3JQ7B

Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor (nadp+) and inhibitor 6-phenylpteridine-2,4,7-triamine (dx2)
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
267
structure length
246
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVKTVETQVAELIGTNAIAPFLLTMSFAQRQNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pteridine reductase 1
publication title Structure-based design of pteridine reductase inhibitors targeting african sleeping sickness and the leishmaniases.
pubmed doi rcsb
source organism Trypanosoma brucei
molecule tags Oxidoreductase
total genus 94
structure length 246
sequence length 267
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2009-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3jq7B00
5JW6A 2X9VA 3RC2A 3RC1A 4XQ9A 2HMWA 1U3WA 1YQXA 4QTZA 2W90A 4CV1A 3ON5A 1D7OA 2BHLA 5A3VA 1U1IA 5HRUA 1GZ6A 1RWBA 1ONOA 1PJ3A 3ZWAA 1F8GA 2WD8A 1ISGA 5FYDA 3DEYX 4RF3A 3EZYA 1LSOA 3K92A 2HMTA 5L4NA 3UVEA 4WLVA 1FDTA 1FDUA 3NT5A 1HZZA 1H2HA 5IN5A 1JTVA 4B7UA 5CG2A 4I8XA 1FDSA 2VQ3A 3TL3A 4W4TA 2Q4EA 1JDJA 3ST7A 4HNHA 4EEZA 3GRPA 2PV7A 3RUDA 3B1JA 4BNUA 1U3TA 5G4KA 5H81A 2NSDA 4JBGA 4WLFA 1R4MA 2EG9A 2Y1OA 3QQPA 2Q4BA 2NVBA 4HFMA 4MIEA 4RQTA 4CL3A 1DRVA 2AQIA 1A7KA 1YB5A 2I3GA 1N92A 1PZFA 1MX3A 1KVSA 2E82A 2O4UX 2VTEA 3UH1A 2Z1MA 4CR7A 3JQGA 4R54A 3WYEA 2CVZA 1GU7A 3SJUA 4BNLA 1E3EA 3MJCA 4J2HA 2B4RO 3AUSA 2QYTA 4A27A 4AJKA 3LZ6A 1WDLA 3GG2A 1R12A 1LA2A 3I6IA 2J5KA 4JX8A 1E1NA 1I32A 4D0SA 1OMOA 2Y1CA 3BMOA 4M55A 4ZD6A 5KJFA 4F3YA 1X13A 1DPGA 3OJOA 4J4HA 1JAXA 2SCUA 5ENDA 1NM5A 2JHFA 4JGBA 4J91A 4GX0A 4P22A 3ZU2A 1GUFA 4DYDA 1M67A 5CHEA 4Q9NA 3P19A 3RKUA 2JFFA 4GX1A 4DBVO 3IS3A 1U9JA 1GPDG 1NAIA 3FNEA 4EJ0A 1A71A 1W8DA 4ESOA 3H9QA 3S2FA 2J6IA 2P9EA 1UZNA 2YHIB 3WGHA 4CMEA 4CM3A 2RHRA 4A10A 1DOHA 1I36A 1ZSYA 2CUKA 2D0IA 1HETA 3HFGA 4Q3EA 3O26A 2X23A 4M87A 5ITWA 4GKBA 4DBZA 1LTHR 1K0UA 4INAA 1SZJG 2X5KO 3FTPA 3Q1LA 1UXIA 2GPTA 2IEDA 3JQAD 3U3XA 4GWKA 3WGTA 3WGIA 4RGBA 3ABIA 1MP0A 1R4NB 4RPKA 5C37A 1A9YA 1EVIA 4NJMB 2WE7A 1W4ZA 3Q2IA 2I76A 1K6XA 3C1OA 2YW9A 1K6JA 2FPIA 2QW8A 4RLHA 3OQBA 2O3UA 1CIVA 3OEYA 4RVUA 1NYTA 3TF5A 4FJ0A 3RBZA 2O3QA 4YTEA 2AQ8A 1T2EA 1ISFA 3JD3A 4HX5A 1DLJA 2X0IA 3B1FA 2AMFA 1ZCJA 4DC1A 1PJSA 1XU7A 3H9UA 5T6BA 1YOVB 1XCBA 2O48X 3L4SO 1Y9EA 3D3WA 1SO8A 4FOSA 5DOZA 1FK8A 3DOCA 3UHAA 1PJ2A 2NLOA 4IUYA 1SNYA 3ZU3A 1ZK0A 3BMNA 3N74A 3OFSA 3OJ0A 1T4BA 4N5MA 1JWBB 4RQUA 3A28A 4AJ4A 4F6LA 1V6AA 4J7CA 4J9UE 3PLRA 3LLSA 3ZWVA 4E2ZA 1WVGA 2QG4A 3SBOA 3DOOA 5JC1A 4Q39A 1VKNA 4CM9A 5COBA 3D3EA 3FRJA 1PGNA 3NDRA 3PQFA 4TRNA 1EFLA 4BNTA 4GX5A 1GEEA 4WNIA 3GVXA 1DJNA 3EVTA 4E5YA 2I65A 3FF4A 4JXKA 1TB4A 3AM5A 3C7CB 3GDGA 4YQYA 4MVJF 1GZ4A 1M6HA 2VYVD 3RJ9A 3ZNQA 3K30A 5IDQA 1R16A 4YACA 5I7EA 3V2GA 2NU8A 3D4OA 3NAQA 5JCJA 1KS9A 1VJ0A 2B4TO 2A9FA 1WXDA 2CDBA 5ITVA 2OO5A 1Q0LA 4YJHB 2NUAA 3O8QB 3FPCA 4DPMA 1ISJA 3BHIA 3HDYA 3WLFA 5T8KA 2HU2A 3H2SA 3HUDA 3WSWA 3O03A 2VYND 4R68A 3PFWO 3B70A 2NWQA 1ZK4A 2J5QA 1MC4A 4BKOA 3NUGA 4B3JA 4CV2A 4CR8A 3PK0A 3JQ8A 2D5AA 4ZVVA 5JPIA 2YJZA 2NQ8A 1DO8A 1P1RA 1AE1A 2AW5A 2VWQA 3GNQA 1YS4A 4B4UA 5C3MA 3N58A 2OL4A 1C1DB 3K8ZA 5C7OO 3ANLA 4I5GA 4JBHA 3S1LA 1VSVA 3AI2A 3I83A 2Y0DA 3D64A 5KJ1A 5TRTA 1DJQA 4TSKA 3L6DA 5CFZA 4JN6B 1HL3A 1J6UA 5EINA 4AJLA 4EZBA 2EP7A 1E3WA 4CPDA 3BMCA 2YDYA 4OMUA 3U49A 3WLEA 3L6OO 2V6BA 3RBXA 4ALIA 4U7WA 2DT5A 4AL4A 4BKQA 5L45A 4L9RA 2JD0A 4WUVA 3D1LA 3DBLA 3SC6A 4AFNA 4XCVA 2ZB8A 4XZ3A 1PS9A 2D3TA 2J3JA 4OOFA 4W99A 3V1YA 1P1IA 2Q49A 3RFVA 1H6CA 4OIMA 3EK2A 4G5HA 3JYLA 1ONNA 2ZTUA 3IUPA 3Q9NA 2D8AA 3QVTA 1H94A 4IIVA 3RU9A 5A9SB 1O8CA 2H9IA 3DAFA 5JFOA 3NGXA 3KYCA 3PZBA 4XYEA 2C7VA 1XHLA 3EW7A 1S6YA 1D1SA 4DREA 4Z3DA 3T4EA 1QR6A 2Q45A 5TNXA 3KZVA 3ZW9A 4FS3A 2PK3A 3LT4A 3RU7A 1GYRA 3A9WA 4ZU3A 2FR1A 1GPJA 1VE9A 4IXTA 3QSGA 1Z73A 4BS9A 1RYDA 2E49A 2NQTA 4XEHA 2VZ0A 5JY6A 2EGHA 3LC2O 3MWEB 3QIVA 3Q9UA 3DHNA 3QA9A 3RWBA 4GVXA 3GOHA 1HDOA 2Q46A 1DDOA 3OIDA 2PD6A 2OBYA 1CRWG 3JQBC 1U7TA 1QYWA 2QX7A 3W4IA 4PLGA 1UP7A 1BHSA 3KM0A 4CMIB 3F5SA 1HE5A 1EDOA 2GRAA 4PLCA 4PIVA 4DIFA 5A04A 1H6BA 1PZEA 1P0FA 1YDEA 4F6CA 1E3JA 1GDHA 1LQTA 3UF0A 2W2LD 4IDAA 5TT1A 1ZSNA 4FGWA 3U5TA 2G17A 3PJFA 1BWSA 2X0RA 4OGWA 4XX0A 4HUJA 1JQBA 3W4KA 1U7HA 4MVJP 4GAEA 1PS8A 1RPNA 3T4XA 5IZCA 4FBGA 4TZKA 3PLNA 2J3HA 3TZKA 2Y1GA 3MTJA 3K6JA 1D8AA 3KETA 1T25A 4E5MA 1NHWA 2WDZA 4LRTB 4R9SA 2VNSA 4XKJA 4J3FA 2UYYA 1U8FO 3GFGA 3S2GA 4EYEA 1WZEA 2Y05A 3ORFA 3QHAA 4ROSA 2O7SA 3JQ9A 3OQ1A 2ZJ1A 3AFNA 3WMXA 4F45A 1XR3A 3HWRA 5H82A 1OC4A 4CM6A 4ZICA 1BW9B 1NBOA 2W2KA 3H9GA 4RVDA 5EERA 3SC4A 5LDGA 4HBGA 4MJLA 2C7GA 1E7MA 3S8MA 1GUZA 1C14A 3PHHA 3D4PA 2NVUA 4E2YA 3ZI0A 1I3KA 1PWZA 2Q50A 3IP1A 2PWZA 2Q3EA 2NU6A 3K73O 3BMCB 4QFCA 4UEOA 2NADA 3I9LA 3PGJA 1XQ6A 3BXXA 3GVCA 3OJEA 4J2OA 3FTNA 4PZDA 2BLLA 1U3UA 1X15A 4ZQGA 3KUXA 4QXMA 4UREA 1ID1A 1Q7CA 1ISIA 1H6AA 4BNYA 5TX7A 4E2XA 4AVYA 3GQVA 4U0JA 1U2DA 2GN9A 4JJIA 4UUPA 2BGLA 1H9BA 3KHUA 3CE6A 5BNIA 4XGKA 3EMKA 3LK7A 4AICA 1NFQA 3UCEA 3E48A 3ZU5A 1U4OA 4YRAA 1ZEMA 4BKUA 2UUOA 1RM3A 3ADOA 4YYZA 4FFLA 3NYWA 2GSDA 3GHYA 3M6IA 5U1PA 3BAZA 3JQAA 1DSSG 4NHEA 2J3IA 3HQ4O 5EJ2A 3VZQA 2Z95A 3CTMA 2NM0A 1PTJA 2YY7A 3JQDA 5L95A 3ZW8A 3I1JA 4NZ9A 1UR5A 3RUFA 1N9GA 4E30A 3DFZA 1GFSA 4LSWA 1P0CA 4Q3CA 1NNUA 1PR3A 4AJNA 2BI7A 1YO6A 1HYHA 2HDHA 4I9UA 1H93A 1KYQA 1NWHA 1O9BA 3JQFC 2OHXA 5ES3A 1LI4A 3DZKA 3ICPA 2EHDA 3DMYA 2TMGA 3JD4A 1X7DA 2DUUA 1T2DA 1DIBA 4J16A 3LT1A 4TKMA 1PS0A 1GL3A 3WBFA 4ND2A 2ZYAA 1WDMA 2P9GA 4FC6A 3H9JA 4MVJM 3QWHA 4BO8A 3JD2A 5B1YA 2C54A 4WNCA 2JFGA 1GCOA 4XDYA 1GYPA 4YDRA 3U9LA 2PKQP 3ZN2A 3IJPA 1HRDA 3IKTA 3ZWXA 2X8LA 5IZ4A 5GZ1A 4RZHA 2AA3A 3U0BA 3GN1A 3VDQA 2NVWA 4LK3A 1L7EA 1UP4A 2ZQYA 2GASA 4LMPA 1NR7A 4AG3A 1GZ3A 2PH3A 1I2ZA 3F1KA 1O94A 5B12A 1E7WA 3PHGA 4IGEA 3H5AA 4ALNA 1Y6JA 3DZBA 4R1UA 3RAJA 3TN7A 3DBHB 1NQOA 3GG9A 1B7GO 5L9AA 4BNMA 4UVIA 1K89A 2GZ2A 1RJWA 1CERA 4GWGA 5TF4A 3TDKA 3QJ5A 2BI8A 3D0OA 1A4UA 1X0VA 3EY4A 2VHZA 4S1VA 2X4GA 1FXSA 1R0SA 2W2KB 2G5CA 1JKIA 4OXNA 2EV9A 1O95A 5AXBA 1CQIA 1Z45A 2NVUB 1E92A 2PKQO 2X58A 4NBRA 1LC0A 2YV3A 4CM9D 1T2CA 5TQVA 4CQLA 4XIJA 1I8TA 2VYNA 4NJOA 1MXHA 3KRTA 3KXDA 5HTOA 3L4BA 3A4VA 3E9MA 1ZKMA 4OSOA 1NFRA 4UAGA 4CM1A 3D7LA 3GEMA 1KC3A 1OZAA 1EBFA 4NU6A 1YH3A 2RH4A 2PZJA 1DIGA 1YE3A 2VWHA 5FFFA 4IQGA 3DHYA 3Q3CA 1OBFO 3IC5A 3JD0A 4XA8A 4JK3A 1UXGA 2DUWA 1DAOA 5BSHA 1LDYA 2PA3A 3HZZA 4PVDA 5DNAA 1L7DA 4D7AA 1XG5A 3HB5X 3ENNA 4IQ8A 2OORA 3WBBA 1QORA 1GCUA 2EWMA 3M2TA 1FDWA 3WNQA 1BG6A 4JJGA 2VUTA 1NXQA 3DBVO 3PDJA 1KVQA 1PSDA 4FDAA 5K6AA 2E4AA 2LDBA 3OJFA 4OH1A 1JU9A 4OJNA 3GHHA 1A5ZA 4AJ2A 4B4WA 4CM8B 4MP3A 3UCXA 4PLYA 3AOGA 1ONPA 2A4KA 4IXWA 5GMOA 4YAKA 1E77A 3TJRA 2B37A 3OH8A 4JROA 3VHRA 4TRJA 3GK3A 1C3VA 1U4SA 4UUNA 5B4TA 3ONFA 4NBWA 2PD4A 2RHCA 3I4FA 2Y66A 4C4OA 2JD1A 3FN4A 5JAQA 3WFJA 2HCTA 1G1AA 1R0LA 1Y8RB 2AE2A 4RJTA 4EEXA 4XQEA 4XWYA 1JA9A 3PRJA 3TWOA 5A1TA 4HP8A 4LSMA 4I5EA 4OM8A 2VUSA 3DZFA 3QVWA 4B7CA 1IY8A 4OOEA 4Y9DA 2YDXA 3MJTA 5KNLA 1YJQA 4R01A 3I5MA 5EESA 5T64A 2IZZA 3WWYA 2ZTVA 5DCUA 3TL2A 3TZQA 5CDSA 1C1XB 2Q99A 3AY7A 2C29D 4N5NA 1NAHA 2GD1O 2PH5A 4RF4A 5TLSA 3R3JA 4PRKA 3V1TC 3CIFA 1QRRA 1JVBA 2W2LA 2BKAA 4Y6SA 3PIIA 3D4NA 1U5AA 3RFXA 1B2LA 3ZWMA 1V3UA 3GZ4A 1QYXA 3NTQA 4CMKA 3DZGA 1A27A 4II3A 1DC3A 1YL6A 2EW2A 4P4NA 4YRDA 9LDTA 4NJMA 3GZNA 3SJ7A 4KWIA 1ML3A 5G0TA 5I9MA 3NEPX 3ZNPA 1BDBA 1U3VA 2EJWA 1LLDA 2ZCUA 3LU1A 3W8FA 3RKRA 1ZFNA 4WCFC 5ER9A 1EEHA 3RASA 3ZNNA 4M54A 4CQLB 1Z74A 1P31A 1ZJYA 2VHXA 3ZWCA 4Z9XA 3GEDA 2JCVA 4OYRA 3EZLA 4XDZA 1YOVA 1EUZA 3HNPA 4XR9A 1BVRA 1GQQA 1R66A 4WK6A 4NI5A 5LC1A 4BQRA 2A92A 4YT8A 2CDAA 2JAPA 4ZA2A 2GCGA 5HS4A 5CDYA 2YQ5A 2VN8A 1B8PA 3QRWA 3U4IA 2H63A 1P1FA 3CMCO 3VKUA 3WGGA 1E3SA 1LRJA 3G79A 1QKIA 1ENOA 5U9CA 1KVRA 4GH5A 4MP6A 1E7RA 5JO0A 4FOOA 5JMPA 1LBEA 3ZH2A 2GNAA 4ALLA 4YRBA 3I3OA 2QZZA 4EBFA 3W8EA 3WWZA 1GYQA 2WE8A 4WASA 2UDPA 1N7GA 2HQ1A 1IE3A 4RF5A 4M8SA 3SX2A 3S55A 2V6FA 4IJUA 2VOEA 4QUKA 3OEWA 2LDXA 3VTZA 5EQFA 4D46A 1DXYA 4DWVA 2Q1TA 2PGLA 4YJDA 5F1OA 4CM5A 4BO1A 4IJWA 3KYBA 2QRKA 4YJHA 4OQYA 4TROA 1GD1O 1KC1A 1SEPA 2EIHA 2CY0A 3O8QA 3DQPA 4YAJA 3QY9A 2FPGA 1HE2A 4H7PA 2H6EA 3UN1A 5EL0A 4R5HA 4ALMA 2PD3A 3WNVA 2DAPA 4Z9FA 3RUEA 5KKCA 4P4GA 3R0IA 4BNJA 5ILGA 5I9LA 3ULKA 2CVQA 1NFFA 1DC6A 4IMPA 2G0TA 2NNLD 3FPLA 4FFRA 3ZWNA 5AVOA 2AQKA 3NV9A 2HK8A 1H0KA 2DKNA 2IZ1A 4ZRNA 1TT7A 3PYMA 4FGSA 1I0ZA 2FWMX 2V65A 4TWRA 1YQGA 3IIEA 4KUEA 4ZQBA 5F1KA 4CLOB 1PZHA 4GQAA 4OQZA 5JYDA 1U5CA 1N5DA 3I9OA 3DDNA 3PDUA 1C1DA 4LN1A 1LJ8A 3U09A 1M2WA 3JQ7B 4FJ1A 3DWFA 4NFHA 5A3JA 3KYDB 4BNNA 5JDIC 3TSCA 2G1UA 1BXKA 2HUNA 3EUWA 1P33A 2D2IA 3INRA 3UKOA 2GLXA 3QWFA 2YV1A 2YZ7A 4QSMA 4CLEA 4DL9A 1XSEA 4BO3A 4PLPA 3BA1A 3PYLA 1Y8QB 5HBRA 4Y67A 3ROPA 2FHSA 3VVCA 2DBZA 3ZGYA 3H65A 3GZNB 4YB8A 3C8MA 1MG5A 5F1PA 5KVCA 3PXXA 3LDHA 3A06A 4WOKA 3C85A 4J49A 4RPLA 1PJCA 2Y93A 3TPCA 1MFZA 1HDGO 2Y0EA 4QECA 5A5FA 4FJ2A 5DCWA 4BL5A 5JAMA 5A9SA 1PJBA 1R15A 3AM3A 5CEJA 4JNKA 3NGLA 4NDNE 2NU9A 2ILTA 2ZKLA 1EQ2A 2VZ8A 3LQFA 4CMBA 2X5OA 1VRWA 1LEHA 1NQTA 3OHSX 3JTMA 2IEBA 1A7AA 2H5LA 3FR8A 3GVHA 3AJRA 3C1TA 4XJTA 1E1LA 1ZVMA 4QT0A 3VPSA 4OHUA 5JC8A 1XKQA 5JY1A 3T7EA 2VZ9A 4R16A 3VPHA 1LLUA 4KDEA 2AHRA 4ND1A 1Y7TA 3MWDB 3WJAA 1B8UA 3CKYA 3Q6IA 2AQHA 1AHIA 3QE3A 4KTTE 3DB2A 1BXZA 1R0KA 2YHUA 5L4SA 1LLCA 1UAGA 5IF3A 4AJEA 1XYGA 3ICCA 4CMIA 5IDYA 3RROA 4L8VA 1JVSA 4UVHA 4FFNA 1KY5A 5B4UA 5IDWA 1ULUA 3HSKA 3K5PA 4YWJA 5JCXA 1DIHA 4U8GA 1A72A 3KSZO 2ZJ0A 4O1MA 1XIVA 4IBOA 3M1AA 2I99A 4PLTA 1RM0A 7ADHA 2F00A 2GYYA 3V2UA 5FWNA 1IPEA 4HADA 5COQA 2F1KA 4C7JA 5HA5A 5CDGA 1AXGA 4BKRA 1LDEA 4G65A 1EK5A 3PHIA 5JS6A 3LF2A 3ROMA 2X9NA 5IAAA 4KOAA 2BD0A 3GPIA 5ILOA 2DC1A 3CMMA 1TT5A 4O0LA 3CUKA 3JYPA 1PQPA 3W4JA 1DB3A 2DBQA 1QXSA 1UDCA 2XAAA 1QG6A 3PHJA 4NBTA 4W9NA 4L76A 1ZXLA 3B1KA 1MLDA 2XXJA 3MOIA 4R9RA 4BO0A 1BXGB 1HYEA 4FN4A 3RUCA 2R6JA 3U4HA 1QLHA 3HE3A 3R3SA 1NHGA 5JDCC 1P1HA 5G0UA 3GUYA 3DOJA 5BT9A 3CZMA 1BW9A 4RO0A 1VM6A 1YQDA 2X0NA 3NKLA 1W73A 4CLRB 4PRLA 2B35A 3DTTA 1ZJZA 1T2FA 3F5QA 1T24A 3NX4A 4CM4B 1PJ4A 5DBIA 3UCFA 1VL8A 2HO5A 3ASUA 4BB5A 1IYZA 1PL6A 4WEOA 4DXHA 1EZ4A 2P2SA 4R51A 5KIAA 1ZK2A 2JFHA 2BH9A 3CXRA 4IIUA 1MC5A 4NK4A 3GVIA 2X9GA 1GQ2A 3P2YA 1KOLA 5TS3A 2FSSA 1DFIA 1OC2A 1V9LA 4XYLA 1GAEO 4ND3A 1F14A 1IB6A 4PG6A 1S7CA 3ZCXA 1LUAA 1GR0A 4FSHA 2D1YA 4DMLA 3UW3A 1NP3A 1HWYA 2AG8A 3BMQB 3R6DA 4MVJD 1NPTO 3E18A 3SXPA 3JQ6A 4W6ZA 3DZIA 1ORRA 1RM5A 1OAAA 2PLAA 2FP4A 2ZTMA 2H1SA 1UXJA 4R3NA 3WQQA 3U4CA 1FJHA 5HM8A 5CP8A 4B79A 4XJSA 4CMHA 1ZUD1 3GUCA 4WPGA 1HDXA 4A73A 4CMCA 4BNKA 5KTKA 2IE0A 3FCOA 5F3RA 3VH2A 2GR9A 4CUKA 4ZN6A 1FDVA 1NASA 2WM3A 1HTBA 3G49A 1Y5RA 4AJIA 5L3ZA 3K31A 2CZCA 3AOEC 2YYYA 3F6YA 4J43A 1E7SA 3HN2A 3WMWA 2XPCA 2IYPA 4H3VA 3MJSA 4H16A 1J5PA 1LRKA 4QQRA 3OQ6A 2EEZA 1LC3A 2DTDA 2VHYA 1NWCA 4BO4A 4ND4A 3DMTC 4U5QA 1KERA 4BIIA 4BNXA 2HRZA 2Y1EA 3KVOA 4KUGA 4ILKA 1J4AA 1SOWA 3M1LA 4GVLA 4BNWA 2GN4A 3QWBA 2VWPA 4D3DA 4N7RA 3GH3A 1HLPA 3ZHZA 4YCAA 2J5RA 4Z6KA 4NFSA 2D59A 1CETA 2O23A 4KQXA 4E32A 5F5NA 1I3MA 2QRJA 1KEPA 2O2SA 3EVNA 2HLPA 2P91A 4RDHA 1ADBA 4NR0A 4EUFA 1IHYA 1TT5B 3JD1A 4XIYA 3OA2A 3GMSA 4DLAA 3IOYA 1EVZA 2POQX 1XWFA 3WGQA 3QP9A 4DC0A 9LDBA 3VH1A 3RVDA 5A4DA 1EE2A 3DBHA 1EMDA 1J0XO 4IPTA 3BTUA 5TSDA 3MZ0A 1JKFA 1VLLA 2WMDA 3PWSA 1HSZA 4D0RA 1RM4A 4PGFA 1E3LA 4TVOA 1VKOA 4CR6A 4N5LA 1X14A 4PFJA 1UH5A 1HDCA 3K2BA 4AJPA 1XQ1A 1ENPA 4D42A 3G1UA 1ENZA 2EP5A 3E9NA 2DVMA 4LVCA 3LF1A 5CEEA 3DR3A 2ZB4A 4DYVA 2DFDA 2WYVA 4IDGA 4QO7A 3MJVA 1LU9A 2NV6A 1CJCA 1NTOA 1XELA 1EUDA 3OJLA 2ET6A 3U62A 3X2FA 4NU5A 4DUPA 1PX0A 8ADHA 3ITDA 3E6AA 4NFYA 5JYEA 3V8BA 4ONEA 1V3TA 1K6IA 1O0SA 1MV8A 4M86A 5JE8A 2Y1DA 1L1FA 4E3ZA 5C5IA 4WCFB 5CAEA 3P2OA 4K26A 2PR2A 1X1EA 1HLDA 1PL8A 4E0BA 1C0LA 4PN3A 4TRRA 1B16A 4LISA 2Q2VA 1ISMA 2OOSA 4YJFA 4YJGA 2YUTA 3F4BA 3RUAA 1LNQA 4WLOA 3MOGA 4LW8A 4R4JA 1RKXA 1SCUA 2IYOA 2CMDA 2Z5LA 2C5EA 3AFMA 1YWGO 5G4LA 5L7YA 4BHTA 3NDIA 1MGOA 4IM7A 1KVUA 4U0KA 5EPOA 1HF3A 3KEQA 5I7VA 3LLVA 4CM8A 1ZK1A 5DN9A 3ASVA 3DTYA 1HDYA 2JKVA 3I6QA 4TZTA 3VKVA 3RUHA 3QVSA 3F46A 4BO6A 4P4LA 1HDZA 4R1NA 4FQ8A 3WDSA 4W82A 4Z0TA 2EGGA 2Y0CA 4CLDA 1SEVA 2O3RA 1GTMA 3PJDA 4FFMA 4PG7A 3G3EA 5TGDA 3C24A 3SEFA 3ZWWA 2YFHA 4ZJUA 4JCOA 4WJZA 1UXKA 3BTOA 1Y8RA 3NRCA 5KVVA 3DZJA 1PJTA 3W6ZA 1F17A 2GZ1A 2HRBA 1ENYA 4YXFA 2JAHA 4BNZA 4KP7A 4BVAA 3KTDA 1NX6A 1WWKA 3H7AA 2WD7B 3TZHA 4BMVA 2FZWA 1P74A 3WFIA 6ADHA 2CFCA 2VHVA 1SB9A 3VZPA 3TFOA 2UAGA 4Q3BA 1PJQA 3I9JA 1I2BA 1C1XA 4MIOA 2WYUA 4TVBA 4BGEA 4D3SA 3HDHA 3KO8A 5A5EA 1DBVO 1Q0HA 4YAEA 4OO3A 5FF9A 3WYCA 3DC2A 1QYDA 2VUUA 4RVSA 3V5NA 5JAIA 1ADFA 1N8KA 3DZHA 1OI7A 3ZV5A 4LGVA 3F4LA 3JQEA 3AU9A 1ADCA 1CEQA 4AJOA 5I8ZA 5JDCA 1YGYA 3CZRA 1IL0A 1T1RA 2FZEA 5BSEA 4RVFA 1YBVA 3NT4A 1Q7BA 4PZCA 4DIBA 4RPJA 5KCZA 5MDHA 1GQYA 1WLYA 1B0AA 1DHRA 4DPKA 4WLNA 2NTNA 1EVYA 4MVJI 2X5JO 4J4BA 4CMEC 4BGVA 4OKNA 3HDQA 4J6FA 3HFSA 4HFNA 2PNFA 3WQRA 4B8ZA 5AQ1A 4QO8A 1LQUA 2DBVO 1TI7A 2FSVA 5A9TA 3UICA 3KB6A 3KLMX 4BO5A 1D1TA 2O2YA 3E5RA 4NIMA 2CD9A 4AJHA 5AXAA 3EGOA 4NQZA 2ZB7A 2ZYDA 5COAA 3V2HA 4KQWA 1QV7A 1U28A 5FEUA 3D5QA 3FBTA 3GGOA 5DCYA 2IRWA 2YQ4A 3PJEA 4E2WA 2X86A 1GADO 3FNHA 4Z0PA 1EFKA 3VPFA 3WICA 4DVJA 5JSFA 1E5QA 1I3NA 3DO5A 3H5RA 4N54A 4GPD1 4YJFB 4MIYA 1IZ9A 3FNGA 4YJGB 3RIHA 5ICMA 3GT0A 3WX0A 4M1QA 3IJRA 2PY6A 2XF8A 1YXMA 1DLIA 4CV3A 3QWAA 3WIEA 1LDBA 4ALKA 4D3FA 1Y81A 2ZB3A 3NDJA 2CNBA 2Q2WA 1EQUA 3D5TA 2PZMA 3Q0EA 1TVEA 1EE9A 3F1LA 2O50A 4K6CA 2NTJA 4CQMB 2BMAA 1FF9A 4BMNA 2NTVA 1P1JA 2AE1A 3K96A 1M76A 4HV4A 4URFA 2R2GA 4MVJA 1Z82A 3JQBA 3KSUA 3AU8A 4A26A 5AXDA 2PGDA 1MUUA 1TXGA 4RCVA 3E5MA 3GR6A 3ZHYA 4XRGA 3WGYA 1DC5A 1TA4A 4RDIA 3BHMA 4L4XA 5THKA 3IMFA 3FNFA 4FD3A 4YT4A 5B4VA 3MJ4A 2BFAA 3GDOA 2G82A 3VDRA 4L74A 1HE3A 2XXBA 2W98A 1G6KA 3E82A 3M2PA 1Z7BA 4PLZA 3LYLA 2CDCA 4ITUA 4XQGA 5A02A 2QHXA 3AW9A 3PJGA 4CODB 4PG5A 3P5SA 4U6QA 5JMWA 3GF4A 2C5AA 5HS6A 3GDFA 4BO2A 5G0SA 4NBUA 4CLOA 1Q7GA 1P9LA 3P7MA 1B8VA 4E21A 4PVCA 4MVJE 1PL7A 3DAPA 1E1KA 1SMKA 3PHLA 2ZK7A 2PZKA 1O6ZA 1HT0A 1Z6ZA 3JQ7A 4RPGA 5L51A 1ZIDA 2EJVA 5T8KC 2Q2QA 3B6ZA 3I9MA 3KYDA 5JLAA 4RORA 1DFGA 4K1LA 4NK5A 2ZYGA 1DIRA 1KVTA 1RYEA 1Y8QA 3PWZA 4B4VA 4UVGA 4X54A 3KV3O 4G81A 3H2ZA 4DTIA 2FMUA 5A06A 4J1TA 2IZ0A 2VCYA 4CLXA 5KKAA 3GAFA 1I2CA 2JHGA 4AJ1A 1U8XX 3W6UA 1UJMA 3JQCA 5GZ6A 1K5HA 2Y99A 1BMDA 3GNSA 1YRLA 1IULA 2HK9A 4E5NA 3F47A 4L73A 2GGSA 2I66A 4YVFA 3OECA 4YA6A 1YL7A 3FWZA 1X7HA 4A03A 4YAIA 4FIZA 2X1HA 3I9KA 4IDDA 4ZRMA 4ZGWA 4DPLA 4J0EA 1DEHA 5KJ6A 1BDMA 1EDZA 1QYCA 3PZRA 3SVTA 2CF5A 2PGJA 2J8ZA 4E31A 4YT5A 4Q3NA 4GKVA 2FN7A 2YV2A 1NPYA 4R5MA 5JAZA 3WS7A 3HADA 1PEDA 3WG9A 4XGIA 4HKTA 2HMVA 1NVGA 2YFQA 4PZEA 4CUJA 5BNFA 2BRUA 4J90A 1ZH8A 1ADGA 1P77A 1ZSVA 2B83A 2W4QA 4Z0HO 4WECA 4K6FA 5FI3A 4WLUA 3ZWBA 1VC2A 2VT2A 2Y67A 2FRDA 4PLHA 3UUWA 4MINA 1WPQA 3JQFA 1K2WA 3E8XA 4P38A 2I6TA 3C7AA 3CH6A 3RCBA 2ZQZA 3VTFA 3QVXA 1N1EA 3CEAA 4GL4A 4K28A 4WEQA 5BR7A 5KWEA 1OOEA 3WTCA 1ZW1A 4TQGA 2UUPA 3OSUA 4WKGA 2E48A 3S2EA 4PG8A 3PP8A 2P9CA 2GZ3A 4OAQA 3AI1A 4J1SA 4II2A 5DBFA 1ISHA 4MKZA 5A9RA 5EN4A 5CG1A 3F3SA 1VJ1A 5G2OA 1BXGA 4GX2A 1LSJA 5DP2A 2DTEA 4Z9YA 4BGUA 1U2GA 5IZCC 2CSUA 3NT2A 3ADPA 3WR5A 5F5LA 4RLSA 5IJZA 1VJTA 3L9WA 4RV9A 2B5WA 1AXEA 2A35A 1YONA 4CLRA 3K2EA 2EW8A 2O3SA 4CM4A 2OXIA 4NPCA 4TMFA 3RBVA 4YEDA 3CPSA 3E1KA 1K3TA 5TJHA 1YB1A 1AN9A 4PLWA 2B5VA 2AEMA 3SLKA 2GERA 3JQ9C 1UAYA 3KLPX 1ARZA 4DRYA 2WWRA 3HG7A 3OICA 1Z75A 4BO7A 4E4YA 1IOLA 4GGPA 4XRRA 3RJ5A 2GUGA 4XB1A 3VZSA 5TIIA 3DBRB 3CINA 4CQMD 4R1TA 2CVOA 4CMGA 2RH8A 3I52A 1KIFA 3PFFA 4B3HA 4EITA 1ZO8A 3BMQA 4BNVA 4E12A 3R1IA 4I1IA 4J1NA 1XU9A 1Q0QA 2EKQA 1VL6A 2W8ZA 3FI9A 3C7DB 3KSDO 1DRUA 4R1SA 5F21A 4UUMA 1UDAA 5DBGA 2EXXA 4A2CA 2OUIA 5BSFA 2B36A 4D45A 3NJ8A 5K9ZA 1N1GA 4FPXA 3PPIA 1HXHA 4Y8VA 5B37A 3EDMA 4JJFA 3I23A 3EHEA 2Z1NA 2HMSA 3GY0A 4DQUA 2WJPA 2HKIA 3G17A 1XEAA 4CLHA 3JYQA 4BB6A 1NPDA 3HDJA 3JSAA 3L9XA 4RVGA 3U4DA 1LLQA 3IAHA 5T57A 4CL8A 4FW8A 3GVPA 4YAGA 5JO9A 7MDHA 4GMGA 1A4IA 2PFGA 1N2SA 2B0JA 4UVDA 1VSUA 1JLLA 1HE4A 1GV0A 2C2XA 4WOJA 5A03A 3WSVA 1SPXA 1E6UA 3EAGA 4UEJA 5JXWA 2X6TA 4XQCA 4ZQFA 2Q1UA 3OETA 1WDKA 1PQWA 5ER6A 3T7CA 3WGOA 3ROQA 1C0PA 1VI2A 2GF2A 5L53A 4D79A 1E1MA 4KMSA 2Q1SA 5G4KB 4JBIA 4DLLA 1R4MB 5G0VA 1QSGA 3AUAA 2PTGA 5LDHA 3MCVA 4EGFA 4D41A 3AUTA 3JYOA 1UXHA 1Y5MA 3MEQA 4OXKA 4QEDA 3JQGB 3WGZA 4DQVA 4HNGA 4MVJG 1T2AA 1WW8A 2X7HA 2PZLA 5U4QA 2I9PA 4E33A 2IXAA 4XD2A 1E5LA 3W8DA 4J4TA 5TT0A 3VZRA 1JN0A 3ZV4A 1HZJA 2QIOA 4QX6A 3BTSA 1V0JA 3ZNOA 5L7TA 2DTXA 1E0DA 3BMOB 1PGQA 1UP6A 4EW6A 4Q3AA 1JAYA 4I5DA 3RC7A 5BQFA 3PVZA 2WSBA 5TJ9A 4Z3KA 4IINA 4BQPA 1H6DA 4PG4A 3VC7A 4BV8A 3I4CA 4Y6PA 2EKLA 1E6WA 3LC7O 1R6DA 4O63O 1Y9AA 3ZWYA 1B26A 3ONEA 4FB5A 3O38A 2V6GA 3VPXA 5ENVA 1M66A 2DLDA 1KEUA 2O3TA 3C1AA 5CPFA 4J7UA 4TKLA 1WAMA 2OZPA 1LSSA 2C59A 3PQDA 1HSOA 2P5UA 3QW2A 4KDFA 1LX6A 4IDBA 3PTZA 5EMHA 5KVSA 4Y6RA 2DM6A 1M75A 1PGJA 4CM7A 1J49A 1LDGA 1WNTA 3PGXA 3K9QO 3OA0A 4L4RA 1UUFA 4EDFA 2GO1A 5IXSA 4LCEA 2NACA 3LSYA 3OF2A 1BGVA 1MA0A 4WCFA 4I5FA 2JL1A 1DC4A 1ULSA 3GGPA 4D44A 4WLEA 4BNGA 1SOVA 1IPFA 4P8RA 2VTDA 2XOXA 5KJEA 1WP4A 1P1KA 2B4QA 2BF7A 3RUIA 2VHWA 3TZ6A 4MO2A 5ICSA 5KJCA 1V8BA 4CMAA 3FHLA 4OSPA 3VPGA 2HJSA 3OIGA 3L4BC 3GMDA 1B3BA 4ND5A 2I67A 3OBBA 4B7XA 3Q2KA 5CEFA 2VRCD 4OL9A 3ZHBA 4B3IA 2HSDA 1BRMA 3TQHA 1B15A 1ZNQO 1I5RA 1QLJA 2FR8A 5AXCA 4BKPA 2GN6A 1W6UA 4FC7A 4A0SA 2BGKA 5DZSA 1R37A 3B20A 3Q11A 2EKPA 3UAGA 2PKRA 1X1TA 2VOJA 3A1NA 3ZV3A 3D3WB 3A14A 3L77A 4IZIA 3KEOA 3TOZA 5K6AC 4F46A 4GGOA 4QFDA 3BMNB 4KUHA 3CSDA 4UUOA 3STHA 2FR0A 1F8FA 4E13A 4D43A 3GFBA 8LDHA 1PZGA 2RCYA 2EERA 4XR4A 1HKUA 1IZ0A 2D5CA 1UZMA 5IDXA 3ZU4A 4HXYA 1PIWA 3ZZNA 1E6EA 1YL5A 3F9IA 3E03A 2RBEA 2WD7A 3PI7A 1CQJA 2IODA 3AUUA 3L0DA 1MXFA 4IGFA 2R00C 3GA0A 1EBUA 4RL6A 5BNTA 1P3DA 1P44A 2CF6A 1VL0A 3INTA 2P68A 5CDUA 4CJXA 2J3KA 1NR1A 2Y68A 5DULA 1JKJA 3ITKA 5J23A 3BHJA 2C20A 6LDHA 3O4RA 4CUZA 2QRLA 4JLWA 4GI2A 4O5OA 4EJMA 2FPPA 4HFJA 1HYGA 2AXQA 5T67A 5MGBA 2DBRA 1DIAA 4J0FA 4IQ0A 5AOVA 1E7YA 4PLVA 4YBZA 4BUCA 4M89A 2ZCVA 5GZ3A 1PGPA 4EUHA 3ONDA 4LMRA 1B3RA 1XA0A 5BSGA 5I7SA 3GNTA 3BIOA 3JYNA 3EC7A 4MOWA 1DRWA 3IQDB 3RSHA 1ZXBA 4YR9A 3H3FA 4PLFA 1KEWA 3FR7A 4FFPA 5KOIA 1H9AA 5DF1A 4C7KA 4WGGA 3RQSA 1I10A 3RFTA 5JDIA 4KWHA 1O5IA 3W1VA 2AEFA 2OMEA 4LVUA 2BGMA 2AEJA 4RPHA 3H9EO 1DAPA 3QLJA 3JQ8B 1YJ8A 1E3IA 2RAFA 2VRBA 1WMAA 2OP0A 4MKRA 3TZCA 1C0KA 1QP8A 3G1TA 3L6EA 3WIDA 4J7XA 4DQXA 1I33A 3DXFA 2DPGA 3SLGA 3X2EA 4E6PA 5JBIA 1O89A 4A7PA 1D3AA 4FR5A 1MG0A 1T26A 1CWUA 4JP2A 1QYVA 1ZBQA 3VAZA 1NQAO 2P4HX 1SB8A 3OMLA 1I30A 4XGNA 5DDIP 3QVOA 2RIRA 2P4QA 3DL2A 4UVEA 2A94A 4DLBA 1N7HA 2B69A 3NJ4A 4IDEA 4LRSB 3QWIA 3ZHXA 4IJKA 4JP3A 1E3WB 4O6VA 4NMHA 3ANNA 4FCCA 4ZHSA 3PWKA 2X0JA 3IUSA 4U6SA 1GV1A 3O9ZA 4HFRA 3HN7A 3LT0A 3GGGA 4IMRA 1Q2XA 3DBLB 5A05A 4DIOA 2JCYA 4IY1A 1I01A 4R41A 4FFOA 3N7UA 4O59O 1FMCA 4IDFA 4JIGA 3TFQA 3LVFO 2QQ5A 3L07A 1ZZEA 3GLQA 4CQMA 4KTVE 5EQDA 1VPDA 1YKFA 1XDWA 3WJ7A 1XGKA 4MDHA 2IXBA 4IS2A 4NNJA 3PIDA 3FD8A 2C2YA 3KYCB 4GSKA 3AM4A 5DT9A 2GDZA 3GRKA 4UEKA 5H83A 2JCXA 5I9NA 1WZIA 1ZMTA 4RF2A 1ZK3A 2D4AA 1YDWA 3NTRA 4HWKA 4EJ6A 1AGNA 2IDZA 4RZIA 4W7HA 2X22A 3H3JA 4BNHA 5IFLA 1H2BA 4DMMA 1PGOA 1KEVA 3IL2A 4ZQHA 4I9NA 2Y1FA 4K9DA 3ROKA 3AY6A 2FY8A 5I7FA 1UDBA 3V1UA 1YBMA 5L7WA 1LXCA 3PQEA 2HMUA 3BTVA 3S2IA 3H4VA 3DHEA 4MVJH 4XB2A 4UULA 1MB4A 1KBZA 4XYMA 5JNLA 1UZLA 4RVHA 3UGKA 5IG2A 2TMDA 3FWNA 1TEHA 4DA9A 1D4FA 3LC1O 3OP4A 1G0NA 2O3JA 2UVDA 2DPHA 5TC4A 3ZV6A 1PWXA 3EYWA 1E7QA 3IDSA 5CPBA 3E9QA 4I9HA 3TNLA 5C7IO 1F06A 2VNAA 4L75A 2HJRA 1XLTA 4M49A 2JD2A 1AHHA 2O4CA 3AWDA 3HHPA 3VVBA 3GAZA 2BELA 3IP3A 3LT2A 3WTBA 2DFVA 5KVQA 4B4OA 3H6KA 4OKIA 5G0WA 1BVUA 4A5OA 2VYVA 4JQCA 3COSA 3UXYA 1LRLA 3ETDA 3ZDFA 1PR9A 4OXYA 1Q1NA 4LCJA 1H5QA 1A9ZA 4HY3A 1CYDA 3JV7A 4BOYA 4YQZA 2BFPA 2BFMA 1DFHA 2QZ9A 2QYSA 3ANMA 4WCDA 4E5KA 4EUEA 3H5NA 5DOVA 3OIFA 3PEFA 4R3WA 3TOXA 1QMGA 5ADHA 4N18A 2VWGA 3HB4X 3UFXA 2V7PA 1KY4A 1V35A 1Y1PA 1EK6A 1SC6A 3WQSB 3INGA 1G0OA 2DU8A 3DFUA 1T1SA 3PYXA 4BMSA 1CDOA 1PU2A 1HDRA 3GN2A 4MKXA 1NVMB 3UOGA 4IZHA 5IXYA 4Q3DA 3RD5A 3WYBA 1MFPA 2WEKA 3VOSA 1LDNA 3VH4A 3AOEA 3MJEA 1EVJA 4CMJA 4EI2A 3WXBA 2E37A 3GEGA 5JCJD 4MPDA 4L4SA 3G0OA 1X7GA 4E5PA 4B8WA 5L4LA 2OFPA 2Q1WA 4G2NA 2E6UX 3JCZA 3BYZA 4ID9A 3C3XA 3JQAB 1AUPA 2DQ4A 2OP1A 4XYGA 1I24A 3DMTA 4GLLA 4YT2A 3RC9A 1F0YA 3MTGA 2C82A 2JJYA 3FBGA 3HJAA 2C0CA 2WTBA 3QV1A 2FOIA 1YB4A 3RI3A 1HEUA 2VRCA 2GN8A 5GY7A 1N9GB 5AYVA 3ZWOA 3AI3A 2P5YA 3OM9A 4GMFA 3DONA 4PCVA 1DHTA 3WB9A 2ZATA 2I3AA 4MP8A 3ZWPA 2ZIZA 4DGSA 1KETA 1P45A 5CDTA 5LCXA 2R00A 3ENKA 3IKVA 1T4DA 1SAYA 4R69A 3KOUA 2OGUA 3KBOA 3BZUA 4WE3A 1GUYA 3WOHA 1EUCA 4BO9A 1ZMOA 3GPDG 4I08A 2EF1A 1GEGA 1I3LA 1F12A 2AG5A 4IJVA 4J9VA 1CF2O 1LSUA 1WMBA 5DP1A 1GY8A 3VH3A 3AY3A 4J1QA 4L0QA 4AJJA 4BNIA 4ALJA 2VT3A 3GC6A 4XYBA 1BTOA 2WYWA 2ZTLA 2HAEA 1ZEJA 1M6WA 2I5PO 4KZPA 1JWAB 2C07A 1IUKA 4IDCA 3AK4A 1QV6A 5EIOA 4BGIA 3TRIA 4W9NC 1PJLA 4GLOA 2YHIA 4NBVA 4ZQEA 1C0IA 4YPOA 1X0XA 3ETGA 5THQA 2UV8A 1IHXA 1SBYA 1BSVA 1TLTA 5C7LO 4W7IA 1YVEI 4NG5A 4BV9A 5HWSA 2G76A 3DAGA 3DBRA 3NTOA 5L40A 4IS3A 1JW9B 1NQ5A 1LDMA 4BNFA 4GBJA 1YBAA 5FI5A 5T5QA 2V6MA 1W0CA 3I9NA 2BFOA 1Z7EA 5IN4A 1PQUA 1R4NA 1V3VA 2HK7A 1NVTA 5K0ZA 2O7QA 3H8VA 4GSLA 4NH4A 4CV0A 4TRMA 1OFGA 2OBNA 3ETEA 4Y98A 4H15A 1B14A 2NU7A 3FSRA 5I8WA 4S3MA
chains in the Genus database with same CATH superfamily
4O2RA 1H0HA 2H8KA 4XQ9A 3HGMA 1RXVA 2HMYB 1RI1A 3UYLA 2FCRA 4DZRA 3WJ1A 4M1EA 1KE1A 3ON5A 5HRUA 2VBIA 3ZWAA 1RWBA 1EHCA 1ONOA 4BC0A 2INGX 5KYWA 5ERYA 1SCNE 2LVBA 1QAQA 2PSFA 5IH7A 4RF3A 3EZYA 1MMFB 2SKCA 3BH7A 3G2OA 3HZHA 5ITZA 1DCFA 1GNTA 4NARA 4UDNA 2O2HA 5CAEB 2E2WA 2QE6A 1FDUA 3L7AA 5FR2A 1HZZA 1Z29A 3P2JA 4JUFA 5BV0A 2QX4A 4B7UA 2G71A 5CG2A 3KVNA 3UKDA 4YJ2A 3ILVA 1L5QA 3BSWA 3OJCA 2YMPA 1T10A 2HADA 2VQ3A 1H1LA 2BFEA 4JC4A 4NFLA 1SU7A 4PV7A 4UU0A 4KBYA 4W4TA 3GA7A 3C98A 3HLYA 5A5GA 1CR1A 3SZMA 3D6AA 1B0UA 2PV7A 4ZC1A 5LQSA 3RUDA 4BNUA 1L0BA 3FFWA 2HJHA 1JT2A 5G4KA 2BHSA 5H81A 3WRYA 1DKNA 5HYVA 4PBSA 2Y1OA 3K0AA 2C7QA 1P2SA 3BXEA 3EG9A 3QVGB 4BMZA 5EJGA 5CA1F 2UUCB 1E1QD 1YB5A 2HA3A 2O4UX 2VTEA 2BBTA 2NZ8A 1LVGA 1M9NA 3JQGA 3OTIA 1YF3A 3DUWA 4R54A 2CVZA 2VEOA 2ONZA 1VJRA 4FN5A 3EGXB 3ROGA 3BWCA 2BOVA 1C1YA 3O4IA 1EVQA 2ZREA 3TKYA 4BNLA 1Z4IA 2B4RO 1P4SA 4A27A 1YFLA 3LZ6A 1GL7A 1JECA 1R12A 2IEAA 3JVVA 4IIBA 2OFFA 4CDNA 2JFBA 3LCMA 3T12A 1QFZA 4CDRA 1I32A 4IIFA 5F5XA 2C3MA 4HEQA 4ZD6A 3SGLA 4BU0A 5B2EA 5KJFA 4HWPA 1ZN8A 1X13A 2HSGA 3WBJA 3QE9Y 1OI3A 1NW5A 3AIMA 3ZKAA 4MCHA 2RGEA 1L8AA 4HRVA 3W5JA 2IP1A 3W3AA 4J91A 3BQ9A 3JARB 5CRIA 5CHEA 3ZDAA 4G4SO 3HBAA 1YZUA 2EL7A 4IUBS 5LZ5A 2B1GA 3RWOA 1DCTA 2FMTA 2ECFA 2IIQA 3FNEA 1SD2A 2Q28A 4JB3A 4X44A 2A0WA 3TW8A 3FOCA 3VV3A 4C0BA 4E07A 4EJ0A 5J4HA 1W8DA 4ZO7A 4LFBB 1E79D 3ETHA 2J6IA 3JWGA 5DWQA 5FBWB 3O4GA 3B85A 4AMGA 5F12A 4CMEA 3FVWA 2Z6QA 4DFDA 1VL1A 4BDTA 5F9HA 1ZSYA 5FBRB 1FSGA 1TUBA 5KTOA 5CCBA 1HETA 4HK4A 3EDCA 4KNVA 1NVWQ 1ML4A 3DLPX 4ABYA 2O2XA 5ITWA 2AG6A 1DTWB 1LTHR 1E9VA 2ZUBA 2BFWA 4TTSA 4B6GA 1S7GA 2YVKA 3K05A 4ACBA 3ZCSA 1QZUA 2JLRA 5IKMA 1RC0A 2II6A 4YHBA 1REQB 1VBNA 2UYHA 3P9QA 1WQ4A 4GWKA 3NIGB 3IGFA 4P7KA 5IAKA 1DAHA 1MP0A 3MXTA 3VR3A 1JFTA 3VU9A 1EVIA 1QFSA 2HC9A 3AQIA 3NP7A 1RBMA 3QPBA 3L6CA 5L6LB 1LPOA 2NZUG 3Q2IA 2XUIA 3D6MA 4GFDA 4I4NA 1J1IA 3W5CA 1EGAA 1CIVA 1NYTA 2FPOA 4FJ0A 2FTKE 5DHTA 3WDKA 3DM9B 4YTEA 4CHTA 3VNUA 1BAPA 4BQNA 1EZZA 3FCUB 1DLJA 4IKPA 4X20A 4BCDA 3B1FA 3T94A 1K8QA 2HPAA 3OIUA 1ZCJA 4JSTA 4HD8A 1P19A 3OZXA 5T6BA 5FI0B 2F4NA 5T4HA 1R27A 4XASA 1OQAA 4MQFB 5AJZA 1XCBA 1OFUA 2ATEA 1MZPA 2YVUA 1UKAA 3L4SO 1VBFA 3L0ZA 3D3WA 3PDHA 3RYHA 1VKRA 5LA6B 5HOEA 4NV1A 4HAUA 3ZXXA 4JP8A 5FT9A 1JFSA 4E1AA 4XDHA 2JIRA 3OFSA 2VXCA 5EG5A 3OPYB 3Q72A 5JSQA 1QE5A 2JCGA 2FPXA 2JC3A 1TADA 2L18A 3P4YA 2O8VA 3RVOA 2NO5A 2ZRHA 3SBOA 3VR1A 4H0CA 5JC1A 4HGPA 4XSHA 1BO6A 1XZBA 5LFAA 3RIEA 2RGXA 2ZT8A 2IIPA 2X13A 4RELA 1YSCA 1EFLA 2BEKA 3ECSA 3M89A 2AK3A 4GX5A 3R7LA 3VXKA 4BNTA 4BP3A 3TRKA 1I3CA 2G28A 2GVNA 3M82A 3UMCA 4Q7QA 5L8VA 1IY0A 3JASB 3PNKA 2HF8A 4HPJB 5GPBA 3VDNB 4RCYA 4YQYA 3K9GA 1KXZA 1KSJA 1U3DA 4GRAA 4MVJF 2F17A 2WABA 2VYVD 3BERA 3B82A 3EFOA 4GVPA 5AKKA 4CIXA 3OD1A 1CNFA 3FYUB 2CCKA 4C7XA 1N2CE 1R5OA 1XAGA 3K30A 4YACA 5IDQA 3V2GA 2RCNA 2NU8A 3REQB 5IPFA 3DO8A 5SYAA 5JCJA 5C34B 1KS9A 3INYA 3NHBA 2ATCA 2B4TO 2A9FA 2R6R1 3RVMA 1AQNA 3VZCA 2CDBA 3MHPA 2HJVA 2OO5A 1H5NA 3OLCX 1Q0LA 4YJHB 1T4MA 3F6CA 1R18A 4PTLA 5DHPA 1E4VA 2NUAA 4KX5A 3O8QB 2N75A 3JAKB 1ZG3A 4DPMA 1ISJA 3ONVA 1AC5A 1CZHA 4X62B 1NW6A 1O95D 1WKBA 2HU2A 3GLIA 4M3NA 2BMDA 2VPPA 4WRRA 1YASA 4G0YA 5CXSA 4KXQA 3MQFA 3O03A 3RSGA 3O93A 3PFWO 3B70A 2SICE 4EFDA 1X9HA 2NWQA 3EXFA 1R8SA 3OFVA 4ENRA 1J0BA 4BKOA 4CETA 2ODTX 4UHJA 4F11A 4B3JA 4JYCA 4BAGA 3PK0A 3RGGA 2D5AA 5BYKA 4U6NA 1DO8A 2AW5A 1CY7A 2I7DA 3GNQA 4BFTA 2F8MA 4QREA 1GU1A 2HA0A 3QM1A 3N58A 1J5EB 4JBHA 3B6IA 1RWWA 1VSVA 2Y0DA 1C30B 4FDLA 4HXEB 3ZE7A 4DHWA 2XCUA 3MWJA 5EJ4A 1DJQA 4PZ9A 5KJ1A 5KAPA 5CFZA 4UHHA 4M1KA 1J6UA 5EINA 2IPMA 1MAVA 1NDQA 3KAQA 4RD1A 3R74A 2XHEA 1E3WA 3CGGA 4G5QA 1OXUA 4CPDA 5MN4A 4ZDWA 2YVQA 1CP2A 3AR9A 1QX3A 3DZCA 4K6HA 4WY8A 1JX6A 2V6BA 3Q3JB 4HH4A 1X77A 4JR0A 4MQ6A 3B7GA 4BKQA 2W6CX 2CJXA 1IZ7A 1Z17A 3LBYA 2JD0A 4MWOA 2ANCA 4QIHA 4UHKA 3DBLA 3SNKA 3K9LA 3WMGA 2ZPTX 3ZDEA 4ZYUA 4QOHA 3SC6A 2DF8A 5J47A 2VUIB 3VR4H 1U28C 2JGNA 4OOFA 2EBFX 2Q49A 4C05A 2FE1A 1JE0A 2R9VA 2GLTA 3KQHA 2C3PA 2E5WA 3L01A 3M49A 5MHTA 3IUPA 1QQTA 4W5HA 1AM4D 1OXSC 1V43A 5C3UA 4KXVA 1O8CA 2DLNA 1B1CA 4P7FA 2NU9B 1KJNA 3E3MA 4TMKA 3PZBA 4XYEA 2C7VA 1ZCBA 1QKJA 2JB9A 2APJA 3BXGA 3ZDCA 3IX7A 1QLWA 3KZVA 4Z1MA 4CG3A 4FFVA 1I6KA 3LT4A 3RU7A 4QJBA 3MT9A 3PXDA 2J32A 3A9WA 3EB9A 2KS6A 5DJ5A 5ERXA 1PBNA 4I36A 2FETA 3JS5A 3LW8A 1CY8A 1S8AA 2ORED 4MZDA 2JLSA 4C03A 5AW8A 1X7YB 3DOFA 3T3OA 1Z73A 2E1RA 4TV9A 2IUSA 5JY6A 2DR0A 3QEMA 1G66A 1ICIA 4D8VA 3Q9UA 2BCGY 1N2JA 1EXMA 3DHNA 4JB0A 3SVLA 3CH4B 3KZOA 5A0VA 2JVIA 1N9KA 2D0OB 2VDOB 1HDOA 4JJ8A 3RS2A 2J41A 4RD4A 5FWYA 4F60A 1CRWG 1ABBA 3CR8A 1QYWA 2YX1A 1JR3A 3DEKA 3W4IA 4C4SA 5DNCA 1FJXA 5F98A 5IWAB 3MC1A 5BSRA 3BXPA 2Z58A 3OF3A 1XNGA 1I5OA 2H54A 5IJAA 1PZEA 1YDEA 1P0FA 3DEAA 3LCRA 4AUMA 2R6HA 3RC8A 3BBPA 4H08A 2MSEB 4DJEC 3K1ZA 3B12A 4WNAB 2W2LD 4JI0B 4GKKB 2Z2KA 3HUEA 1YHNA 3BT7A 3EZ6A 5TT1A 3UT5A 2GM3A 3WGKA 4IAOA 3GJYA 5DMXA 3U5TA 2FQQA 2G17A 3WADA 3PJFA 1UADA 1BWSA 3SPXA 3PNBA 3SQWA 1CDEA 1B41A 4PC6A 5DGIA 1JQBA 5GIPE 5IZCA 3N07A 5GM2A 4BFLA 2I4OA 3ND8A 5JOQA 4FLEA 2DYKA 1WCXA 4RX1A 5JQGB 3ZD9A 1D8AA 3S8YA 1A2KC 3M1YA 4GLBA 1YZKA 1QP0A 5ARCA 1NR5A 2ODNA 4E5MA 4LQCA 4Y2XA 2WDZA 3LHKA 5FBQB 2ZYRA 4BFXA 3L8YA 1RZ3A 2O8EB 4QPPA 2G63A 3SXJA 1A1VA 2J6HA 4C1BA 1U8FO 3GFGA 3S2GA 1WZEA 3TQFA 4BVEA 1WXEA 1C3OA 1D2NA 4TRNA 1TK3A 3KP1A 2Y05A 3QHAA 4ROSA 4YRSA 3O7MA 4RMIA 2GNOA 3HO6A 2BZSA 4UAJA 1ZH0A 5E1DA 3AFNA 4F45A 2QMYA 3QFTA 3KU4A 2AN9A 3HWRA 4Y9SA 1J24A 3M6FA 3R6TA 1SCQA 2XECA 1EFPA 3E0QA 2J85A 5FA6A 2SECE 2P35A 3CG0A 4FNMA 5FUBA 2I6GA 5LDGA 4Q12A 2A30A 1CVRA 2C7GA 3FOAA 3QBEA 3OT1A 1LY1A 1C14A 3TVYA 1K3UB 1R0BA 2NVUA 3DXZA 4OFXA 1PWZA 5DX8A 4E2YA 1S89A 2EIXA 4OGGA 3JZAA 3K73O 3PCXA 2W6OA 4LFCB 4IOJA 4HAVA 3I9LA 2UZ0A 2XTNA 3CPJB 5WRFA 3FTNA 4MHTA 2BUBA 2QTFA 3UUGA 3M6MD 3KUXA 1AT1A 1MJ5A 3MERA 4QXMA 4UREA 4NZMA 1Q7CA 4BV3A 1H6AA 5EP4A 3LQ2A 4EHDA 4CLRA 4AVYA 3GQVA 1HX7A 3DVRX 1WABA 3ILHA 3MELA 1H9BA 5BUCA 4KXLA 3PA6A 5B3JC 3A32A 3H5VA 3RYIA 1SC3A 3NUQA 4PO3X 1NFQA 4AICA 4UDYX 1DWPA 3E48A 4LWPA 4UUQA 4PO1A 3IAS6 3OZAA 4YRAA 1CUDA 2FFHA 3DWIA 4UPVA 2M1XA 2C3OA 2R60A 5BN5B 4ERXA 5BMOA 1PJRA 1IQUA 2BM1A 2WC1A 2OO3A 2QM0A 2GSDA 3K16A 4DNPA 3H5TA 1OZGA 1XCPA 5U1PA 2YYSA 3QPCA 2I6FA 3K1YA 2D4HA 3KSMA 1NN1A 2I4TA 1QH8A 1VKHA 1OLOA 2XDAA 4D4MA 1M1NA 2P1DA 4DRZA 4UTPA 1OXVA 1U90A 2AN3A 2ACEA 5D01A 1I7SB 2JLVA 4Y9UA 3S7TA 1XDSA 2O0JA 3DFZA 3WKAA 1F38A 4Z4FA 4B9AA 4WCVA 2LWIA 4FS8A 5CLFA 2GBFA 2HDHA 4L0CA 3SHTA 4I9UA 3GD5A 4PXYA 4DQKA 1KYQA 1O9BA 2WVGA 3JQFC 4BN5A 2PT5A 1CFZA 1FYWA 1N5IA 4KHZA 1C1HA 4COOA 5ALZA 2AI3A 1JU3A 3K9FC 3K4QA 1QAOA 5HIKA 2EHDA 3TZBA 1X7DA 2Z08A 2ON6A 5KDOA 1T2DA 3KPUA 2YWGA 1TPZA 3WO1A 1PS0A 1UBTS 1FSPA 5CT4A 1WDMA 3FMIA 1Y5NA 2FW1A 2G4VA 3ESZA 3BGDA 5FWXA 1G8SA 2H48A 1B8OA 4Z0NA 5IVPA 5C9ZA 1Q0PA 3KQPA 3JSXA 3NAGA 3PEEA 3WP0A 4OB6A 4Y1EA 4ND6A 2JFGA 1GCOA 3AR2A 3L7JA 4HC4A 5BMVF 4XW2A 2PKQP 2VJCA 1LBTA 3OSZA 4FT2A 3P9PA 3C6ZA 4B43A 3RDPA 2GXSA 3HXTA 3IAUA 5IDVA 3NVDA 2IDKA 5GZ1A 2YN2A 3IBSA 5IZ4A 3L8HA 4ZO8A 3SQOA 2OCDA 4M8KA 2ZQYA 3DFFA 2PH3A 2R2AA 3KQQA 5INTA 1U63A 3WK9A 1T3GA 2OFXA 3E0XA 5BV7A 5CBPB 3NVMB 1IJKA 4C0SA 5H70A 2ZT7A 3OQIA 1XXHA 2QQEA 1SY7A 4QBKA 4LJKA 1G9TA 1TTTA 3FYSA 1QG4A 5F76A 3TN7A 5BRAA 4Z7NB 3D8TA 1K98A 1TA9A 1ZA2A 3QLUC 4GWGA 2PM8A 2ZRCA 3QJ5A 3RV4A 4NOLA 2Z2YA 3MQ4A 1IK6A 3GWZA 3MIZA 1P5JA 2WPDA 4QBFA 1FFHA 1DX9A 1ZJ6A 3LVBA 2H2AA 3AF1A 5IJXA 3W3ZB 4P1ZA 2J67A 1ZL2A 1BH2A 2ZE8A 2ANBA 1QQ6A 1I4DD 1O95A 3R3HA 5AXBA 1Z45A 1E92A 2X58A 4JI6B 1LC0A 1RFLA 2YV3A 2Q4RA 1KFJB 2WLSA 4RE5A 1XX6A 2PSDA 1EUDB 2FZLA 3AIIA 4MEJA 4X6XA 1MXHA 4O25A 4C76A 2Z6AA 4YS6A 1M2GA 4RIIA 4PX2A 1YH3A 2RH4A 2BFNA 1DIGA 1I4OA 4MW5A 3S27A 2PT9A 3Q3CA 3ETLA 4G25A 4OMFG 2DUWA 4RA6B 1DAOA 5JCOA 5HCNA 4PVDA 2WAYA 5DM1A 5C8XA 3E1GA 4PPYA 4ZPXA 5FA8A 3BIFA 1GLGA 3P0HA 3U9SA 3TLZA 3HB5X 1Q6ZA 4Q37A 1BS2A 2OORA 1N78A 1QORA 1GCUA 4B82A 4YMGA 2XWQA 3WNQA 2PG3A 3ZY2A 2W22A 1SCUB 5FPQA 4UEWA 3PDJA 1FFGA 3UK1A 1KVQA 5LU9A 5D5PA 1DDGA 2LDBA 5CITA 3OJFA 4QXPA 3H17A 1ZVJA 4OJNA 3T1NA 5KQMA 2QW0X 2FWNA 3NYIA 1EXNA 1GO2A 4NH0A 4B4WA 4UE3S 5E6SB 4CKZA 1Y34E 4IEIA 4MP3A 3UCXA 1OXBB 4DVGA 5JJIA 2I2XB 5I5GA 5EZYF 4AO6A 1H2AS 1W44A 1AA6A 1F2TA 1HDIA 2QXTA 2A4KA 4A10A 1NBME 4BAZA 1P91A 3RS4A 1RT9A 3OMWA 4IXWA 5GMOA 4AM8A 3TJRA 5CA1B 3HM9A 4DGQA 1BHQ1 2Z9CA 3IP9A 3UEOA 1C3VA 2TMKA 3D8HA 1SHLA 3N39C 3AP3A 4X45A 5B4TA 3EGDA 1JIIA 4W1SA 3ONFA 4NBWA 5J2UA 2ZJ2A 1MQSA 3P9SA 3FN4A 4RESA 1PCXA 3ET5A 4QU5A 3SDSA 3WFJA 3MMZA 5DXFA 2Y4NA 3AVTA 1R0LA 1NUPA 1X19A 4CT4B 4XQEA 3CUEF 4XWYA 1JA9A 4ZI7B 1A8SA 5A1TA 1WBDA 4PPFA 2HLNA 2W2QA 3AHHA 1B74A 3ABRB 3K09C 3TIFA 1XZIA 4I5EA 4KAFA 3V8NA 4AULA 4OM8A 1EQAA 2VJDA 3LLUA 5TARA 3S0JA 1NUQA 1E1CB 2PO5A 1CUBA 1A9XB 1ELOA 2HIAA 3T52A 4EABA 5ALJA 5B58T 4PGMA 3C3BA 1T9AA 4UD2A 5KNLA 4J07A 5CB0A 2HU5A 3I5MA 5T64A 4L2IA 5HGJA 1DJPA 1UK8A 1GJRA 3TI7A 2IKSA 3OPYI 3U60B 1FC0A 4NENB 3SSOA 2PGNA 1CYEA 1V9CA 2D1TA 3QOFA 4K9SA 3A70A 5AVZA 1A8UA 3EGVA 3LNTA 4WY2A 2A9RA 3V48A 4X8HA 4M9RA 2CK3D 4L8LA 4RF4A 1GRQA 3B53X 4TTPA 4HYEA 2A9QA 2WAMA 3KJQA 1OPXA 2P3SA 5IJWA 5JNWA 2F67A 1U6IA 2W2LA 4IIDA 4RQBA 1LF0A 1F2UA 4AT1A 3PIIA 3VOBA 3RJMA 2RK3A 4UU7A 5JRDS 4KMMA 2W70A 1Z2EA 5ED4A 3GZ4A 1QYXA 1G59A 1XO1A 4QU9A 3TRDA 4CMKA 1COZA 1IUOA 2C78A 2EAUA 4II3A 2DY1A 1SUWA 1YL6A 2EW2A 4QPZA 4YRDA 1G8JA 1YIOA 4MPRA 4WZBA 9LDTA 1Z0AA 3GZNA 2QZJA 4KWIA 5I9MA 5G0TA 4M1OA 4EPRA 5E95A 1OBVA 5ILQA 1U8YA 2KX7A 2Q5JA 3HN6A 3N0VA 1JJBA 1U3VA 1LLDA 4MJXA 1LS1A 4HRAA 3VYVA 4WHMA 3RS9A 1E2JA 4WCFC 1JEEA 1F0NA 1PK8A 3U4GA 3WA7A 1RJEA 3HMKA 4CTMA 2BI4A 1XMQB 1KDVA 4Z9XA 2P62A 1SD1A 1YOVA 1BX3A 2ZDGA 3HNPA 4P92A 4C7OB 1J0DA 3U26A 1JBEA 3GYGA 1M2FA 3WWPA 4DKXA 4YT8A 4H1WA 4D6YA 5B3JA 4H4CA 2P5SA 3M6WA 3P2MA 4ZA2A 3IULA 4GI3A 2G80A 2V5UA 4IUDS 2YQ5A 5KYYA 2VN8A 3QRWA 2NSLA 2AZDA 3VJKA 1UK7A 1XRNA 2GF0A 3A6JA 3C6BA 2RGWA 3CMCO 3H84A 3IQWA 3WGGA 4A8TA 5K0SA 1Z4NA 1Y3FE 3G79A 1SOAA 4B71A 4C3OB 1LI5A 1ENOA 3ZYZA 4YRTA 4Q48A 3RVSA 2FR8C 1KMMA 4XLZA 5U9CA 2DXIA 2YJTD 1VP9A 1T0JB 2W2MA 4GH5A 1JG3A 2DCMA 4IIJF 4M0MA 4LGCA 3M6LA 4WINA 3RIXA 4EKNB 3NIDB 5A3RA 4DWOA 1QFMA 1XL1A 4ALLA 1ZISA 2VH2A 3COJA 3W8EA 1GYQA 3A7EA 3EZGA 3RRNA 3H87A 3S2YA 4WASA 1TVKA 3C3PA 1T9BA 4TT8A 3UG6A 3H11B 2Q3FA 1K7FB 3DOEA 4PC1A 5BSUA 4DJTA 3G2QA 1DMRA 5IJ9A 3DG9A 2QVCA 1EPUA 4JB8A 1EM6A 4KQJA 2GQ0A 4DR3B 1MN6A 4U63A 1A96A 4LJLA 2ODWA 4KO8A 2B3TA 3VU3A 4EGQA 1YMUA 2LDXA 3U4QB 1DXYA 2A1TS 1PG2A 3TNDA 4ND8A 2PGLA 2KLBA 3ZHVA 2HPVA 2X2PA 3CT6A 4LF4B 1T29A 2H0RA 3NATA 5KC9A 1GGFA 3IQZA 1M8KA 3KYBA 4TROA 3LBIA 1KC1A 2VA8A 4IIGA 1HFJA 4KV7A 4YAJA 1XN4A 2B82A 2I3DA 2AR7A 3FGZA 1HE2A 3O6VA 2H6EA 4H7PA 3T5BA 1FJ2A 4EQ6A 2B5OA 3LUCA 4R31A 4R5HA 4XX1A 3HWSA 2V7GA 3GIWA 2DETA 4JL8A 1XCOA 1ZM4A 4FQ5A 4Z9FA 2GMWA 2WHPA 2L0XA 3V7FA 5D7BA 1NW8A 5KKCA 1YJ5A 2EFGA 5B1SA 3LAWA 5I9LA 2WJGA 3D2CA 1QONA 1HNWB 1ES9A 2Z8XA 2VBGA 5GIOE 4FFRA 3EOZA 3M6XA 4RKEA 4F2PA 5DFAA 1FP4A 2DKNA 1ATIA 1IOWA 3EIOA 1OGYA 3IFSA 2PBFA 1J1ZA 4EA7A 4QKQA 5A2QA 5F1KA 2XE7A 4GQAA 3C3EA 3T9EA 2XZPA 3ENVA 1VHWA 2Q0QA 4WKCA 3UO8B 3ROZA 2HQSA 4EGJA 3TI9A 3U09A 3CLRC 4RM3A 4D0LB 3DWFA 4GI7A 2ZIEA 4NFHA 3VR6D 1E89A 4FXOA 2DKOA 1MDFA 2X0KA 4LXIA 2CKMA 3H1PA 3ZXIA 1UOEA 3ZWXA 3NALA 3H75A 3HZRA 2UU9B 5C5DA 4CLEA 4L08A 4PLPA 1Q95A 3TVTA 4DMRA 1GTG1 4YH1A 1TE2A 1FTSA 4AXBA 3Q8MA 2BTEA 2LNDA 3ROPA 1UKZA 2FHSA 4MI1A 2DBZA 1AG9A 1QQAA 4Q82A 5CVVA 4JLUA 3H65A 3OZDA 1W47A 4D1YA 5C4IA 3C8MA 3E2PA 1F9EA 3I5AA 5IANA 4K0RA 3HKEB 3LDHA 5AIAA 3EVDA 3HVHA 3TH5A 3WLTA 2RI6A 4B3DA 3GZJA 2Y93A 5EHQA 4Q1BA 5JT1A 3O47A 1TU0A 2OXCA 3U3KA 4RTKA 1TQHA 3GZTB 5H83A 1NYLA 1SWWA 2V4ZA 5ALGA 5TV2A 2ZJ8A 4D80A 4JJKA 5BWBA 3UWMA 4WN9A 3S44A 4RTQA 3C6XA 4E5DA 3N8KA 1WP9A 2OHJA 1LEHA 4FYHA 1RHJA 2G9VA 2IEBA 2QTNA 3FR8A 3TZLA 3TLBA 1D5WA 3RNOA 4H6XA 1GRRA 4B3BA 4ER3A 3MWYW 1BGXT 2OV3A 4QM6A 4QVKA 5JC8A 4OHUA 2F1HA 5DI9A 3T7EA 4PNEA 3R7FA 2ZYHA 2VXBA 2WILA 3KZ1E 4JELA 5CNJA 1X7WA 1MH9A 2JGRA 1ODIA 2HWWA 5AM5A 4KQGA 3WJAA 2IBTA 1DQNA 5BO5A 1PR6A 3Q6IA 3R7AA 1E61A 2BUAA 4YCNA 1U5BA 1BVHA 3N2GA 4ICIA 2DHRA 2YHUA 3FJ1A 1QIKA 4LX8A 2ZAOA 4FYMA 3LRPA 4KIJA 4QU8A 3SE0A 4AJEA 1XAIA 1XYGA 2EGUA 3A1DA 5IF3A 1H4SA 3RROA 4MS3A 1T3SA 1W9HA 3LYAA 3NHAA 3T9DA 4RTRA 2R6AA 1KSFX 3O8OA 1DIHA 4H7JA 4YWJA 2J5BA 5DTIA 3AETA 2PLRA 1SU4A 2H00A 2NP6A 3H1GA 4IBOA 4ENVA 3M1AA 4PLTA 5FWNA 4ZVTA 4GZLA 3V2UA 5IBPA 1UBJS 2QGFA 1IPEA 2RBGA 4L57A 3QYFA 1Z5ZA 4A1FA 4QFMA 5CDGA 3D6HA 2HLDA 2NPIA 3CXUA 3HGTA 4YO8A 1QWSA 3TB4A 3PHIA 3DBOB 3JVDA 5JS6A 2Q6TA 3JQQA 1MAUA 2Q5EA 3OZUA 1AK1A 2R4UA 2BD0A 1TKCA 1P2VA 2HRQA 1YKSA 4FDUA 3A6GA 4Y7DA 16PKA 3IOMA 4LZJA 5DGTA 2Y9PB 3JYPA 4Z7JA 1MVLA 2WAXA 1BDIA 1YGPA 3ORQA 2GN2A 3NC4A 1H05A 4MS1A 1QXSA 2A9KA 2AFIA 2D8MA 2XAAA 3QE2A 1GOTA 2EBWA 4PAOA 4W9NA 1T0HB 1E1RD 1MLDA 3B1KA 5CM2Z 5KVAA 2GKOA 1HYEA 2PXXA 4FN4A 3V8VA 3U4HA 4ZAXA 1KR5A 3UWKA 2QG9A 1JSXA 2QN6A 3R3SA 4WZAB 2P40A 5JDCC 4XE5A 2I8LA 5G0UA 3DOJA 3DVLA 5JJBA 1BW9A 4RK0A 4AIRA 2AJBA 4GLFA 3RH0A 4KR6A 3EXEB 1VJCA 2H4XA 1WUTA 2C4TA 2CLLB 2EJTA 1PJ4A 2VF4X 4CM4B 3SQXA 5DGHA 4PX5A 1PL6A 1ZNWA 1EZ4A 1IBSA 1NVAA 1JALA 4IEFB 5CFNA 4KR3A 1ZWKA 2RHGB 4GYYA 4LBZA 3B2NA 2WU3A 2ZIAA 4IVQA 1L5KA 5J4LA 4DSZA 4LJ4A 2B20A 2HGZA 5F7XA 1L5VA 2WG2A 2C42A 1MC5A 2ERCA 3HBFA 5IAGA 2X9GA 5AR1A 1MRZA 1ZRSA 5BYJA 4B6JA 5BOVA 1OC2A 4HYTA 3LG2A 1L7RA 1AZTA 1PDVA 5H1YA 5BNWA 1HFKA 1DOAA 2HEGA 3OUUA 1QZXA 3B1VA 2CK3A 4M0UA 5DLDA 5IM4F 1WPXA 3OEED 4PG6A 1JFLA 1S7CA 3A1WA 3AP1A 4TV8B 5AJXA 1P4JA 4F04A 1WOMA 3F9CA 3N3AC 4Z4CA 1NP3A 1HWYA 1DUIA 2DWPA 2ODAA 4I4TA 1TUGA 3MB8A 4W6ZA 2ZWPA 1ORRA 1P9NA 1RM5A 1OAAA 5EJMA 4RK5A 1JMYA 2PLAA 2ZDHA 2HX1A 3D4IA 5HM8A 1H4QA 3FY4A 5DX0A 1E5VA 5CP8A 2J33A 3W6NA 1DBWA 1FP7A 2IIBA 2JCSA 4J7AA 1X7ZA 3EH1A 4MV7A 5EQTA 4WPGA 3D6TB 4A73A 4CMCA 4FBMA 4BNKA 5LD2B 5KTKA 4LRWA 5CX4A 5F3RA 2GR9A 1FDVA 1NASA 4OU4A 1NW7A 3D6VA 4DW8A 5IU6A 5K2OA 4X84A 1Y5RA 3K31A 2CZCA 3A9UA 3AOEC 5A3QA 4J43A 2C61A 1M6NA 1RHUA 1DBPA 4NOMA 1RABA 5JIBA 1RACA 4H3VA 4FYWA 3HXPA 4G8JA 4BX0A 1VMEA 2IJGX 4H16A 5TPZD 3JYHA 3OQ6A 3REFA 5KYKA 1M54A 4EX6A 1LC3A 1A95A 1DADA 3D81A 1B0PA 1EHYA 5KYGA 2LBPA 4YJ2F 3O0TA 5J2TB 1JLLB 1ZDMA 2JANA 2NO7A 4U5QA 1KERA 2WWWA 3T5MA 4AQYB 1J99A 1G16A 4NYIR 1J22A 4I1RA 5FOQA 1UJCA 3GQBB 4LTMA 5GOZA 1QP4A 4KUGA 3A9TA 4LDQA 3ZBUA 3LSTA 4HQ0A 3TZEA 5CA0B 1GPMA 4IVNA 3IVGA 2F8LA 2V8OA 3OZGA 4FE4A 2RK6A 4PPGA 5FLYA 1QX4A 2IQ5A 2B61A 4N7RA 1MB0A 2C5GA 3HCPA 3KXPA 2J5RA 2PGIA 2A7QA 2QBYB 1CETA 1JQ3A 4I6EA 1ULTA 1Q1BA 5BMVB 3A1FA 5D6NA 4DSNA 5F5NA 4X64B 1XZLA 2CEAA 2H2IA 1BQ3A 3E4DA 1UPFA 2UZ1B 4RDHA 3BFJA 3VU0A 3UC9A 5K3CA 2Z56A 1I7NA 2IXEA 4XIYA 2OQIA 1CXZA 1JDBB 3OA2A 3RAPR 5KSPA 3IOYA 2HHAA 2WZBA 4G0MA 2QJRA 2JLAA 4Q4HA 3QOYA 4Q4LA 5EKUA 1IJEA 1J0XO 4TS9A 5EXXA 3UJ9A 4CN9A 1JKFA 1VLLA 3E3AA 2R25B 3DWGA 1HSZA 3EEBA 1RM4A 3KELA 3UK7A 2JI8A 4QBTA 1XZGA 4MMZB 1ZMXA 2BDEA 2RKOA 5LNK1 1KSHA 2E85A 1FTQA 1ENPA 1QZZA 3CF4A 3DE4X 4TYPA 4GL2A 3RRXA 3INNA 4QGAA 1NJGA 5DLPA 4LVCA 5KOJA 4JITA 4NE2A 3M4ZA 4HNRA 4QO7A 2L69A 1N9ZA 2PTHA 1RAGA 3BJEA 2JLCA 4GPEA 1W9MA 2A5DA 1YZFA 1CJCA 1LTQA 5HKAA 3OJLA 2ET6A 2PS1A 3X2FA 5JH7A 3KJZA 1PX0A 1NOJA 1UT6A 3IMGA 4GECA 3ZU6A 4M0CA 5JYEA 3BH6A 3TRFA 3BRSA 2A9OA 3Q3HA 5K8CA 1DEKA 4JQZA 3RJZA 3VKFA 1AKEA 1YUBA 1JJ7A 1RRKA 1V3TA 1K6IA 2MYUA 1MV8A 1YRBA 4EVIA 1L1FA 4TKVA 1Y3IA 5C5IA 5CAEA 3PQ3A 4PHFA 3U3DA 2QQGA 3HCWA 3WHIA 1PL8A 3ZE9A 2IYEA 1WZNA 4XWAA 4XVCA 2AC7A 2BFCA 4LISA 4TUYA 3VR6A 4L3WA 1FNDA 1LNQA 2P2NA 3OOWA 2W2OA 4B47A 1X87A 2W5UA 1DKRA 1I6WA 3C5VA 1GTSA 4QATA 2IYOA 3UAYA 2GYWA 3G8AA 4GXTA 3AFMA 2PUHA 2P7IA 1NNSA 4BHTA 3M4NA 4DSUA 3ABSB 3QNWA 4B44A 3CISA 5EXTA 4QEKA 1W8IA 3L46A 4AYTA 2FK7A 5I7VA 2GYUA 3LLVA 4CM8A 1OZFA 3NWEA 2GEKA 4Q1FA 3UANA 4RTMA 1GKYA 5DN9A 3LXUX 2ACVA 4E46A 4US1R 4ZIRA 1FRVA 3LL4A 1RJGA 4DV5B 1FP1D 4ZCRA 1IBLB 2FNAA 3BK1A 3FMVA 4Q3KA 3EX7C 4J0GA 4TZTA 4MWTA 1TW3A 1OXMA 2PX8A 2Q29A 3C74A 3QVSA 5EZYB 1JYEA 4BO6A 4TMVA 4MQEB 1JEOA 5HIAA 3W5SA 3W8NA 1JSLA 4R1NA 5HPYB 3NWBA 5CMLA 4Z0TA 1GUDA 2EGGA 2Y0CA 4ZVSA 2Q5QA 1GTMA 4PG7A 4FFMA 4CLDA 1Z68A 1Q1QA 4F38A 4AUEA 2ZRJA 4CIVA 5IHXA 3BFKA 1IWBB 4ZJZA 3X43A 2B4KA 3LUGA 2JFPA 5LMZA 3NRCA 3UH0A 4WAUA 5KVVA 3DZJA 4HB0A 2GAOA 3W6ZA 2GZ1A 2WB4A 5H7XA 1OI2A 5JAUA 2ZSJA 3RSSA 2WIJA 4KZKA 4YXFA 2HQRA 1T8PA 1L7VC 1XTVA 2JHAA 5G1PA 2W2TA 1NX6A 1UF9A 1MU0A 2IYFA 4PFSA 5FBHA 1CQJB 2O5RA 3BIXA 2V5AA 1K5DA 3N05A 1VLHA 3WLLA 2YH2A 3WFIA 1K7CA 4U7FA 2AVNA 4Y2TA 4HCJA 1XUOA 4PRZA 2WG0A 3N7TA 4NYJQ 4EY8A 4C0QC 1K7XB 3A6ZA 1PJQA 1GFZA 2FX2A 2Z9DA 1I2BA 4Q5IA 4MIOA 4P33A 2XTJA 2ALJA 1S8NA 3FVRA 4MZXA 4OP1A 4DCJA 4BRUA 4G24A 2FUCA 1DBVO 3A9SA 4ZEXA 4B6SA 2ODPA 3ER9A 1KARA 1T2UA 2FPPB 4R2IA 4CEHA 3LQ4A 1T2VA 2WJIA 3O83A 4P9NA 4RK7A 4UZSA 3DZHA 1ORWA 5EXPA 4IVRA 1QVVA 1CIPA 4OQDA 4PZYA 1CJSA 1H2RS 2QPLA 3AHGA 2E7ZA 3BE8A 4UTZA 4BRZA 1WU8A 3RKSA 4YYEA 1QC5B 4WDQA 3O92A 4KPFC 1P73A 5IEBA 5ICEA 5JDCA 5E6UB 3SWWA 5BSKA 3ZEAA 4LRUA 4Z8XA 5U4XA 2VCEA 4LRXA 3TXXA 4E1BA 4MPTA 2QRPA 5JALA 3LWZA 5MDHA 3W05A 1GQYA 1WLYA 1DAIA 4MR7B 3T06B 3CV3A 1EVYA 3JATA 4IVPA 4MVJI 3TSOA 2X5JO 4AZ0B 2H1WA 5LQJA 3DMPA 2VQFB 1XZPA 4OKNA 4C6SA 2IV7A 4UE2A 2QD5A 3DPUA 4FE7A 4DC9A 4TTAA 5AQ1A 1WEKA 3UAXA 3WV4A 4RYLA 5AVJA 1H8HD 1CIJA 2DBVO 3PPWA 5A9TA 1SUDA 1CHNA 2P67A 1KEZA 2I33A 3AJ9A 3B6EA 4ZTUB 4EUNA 1D6JA 4BO5A 1D1TA 4NIMA 4NZYA 4AJHA 4A6XA 3P9YA 2HZ7A 5AVOA 1ABFA 2VVTA 5EWJA 3ZOKA 3WRXA 3TGLA 1X70A 4FHCA 3BICA 4X0EA 3X44A 3JAMA 1FS6A 5FEUA 3HS3A 1AY0A 5CB4A 5LMNB 2EVWX 3FBTA 3P2KA 3WB2A 2H18A 3MFQA 2D5LA 4OHBA 5JSFA 2ZOSA 3G5UA 1EFKA 1I5EA 3WICA 4MDEA 2C98A 2CFSA 3ISTA 5FTLA 3DO5A 3WOVA 3RWMB 3IPAA 1V2HE 3FNGA 4MIYA 4Q18A 3RIHA 4JLBA 3D8SA 5ICMA 2R87A 2VJMA 1P9WA 5GJCA 4ECAA 5ABPA 2G04A 2C97A 1RBQA 1M33A 1EH5A 3HB1A 4JQSA 3FPBA 1YXMA 2EYUA 3G2KA 1Q14A 2HY7A 2UKDA 1P5HA 5AK3A 2ILVA 4GU5A 2CNBA 3LPCA 4LNUB 4QGGA 3TIIA 4UBIA 3R0JA 3ZCQA 5A3SA 3D5TA 1QO0D 3X0DA 5K0GA 4Q34A 5EWLB 4YV2A 4BEBA 1IN4A 1NMXA 1NSFA 1TVEA 2YJ5A 3Q0EA 4I55A 2J0EA 1WB5A 2ZUWA 4NNPA 1NI5A 5IWCA 3QKIA 1FF9A 3A36A 2ZM5A 2JRLA 4AU1A 2YWCA 2AE1A 1PHPA 1NMYA 2ZSAA 3EZNA 1TJ3A 2KWIA 3K96A 4MPPA 4E5VA 1RYHA 4HV4A 5JVDF 3NW9A 3Q98A 2B34A 1W5SA 1Z82A 5IW8A 3RS3A 3JQBA 3LBAA 4BUZA 3T99A 1P6XA 3EXHB 3OG9A 4YCJA 4A26A 3QELA 5FDFA 2CBXA 1MUUA 1SCAA 2RHDA 2XEXA 2XT6A 1V8FA 4QU0A 3RNLA 3W2FA 4EY4A 3A4TA 4X8MA 4TV9F 4ZYWA 4XWWA 3MWFA 2XVAA 3TAHA 1RD4A 3WGYA 3HKCB 1TA4A 4JUIA 1E6CA 5FFNA 1P2DA 5FB3A 3QPWA 3T7IA 2G9QA 2COKA 5DHAA 3U0VA 4I4CA 2OT3B 2AJDA 5LB4A 1G6KA 3A4NA 3E82A 1LZKA 1TVCA 5LP6A 4Y7CA 3UHPA 5F4ZA 4NNOA 1WHTA 2R65A 3THXA 4ZVOA 4ER7A 4X6UA 2Y76A 2CDCA 1VLJA 4ITUA 4B3TB 3TXAA 4H1VA 3LPLA 2V3CC 4KFTA 3RAFC 3P5SA 4U6QA 2UVPA 1Q17A 1KO5A 2WSLA 4LJ6A 3OAAA 3THYA 1ESNA 1TM5E 4GT1A 3I53A 3P7MA 5TPZA 1P29A 4CDGA 4EENA 3B2QA 3GEIA 1PL7A 4HX2A 2WIGA 1SMKA 1TCBA 3PHLA 1ZJ4A 4B8YA 2RMKA 1UFKA 1O6ZA 1VG0B 4HB2A 2YNMC 1Z6ZA 3NUZA 3PFIA 1E3MA 4MI6A 4RPGA 3P1JA 3ZWKA 1JG2A 2Q2QA 2XXAB 1K6EA 4HN2A 4NXMB 1XL0A 1CEEA 5K3SA 1G5TA 2J7PD 3SF8A 2CYCA 4C0HA 1JL3A 1BE1A 2P2YA 2Y1KA 2ZRKA