA 2VT2A 1T2CA 1NPDA 1U5CA 3GHHA 2O3QA 3E9NA 3IMFA 4J7XA 2HCTA 1TT7A 3BMNB 4QQRA 4D79A 1M76A 2DBZA 4JJGA 2D2IA 4C7JA 2X86A 3GMDA 3QIVA 3WYCA 4CMGA 4L0QA 1R0KA 4BO1A 2HMWA 3V1YA 1NPTO 1UAYA 1HE4A 1NWHA 3E48A 3KSUA 1PJTA 4FR5A 5KTKA 2Y1OA 1QG6A 3TZ6A 5A9SA 3KOUA 2O3UA 3MWDB 4OSOA 4GMFA 3KYCA 3RKUA 2FPPA 3ICCA 1RM4A 2NTVA 4RVDA 3HQ4O 1NVMB 2YHUA 4WGGA 2EEZA 2ZQYA 5I7VA 3WBFA 1AHIA 3DMTC 3GVPA 4GWKA 1O5IA 4BNTA 4YR9A 3JQDA 1Q2XA 2XAAA 4BNGA 1K0UA 4LSMA 3AY3A 4IGFA 2CUKA 3PLRA 4CR7A 4E6PA 4BNLA 1QV7A 1XG5A 1DRVA 4NHEA 1V3UA 5BSHA 2HSDA 1HF3A 1EFLA 4YAJA 4YDRA 2VRCA 4BMVA 1HDYA 1GZ3A 5ITWA 1B8UA 5IN5A 1I2ZA 1M2WA 4OHUA 5LDHA 1MX3A 2NVUB 5JYEA 3LC7O 3WNQA 3AU9A 3INGA 3IJPA 3PQDA 4CUJA 2W2LD 1HYEA 4PCVA 4DLBA 1LRJA 3SX2A 4O6VA 3IKTA 2RH4A 1XWFA 4WNCA 2GD1O 1E1NA 4U0JA 3T4XA 4RF4A 4YJFB 2C54A 5HS6A 2CVQA 4PLFA 2A35A 4XB1A 3I23A 4EGFA 1LJ8A 4Y98A 4IXTA 2CF5A 3FPLA 3ZNQA 1FDVA 3VPFA 3KB6A 3ZHYA 2YDXA 3DZBA 4J4TA 4WOKA 5DDIP 2DU8A 5I8ZA 4CPDA 2I66A 3IS3A 5B4UA 3GVCA 5EQFA 5JDCA 1WWKA 3I9LA 1PJ4A 5HTOA 1QYWA 2C5EA 4O63O 4WPGA 4GH5A 4LRTB 5DN9A 4KMSA 2Y99A 1K3TA 1GTMA 3RUIA 1A4UA 2PD6A 4I5DA 3KVOA 5L7WA 5FWNA 2B4RO 3DB2A 1ZJYA 3HUDA 1KIFA 4D0RA 1P1HA 3WIEA 2GLXA 1YWGO 2NTNA 2RHRA 4RPGA 1BWSA 3N7UA 5CPBA 3WYEA 4DQXA 4BO4A 3ZWVA 4E13A 4YACA 4OQYA 2Q1SA 3VZQA 1JKJA 1VKNA 4NFYA 3OFSA 3GAFA 4FFLA 4NBUA 3FHLA 4OMUA 3OJOA 4MP6A 3FBTA 3PVZA 4XWYA 4W82A 5K6AC 7ADHA 4UEOA 3M6IA 1N92A 1NBOA 3LLVA 1EVIA 3UHAA 4CM9D 3ZHXA 1X1EA 4IQGA 1GFSA 1E6WA 3L4SO 5BNTA 4PLVA 4J43A 4DGSA 4DPLA 2HMUA 3WOHA 1MC4A 2ZTMA 4XGIA 2ZJ1A 4Z3DA 4RF5A 2CDAA 1EE2A 4CLHA 2Y0CA 2WE8A 3LU1A 1KEPA 4DVJA 1ZO8A 3C7DB 5K0ZA 5IFLA 1NAHA 4ND3A 2VWPA 3PIIA 3QRWA 3UCFA 3TN7A 1HYHA 1B0AA 3HFSA 4U7WA 4BO8A 3W8DA 3I1JA 4GVLA 3Q9NA 3ETGA 2FRDA 4RGBA 2C82A 4A2CA 3H4VA 2WYWA 3RC7A 4HFMA 4DMLA 3ZWNA 4BNXA 5L45A 3HZZA 4HKTA 2P5UA 4GX1A 4PVDA 1DBVO 4ND5A 1IPEA 3U4CA 1ZSYA 4OGWA 4CLDA 3D4NA 2AMFA 2G5CA 3JSAA 1P1JA 3AM3A 3HN7A 1DSSG 2FN7A 2W2KA 4XJTA 1KETA 3INTA 2OORA 2B35A 4GKVA 5A02A 4L75A 5U9CA 1NVGA 1X15A 1UXGA 4BGUA 3FNEA 1UP7A 4YAGA 4ZU3A 2Q4BA 6ADHA 2YHIB 2EKPA 3GEMA 2OXIA 3ONEA 4RORA 1DFIA 2W2LA 1MP0A 3Q9UA 5LCXA 4XA8A 2O3JA 4PLTA 5I9NA 1ZIDA 4UEJA 1QYXA 2BGKA 4BVAA 3G3EA 1YONA 5C7LO 2WD7A 1DIHA 1M75A 5GMOA 3OSUA 1JAXA 4CM6A 1E77A 3LZ6A 3R3SA 5JLAA 3U49A 1P3DA 1G6KA 3GRPA 3HB4X 3MTJA 3RU9A 4FFPA 2VOJA 4XRRA 3ZV6A 2VUSA 4TZKA 4TMFA 4BB6A 1MB4A 4HP8A 5BR7A 5FYDA 3G17A 3ITKA 3LSYA 3JYPA 3STHA 1PGQA 3DBVO 4CMBA 2DC1A 5L4LA 5K9ZA 4PLZA 5FF9A 4JP3A 5F1OA 4JP2A 2P9EA 4XEHA 2B4TO 2NQTA 3JD3A 1U3TA 3GNSA 3E8XA 5EINA 2V6GA 2HMTA 3H5AA 3K2EA 1HWYA 2DVMA 1NQTA 2WMDA 3FPCA 2Y05A 2JD2A 4QXMA 4YPOA 3PYMA 9LDTA 3QWFA 1NHGA 3DMTA 4YRDA 2GO1A 5TJHA 4ALLA 2VQ3A 5DCUA 2J5RA 3JQAD 3PHGA 1ONNA 3E9MA 1DIAA 2Y0EA 1CDOA 1U7TA 1JWBB 3KHUA 4B4VA 1KERA 1DC3A 2FHSA 1ZCJA 1MLDA 2FR0A 3GEDA 3HWRA 4R4JA 1HSZA 3NDJA 4FOOA 2VYND 3PQEA 1ZEMA 3AUSA 4J1SA 2DBVO 2I6TA 4XQGA 3WR5A 1YQDA 2IEBA 5KJEA 3UCXA 1F17A 1PEDA 3VZRA 3P2OA 1H94A 1EK5A 1P45A 3PGXA 4ZD6A 4H15A 1A9YA 4P4NA 3V2UA 2HJSA 1NFRA 2GN6A 3PGJA 4CMHA 1OAAA 4R16A 2CZCA 4XQCA 3WJ7A 3DBHA 3EY4A 4F46A 3ANMA 3IC5A 1XQ1A 2V65A 5TT1A 1D1SA 1KC3A 3AY6A 1A72A 4Q9NA 4NMHA 1CETA 1BXZA 1K5HA 1YXMA 1VSVA 2UAGA 1MUUA 1EUDA 4BNMA 3H9QA 1F12A 1O6ZA 1DJQA 5I7SA 2SCUA 3HFGA 2I76A 1WXDA 3ZV3A 4E5MA 1A5ZA 3W8EA 1BG6A 2X5JO 1E1LA 4S3MA 2VUUA 1LLUA 2IRWA 1PGOA 3AY7A 4RPHA 3RJ9A 3WS7A 1EBFA 3OQBA 2FWMX 4AJEA 5G0SA 1EK6A 1CIVA 2YUTA 4JJFA 2C59A 1EDOA 2JCVA 4K1LA 1UJMA 4XQ9A 4BV9A 2DPGA 5A5EA 3PK0A 1WDKA 1KEUA 3TJRA 1UXKA 1UXHA 1YQXA 5JMPA 4TVBA 5A9RA 2BI8A 2HK8A 4U6SA 4E30A 1M67A 3MZ0A 3INRA 3ZNPA 3D5TA 3QWHA 3AI1A 1ZFNA 1ZK0A 5K6AA 2NVWA 2PKQP 1LC3A 3JD2A 1DHTA 4DRYA 5TIIA 1PGNA 2DUWA 1RKXA 4BKOA 1R66A 3B1KA 2ZKLA 1G0NA 1HDOA 3GG9A 4XKJA 3PHHA 2E82A 3K31A 5F3RA 4FFOA 4F6CA 1JVSA 2NWQA 4GKBA 4ZQBA 4B79A 3G49A 5TSDA 2O7QA 2I9PA 3OQ1A 5IF3A 2O3SA 4E2ZA 1T25A 2O3RA 3H3FA 4WLNA 3KZVA 1N7HA 1WAMA 2BI7A 3DAPA 4BV8A 4FGSA 2LDBA 1SB8A 3DFUA 3BMOB 5A9TA 4KQWA 5MDHA 3QLJA 3H8VA 1YDWA 3JQAA 2NNLD 3TQHA 3H9JA 4BO7A 4L4XA 5THQA 4BNUA 3RCBA 4I5GA 3KUXA 1LUAA 4W9NC 3MJSA 4MIEA 2A94A 2DTXA 3NT4A 1O8CA 4TRRA 4UUOA 1WW8A 2GNAA 4OYRA 2AE2A 1HDRA 1ZMTA 2BFPA 1U3WA 3EMKA 2E48A 2X5KO 3EK2A 2X9NA 1RWBA 4BGVA 3WMWA 2CNBA 3HDYA 3NV9A 4JROA 1K89A 1C1XA 1H6DA 1JKIA 2JHGA 4ALIA 3MOGA 2GZ3A 3D3EA 1F14A 4Y9DA 3MEQA 2JCYA 1TT5B 2X1HA 4RPLA 3PWSA 1YOVB 3TOZA 3BMQB 4JGBA 1GV1A 4NU5A 2QZZA 4LMPA 4ZJUA 4M86A 3VVBA 4IY1A 1DDOA 4CR6A 4ILKA 5L95A 2ZTVA 2PTGA 4R1UA 2CVZA 3U9LA 2Y68A 2JHFA 2RIRA 2EWMA 3I83A 4FS3A 4AICA 5CG1A 1BRMA 4FGWA 2QRLA 4L9RA 3FN4A 4EI2A 4NR0A 2X0RA 2IZ1A 3ZDFA 1I10A 2I65A 1Z73A 1TA4A 2VCYA 4L76A 4U8GA 2IXBA 2Q1UA 3MJTA 5TQVA 3SJUA 4J6FA 1J4AA 3NYWA 2FSSA 3UKOA 4GBJA 4DC0A 1HEUA 4HFNA 1FXSA 4OH1A 4FFNA 4TSKA 3QA9A 3B1JA 4YT4A 1HT0A 4DPKA 4ZHSA 3DZGA 3WGIA 4B4WA 2V6BA 1T2FA 1LTHR 3E9QA 4DREA 4ID9A 1NM5A 3L77A 3VPSA 5KJCA 5HRUA 1F8GA 1GZ6A 3DMYA 3F5SA 2HAEA 2Y0DA 1EUZA 2HJRA 2FPGA 2W8ZA 3ANLA 4BQRA 4J9VA 2I3GA 2D0IA 1YB5A 2YZ7A 1YL7A 1HZJA 3WFJA 1I0ZA 2HO5A 4Z9XA 4WLEA 3L6EA 2W98A 1AXGA 1VJTA 3C1AA 1PX0A 4CJXA 3GZNB 4Z0TA 4BO2A 4PG6A 1UZMA 3JD0A 1T24A 3FTPA 1C1DA 1QYCA 1Y5RA 1DRWA 3X2FA 3VOSA 2PKQO 4YRAA 5IAAA 2WWRA 1PU2A 4PRKA 5L4NA 1MG0A 3CMCO 4JCOA 3O38A 4CLXA 4D46A 1HSOA 4ZICA 3PP8A 4J1NA 2VTEA 4FPXA 1GUFA 4IQ8A 1UDBA 1XLTA 4YB8A 4ITUA 4MVJM 2IYPA 4BB5A 5ITVA 3GK3A 1CRWG 4MKXA 1IYZA 2GGSA 3NT2A 1C0LA 1WZIA 4XD2A 1JLLA 2OHXA 1FDWA 2AHRA 1N8KA 4C4OA 3TWOA 3V5NA 1Y9AA 4R5HA 4Y67A 2XXJA 1ZEJA 2V7PA 2ZQZA 1BVRA 2GSDA 4TRMA 3MJVA 5DULA 5KOIA 5IDXA 3DBLA 2IXAA 4IJVA 3H5NA 4RPJA 1Z7EA 3JYNA 3KM0A 3QE3A 1ZBQA 2X22A 4BIIA 3VPGA 4DQUA 4BGEA 1YVEI 5DOZA 2BMAA 2NVBA 3ZWPA 1NQOA 2V6MA 4DBVO 1W0CA 4TVOA 2ZTUA 2CDCA 3IQDB 4CLOB 2OMEA 2VRBA 4E33A 4HFJA 5B1YA 2ZK7A 4J4HA 1NXQA 2NLOA 3K9QO 4BKUA 3X2EA 2BKAA 1JN0A 5T67A 5GZ1A 3JQ8A 3FNGA 4AJKA 2AQIA 4CM7A 1ZZEA 2AEMA 4UEKA 4A5OA 1FK8A 1U5AA 3S8MA 4CM3A 4EUEA 1DLIA 3WTCA 2YFQA 3VC7A 3RWBA 4WLFA 3EUWA 2EIHA 3GGGA 3CINA 2I67A 5KVCA 4PG5A 4B4OA 4NJMA 3PRJA 1UUFA 1YB1A 5TX7A 1RJWA 1NVTA 4XRGA 2YV2A 3FNHA 3ORFA 4KUHA 4DQVA 1DHRA 2AG5A 3JQ9C 1DIGA 5EJ2A 3DDNA 3G1TA 4KP7A 4XYBA 3V2HA 4HXYA 4A7PA 4PG8A 1NYTA 3RUHA 3TF5A 2O2YA 3P19A 4E5PA 7MDHA 2J3JA 3VHRA 1R4NB 3NDIA 1E92A 2ZATA 5DP2A 1KEWA 2UVDA 3TSCA 5HWSA 2OP0A 4E2YA 5I9MA 4P22A 4W9NA 1Y5MA 3VH1A 2EF1A 4INAA 4R3NA 5KKCA 2YQ5A 4CL8A 3S1LA 4JK3A 2CF6A 2DBRA 1DFGA 1F06A 1LLQA 3F47A 3KYDA 5KNLA 2PZMA 5CEFA 1E1MA 3D64A 5HS4A 3C7CB 3PZRA 3D7LA 3A1NA 4PLYA 3PJGA 5CPFA 2B5VA 3ASUA 4W7IA 5KCZA 5KKAA 1NFQA 1Z82A 1MC5A 1Q0HA 3PYXA 1E3WA 4MVJE 3W4KA 1UXIA 2HMVA 1U8XX 4CMIB 4LGVA 4CLEA 4CUZA 2AW5A 2C7VA 5LDGA 5IDWA 4M89A 5G0VA 1GYPA 1T4BA 3AM4A 4PG4A 1C0IA 5EERA 4OAQA 1ZMOA 4CODB 4MO2A 4E12A 3QSGA 4BNZA 1B16A 4JBGA 5G4KA 3U62A 1GY8A 5AXDA 1EEHA 1PS0A 1SNYA 1H6AA 1Z45A 3WIDA 4LMRA 4KWHA 2ZIZA 3U4HA 1M6HA 2O7SA 4UVDA 4CM8B 1PQUA 2JFFA 3MWEB 2BFAA 1GEGA 3I52A 2UDPA 1E3EA 3Q6IA 5JCXA 2Q2QA 5JAIA 2OGUA 1E7RA 5ILGA 4WASA 4ZQGA 4EDFA 3TFOA 4DBZA 4CMCA 3WSVA 3AI3A 4RV9A 4YBZA 3DHYA 5EL0A 5HA5A 1HZZA 1DOHA 2C2XA 1LRLA 4PN3A 4YRBA 2WJPA 1NR7A 1I5RA 5AXCA 4M8SA 1I30A 1UR5A 5H82A 4E2XA 1V9LA 3U09A 3CSDA 1DEHA 4NNJA 3IAHA 3KBOA 3ZU2A 2VWHA 1DAPA 1JWAB 2VTDA 3L6DA 3RUEA 2H63A 3NKLA 4JJIA 3ZWWA 2B4QA 3D3WB 3JQ7A 2GR9A 1T2DA 1GUYA 1VI2A 4I5EA 1U3UA 1P77A 1U2DA 1SMKA 3EAGA 4BO5A 1PR3A 3ZWCA 2YJZA 4PLHA 4R1NA 3JYOA 1VSUA 2Y66A 1YB4A 4NH4A 3JQGB 1XSEA 3T4EA 4E21A 4R54A 1DFHA 1ZH8A 1GQ2A 1I36A 4KUGA 1HYGA 4DIFA 2J6IA 3SC4A 4EITA 3BYZA 5DF1A 3I9JA 3WTBA 2QG4A 3PZBA 1MFPA 1V3VA 2GPTA 4XR9A 1P44A 4DA9A 4MDHA 3U5TA 3QVOA 3OA0A 1NX6A 3C1TA 3ZU5A 2Q2VA 3KEOA 1ULSA 3H2SA 4BMNA 4WLOA 2X7HA 4J7CA 3OICA 4NBWA 1GDHA 4GMGA 4XDZA 3GOHA 4NQZA 3WDSA 3RUDA 1KEVA 3WGYA 4U0KA 2FZWA 3QP9A 4L8VA 4LSWA 2GN8A 5IDQA 4X54A 2EW2A 3RC1A 3I5MA 3GUCA 3GPDG 3L9XA 3M1LA 5DNAA 4NK5A 4I9UA 5H81A 3BTOA 3ZZNA 1QYVA 1N9GA 5CDYA 3ADPA 3IP3A 5JO0A 1KVUA 2EP5A 3RBVA 3OJLA 4R51A 1UH5A 4YAIA 1CYDA 4ZQFA 1YE3A 5B12A 1X7HA 1HDXA 1ISJA 4W4TA 3GQVA 5A9SB 3K8ZA 3ASVA 3JQFC 5TNXA 3ZWYA 5KWEA 4BUCA 3KYCB 5JY1A 2QZ9A 2FZEA 3FRJA 3SC6A 1QKIA 1JKFA 4I9NA 5TRTA 3BMCA 3PJEA 5EQDA 5DBGA 4C7KA 4NI5A 3EZLA 2LDXA 3PJDA 1CF2O 4PFJA 5FI3A 4JLWA 1E0DA 1AUPA 3WXBA 4FIZA 5GY7A 3TZCA 4CV0A 1U8FO 4MVJH 5L4SA 2YYYA 3CKYA 2VN8A 1Z6ZA 1VL6A 3JTMA 4QFCA 3L4BC 3LF2A 4BO3A 1OZAA 3A9WA 2YW9A 1I8TA 5A1TA 1VJ1A 1PWXA 4BO9A 2O23A 3LQFA 1Y9EA 1K6JA 1DIRA 1MGOA 1YBVA 2QX7A 1X7DA 1P0FA 3WGTA 3E82A 2GN4A 2GN9A 4OXYA 3IOYA 3A14A 4FOSA 1LSOA 2EJVA 3QWIA 4R01A 5JAMA 2POQX 2Q99A 1A71A 2VT3A 4OO3A 3JQ9A 3E1KA 4WNIA 1P31A 3QY9A 4RLSA 1LDMA 3JQBA 4BHTA 1ZK3A 3D0OA 2X58A 3C3XA 4E5KA 4RF2A 1Q0LA 4I1IA 3UVEA 3ZN2A 2PH3A 1VRWA 4NU6A 5JY6A 2RH8A 2Y67A 1D1TA 1QORA 2GZ1A 3QVTA 4LK3A 4OL9A 3ENNA 2XXBA 3VPHA 4ZQEA 2WYVA 1CJCA 1KVSA 2BFOA 1XEAA 1H9AA 1P74A 2P9GA 4MOWA 1BMDA 4S1VA 4BO6A 1PJCA 2BLLA 4F6LA 1P1KA 3H65A 2IEDA 1WVGA 2PY6A 5G4LA 2GUGA 4YYZA 2PGDA 2IDZA 3AJRA 1MXFA 3S2FA 4H16A 4IDAA 1BXGA 4CMAA 5ENDA 5C37A 2GYYA 5JPIA 2EXXA 2WDZA 1KVQA 5JE8A 1GQYA 1E6EA 2B36A 2FPIA 2JFHA 3GA0A 4EBFA 3AM5A 3ST7A 2JFGA 2NU9A 1DO8A 3UUWA 2Z5LA 4J1QA 4E31A 3SBOA 5FFFA 4M87A 5B37A 1R12A 4TRJA 2NQ8A 3KV3O 1GZ4A 1VM6A 1W8DA 4B8ZA 4AL4A 3V1TC 2GRAA 4FFRA 5DT9A 5MGBA 2ZB4A 1P1FA 4ROSA 1J49A 4E4YA 3DTYA 4RVSA 4EYEA 3PWKA 1EFKA 4EUHA 3GN2A 4ZGWA 2DBQA 3H7AA 4BOYA 2JKVA 3E5RA 2QYTA 1BGVA 1NASA 4XIJA 5U4QA 5TS3A 4YQZA 2PZKA 2BF7A 2OL4A 2Z95A 1OMOA 1LDEA 4R68A 4RJTA 3BTVA 3DZJA 3BA1A 4G5HA 3H6KA 4PZEA 3KSDO 3RC9A 4W7HA 2GDZA 3TL2A 2X4GA 3PI7A 1ISFA 1TLTA 2FR1A
chains in the Genus database with same CATH superfamily
3MXOA 4DMMA 2W6QA 3CM0A 3V7YA 3V3KA 4F4IA 3F6RA 5D87A 4BRZA 1JI0A 4ED9A 1P9LA 3IL2A 3M2TA 1F4PA 5EIEA 2IX9A 3C3MA 4N5HX 3ZWDA 2WMOB 5KBYA 2EWWA 1L7AA 2O2IA 4N8EA 2AFHA 1RJEA 2O50A 4I8DA 5CM2Z 2YJNA 1PFUA 3L5KA 1F0PA 2WHYA 3MBIA 5D7BA 2Z2KA 5JJIA 4MCAA 4RUKA 1R0ZA 1BU8A 1RYEA 1T4DA 1ZN2A 4HQLA 1CE8B 2VO1A 4NFLA 3B9BA 1M2NA 3GHYA 5D5QA 4K6FA 2G07A 3L7MA 1OIXA 3EIXA 1M8KA 4UXIA 5IJXA 621PA 3DMPA 2D54A 2EGGA 2QW1A 3PUIA 4PQGA 4XIFA 1QF9A 1BEUB 4CQLA 4ZGGA 5CFZA 2V7VA 3G79A 1EX9A 5HBRA 4HD8A 5F21A 1Z68A 4WKGA 3A2NA 4COKA 1J8VA 2Q5OA 1YR1A 3D8UA 1M0WA 2XYRA 2YASA 2IFTA 5IXSA 1Z38A 1CVRA 1U1FA 3UY4A 2VHXA 1YJQA 3CE6A 4H60A 4LRYA 1VKJA 4Q7JB 4P33A 5DVZA 3T5DA 2ZBPA 4NIMA 3QG5A 3OU2A 2PIDA 1RJ9A 3FCEA 3CSUA 5B3JA 5T6MA 2VHYA 1NJ8A 3GGPA 4O4IF 1VYVA 2QQEA 5DM1A 3V8MA 4ZYTA 3ESDA 2CUZA 3O83A 2NXNA 4UDNA 1Z3IX 2WJJA 4LYFA 5BVGB 2UXCB 4CM5A 3UBMA 3U7FB 5ICGA 4KXVA 2L42A 2QLTA 3QYJA 3GLVA 3HLKA 3C45A 1AD2A 1AXRA 1CJVC 1AVTA 1X1CA 4RPKA 4YCAA 5AMXA 5DSZA 1DQRA 1NJ2A 2B3DA 4RKQA 4Q7MB 4YAWA 2HXGA 4C1BA 1NI4B 1P75A 2UVQA 2CZGA 3CXUA 4R0VA 2BM8A 2RGUA 2P91A 3O4VA 3VR6H 4ZOAA 4WCDA 3GDOA 1FTSA 2P8SA 3PXGA 5FWAA 3SHTA 4ZP1A 3TYXA 2WVAA 2J3EA 4HNRA 5FPSA 3LDFA 5FUXA 4DSOA 5AW7A 2PJRA 1GCUA 1RIIA 4D9JA 2X15A 4X85A 1II0A 1RZRA 1EMDA 3EWAA 2I6UA 3KSRA 3VPCA 4AXBA 5HYVA 5IJ9B 1YL5A 4GVXA 3TXAA 3AKYA 1SU6A 4YLYA 3MQ4A 1ETHA 2JCBA 1B3RA 3G85A 4NBSA 2WU1A 2C9CA 5TQ2A 4M9XA 2X13A 3AHJA 4OA8A 4K0KB 1WXEA 1IHXA 1IXKA 1GD1O 1IY8A 1KO7A 1R4MA 2QUAA 1YZVA 4GXRA 3U26A 4CL0A 2JL1A 4CMEC 1Q0QA 2DUJA 4XWWA 1F7VA 3DL4A 2P2GA 4KQCA 4D3SA 1ZGZA 2G9RA 3I0ZA 3CMMA 2C8VA 2C9OA 2F1KA 2WSIA 3KKMA 3B3AA 3L7AA 5TPWA 3SK0A 1QV6A 2Y1WA 4BX9A 1OBHA 1RXVA 1J99A 2GBCA 1V5GA 4IIJA 2D4AA 1HG0A 4AMUA 2FAXA 1XJ0A 4GICA 4CG2A 1Q91A 1MEOA 2EU8A 1Y3BE 4X7RA 3P5SA 3OECA 7REQA 1WMDA 3BE4A 3QQPA 3ENVA 3I5YA 1EFUA 4EB6A 4YYEA 4CKXA 4ZJYA 2VDRB 2ZEJA 4P4UA 3U4QA 2OTCA 2BHSA 3FFXA 3KSZO 4UCFA 2B99A 4K88A 4LZJA 5EWJB 4FS8A 1CUUA 2X9QA 1P3JA 1IBMB 1NW8A 2D5IA 1YR8A 4H35A 1N2CE 4AO8A 1BHJA 1M2HA 4O2BA 7ABPA 1GA6A 4EB3A 3ONDA 1UJNA 1ISMA 2PBRA 1JQEA 3QJYA 4FK8A 3WBBA 1GZVA 1QH1A 5DX1A 3RIEA 4BNYA 1YRYE 4MO9A 4ZDKA 1SHKA 4CL2A 5CM9C 5CT9A 2XI4A 3H83A 4H3SA 4RFSB 1CZLA 1Q1NA 2I4TA 1N5DA 3MJCA 1WSBA 1MJFA 2X3FA 5EQJB 1YZNA 1P39A 2DHRA 1KZHA 4L95C 5BR1A 2JD0A 3CONA 1FSSA 3FVVA 4RCVA 2DM6A 2RJ3A 4KQ2A 4TRNA 3N3AC 3CLRD 4J76A 4KH1A 2B4KA 2Q4EA 3HK2A 1W35A 421PA 1TM5E 3H3JA 4E5NA 3F4KA 2SCUB 3GVHA 1TCUA 4KPGA 4NZMA 4S2UA 4TQ9A 5CNIA 1LF0A 4UHHA 5JD6A 4RF3A 1GFWA 1WCV1 2PKYX 1QTIA 3QVXA 1IBKB 2XJ9A 1QGOA 1KJJA 2IEYA 1OC4A 4J3FA 4KZPA 3SF8B 5H1YA 1M9NA 3V8PA 3Q7QA 4PSKA 4KQFA 2BFNA 4KQHA 1U28A 1ZGAA 2IODA 4YRQA 1V11A 4CKCA 1UPCA 3ZWXA 1EUCA 2E2WA 4G0QA 4AY3A 1B0UA 1MA0A 2IYOA 4GBED 5JV5A 1J22A 3D1VA 3UUGA 3LOUA 4Q1CA 4WJKB 1GDTA 2HRZA 3LUCA 4IGEA 1EP1B 2NADA 1JDZA 4WVFA 2GNOA 2JJQA 1CD5A 1W85B 3HCFA 1DQZA 3UA4A 4D9EA 4V39A 4FHDA 4XCXA 4ZCPA 5A4FS 1Q11A 3VR4H 1OWNA 5BSGA 5CFOA 1XRPA 5FBHA 2DFNA 3O47A 1QF7A 1FMCA 4LWPA 3OH8A 4KR9A 3SZOA 3ZH9B 4KLRA 3SSNA 2WLTA 5HIAA 4CV1A 4AX4A 3GUUA 1CDEA 1NRIA 1DBPA 1II8B 4EHIA 3WGOA 4DJDC 2JZCA 3QUCA 2FSPA 3RW9A 2E4WA 1VRVA 4TS3A 1DC6A 5E1BA 1KVTA 1U2TA 5JC8A 3MXTA 5BXYA 4I1UA 3E18A 5L3VA 4JBNA 2Q7DA 1K9SA 3BFVA 2FWNA 2CV1A 1DB3A 1XA3A 2VSNA 3BC1A 3T5MA 2XLBA 1JU3A 4RQTA 4XOIA 5ECGC 1J0CA 1JLKA 2RIPA 2I4MA 1QIIA 1T4CB 2B5OA 1MNAA 5G02A 2FA9A 4NZZA 4Y8VA 4BVKA 3GJQA 3WP0A 1BEEA 2HQSA 1EVLA 3II6X 4AT1A 4UNSA 2ZT7A 4LYYA 2DYKA 3HDVA 4IPTA 2WD8A 3MF4A 2RHBA 3EA0A 1CS4C 1NFFA 4M1OA 3TLKA 5BNZA 4LK2A 2VDLB 4MWBA 1VBKA 3NRBA 1GVHA 3VH2A 2NXCA 3P1JA 5DU2A 3H6HA 3PYLA 4KBYA 2G67A 1U6IA 1JHVA 4KXQA 5HKKA 3RBAA 2DT5A 1ODTC 2ZB8A 1V6AA 5GJWC 2VPYA 3IVXA 3B53X 3TW0A 2YHBA 1E63A 2ZWPA 3ZBTA 1BTOA 1YQTA 3PEFA 1K8QA 1FDTA 4XVRA 3GJ8A 2FSVA 3U1VA 2XXAA 2FCAA 2HJGA 3K9HA 2CXNA 3GLRA 3SNKA 4D57A 4RTSA 3NAGA 3DWEX 3NAZA 3UCEA 5TF4A 2NUAA 3H5IA 5AKYA 2CV2A 3LQRA 5TMBA 1I4LD 2QUKA 4BX3A 2BEJA 1QQ5A 4FHEA 1GKIA 2PZJA 1ZU4A 2GTIA 5K8IA 1VHJA 1SHZA 4QOIA 3KKPA 2QT1A 3SZLA 2C5GA 4FYIA 3HPRA 3JAWA 4IBOA 3REFA 3NOQA 2PT6A 3U19A 1Y6FA 1FVFA 3GLIE 4F6RB 1EYZA 3W04A 4KTVE 2WFZA 3LDGA 3UAWA 4GOOD 5DBIA 5LZ7A 3BICA 3K1AA 4N7MA 3ZD8A 2W6NA 2P2ZA 2NPOA 3TMAA 1PN3A 3EJWA 2QAIA 4HUQA 5T5QA 2F8TA 1KY5A 5FTLA 1KRWA 1JXOA 3LGAA 2I1WA 4MV4A 4JJ4A 2JA2A 3ESRA 2M1XA 3K1YA 3LA8A 4MHTA 3GGOA 1SOAA 5KI6A 4MP3A 3CTMA 4NBTA 3ZYZA 2P9HA 2R11A 2HPVA 1S7CA 5JNLA 1QJCA 4CL3A 3I3SR 3HKEA 2C7GA 2D7JA 1SD2A 3D7SA 3EZXA 4IV8A 4M9QA 3ZKWB 3QI2A 121PA 1U6JA 5CLQA 2IH4A 1XB2A 2HCFA 3V42A 2WFLA 3U4GA 3B5IA 4K9DA 3SF0A 3UGJA 3ULKA 1HLGA 4PRYA 2WJAA 1AKEA 3BMNA 3MT9A 3PHJA 1JHDA 1AURA 4O2AB 5T6BA 3LZCA 2IPXA 5L51A 2G4LA 2ZSKA 4YRKA 2AXNA 2XTAA 2LP4Y 3W5AA 4W6QA 4QUKA 1HOXA 3RU7A 3I30X 1A77A 3D6VA 1D3AA 2FPGB 4CEJA 4DQVA 4KQXA 1KXJA 3QV2A 1XVAA 3MTQA 3DDSA 3RQIA 1ZD8A 2JI7A 2WAXA 2WUVA 2NSHA 2ZI6A 3C15C 3C3JA 3V8NA 4WZBA 2J0UB 3RC3A 2B69A 2Q8QA 3IFSA 4ER6A 2HC9A 3KQYA 2CEKA 3AX6A 1UBGA 2P9TA 1H05A 1OF1A 1Z34A 2QDKA 1MVNA 3IUBA 3HKCB 2QL5A 5FBQB 1B4DA 2GS9A 3WWCA 5BWOA 4D97A 1U1CA 2APJA 4UBLA 3WLEA 4YS6A 1XNQB 4KO1S 1C1DB 4P84A 4KW7A 4BP3A 3HG7A 4IL5A 1M34B 4AZVA 1B0ZA 4HWTA 4MPRA 4E08A 4ZI5A 4HQ6A 2XUQA 3AWIA 4FGUA 3OQHA 2Q62A 4JX8A 3KPUA 4GP6A 2GZMA 1S2IA 2UKDA 4IHAA 1U2GA 3R7SA 3OIUA 3WIBA 4BTVA 4O59O 1J6UA 1WP9A 3MIIA 4IRUB 1K6IA 1PGPA 2FPLA 3E03A 2RHHA 3K1JA 3O4RA 3U7QA 3EZYA 3KEQA 1W36C 4FMDB 3AO0B 1Z0KA 3B8HA 4FFBA 2PZ8A 5F4ZA 3BH7A 1RM0A 1PTJC 1Y9ZA 1Q3TA 2Y6UA 4RGVA 3RAGA 3VQTA 2O8EB 1CUWA 1KJNA 5DB4A 1VBFA 2RK6A 5CLGA 3ZLTA 2RHJA 2JBWA 2IP4A 1CV2A 1NDUA 2A30A 4PC1A 1Y8CA 1TQ6A 4EW2A 1VL8A 4PXAA 4I4TB 5CRIA 5F52A 4B7UA 4KPEC 4Q4JA 4YQFA 4M49A 3KJEA 2W58A 1TU0A 4X1IB 2O0LA 3K0FB 5KYWA 3ILHA 4Q21A 2PMFA 4EJ0A 2IPLA 3EXIA 3B9RA 3DBLB 3K5PA 3WLJA 3F5MA 4F91B 2IZZA 3P4UA 4TKVA 2ZJZA 4LE2A 1NUPA 3NIFB 4CQJA 2GLTA 3SDSA 2R7MA 2PG3A 2VHZA 4QU9A 3UM9A 4R8KA 4ACBA 5BMVA 1JX6A 1KYZA 1IMJA 1M3SA 2H29A 3KD3A 4OH7A 3R20A 3QWAA 1BU5A 4GLBA 3HLTA 5AJXA 3T7AA 4RDXA 1ZW1A 3UK1A 3SG0A 4HPXB 3LCCA 1JIKA 3HSSA 1JQAA 3BOSA 3O8OB 3OZAA 2G8LA 3OLYA 3EPPA 3A25A 3HDGA 3LC1O 4QECA 1J8DA 4B3JA 4BAZA 2GT1A 2VHCA 2WPNA 3G2NA 5KNDH 1YB6A 3ER9A 2NAFA 4C9BA 4QU5A 5ENVA 1BCRB 1UDWA 5CK5A 2GKOA 2GD2A 4CIDA 4Q9KA 1JVBA 1OWPA 4D82A 4JLSA 4ENTA 3GRVA 4MQ4A 4MYDA 4B6SA 3A2KA 1TTQB 2XQVA 1WF6A 1QRRA 1ZRHA 1VE1A 3F9IA 1NMEA 1QRAA 4FJ0A 4LRUA 4CBVA 4NJMB 1X7YB 3KD2A 3Q4GA 4OJNA 2C8KA 1BH6A 1TF2A 3MWLA 5DTJA 5JD4A 4NXNB 2WSBA 1CY8A 1JA1A 1BN7A 1K1EA 3LK7A 3LX4A 4L4RA 1JAYA 1JG2A 1VHTA 3DQQA 4HX2A 1I0IA 3ZVRA 1SVMA 1U98A 2NO1A 2QVXX 1I1OA 1OQAA 2EJWA 4RAQA 3T3GA 4RA9B 1N0WA 4RBNA 2OD9A 3WLOA 4BLPA 1UJBA 5DMHA 2REXB 1E7MA 1Y1KE 3LWDA 3G5TA 4RS3A 3EGVA 4Y2QA 5EOVA 4C05A 2P8JA 3ZD7A 2KMLA 1ORRA 1ZGHA 3AC0A 2YCBA 1BQ4A 3U3XA 5HJ5A 3DVQX 4KN5A 3OETA 2XIQA 4IXWA 1XTJA 1YULA 4XH9B 4OXXA 3PX7A 4LC1A 2WTUA 1QZTA 3UT0A 3HY4A 3QU7A 4UFOA 3MSXA 1NW7A 1EINA 2OO5C 5IU6A 1PK9A 4MPDA 3MAJA 4UMEA 4ZRNA 1UCFA 1D8AA 3OP4A 1TUEA 1KZYC 4UEWA 2CMFA 4MUMA 5SICE 3IVCA 2AF4C 4HDRB 4KAFA 4OIFA 1S2DA 3AEXA 4R8SA 1SCBA 2WM2A 4IIVA 4A3SA 4KRFA 3E3LA 3AGQA 1H93A 2FKNA 1XTBA 4QWMA 5AI8A 4Q6WA 4CG3A 5JANA 2CY0A 5TGDA 1RDFA 5IM4A 5A5DA 3EOBI 4JI1B 1WXHA 3KKNA 2PL9A 4LCBA 4MHSA 5AJZA 4F5WA 2KPOA 1L4HA 4AS3A 1YC2A 2I8AA 1TQDA 3E6AA 3H2IA 4I6EA 2Q41A 4UVEA 4RS4A 1UMBA 2ZS7A 1QH8A 4NV0A 4TMYA 1KOLA 4ZI7A 1GG5A 4FKZA 4CIVA 3VZSA 2IS6A 5IC4A 1W4BA 4KV9A 1X19A 4QAQA 1W5BA 2REQA 1FXWA 1FOEB 2FP4A 2HHLA 2WY2D 4JC8A 3TL3A 5CDUA 3KOZA 3EBLA 1T3ZA 1Q92A 3MVEA 2AJBA 3HB5X 4G0NA 1VE9A 3DZIA 2HWUA 1M6VB 4LJ7A 4NFSA 3WLNA 1LPNA 2AMVA 4ARCA 1LZKA 2ZIEA 1GYRA 3FUXA 2YHIA 2O8BA 2ZT6A 4REQB 5DWDA 3FNFA 4TYNA 1AMUA 1NQWA 3NJRA 1E9CA 1P2SA 3WMRA 2VI5A 2GF2A 1Y6JA 3P2IA 1ZESA 2BTQA 3D8TA 3ZZ1A 2XW6A 4YCNA 4EG1A 3L43A 5DBEX 3NVMB 3TVTA 1XN1A 2X8LA 3V2IA 4YTEA 3TM5A 1X80B 1IE3A 2QVZX 4GPBA 2E1PA 4XFKA 1M5TA 4GHWA 1O96B 1VSBA 1H2BA 4BP9A 3CVOA 2O2EA 3GFGA 3H2ZA 2W4QA 5B7QA 3RBXA 5CDGA 4PAOA 1TZ2A 4IVPA 1S1MA 2IBSA 2Q5QA 2WWFA 1OC2A 1WDLA 4YJ3A 5CH8A 1JILA 2EGHA 2ZWOA 2Q2WA 4MWSA 1L9XA 3LBYA 1W1IA 4LFCB 4Z5XA 3COYA 5CDTA 3ZCXA 5KQLA 2G6BA 1HMYA 4Q19A 4CIXA 5FADA 4Z4FA 3I37X 3C7AA 1C9KA 1V48A 2R87A 3G2KA 2HRDA 4CYMA 3R8XA 2V3CC 3WL5A 3SJ7A 4EY3A 4DB2A 3SE0A 5I9SA 4ZDIA 2QU7A 4QGSA 1SXIA 4EA9A 1JZSA 3BWCA 4Z53A 2BH2A 4BP1A 1JEAA 1KSGA 1X7WB 2OM2A 4KXNA 3PFHA 1O7JA 2QLJA 4G0YA 3FZQA 1XDGA 3GLKA 2HI0A 3OA2A 4ALKA 1EDZA 3CVWA 3QWBA 1R18A 2G63A 1PQPA 5C1DA 4OLBA 5IARA 3VISA 3H4MA 2XQFA 3R9XA 5THKA 3BIXA 5FFNA 4BNVA 5K0EA 3DLCA 3FPAA 3NUQA 1A5SB 2JGAA 1XZNA 3OESA 3VU0A 2G09A 4QU8A 2R00C 5AXAA 2FTKE 1QP7A 5KPDA 4WUVA 5AK6A 1NLFA 2D3WA 2RHTA 2XJ4A 3TLCA 1F5SA 2IXGA 4BZWA 4DG5A 5A04A 2HMSA 2WF8A 2WT9A 4CHGA 1WULS 1DC4A 4HGQA 2C8JA 2YHSA 3TLZA 3L8CA 3S2UA 4TV8B 3TSWA 1JECA 3PJFA 1R0BA 5B2ZA 1OX4B 4MUFA 3FKSA 5ERXA 3VNBA 4TWIA 3D4OA 2I6QA 3AEKB 3CYFA 3RASA 4WNAA 3S3TA 1U7DA 4B80A 3KTOA 4EVIA 5LXTA 3THWA 3I6QA 4KE8A 4LF4B 3MTEA 1XP8A 3M1IA 5I4CA 4H59A 1FU4A 5ALYA 2Z2JA 5E7MA 3ZWOA 2G4VA 2DFLA 2OECA 3SKYA 1G5QA 4M0PA 4PZ9A 3ONFA 1IVNA 3BULA 4RTNA 4ER7A 1G20B 1EFCA 2IELA 4GS5A 3CRNA 1PJ2A 1C7RA 2GHRA 4HRXA 3CF6R 2C61A 4IDHA 5TC4A 2BSQA 4ESVA 4MA0A 4JKOA 2XPCA 1NXWA 1NJGA 3SYLA 2D5AA 2KW5A 3N2EA 3SC2A 3JSXA 2PVPA 4ZQHA 4MK4A 2FJPA 2Q5HA 1ZJWA 1OZFA 2EP7A 2PRYA 3AI2A 5FBWB 1D4FA 2J9FB 3EYAA 5LB4A 2VJPA 2ZYGA 2R6CA 3A36A 3N87A 4J03A 2R3SA 4RVUA 1KO8A 3CZMA 4X1OA 3OLCX 1KS2A 1PKXA 1XQ9A 2BFFA 2C4NA 4WNYA 3ZDYB 4KXLA 1RS0A 2BZSA 1NU8A 4DBLE 5JR3A 1UFQA 1KVRA 3R8FA 5T64A 1PT5A 3JV7A 5C9ZA 2FWRA 3QX8A 1GPBA 2QTRA 1T0JB 3PPVA 4OSEA 4WZAA 4Q9JA 5FNVA 3Q72A 3DAGA 3QPVA 1ZJ6A 3K5IA 5CHEA 4L8YA 1VFPA 2HLDD 2ZB3A 1TRHA 4RD2A 5L53A 5D5HA 3HYNA 5JRZA 3AF6A 4AJ4A 1Z4JA 3MTGA 1RI1A 4GO1A 1RWOA 4GX2A 2ZUBA 4W5RA 3PX2A 3MTDA 3CNOA 1HRDA 3BE5A 4Q4LA 1P29A 1V7ZA 4M54A 4O4LF 5FP0A 4EDHA 4UE6A 3BRWD 1DUIA 2B5WA 2BIFA 1H0HA 3DCIA 2DHEA 3NAQA 1OWMA 3OCUA 1CJTC 2GBIA 2Z4TA 3T12A 4UCWA 3CH5A 1CEYA 1DQSA 3M6XA 3Q87B 3TXYA 4L72A 4O2LA 2P9CA 3UWOA 1ODIA 1ECLA 4DANA 4CLRA 3T1TA 1XMOB 1F7UA 5EYPB 2QX8A 4E1AA 1E6UA 4AMVA 5KJFA 4B81A 2BDUA 4V0LA 3YASA 1Y1RA 2YMQA 5COAA 1IIBA 3LXXA 2VF7A 1PR1A 2FSFA 1TJNA 3LHSA 1QHSA 4A0SA 5JSHA 2GBLC 3QEOA 6LDHA 2OWEA 5J23A 1JR3E 1NR1A 4GBMA 5FA8A 2WKPA 1T9GR 4D0SA 4FFSA 3GLTA 2VAWA 5AW1A 3EF1A 3IJEB 2ZDGA 1GLNA 2FWPA 2E7ZA 4HEA6 1IZ8A 1P1IA 2E4YA 3BH6A 2GZRA 1AZWA 2HDNB 3M1AA 1FQKA 4EG7A 3I9V1 3D1JA 2YCLA 4CM9A 1SXJC 5JZBA 1G60A 4HTFA 4I81A 5EJMA 4AKSA 2W2QA 2WIJA 3AUKA 3IVMA 3BMOA 1KMHB 2QF7A 5AKJA 2QJWA 2ZI4A 2IHBA 1T2AA 4YP1A 1UPXA 3FHTA 2AMYA 3AW9A 2Q45A 3NS7A 4R69A 1BQ3A 4E1BA 1H22A 3CLUC 4BE9A 3BORA 4S35A 2C3PA 3DOHA 1ZVMA 3U3DA 3BCSA 3E0XA 1ESEA 2OQVA 5BN4A 1OBCA 2JBHA 3G2HA 3PQCA 1JS1X 2Z8ZA 3GLGA 3L8GA 3NXKA 2C00A 1YVDA 3GLHB 1E1CB 3Q8MA 4GQAA 1U7OA 3IEUA 3WX0A 2FK8A 2YY7A 3KETA 1T10A 2QNBA 4WIAA 1XP5A 3L0PA 1FFEA 1WUJS 4G2NA 4GMKA 1AS2A 4H27A 2JAHA 2OCIA 1DX9A 3I58A 3KOMA 2VXBA 3DV2A 5EIHA 3Q7PA 4HNAB 4FI3C 4NCAA 2GN2A 1T0BA 3DV0B 1I0LA 1CQJA 5FOUA 3TXXA 1YBMA 1KPGA 4CR8A 4P4GA 1AK2A 3C3BA 4EB8A 4EI7A 2X76A 1ZGCA 4FHGA 4MYSA 5J63A 3V46A 1W4LA 3JPYA 3AL2A 1D2CA 3ET5A 4DMHA 1TJ5A 4RHEA 2FW7A 4CE6A 5FOWA 3K70D 5IW8A 2RKBA 4WMLA 2PUAA 1W4ZA 3TDNA 2AJ8A 4OJTA 1HEYA 1NDHA 2QBYB 4IJWA 4BQNA 4QVGA 1V9CA 2VSQA 1L5HA 1DTWB 5BORA 4ZTBA 1UJ5A 1Q84A 3OUZA 2ISSD 2J6BA 2QW8A 3HLYA 4UMDA 1GG9A 2J67A 3LL4A 5IK2D 3LO5A 3PRYA 4XQEA 4LZNA 3NORA 1I24A 1N5KA 1SCNE 2BN4A 4EATA 1Q14A 5AHOA 2H48A 1UDCA 2ZIXA 3LIPA 4KFRA 3I2GA 1OPRA 5E0KB 4FBGA 1U0BB 1IPFA 4BC1A 1MXHA 4FDMA 1L4FA 1DEAA 1TUBB 1LK5A 3AFOA 3KWLA 4N01A 4NJOA 4O4IB 4A8JB 2ZS9A 1QVVA 2P6UA 2ONZA 4TTSA 4IRMA 5L3RA 3NYRA 5JTUA 4D8TA 2JGDA 4XD7D 4DPMA 1HLDA 3B78A 4WADA 5FUWA 5CVJA 5ES4B 1IQ0A 2W90A 1JFFB 3QVUA 1DC5A 3IXMA 3R23A 4IFIA 5DH9A 4N1AA 3TQRA 5KVAA 1S2MA 1U1IA 2OYRA 2ZWAA 1Y8QB 3AONB 2NXJA 4OXNA 5D1HA 4G4IA 2P68A 3RYCB 3KQKA 3ILSA 4DLLA 1CLEA 4PSVA 4B3BA 2HLDA 3QJ5A 5AOBA 2Y1GA 1M2JA 2LBPA 3R7WA 1D0IA 1NAIA 1FP1D 4NV3A 2D1RA 4Q1VA 4XCVA 2C9DA 3WK7A 2FY8A 4D26A 1FYDA 1T35A 1HNZB 4B46A 2JLWA 3OZEA 1CUYA 1M6WA 5G1PA 2PL5A 3IQXA 3OT1B 4X94A 3FA2A 3IUNA 1LD3A 3DE1X 4PPYA 5EWLB 2J3IA 2SKCA 4NPCA 3K35A 4CQMB 5CEEA 5JRJA 2QSJA 3ANNA 4TROA 3GEEA 1RM5A 2B0CA 2W83A 3HR7A 3N53A 4JR2A 1G8FA 2G1JA 1Q1ZA 4KXXA 2NO5A 3DCNA 1NOJA 1TK3A 3RVDA 4DWOA 1V5WA 3DYBA 5B7PA 3ACBA 1X7ZA 3B6JA 4N0PA 2PCLA 3I73A 4NMLA 4C6HA 3A9VA 2Z08A 2QTGA 3ZU6A 2OGZA 3VPXA 3OKAA 5JYDA 3WBKA 1EG7A 2YTZA 1CR6A 4LV8B 2QROA 2RC5A 4YLEA 3SI7A 2FEWB 4P0TA 4TUYB 1T4GA 5K8CA 1TM1E 4YRTA 3ZCRA 1K88A 1RR6A 3OFKA 2HJ9A 4C6TA 3PTAA 2P0AA 3B2NA 3F46A 3SYRA 3VYWA 1AIPA 4LCEA 3HPQA 3DOEA 3TBKA 3NATA 3U40A 3KQWA 1T6ZA 1LLCA 1X14A 4RDIA 3WGHA 3N6RA 2A0FA 3DF7A 1SIBE 1KE1A 4YAOA 2C3YA 2JLSA 3TIIA 4YROA 2CCJA 3EZ2A 2JFOA 3KT3A 2PMCA 1U4OA 2HN9A 3L0ZA 3NGLA 3PE4A 1MX5A 3BWXA 3VUFA 3OIGA 4P35A 2VQFB 2AFHE 1E2BA 2LTAA 2PV7A 2FN4A 4G4GA 1RBQA 1UMDA 5EGNA 5MGNA 4OI2A 4RIIA 1VQ1A 2WSYB 4WI1A 4D6YA 1AXEA 1IJEA 3Q11A 1H2RS 1A95A 3LRPA 3D2LA 3K0HA 4DEYA 4HUJA 1BWQA 3A0UA 3HBJA 4QTUB 1ZICA 3GUYA 1PJBA 4FEGA 3HN2A 2ECFA 3UFXB 3L7OA 4DR2B 4MI6A 4UTNA 4GEKA 1RVDA 1VMDA 2H3EA 2O4CA 4L74A 3CRQA 5BSRA 5A7FA 5JDIA 3I6MA 3KL2A 5JH7F 4D92A 1ZWKA 1TW2A 3KKLA 1JQBA 4C0SA 5AKXA 1QQTA 1HNNA 3OZGA 3HWX1 4GZLA 3EODA 1VCOA 3VKUA 3SZUA 4ARIA 3ABIA 3QW2A 5ARCA 1H5NA 1LU9A 2PXXA 1MVOA 3KQUA 1HFKA 3FGPA 4J3JA 3S55A 5JTTA 4EI8A 3R41A 3X1JA 2XV1A 3AJEA 4LDRA 4O02B 5AJWA 3GFVA 4HQFA 2R7LA 1WPQA 1QOPB 4CTKA 3GY0A 2DOKA 2JKZA 5FEMA 1QMGA 3UB2A 4W5OA 3SQWA 3V1NA 5JS1A 1JUDA 1YNOA 2DWCA 4CRWB 1YVPA 3CX8A 2QHXA 2ZYDA 2YNMC 2D5LA 1P2GA 5IZCC 4WA8A 2RMKA 4I19A 1T0IA 3PQ7A 1Q0ZA 10MHA 4FHFA 2FR8A 4YI3A 4DIUA 2PNFA 4XD7A 4GLLA 2I2AA 2ZCUA 3GXBA 3D8SA 1U9JA 2H2FA 1U1EA 1BE0A 2P7IA 1JH8A 2NZJA 2JZOA 3GFFA 2ZE7A 4K6GA 3AVWA 4MIYA 5I7WA 1F4VA 4H1TA 5LLSA 5EJIA 1R9MA 2JATA 2JKYA 2ZG6A 1T8PA 3CN7A 4H7KA 4GM0A 3QYFA 4HWKA 4P83A 4BTEA 2A9JA 4FD2A 1MJHA 2ZUSA 2JS7A 4QYIA 2CD9A 5DNYB 2HMYB 2YYZA 3DMHA 3OCYA 3W0LB 1DS6A 4O0LA 1ISIA 2H07A 3N8HA 1EXWA 1K8YB 3I04M 2ECPA 5TLSA 1E6CA 3INYA 4EABA 4CKWA 3PXCX 2I3DA 4DIBA 4DC1A 2WB2A 1YIDA 1BX1A 1FP7A 2IZOA 2WTNA 3D7MA 2B7BA 4UQOA 3OIDA 4BC0A 4RM2A 1BJKA 2GKGA 2PD4A 5AJTA 1VECA 3FMVA 4UDOA 4WLUA 5AR1A 2AFVA 4PTZA 4BE4A 4DLZA 3M33A 3BWVA 1OAOC 4EENA 4G56A 3ETLA 3BRSA 1RIFA 3BHJA 2IE8A 3AIKA 1I3OA 1KIAA 4FFMA 2OK8A 4TSFD 4X1KB 3NDBB 2DPHA 2QTMA 3D6MA 1K6XA 2OB2A 3BSSA 4BNNA 3NYQA 1GZDA 4NU0A 4DLAA 2ZZNA 1S2OA 1CZRA 1QHNA 3WWYA 4N0DA 4GF5A 2HBZA 2Y1FA 3HGTA 2CB9A 4ABYA 1H4QA 3GN1A 3SIXA 5LIPA 3NC4A 3LYLA 3BQ9A 3RKRA 4HX5A 1YB7A 1P4RA 3A3OA 3T4UA 4ESOA 1MAAA 4ZVLA 2RHWA 2ASEA 2V59A 1GQQA 4FNAA 1Q0PA 3EXHC 2XVZA 4M8KA 2XB6A 1VG0B 1HRKA 3QPDA 5THXA 2VRCD 1PQ4A 3A1FA 3PQ8A 5AXBA 2ZXUA 2FH5B 2GASA 4C4ZA 1KARA 2QP3A 4ZZIA 4Z0HO 3C43A 4HEHA 4ZAYA 1YS9A 3V8BA 4KR2A 4Q47A 4AFNA 3T35A 5LIRA 1L2TA 4FYHA 3SZ3A 3MWEA 1JHZA 4RLHA 3P26A 1XV5A 1U0SY 3IAS6 5B57C 2EP8A 4D8YA 4BU0A 3GEIA 4B85A 3GPIA 3LRTA 1U2EA 1M1NB 1T5DX 2ORYA 4JU9A 1WMFA 1KJWA 1OU4A 3FJOA 5DLYA 5EIFA 4H4EA 4DSAA 2C7QA 2BGUA 2DG2A 2Q28A 3F97A 5H59A 1HETA 2FJUA 2W2TA 5ULLA 3V8QA 5J2UF 5EIXA 4YEDA 1WBJB 2Y1CA 4P31A 5F3DA 2PWPA 1Z3CA 1ZGBA 1OV6A 3OJFA 4G07A 4PR3A 1ILEA 1KAHA 1VLLA 3ER6A 3QKSA 3BGVA 3ZZTA 3ZHSA 5EWMB 4Y6SA 1NT2A 1LDBA 4HG2A 3H2KA 1JEOA 3RF7A 3VR5D 4IZ6A 4HYYA 3P0JA 3GR6A 1UBHS 2H2AA 1B73A 4BPBA 4NTZA 3O8BA 1H2AS 1IHOA 1DRUA 2GCOB 3D3WA 3OQIB 4IH9A 4U7GA 4XQ0A 1JIXA 4Y6RA 4BV3A 3UJ3X 1GZHB 1JHOA 5HGXA 3ZHZA 4Z2YA 2WG2A 2VXCA 1BIFA 4BQQA 1NU6A 3V4FA 4DHEA 2PZLA 2MCFA 3D8BA 5FUQA 2EBHX 1N2IA 5SY9A 4MINA 1KL7A 1WMAA 2J4DA 4MKIA 2YICA 2ZP1A 3LVBA 3A4VA 3ITDA 2FQQA 2ZYUX 1Y42X 3QF4A 3HXQA 2L2QA 3H3XA 1W46A 4RK6A 4B48A 5IJZA 2PFGA 1YZLA 4S1TA 4BMOB 3ZQ4A 2QR2A 4R8MA 4EEKA 1BW9B 1H1TA 1LVUA 5GM2A 1PZHA 1U3GA 4X1YB 4EZEA 3G82C 2UV8A 3KXPA 1TK2A 3R1IA 1IULA 2FG7C 2VF8A 3ONVA 5TJ9A 1F0YA 2HQRA 2ZULA 1OPXA 2YC4C 3DXFA 2VHVA 4UPDA 2QX9A 1WP4A 2VJQA 3R5KA 1T2CA 4R2HA 1DINA 5D7NA 3H0KA 4MUHA 3VZDA 4HNUA 3GHHA 2O3QA 3HB1A 3A9RA 4YMTA 2R84A 3DFMA 2JGNA 3M6UA 5E4FA 5FTWA 4F2HA 2CJYA 3DL0A 3O75A 2VXOA 4JJGA 3WNBA 3DTVD 4HQ0A 4BJHB 4C7JA 3GMDA 3NHWA 3D6AA 3HKBB 1N78A 5KU7A 4QYSA 3UKDA 2DFTA 3U7IA 1UOPA 1TE2A 2HMWA 4PPFA 3EG9B 2XQKA 1YK0A 4WACA 1U31A 1QDEA 1NPTO 1VMAA 1VXOA 3WRWA 3KSUA 4L4ZA 2JARA 1EFDN 1MABA 1OFVA 2YV4A 1JQJC 4R2KA 3W9UA 3KR9A 4K6OA 3A58B 4G4JA 1WZ2A 1UDXA 2A5JA 4OHYA 4YY3B 1SC9A 5CAEB 3TZ6A 2F7SA 5P8WA 3VNSA 3KOUA 4UTRA 2GM3A 2MINB 2O3UA 2J59A 3EH2A 3VSAA 1VSQA 4RIHA 1SXQA 3AVOA 2UU9B 1PEAA 2WKQA 3KVNA 1K68A 3H0EA 2ZVQX 1BX0A 1VLJA 5BV1A 3TBFA 4TSFA 5EZ6B 1OYYA 3ZQUA 2NTVA 4FZRA 4MROA 4ZDJA 5HE8A 1F2DA 3DUFB 2EEZA 4C3ZA 4F7DA 4KGZA 1W94A 2Z30A 5D86A 1T43A 2BR5A 4POAA 3WBFA 1H8HA 1W7AA 1O5IA 1K6EA 3IT0A 4ZC8A 1YGPA 4BNTA 2XNDD 1DZ3A 4YR9A 1RZVA 3W7BA 4LOIA 1L5OA 1K0UA 1SVUA 1DADA 1WX1A 3AY3A 4XGRA 5FWYB 1C4KA 1LTKA 2XKBA 4G0ZA 4E6PA 4EG3A 1OLSA 4HOYA 5F7ZA 2RH5A 1F8UA 3OCJA 4U3JB 5EZYA 1J07A 3K3PA 1UKBA 2GAJA 5G3YA 4ROTA 2O5VA 3F49S 1WVIA 3PA6A 5T4BA 2VRCA 3PR1A 3UWPA 4ZHQB 2JIPA 1IQRA 3RRJA 4OHUA 1E2UA 5IWCA 5LDHA 1YDFA 3KSBC 4KREA 3RWOA 3ITNA 3LC7O 1E2EA 1A4RA 3NP9A 3IP6A 2K7ZA 1CB7A 2Y1KA 3E2MA 4PCVA 5FPTA 1BCSB 4DUGD 3SX2A 3TVYA 1A8HA 1JR4A 3AG5A 2ATIA 2ONJA 3T4XA 1O97D 3BGWA 4YJFB 2C54A 5HS6A 5A4JA 2BFCB 1PT8A 1JEQB 1U65A 1XJ5A 2JIOA 3EH1A 3I23A 2JRCA 5C52B 4Y98A 1FJGB 3VKHA 2CF5A 1Q1EA 3LP6A 1V5IA 2HHAA 4QRHA 3VPFA 5EJ8A 3DZBA 4J4TA 5DDIP 2A0YA 1TD9A 3KVYA 2I66A 4FEAA 3VR5A 3CPEA 3GVCA 1XCLA 3DDZX 3WB2A 4ZI2A 5EMJA 2OCGA 4WWHA 5HK8A 1QYWA 1S9HA 2C5EA 4O63O 4WPGA 4GH5A 4OL0A 2YBEA 2QQGA 4PC7A 3ZDBA 3SEQA 3FXAA 2VSYA 2WU0A 4KX5A 1XZCA 2EZTA 4WZBE 4HDSA 1F20A 2X8JB 1OJ7A 1Z8FA 2R7AA 2R6HA 3AZPA 5FWNA 4P32A 3N70A 5JEEA 3LXUX 1HO3A 5T7BA 1NVUQ 2DWPA 2ZRCA 3CX4A 3JVUA 1H65A 1RQNA 4TV9F 5AJUA 4G0UA 1CUIA 3A7EA 3EIEA 3SM3A 3FSEA 3WK9A 4YMVA 4RW0A 3WIEA 3G2IA 2NU6B 4W8GA 4LI3X 1YWGO 4EQ6B 1AO3A 3VOTA 1L7PA 4MQ6A 4EGCB 2HA0A 1QWOA 1YUMA 2KLBA 2ZWVA 1WKCA 3AJ8A 5EJGA 2CHQA 3UB4A 1XZBA 3UK7A 4BBZA 3HCEA 4XPIA 2FOXA 1CIJA 4M7PA 2V0GA 1I51A 4ND6A 1TYDE 4NFYA 2C58A 1V5EA 1PNOA 3DDCA 1VGVA 2XMCA 3LLMA 4QU0A 4TXLA 2G0AA 1MNQA 5HQJA 3M6IA 5JD5A 1N92A 1NBOA 3G9ZA 1TYCA 2K5UA 5CB4F 4YASA 1NYLA 2WUDA 4CKBB 4EAQA 1GFSA 1X7XB 4MQBA 4LZAA 5K1ZA 2YWCA 4PLVA 3M3DA 4MTCA 3WDLA 2ODTX 3LX6A 3DZCA 1ZCFA 4AZWA 4FEYA 1MC4A 4DMKA 2ZTMA 1V8ZA 1SQ6A 2OLKA 1U2PA 2OENG 2YIDA 3EUAA 4B9EA 2QYHA 1G8AA 2V7QD 2C88A 4Z1MD 1T9BA 3HV0A 4LEIA 3SIWA 5A0FA 2Y0CA 1CY6A 5SZHB 2W2VA 1S4MA 3JQRA 4OCZA 1G41A 1NAHA 3I05A 4HDQB 4MPTA 5C8YA 3UCFA 3RTBA 3L40A 3L6RA 5DKFA 3IBYA 2ZIWB 3KOYA 3K15A 3HVUA 1A9OA 3FCUB 5AHRA 1UWVA 1JE1A 3ETGA 2XNDA 4B7ZA 4K6HA 4RGBA 2C82A 4A2CA 3H4VA 4OBXA 4HFMA 5IVDA 3ZWQA 1FFAA 3O3OB 1QO7A 3WK6A 1RLJA 1DBVO 4Z7JA 4D0LB 4PEVA 3RUPA 4BFSA 3JALA 3JSAA 4ZYYA 5C46F 1OTYA 3PEYA 5TDHA 5K3CA 3AVQA 3TSYA 3CY6A 3HN7A 1T8RA 2FN7A 4BWGA 5B7GA 3IDZA 1XAIA 5F9HA 2B35A 2ZBVA 3ED5A 4A6EA 3S5JA 1G4AE 3FNBA 2C9BA 1NBHA 1NVGA 3LX5A 1JMVA 2FPUA 1UXGA 1X8JA 3I2FA 4X8OA 4BGUA 4G9BA 4AKEA