3JQ7B

Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor (nadp+) and inhibitor 6-phenylpteridine-2,4,7-triamine (dx2)
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
267
structure length
246
Chain Sequence
b'EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVKTVETQVAELIGTNAIAPFLLTMSFAQRQNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pteridine reductase 1
publication title Structure-based design of pteridine reductase inhibitors targeting african sleeping sickness and the leishmaniases.
pubmed doi rcsb
source organism Trypanosoma brucei
molecule tags Oxidoreductase
total genus 94
structure length 246
sequence length 267
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2009-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3jq7B00
3ZWVA 2O2SA 1EVIA 3K96A 4IPTA 2X4GA 1Y5MA 4IMRA 3ZV3A 3L6OO 4KWIA 5JAZA 1HDXA 3I23A 4E0BA 5IF3A 5FI5A 1OBFO 4YAJA 4G2NA 5TRTA 3DDNA 4ZQBA 5HRUA 1JKIA 1XGKA 1MFZA 1EVJA 5DT9A 2GZ2A 2VWHA 4NR0A 1ZJZA 3WBBA 3MWEB 4FPXA 5TLSA 5COQA 4B7XA 2IEDA 2EW8A 2FZWA 2PFGA 3RC2A 3TQHA 4YT2A 3FTPA 3GEGA 4BNTA 1UDCA 3V2HA 2VNSA 1RM4A 1U28A 1V0JA 3ITDA 2QIOA 2NVUB 3UKOA 4UEJA 2CDAA 1J0XO 1E3SA 1NWCA 4BO4A 3QVTA 3B6ZA 4MVJM 1B3BA 2P5UA 1JA9A 4YJHA 3RC9A 4CM8A 1UJMA 3P19A 2CNBA 4UEKA 3ENKA 3TRIA 1V3UA 2Y1GA 3U9LA 5ER6A 3S55A 1YOVA 3KTDA 5KJ6A 5KVCA 1QG6A 3WNQA 4B7CA 4P38A 4FFMA 4FBGA 2C07A 2BKAA 2HK9A 3ADPA 3GA0A 1NQOA 2O3JA 4XR4A 2IZZA 4HFJA 2NTNA 1NBOA 4EW6A 2VN8A 3M2PA 1AE1A 2QG4A 1LDYA 1NHGA 3NTRA 5I7VA 5FWNA 4BS9A 2B36A 4RVGA 4JQCA 2G1UA 3B20A 2BELA 4E2XA 3GNQA 3V2UA 3C1OA 3Q2IA 1E3WA 3I4FA 1X13A 3G0OA 4IJUA 5EIOA 3KB6A 1U4OA 4KTVE 2A4KA 4A10A 4D79A 3ZV4A 5I8WA 3JQFA 1Q1NA 3JCZA 3KYCA 1FDUA 4TKMA 5DCUA 3BZUA 2HO5A 3I83A 4AJEA 1GPJA 1QYDA 1MXFA 1YBMA 3JYOA 1HF3A 1H5QA 1Z7BA 1ZK3A 3H4VA 4RQUA 3ZHBA 1PJTA 1Z75A 2CVQA 3DZHA 4MKXA 3G3EA 4GKBA 4IIVA 4CM9D 3IJRA 4HFNA 3DAGA 1I8TA 3BMCA 3D5QA 4YR9A 3VHRA 4WECA 3WGHA 2PKQO 1ML3A 1N8KA 1IULA 2CF5A 2V6BA 2D4AA 3WXBA 3UN1A 4I9HA 1ZSNA 3W4JA 1LUAA 3JTMA 3F1KA 2R6JA 4YT4A 1MGOA 1ISGA 4R1SA 4Y9DA 4YVFA 1T1SA 5IZCA 1ZJYA 4XJTA 4AJ2A 4J90A 3DHNA 3WQRA 4JGBA 2X0NA 4FOOA 2BRUA 4TKLA 2VZ9A 2WJPA 1DC4A 1ZK0A 2PK3A 3AM5A 1HKUA 3R3JA 2AG8A 5GZ6A 3ANMA 3OETA 5CEFA 5TT1A 3QWFA 3ZHZA 3GVHA 3P7MA 2EWMA 4CM8B 2TMDA 4E12A 2FOIA 4LCEA 4A26A 3LLSA 3N74A 4F6LA 1X7DA 1PGJA 1B26A 2C29D 2Y1CA 2Z95A 3PYMA 5BQFA 5BSHA 5EQDA 1D7OA 3OQ6A 1AN9A 2VTDA 1MX3A 4QUKA 2JCVA 1I2CA 1R37A 1YJQA 1YB5A 4YQYA 3HDQA 2D8AA 3WWYA 2VWPA 2BGLA 3WLEA 5CPBA 1GQ2A 2AE1A 5B12A 3QWAA 4IDEA 2I76A 4DMMA 4BMSA 2NNLD 5EN4A 1I2BA 1RPNA 1LRKA 4BL5A 4NIMA 1B8VA 3DB2A 2RHCA 4JNKA 3VC7A 5A03A 2GR9A 1CRWG 3VZPA 1Y8QA 1PJ4A 2DBVO 5CDSA 1DRVA 2P68A 2ZB7A 1GUFA 4JP2A 5U1PA 1F17A 2Y67A 3QLJA 4F6CA 1ZO8A 1E0DA 2BFMA 3RSHA 4U6SA 1MXHA 3FRJA 1CIVA 1J49A 5A5FA 1QP8A 1HTBA 3GAFA 3AOEC 3AI2A 4NJMA 4B7UA 1WXDA 2SCUA 1UP4A 4FIZA 3H2SA 3WGOA 2CDBA 3ZNQA 3BMCB 5EPOA 4A7PA 3JQAA 4XYMA 1YE3A 5HM8A 3UICA 4R54A 1F06A 4LRTB 1T2CA 4QFCA 5A02A 4W99A 3RFXA 1LDMA 4CMGA 3I9NA 3IP3A 3WGYA 2O3QA 1YJ8A 1YO6A 2YV3A 3OQBA 1B8PA 4INAA 3ZWBA 1JWAB 4HV4A 3NTOA 1LX6A 1KVQA 3V1YA 5I9LA 2CD9A 5MDHA 4Q39A 5JFOA 3QQPA 4PRKA 4W6ZA 1PGPA 3LC7O 5AXBA 1HZZA 3LT4A 2AW5A 4CMKA 4RGBA 3R6DA 1K6IA 1LDGA 2GN9A 4AFNA 3DAFA 3JSAA 3PGXA 3WYEA 2CF6A 4DREA 1BTOA 1CWUA 1S6YA 2PZLA 4M89A 4D45A 1XR3A 1VL0A 1ZNQO 2JD0A 2YFQA 4CMEA 1EUDA 1E1MA 4ONEA 3CXRA 5I9MA 5TIIA 2Q3EA 4AL4A 1R4MB 3PFFA 3PP8A 5CG1A 3OEYA 2EG9A 4FC6A 3WQQA 1L7DA 3RQSA 1UR5A 5B4TA 4D41A 3CTMA 1YL7A 2JD2A 4LSWA 2Q2VA 2GZ3A 1E6WA 1Z74A 3T4XA 2YYYA 1SEVA 3KSUA 3GUCA 4RLSA 1H6DA 1WZEA 4NDNE 3DTTA 4YWJA 2X1HA 3FNFA 4B3JA 5C3MA 2FMUA 5JDCC 1WLYA 3DONA 4BO6A 2FPIA 1K2WA 3KVOA 5JLAA 1KVUA 3HDHA 4I5GA 5IAAA 4RDIA 3NT4A 5G0WA 4CMCA 2I3AA 1CJCA 1GAEO 4I5DA 3NX4A 5F5NA 3RJ9A 3V1UA 3VPHA 1I2ZA 2HMVA 2EF1A 4BMVA 4WK6A 3LT1A 3L4BA 3S2IA 2B5WA 4Y6PA 1F14A 4ZU3A 2JJYA 3FSRA 3QIVA 2QX7A 3IUPA 3VAZA 2P5YA 2NU6A 1VJ0A 3LLVA 5A04A 4E6PA 4EYEA 1A27A 2GERA 5JBIA 3SVTA 3F6YA 2V7PA 4CLEA 4O1MA 2AA3A 5ILGA 4R3NA 1CETA 3JQ9C 5KNLA 3NRCA 2X7HA 3CEAA 2X5KO 1EVZA 3H2ZA 3QVWA 2AQ8A 4FGWA 3D0OA 4K1LA 4YAEA 5KKAA 4CMHA 2DTEA 3L9XA 1JQBA 3BTOA 3HWRA 4ND4A 5F21A 4EJ6A 4YAIA 3IDSA 5EINA 4GGPA 2DBZA 4R51A 2J5QA 1KIFA 2W2KA 3DBRA 4GWGA 5HA5A 1ADCA 3VZRA 1GFSA 4YACA 1T26A 5TQVA 3MOGA 1BRMA 4I5FA 2NWQA 4FJ1A 5LCXA 1JAXA 3RCBA 3RUCA 3UCEA 4BNGA 1O8CA 2BFAA 1I36A 5ER9A 5A9RA 4QO7A 1GU7A 5DULA 1W8DA 1I33A 1N1EA 2GASA 1K3TA 3OQ1A 5G0VA 2Q1UA 4J1TA 4JBIA 4IDCA 3W4KA 4Q3NA 1EBUA 5A3VA 4CV2A 5IXYA 3HDJA 1T25A 3E6AA 2GYYA 2GGSA 4CJXA 3NGLA 4IS3A 5KOIA 4GKVA 3DBHB 1MC4A 1H2BA 4ND1A 5JO9A 1GYQA 1WZIA 1ZEMA 2YV2A 1DOHA 4CM6A 4WOJA 4PG4A 1U8XX 1I24A 4N18A 3NKLA 1HDOA 1DSSG 1P1RA 3CZMA 4DBZA 2ZJ1A 3DC2A 5THKA 4S1VA 1WDLA 4J4HA 4ZD6A 4M86A 4YXFA 5ITVA 4NFHA 3QE3A 4BO3A 1GEGA 1QYCA 3DR3A 3GY0A 1BDBA 2B83A 4WEOA 1DDOA 2E6UX 1PZGA 4BVAA 4DIOA 4TROA 3ZDFA 2ZCVA 2DFVA 2QHXA 1R0SA 2O3UA 1Z82A 3BMQA 4CUZA 4NH4A 1XYGA 4W4TA 1NQ5A 1G1AA 5TC4A 2DQ4A 4XDYA 4OSPA 3O26A 3IP1A 4NU6A 4QXMA 2WD8A 4B4VA 1NM5A 3JYPA 1XSEA 3DMYA 4OGWA 3TZ6A 1XU9A 3ONDA 3DFZA 4IQGA 3OSUA 4PG8A 1YWGO 3K2BA 1X7HA 1IY8A 1ARZA 3HADA 1U2GA 2EHDA 1WW8A 4JXKA 4L9RA 1HE4A 1QYXA 3GQVA 2YQ5A 1DIRA 1SZJG 3QWBA 3WTCA 4EEZA 1VE9A 3CSDA 3HE3A 2O4CA 2HU2A 3DOCA 3F4LA 3OJFA 4D46A 1DAOA 5JE8A 1LTHR 1ISHA 2GUGA 1GTMA 3DBRB 2ILTA 4OOEA 1GL3A 3RUIA 2QW8A 2GLXA 5L7TA 2E82A 2O7QA 4L4SA 1E3JA 2B0JA 1U1IA 3GOHA 4KMSA 5ICSA 3ZWPA 5T5QA 4D3SA 4FCCA 3NDRA 2WE7A 1GZ4A 3OBBA 2Z1NA 4XQCA 1HYEA 1JU9A 3CUKA 1TB4A 4UEOA 5CDGA 2I67A 3ROQA 3A14A 3RU7A 3MZ0A 2D1YA 3RBZA 4BIIA 2NQ8A 4TMFA 2PLAA 1OI7A 4Q3CA 4CM4A 4CM9A 1SOVA 2GCGA 4HXYA 2J8ZA 1ZK4A 3MCVA 2EJWA 2GD1O 3WR5A 1EK5A 2C2XA 3F3SA 3OA0A 4WCFB 1XDWA 2GPTA 3W8FA 4FC7A 5K9ZA 3H65A 4M55A 3GDFA 2HMSA 1GCUA 2G82A 2I5PO 1D1TA 2A92A 3FR7A 5BNIA 5C37A 2Q4BA 4E3ZA 2X86A 3SJ7A 1R6DA 1HEUA 1JW9B 2Y93A 5JCJD 2OGUA 5G2OA 3GN2A 4OIMA 3HB4X 4L4RA 5TS3A 3CH6A 1XCBA 2W90A 5L40A 4WLEA 2X9NA 3GGPA 3GRKA 5G4KA 5H81A 2VUSA 4BUCA 4UVIA 4NBRA 1XG5A 4XZ3A 1U2DA 1N92A 4RVHA 4DYVA 1E1LA 4XKJA 2Y1FA 2Q50A 4EZBA 2BI7A 4WGGA 3ZWYA 1G6KA 4IS2A 4CLRB 4EUHA 2Y05A 3FN4A 4ESOA 1NPDA 4LRSB 1JKJA 1ADBA 1YB4A 4OM8A 3AWDA 5H82A 2G5CA 1A7AA 3DZBA 4J49A 1EEHA 2AQKA 3DO5A 3VTZA 4FD3A 2JAPA 3UUWA 1FK8A 3G17A 1EQ2A 1XLTA 1SC6A 1NASA 4GX1A 4CL3A 1XQ6A 2PV7A 4CUKA 4EJ0A 3G49A 2Q1WA 5L4SA 1IPFA 4U8GA 4W9NC 1DHTA 5A9SA 2Q4EA 1K5HA 2NU7A 5AYVA 4CLXA 1PR3A 1NTOA 1VL6A 1T2EA 2RIRA 3RUAA 4LSMA 1H93A 3IS3A 1G0NA 1HWYA 3N7UA 4CMEC 4NQZA 1U5CA 1PJBA 4HNGA 4YJDA 5LC1A 4I5EA 5JY1A 1O9BA 1GYPA 4B79A 1TEHA 3NDIA 4Q3DA 4CM4B 4DPKA 1PEDA 3H3JA 1YQDA 2HDHA 3WICA 3NV9A 3MWDB 1FJHA 2OOSA 3DZGA 1LDEA 2ZYGA 3AOEA 1NX6A 1Y7TA 3DZIA 2FWMX 5B37A 2VYND 4O0LA 3ONFA 4J1QA 4FSHA 3PJFA 3IKTA 1C1XB 4CQLB 1LI4A 3ZCXA 5CDTA 2WDZA 1BW9B 4IJWA 1R0KA 2HMTA 5F3RA 4DLAA 4B4OA 2JL1A 5JY6A 4XDZA 3ENNA 1R12A 3PJGA 3TZHA 1M75A 3WIDA 2EGGA 2I66A 5EQFA 3UFXA 4EBFA 3R1IA 5GY7A 3PHHA 3FF4A 3ICPA 3T4EA 2O50A 3LC2O 3JYLA 3SJUA 2D5AA 2BGKA 1E7SA 2JKVA 3COSA 2NVUA 3GVXA 3GUYA 2X8LA 4BO1A 2VT2A 1IZ9A 1D8AA 1IUKA 1QLHA 3RBVA 3UF0A 2X5JO 3ASVA 4ZQEA 1NFRA 1DAPA 2OZPA 5FYDA 3ZWMA 2VQ3A 1EQUA 2C82A 1A72A 3ASUA 4L8VA 2VZ0A 3I4CA 5KKCA 1UZLA 4HUJA 5JAMA 2NVWA 5JO0A 2GZ1A 2PZJA 3KYBA 3PXXA 2NU8A 3VVCA 3TN7A 2HRBA 4CLOB 1DBVO 2HK7A 4D42A 1C3VA 2H6EA 3O03A 5DP1A 1YGYA 4HP8A 2BH9A 4NMHA 4R41A 3WGQA 1NAIA 2FHSA 1SCUA 2I6TA 2VYVD 2C5AA 2YUTA 4TVOA 4UUOA 1PZEA 4B8ZA 3ADOA 5A9SB 4KDFA 4BB6A 4AJPA 3QRWA 3VKUA 4E30A 1F8GA 2AQHA 2I3GA 2XXBA 4YAKA 3WLFA 1BXGB 2GNAA 3TWOA 1WP4A 4ZICA 2NADA 4PLFA 4Z3KA 2O2YA 4Z9YA 2E37A 5JDCA 3ZU3A 3S2EA 1N2SA 5IN5A 3E9NA 5DCYA 4ZVVA 5HWSA 3RKRA 4WCFC 2OXIA 4BNIA 4BOYA 1P1FA 5H83A 4P4LA 4R3WA 3PWSA 4JJIA 3AOGA 1PGQA 4OYRA 2D3TA 4IXWA 4K9DA 5A9TA 3ABIA 2UUPA 4FS3A 1SPXA 3PLRA 3ITKA 3FHLA 5K6AC 1SNYA 3PQFA 4OQZA 3PHGA 3U62A 4D3DA 3FNHA 5KIAA 2B4QA 3NAQA 2OUIA 4BNUA 3U0BA 3P2YA 3GEDA 4J7UA 3JQ9A 2BHLA 3ICCA 2B69A 4XD2A 1LXCA 2XXJA 1GCOA 2HRZA 4O6VA 3IQDB 4JBGA 5IXSA 5I7FA 3MTGA 4HBGA 4XYBA 4CM7A 4AJHA 4EJMA 1KC3A 2H1SA 3A28A 5CHEA 4F45A 4FW8A 4RORA 4YRBA 4ND3A 1VJ1A 1LQTA 1U3WA 3LVFO 5U9CA 4MVJH 3WIEA 2CSUA 1BGVA 4UVHA 2Q1SA 3LK7A 1NFFA 4U0JA 4XQ9A 3BXXA 3MEQA 2ZTMA 3AU9A 1TVEA 4GPD1 4II3A 5G0TA 3VDQA 3L6EA 4IDBA 3CPSA 3K30A 1ONOA 2W8ZA 1RM0A 1PIWA 4RL6A 1ZCJA 4E13A 1OZAA 3D3WB 1NXQA 1YXMA 1E7RA 3JQBC 4NBVA 3V5NA 1DIHA 4J2OA 1XQ1A 4IDAA 1AHHA 4AG3A 2HMUA 4DXHA 5BT9A 4RF2A 5U4QA 2HQ1A 3FR8A 4JN6B 4FR5A 1M6WA 2WD7B 5MGBA 4X54A 1WNTA 2EP7A 4RZHA 2IXBA 5IDXA 3Q3CA 5HBRA 1V9LA 4W7HA 1PJQA 4MVJP 5KCZA 3I9JA 4S3MA 3V1TC 2PH3A 3VH4A 4MINA 3IIEA 1GD1O 2HKIA 2PGLA 3OH8A 1VJTA 5C7IO 4I9UA 1T2AA 1HE2A 1JVBA 1UXGA 5CG2A 4BGIA 2FSSA 3BAZA 3UCFA 3CMCO 3UAGA 3ZI0A 1GADO 3KO8A 4TVBA 3UH1A 9LDBA 1NVMB 3IJPA 1QR6A 4GX0A 5L51A 1PWZA 3IL2A 5A1TA 2GO1A 1RM3A 5COAA 1BWSA 3UVEA 4WCDA 2O4UX 4E4YA 3BMNB 3QJ5A 5KVSA 4NBUA 4IQ8A 3GVCA 1PJLA 4GVXA 3DAPA 4BV9A 5JNLA 3E8XA 3PYXA 4CV3A 4DUPA 1I3MA 1EBFA 4KP7A 3QHAA 4CMBA 1YB1A 3O38A 4GX5A 5DN9A 1F8FA 2X0RA 3HUDA 5BSGA 1U9JA 1P1JA 2Q1TA 2NTVA 3WDSA 3G1TA 3RAJA 1DC5A 1I30A 4U0KA 3EC7A 2EW2A 3GG2A 1Q7GA 1CQIA 2Y0DA 3AUTA 4MKRA 1R4MA 1EE9A 2VHYA 4XX0A 2HMWA 3JYQA 4BV8A 3OJOA 1QV7A 4J3FA 2I9PA 1TLTA 3S1LA 3ZZNA 4DIFA 4XRRA 3WGZA 4IUYA 1BG6A 2H5LA 4PLHA 1H0KA 3PWKA 3RASA 1GY8A 5TX7A 1A4IA 1CEQA 4GLOA 1LLQA 3WMXA 2ZJ0A 3JD4A 3GGOA 3S2GA 1DHRA 3INTA 3SX2A 3AU8A 4R69A 2HLPA 4AJLA 3BTSA 1EUZA 1H2HA 4BNKA 1UAGA 2V65A 3EMKA 4D43A 4OXYA 5F1PA 2VNAA 4MO2A 1E6EA 2FR1A 1HDCA 2QRLA 4E2WA 4WLUA 4I9NA 1XHLA 4GSLA 3A9WA 1L7EA 5IG2A 1NPYA 1DFHA 1HDRA 3UHAA 5I9NA 3FI9A 2FR8A 2B4TO 3RIHA 4O63O 4DC0A 4XRGA 3ST7A 1Q0QA 1HDYA 3I9LA 1ZMOA 1CF2O 4WNIA 1EFKA 3VPSA 1MP0A 3MJTA 1W73A 3GFGA 3K8ZA 4DBVO 1Y81A 2GN8A 3IKVA 4JROA 3FPCA 3AJRA 2A35A 2DPGA 2DPHA 5EERA 1PZHA 1A4UA 4YAGA 1LBEA 5B4VA 1YQXA 4GL4A 3ZWAA 4QQRA 2J5KA 1LSJA 1HXHA 3HN2A 4I1IA 4LN1A 1B3RA 2X23A 3U4IA 1PX0A 4GQAA 4WE3A 3RUEA 1LLUA 1X15A 4MVJG 4R4JA 1HYHA 2O48X 3CIFA 1O5IA 3WMWA 4DTIA 3DEYX 4IMPA 1Y1PA 1P77A 1N9GB 2E4AA 3KYDB 2GN4A 1E7YA 3FWZA 5JPIA 1B16A 4DPMA 1HE5A 4ALMA 2O7SA 2X0JA 4CQMD 4BKUA 2NU9A 5CP8A 1JTVA 5GMOA 4W9NA 4MIEA 3QVOA 1ZK1A 1NQAO 1MC5A 1N1GA 3ZWCA 4YRAA 3GDGA 4ZJUA 3HSKA 3GHYA 4GBJA 5B1YA 3F5QA 5JAIA 3AFMA 4BQPA 4EEXA 4NG5A 3E1KA 4L4XA 3ZHXA 4IZIA 3ETEA 1XU7A 3JD2A 4ZRNA 4G65A 1V6AA 4DQVA 5DOVA 2QRKA 3JYNA 3TL2A 4DVJA 2VYNA 3KEOA 1W0CA 5L95A 4MVJA 4OO3A 1LLCA 3DBHA 5CEEA 4Q3AA 4Y6RA 4FFNA 3I9MA 1BDMA 4NK5A 3AK4A 3C8MA 4K28A 1VC2A 4ZA2A 4U5QA 1A9ZA 3UW3A 4LVUA 4FOSA 5ES3A 5ICMA 3JQ7B 4B8WA 4XB2A 1DC6A 1T2DA 3SC4A 3GT0A 5IDWA 2VHWA 2NTJA 1ZZEA 4P22A 3K92A 5L45A 4BO5A 4D0RA 3NJ8A 1KVRA 2ZYDA 4CM5A 3TZKA 3PEFA 2X58A 3Q9UA 4LVCA 1M66A 5F1KA 4HFRA 3S8MA 1UZMA 4BNYA 1U3UA 3I9OA 3WSVA 8ADHA 3QY9A 5IDYA 1EFLA 3V8BA 2EEZA 3PHLA 1UXJA 3RJ5A 1NYTA 5A3JA 3RROA 3HFSA 4EDFA 1QSGA 3VOSA 2OBNA 3GK3A 2NSDA 5F1OA 4UUPA 3ON5A 3BTVA 3IUSA 3M2TA 4YJGB 2Z1MA 4GGOA 4PLTA 2VYVA 3F9IA 4RVSA 2PR2A 3Q11A 2JAHA 3PDUA 4A73A 4E2ZA 4GWKA 4KUEA 5FEUA 4XYEA 2YHUA 3CZRA 4PRLA 1S7CA 4L75A 3H3FA 4QTZA 1ID1A 5IN4A 2XAAA 3OJ0A 3TZQA 4DPLA 4PZCA 1HZJA 1LC3A 4RPGA 1SOWA 1D4FA 1A7KA 2AXQA 4RPKA 4M1QA 1X1EA 2IE0A 5BNFA 2VRCA 1NHWA 5TSDA 1ENOA 4RVFA 4MVJF 4L0QA 3VDRA 2DUWA 3WOHA 4MPDA 3GVPA 2FY8A 1IHXA 1KEWA 3LT2A 3TJRA 3ETDA 4D7AA 1DO8A 3NT5A 1ZXBA 1U3TA 3AM4A 3DZJA 3VH1A 2B37A 2CY0A 4J7CA 1O89A 3Q9NA 4PZEA 1PS0A 4CUJA 4WCFA 1ADFA 1VKNA 4ID9A 1D1SA 2GDZA 2OORA 4PIVA 5HTOA 1I5RA 3QVXA 4E5NA 5JYEA 2DLDA 5FF9A 2EXXA 3KXDA 4KTTE 4MP8A 4YA6A 4J91A 5K0ZA 1EDZA 1NPTO 3LT0A 5K6AA 1OMOA 1UXKA 4TWRA 5DBIA 4BO7A 1P45A 1N5DA 2CFCA 2HK8A 4JCOA 2J5RA 3DFUA 2Q2QA 1U7HA 1MG5A 5C5IA 2PY6A 3JD0A 5A5EA 5AXCA 4J4TA 4EGFA 1DB3A 5FI3A 3PQDA 4NZ9A 4BNLA 3TNLA 2B5VA 3ZWXA 4FGSA 3F47A 3GPDG 3GH3A 2UUOA 4C7JA 1ADGA 1GDHA 1KVSA 1QXSA 2H63A 3OICA 3R3SA 3QW2A 3LF1A 8LDHA 3RD5A 5C7OO 3L0DA 4CLRA 4BNNA 1OC4A 4C4OA 2Q49A 4YJFA 3TSCA 3IAHA 4LMRA 4PG6A 2D5CA 4BHTA 4BQRA 4HKTA 4DQUA 5KVQA 1E92A 3WTBA 4WUVA 4E5YA 3RC1A 3EYWA 1SO8A 2P9EA 3QWHA 3M1LA 4EUFA 2AMFA 4I8XA 5DZSA 4IDDA 2A9FA 4ZQFA 3VPXA 1IE3A 4PN3A 3IC5A 1LRLA 1P44A 4E31A 3WB9A 1B14A 2UV8A 3JQBA 1MFPA 1R4NB 4ZRMA 4FDAA 4IIUA 5JMPA 4N54A 2YV1A 3PWZA 2D2IA 3OFSA 3EVNA 1IHYA 3B1FA 3ANNA 2DC1A 3GPIA 4IZHA 4PVCA 5DBFA 3H9JA 4J16A 2VHZA 1H6CA 3TFQA 2W98A 2NM0A 4GVLA 3GDOA 1ISFA 5CAEA 1MG0A 3NGXA 4IDGA 4OHUA 4J0FA 3UOGA 4CR6A 2VCYA 4OAQA 4PCVA 4UUMA 1UH5A 3SBOA 3I6QA 3TL3A 1ZH8A 4HWKA 2AHRA 5BSEA 1TT5A 1GUZA 2RH4A 4PG7A 5THQA 1EMDA 2W2LD 4NBTA 3Q0EA 3V2GA 1VSUA 1EDOA 4PLYA 1L1FA 1NQTA 1C1XA 2PD6A 1KERA 4CQLA 1DFGA 4K6CA 2F00A 2VUTA 3E5RA 2Y1EA 1BW9A 1FDSA 5L9AA 4XYGA 4RF5A 1PWXA 1KOLA 1C1DA 2F1KA 3KLPX 5KVVA 3CE6A 7ADHA 3QP9A 3WGIA 1E77A 2A94A 3PIIA 1ISJA 5G4LA 2CZCA 1YVEI 2C5EA 2X0IA 1I3KA 5JAQA 5KJCA 1Y9AA 2POQX 3WWZA 3C3XA 3PDJA 4E5MA 1PL6A 1U4SA 1HYGA 2X22A 4TSKA 4MOWA 3SXPA 2YW9A 1B15A 1ZKMA 2EP5A 3ZGYA 3ZU2A 5JW6A 4ILKA 4RJTA 4YJFB 2Y1OA 4E5KA 5BNTA 3SC6A 4Y8VA 4W82A 3TOXA 3BYZA 1XELA 4DRYA 4I08A 3H9GA 2DFDA 3LC1O 1I3NA 4CLOA 4H15A 1MA0A 4NJOA 5JYDA 2Q46A 3MOIA 2AEMA 4CODB 3D3EA 4YB8A 1K6XA 4MVJI 3K73O 3OHSX 4CMIA 3ONEA 3VPGA 1WDKA 1E7QA 4LMPA 1KEPA 3GZNB 2YJZA 4Z9FA 4M49A 1DXYA 4YYZA 1JAYA 2PD4A 1BXGA 5A06A 2IYOA 3HN7A 3JQAD 2PGDA 4BNWA 2WM3A 4R68A 1IOLA 3RBXA 2W4QA 3H6KA 3GLQA 3L07A 4WNCA 5L7WA 4CR8A 3ROMA 1MUUA 2Z5LA 5AQ1A 1I10A 4BNVA 3OIFA 4R01A 2LDBA 4BO9A 2VOEA 4PZDA 3FPLA 2ZTVA 3RVDA 4PLVA 4F46A 3F4BA 3LSYA 2EKQA 3A4VA 3TZCA 1UP7A 4IJKA 4JJFA 2OHXA 1VRWA 1TT5B 2DKNA 1GQQA 2AQIA 3GVIA 3NUGA 2YQ4A 2J3IA 3WGGA 1P9LA 5JC8A 1UDBA 1SB8A 4HX5A 4KOAA 1ZSYA 3RKUA 1ZEJA 3ZHYA 5DCWA 5EJ2A 3U3XA 4RCVA 1T1RA 4AICA 1X7GA 3RWBA 5CEJA 1C1DB 1UP6A 4BGVA 1P1IA 3AY7A 3LU1A 1ONNA 4URFA 1FDTA 1QORA 3VKVA 3OA2A 1Q7BA 2VWQA 3C1AA 4J9VA 1XIVA 2I99A 3HDYA 1DLIA 1P3DA 4L76A 4P4GA 4OMUA 4FQ8A 1PGNA 4XR9A 1KS9A 2YHIB 2ZQZA 1BHSA 1CDOA 3PRJA 1H9AA 1A5ZA 2EGHA 2VOJA 2PKQP 4OSOA 3H7AA 4HNHA 2DAPA 5A4DA 3BMOA 4JLWA 4R1UA 3U49A 4NU5A 4UVEA 4ND5A 1YH3A 4RF3A 4Z9XA 5G0UA 4YQZA 3WG9A 5JS6A 2BD0A 5L3ZA 3QWIA 3D3WA 1J5PA 1F12A 4AJKA 2NQTA 1M67A 1YONA 4EI2A 3AY3A 2JFHA 4CMIB 2Q99A 3VTFA 4DGSA 1ZMTA 4K26A 4HY3A 4NBWA 1E1KA 4ZQGA 3FCOA 4IGFA 4AJIA 3VVBA 2WD7A 3AI3A 2X9GA 3MTJA 2RH8A 1HDGO 4DLLA 1KC1A 3AUUA 3PQEA 4LW8A 1DEHA 4MIYA 1M76A 2QQ5A 3HNPA 4Z0TA 4RQTA 3H5NA 4E2YA 2V6MA 3MJVA 4DC1A 4NFYA 5T57A 5T8KC 3KETA 1WMBA 1A71A 4YEDA 1EVYA 3JQGB 2ZYAA 1GPDG 5AXDA 4A5OA 1A9YA 3H5AA 3CMMA 1E5QA 1GV1A 1PTJA 2Y0EA 3F46A 3KZVA 4XB1A 4Y67A 4HADA 2DBRA 1LEHA 3SEFA 1NWHA 4MP6A 4AJ1A 1PU2A 4DA9A 2NVBA 3AW9A 2R00C 4A0SA 1ORRA 2Y66A 3BMNA 4ALKA 1ENYA 4RF4A 4BMNA 4L74A 1C0IA 1H94A 1Q0LA 4XA8A 3TOZA 1I3LA 3ZH2A 3E9QA 4WLNA 2Y0CA 3KSZO 1E5LA 2P91A 4GSKA 4CQMB 3DOOA 3DHYA 3BTUA 3EZYA 4OH1A 4J6FA 5TGDA 3EDMA 2E49A 2HSDA 3ETGA 3MJCA 1IZ0A 4PLPA 1ZVMA 2VT3A 4RPHA 1BVUA 4KQXA 3ZNOA 3NJ4A 1MB4A 1N7HA 4CV0A 4B4UA 2Q45A 3OF2A 4J9UE 4OQYA 3I9KA 3BA1A 3BMOB 4AJJA 1E1NA 2AE2A 4NNJA 2RHRA 1K89A 2OO5A 4YBZA 4BB5A 1AHIA 2FSVA 1E6UA 2CVZA 5I8ZA 5A05A 3O8QB 1IYZA 2ZTUA 3TFOA 4ZN6A 4R5MA 4N5NA 2IYPA 3A1NA 3ZU5A 1LC0A 2O3SA 4FJ2A 3EGOA 1EUCA 2EJVA 2ET6A 2HJRA 3MJEA 3ROPA 3ZNNA 1LDBA 3VH3A 1AGNA 3A06A 3FBGA 3NDJA 4ZGWA 3WJAA 3E18A 2BFPA 2B4RO 2DBQA 3PTZA 5COBA 9LDTA 2OBYA 4OOFA 3JQDA 4O5OA 4YRDA 3U5TA 1RJWA 2HJSA 4LGVA 5CDUA 3ZWWA 2JD1A 4GH5A 5DDIP 3D5TA 3ZN2A 2C59A 3I52A 3S2FA 5JSFA 4G5HA 5EESA 5KTKA 2YFHA 1IB6A 5JDIC 6ADHA 4BO2A 3ROKA 4C7KA 3SLGA 1DPGA 4XWYA 2PH5A 4FN4A 4M54A 1PL8A 4EITA 1YKFA 3GF4A 5IDQA 4RZIA 4D3FA 1XEAA 3Q6IA 2OMEA 1VI2A 3RUFA 3WYBA 1HETA 1E3EA 3KEQA 1NR7A 2CVOA 1DRUA 1Z6ZA 3EW7A 1YDEA 2G17A 4DMLA 3KYDA 1N9GA 2C7GA 1SB9A 2P9CA 5KJEA 1W6UA 2CUKA 4BKQA 4CV1A 1YL5A 2WYWA 1BSVA 2DUUA 1HDZA 2RAFA 3TF5A 4XGKA 4ALLA 3N58A 5HS4A 2GN6A 2TMGA 1LU9A 4OXKA 4IQ0A 3KOUA 4WKGA 4ITUA 1PZFA 4PLCA 2FR0A 3L9WA 1RYEA 3W6ZA 3DMTC 3HJAA 1OC2A 1T2FA 2JCYA 4KDEA 4Z6KA 1RKXA 4Z0PA 2HAEA 4TZTA 3WNVA 3F1LA 1BVRA 2W2LA 5GZ3A 3RFTA 2E48A 3U09A 3W4IA 2FPPA 1UUFA 3DHEA 4YJHB 3RUDA 5BSFA 2VZ8A 3C85A 4L73A 3B1JA 5ITWA 3L77A 4R1TA 5JCJA 4WJZA 3KUXA 2WEKA 1DFIA 3JQ7A 1NVGA 2Y1DA 1AXEA 1YOVB 3MJSA 4PG5A 1GV0A 3ZW9A 4B3IA 5CFZA 4JX8A 1KEUA 2VUUA 4P4NA 3Q2KA 1O94A 3DZKA 1CYDA 1V8BA 2QRJA 4XQEA 2I65A 2PWZA 3D64A 4H7PA 1NAHA 3W8DA 5LDHA 3U4DA 5TNXA 1PQPA 3EK2A 3U4HA 3C7AA 5GZ1A 3GRPA 5FFFA 1E3WB 2D59A 3EUWA 3O4RA 1B0AA 4HFMA 1I01A 1WMAA 4CLHA 1KVTA 1WAMA 1H9BA 1ZXLA 4R1NA 1P74A 2CDCA 2G0TA 1TT7A 4TRJA 4ALIA 4BNHA 3KYCB 1XKQA 3ZW8A 1YRLA 1MLDA 2GSDA 1QKIA 4YJGA 1DJNA 3PYLA 2UDPA 1SBYA 1K6JA 4KQWA 4CPDA 1WDMA 1PJ2A 3AUSA 4NPCA 1NR1A 1H6BA 3PZBA 4CR7A 1E3IA 1PQUA 2XOXA 4DIBA 4UREA 5IZ4A 3CINA 3DBLA 1LLDA 4NK4A 4GMFA 4BNFA 4DQXA 1F0YA 3M6IA 3H5RA 7MDHA 2DU8A 2ZIZA 5ENVA 1O6ZA 1MV8A 1OFGA 2WSBA 3UGKA 3QSGA 1HE3A 2PTGA 1XWFA 3PJDA 2VHVA 3E03A 3T7CA 3DOJA 2EKPA 3H9QA 2YDYA 2QYSA 4YCAA 4RVUA 4KUGA 3D7LA 1GQYA 4E5PA 3KHUA 5TJ9A 2C0CA 4J2HA 1GYRA 2IZ1A 2D0IA 1YL6A 4D0SA 1LQUA 3WQSB 4QEDA 1I0ZA 1X0VA 4XEHA 3D4NA 4QSMA 1ZBQA 5TF4A 4U7WA 5KWEA 3ANLA 3LZ6A 4WLOA 3H9EO 1JLLA 2IRWA 3FD8A 5DNAA 2HCTA 5T6BA 5AOVA 4J0EA 2J3HA 2YDXA 1ENPA 2ZATA 1NVTA 1O95A 1GEEA 2EERA 4FFOA 4DWVA 1LSUA 1BXKA 1FDVA 4R5HA 4NI5A 1QRRA 3QVSA 5ENDA 4BGUA 1P33A 1JWBB 4AVYA 2ZQYA 3WJ7A 1Z45A 2WYUA 1GR0A 5T64A 2XPCA 2ZB3A 4OKIA 3W1VA 4DLBA 3NTQA 4YPOA 1WPQA 1UXHA 4JJGA 4YT8A 3QV1A 3WS7A 4ALJA 5IJZA 4K6FA 4AJOA 1DRWA 1PJCA 2ZCUA 2P9GA 1PJSA 1H6AA 1NP3A 1RWBA 4Y6SA 1GZ6A 2J3JA 3PHIA 4J43A 3DZFA 4RO0A 3HFGA 1Y8QB 5L4NA 1T4DA 5DBGA 3RC7A 5L53A 5TT0A 1QV6A 1R0LA 5CDYA 3PFWO 4QECA 1T24A 4YDRA 1HLPA 4FFRA 3PJEA 4UUNA 4IJVA 1M6HA 1Q7CA 4NJMB 3R0IA 5L7YA 3AUAA 3OMLA 3GN1A 4Q3BA 4Y98A 4ZHSA 1R4NA 1Z7EA 1I32A 3DBLB 2BMAA 2O3TA 1YS4A 1LNQA 3JQAB 1KEVA 4DYDA 3WGTA 1Z73A 3W8EA 3WFIA 2NACA 4A2CA 1GUYA 4Z3DA 2JFFA 4GLLA 1ZK2A 2YY7A 3L4SO 4Q9NA 1KY4A 3I6IA 5T67A 3WFJA 1RYDA 1ULUA 4BNJA 4NFSA 1FF9A 1B2LA 1DJQA 1QYVA 1PR9A 3IMFA 2PZKA 1PGOA 5I7SA 1TXGA 5T8KA 3L6DA 2DTXA 3ORFA 1GZ3A 4TZKA 2IDZA 4OL9A 3ZWOA 4KZPA 1J6UA 4XCVA 3W6UA 1D3AA 3OECA 4LISA 1LSSA 4TQGA 2BF7A 3EZLA 2Y99A 1C0KA 3LYLA 3OIGA 4RV9A 4AJNA 3JV7A 3K5PA 2EV9A 4RVDA 1EK6A 3GG9A 2JCXA 5CPFA 4ROSA 2R00A 2AG5A 3AM3A 3KV3O 3PVZA 2C20A 4UVGA 3VZSA 3EHEA 3PPIA 3KSDO 1PSDA 4XGIA 4WLVA 1SAYA 3K31A 4CMJA 2JFGA 4XIYA 1C0LA 2ZB4A 2JHFA 4MP3A 5EL0A 3HB5X 4J4BA 4A27A 4II2A 3C7CB 4CL8A 2PKRA 4U6QA 1QYWA 1X1TA 2AEJA 4CM1A 2Q2WA 4RLHA 2WWRA 3BIOA 3JQFC 1VSVA 2BI8A 1LRJA 4GX2A 3IOYA 1WWKA 2QYTA 4N7RA 1Q2XA 4WLFA 3TDKA 3M1AA 4BO0A 1HRDA 4IM7A 2EIHA 3VZQA 1FMCA 1FDWA 1NNUA 2PA3A 1HSOA 1TA4A 4FB5A 1C0PA 1Q0HA 4LCJA 1DIGA 2AEFA 3C24A 4IGEA 3FWNA 4PLWA 1P1HA 5HS6A 4MIOA 1E3LA 3PK0A 4XIJA 1BMDA 1PS9A 4O59O 2G76A 1PL7A 3WX0A 1ONPA 5JXWA 2LDXA 4M87A 1R15A 3GZNA 4R16A 4JP3A 5ADHA 3C7DB 3DQPA 4GAEA 4H16A 3SLKA 3INGA 1UXIA 3RU9A 1ZFNA 4IY1A 4OXNA 3VPFA 1O0SA 2V6GA 4PVDA 4XYLA 3H9UA 4XGNA 5C7LO 4FFPA 1PJ3A 2QZZA 2ZB8A 3AI1A 3K6JA 4D44A 5IZCC 1ZW1A 1SMKA 2VTEA 4MVJE 1OOEA 1DIAA 1KY5A 2W2KB 3FTNA 2R2GA 2QZ9A 3OIDA 1V35A 4XJSA 4QT0A 1BXZA 1VPDA 1JDJA 3DWFA 3MJ4A 4H3VA 2V6FA 1SEPA 2OFPA 2WTBA 4RPJA 2GRAA 1Y5RA 4RPLA 5LDGA 5JDIA 1ULSA 4QO8A 4XQGA 3PZRA 4EUEA 2X6TA 1KYQA 1Y6JA 1HL3A 3ZU4A 1KETA 1FXSA 4IINA 4QFDA 5AVOA 4N5MA 2X9VA 1ISIA 5F5LA 3STHA 2NV6A 1X14A 1P0FA 3GNSA 3NT2A 1IL0A 3ZV5A 1ZSVA 1ZIDA 2IODA 4G81A 3NYWA 3KM0A 2YHIA 3LQFA 2YZ7A 6LDHA 2P4HX 3X2FA 5G0SA 3AFNA 2JHGA 4MKZA 1PQWA 1Y8RA 2NUAA 2EKLA 2PD3A 3HZZA 3D1LA 4YT5A 3RFVA 1EZ4A 4N5LA 1LDNA 3GZ4A 3O9ZA 1E7MA 3PLNA 4GI2A 3BMQB 1T4BA 4BKRA 5AXAA 3FNEA 3DMTA 3PGJA 3T7EA 4ALNA 3JQ8A 4J1NA 4YTEA 1UAYA 3B70A 4PFJA 4WEQA 3G79A 2ZK7A 3OEWA 3UCXA 2HUNA 1NFQA 2P2SA 4BKPA 1HLDA 4A03A 1E7WA 2FN7A 4CM3A 3HQ4O 2Y68A 1VM6A 2O3RA 1YQGA 3UXYA 1AUPA 1U5AA 3GGGA 1ISMA 2RBEA 3CKYA 1QMGA 1UZNA 3ULKA 2DVMA 1M2WA 4AJ4A 3AY6A 3DBVO 4BO8A 3G1UA 3PHJA 3EAGA 4E21A 1X0XA 2C7VA 2CMDA 3DXFA 2PGJA 3EY4A 3GMSA 1N7GA 1VL8A 1P31A 4BGEA 2H9IA 3GHHA 1DIBA 4P8RA 4DL9A 4TRNA 3PIDA 1VKOA 2O23A 2X5OA 3OJLA 3U4CA 3JQGA 4OKNA 1HSZA 2J3KA 4IBOA 4NHEA 1AXGA 3I1JA 3E5MA 4OJNA 4JBHA 1R66A 1TI7A 3BHIA 3I5MA 3JQCA 3KLMX 1Y9EA 2FPGA 3NEPX 4ND2A 4R9RA 1YDWA 4E32A 1P1KA 3HHPA 1HT0A 2C2YA 3ZWNA 4RDHA 4F3YA 2ZKLA 3BHMA 1YBVA 2GF2A 1QLJA 4CQMA 5DOZA 2OP0A 4WPGA 3OP4A 1VLLA 1UDAA 5EMHA 3INRA 3P2OA 4ZQHA 4PLZA 4MVJD 3FNGA 1V3TA 4JK3A 2PNFA 1K0UA 3D4OA 2PZMA 1U8FO 1DC3A 3F5SA 4M8SA 1JKFA 5I7EA 4IXTA 5JMWA 2DT5A 4CLDA 1Y8RB 4UVDA 3K9QO 3E9MA 4B3HA 2FP4A 3KBOA 2BLLA 5TJHA 1YBAA 2IEBA 2B35A 3QA9A 3JD3A 3H8VA 1CERA 4FFLA 5IFLA 3ZV6A 4PGFA 5JC1A 1LA2A 3GFBA 5KJ1A 2BFOA 1B8UA 4W7IA 4BNMA 2IZ0A 3EVTA 2J6IA 3JQ8B 1J4AA 1XA0A 3HG7A 5G4KB 3L4BC 3RI3A 2C54A 2UYYA 2OL4A 3P5SA 4UULA 4JIGA 1LSOA 1DLJA 2VHXA 3BHJA 3O8QA 2WYVA 3JQEA 2UAGA 5DF1A 1G0OA 2BGMA 1C14A 2FRDA 2NLOA 1JVSA 3GEMA 4R9SA 2WE8A 4PLGA 1IPEA 2DTDA 4BKOA 1ZUD1 1V3VA 4QX6A 1CQJA 4Q3EA 1EE2A 3PI7A 3X2EA 3GAZA 1R16A 2IXAA 1W4ZA 3TPCA 4GMGA 3LDHA 3GR6A 5L4LA 1KBZA 3ZNPA 1WVGA 2ZTLA 2VWGA 5B4UA 1OAAA 4KUHA 4B4WA 3Q1LA 1ENZA 4FJ0A 5JCXA 4UAGA 4MJLA 4J1SA 1PS8A 3DTYA 2RCYA 3OJEA 3VH2A 2XF8A 3D4PA 2FZEA 4WOKA 4IDFA 3WYCA 4BNZA 1P0CA 3KRTA 1U7TA 3B1KA 4WASA 4E33A 2VRBA 5J23A 3E82A 5DP2A 3GC6A 3GNTA 4J7XA 3WBFA 4Z0HO 4MDHA 4TRMA 3WSWA 4LK3A 5KJFA 3OM9A 1LJ8A 2UVDA 3FBTA 3GMDA 3K2EA 3JQ6A 3RUHA 2VRCD 3DL2A 1JN0A 4TRRA 3LF2A 3I3OA 4KWHA 2P4QA 5ILOA 2DM6A 2OP1A 5BR7A 1U3VA 2WMDA 3E48A 3JD1A 4CMAA 4BNXA 1RM5A 1B7GO 3C1TA
chains in the Genus database with same CATH superfamily
3GNLA 5BURA 1L4BA 2DWPA 1II9A 3C5CA 1GP2A 4N47A 1A95A 1XD2B 4RHEA 4D9HA 4BECA 2ZYVX 3TUJC 4CDMA 3H4MA 3O47A 1JIUA 1QVZA 4KMOA 2ZVDA 4JELA 1UKAA 1Y6RA 3B8EA 4E0BA 3U5ZB 5AW3A 1TVCA 2QR2A 3QHQA 2W6IA 3ZHVA 1OBFO 2NNWB 3D8SA 621PA 1A8PA 3WO1A 2GZ2A 2IH2A 1Q92A 2RD2A 4UU7A 5IKXA 4HUTA 2DSNA 3D6AA 5EWJB 3U7QA 4KYIB 3UFXB 3WRXA 1U02A 3NI2A 4FPXA 5E8RA 4RXUA 2GEJA 1GTJ1 1EG7A 1JJFA 2AT1A 2EW8A 2IEDA 3OU6A 1N9ZA 4UQPA 2DE0X 3TQHA 4YT2A 2JRCA 2Z0MA 3W77A 1QF6A 4X6LA 1T8YA 3TLBA 2DT8A 2QMHA 1RM4A 2QD1A 3PA8A 3QLEA 4K5QA 2QX9A 4F4HA 2QIOA 2FFRA 5HF8A 1ZRHA 4NCNA 1W5EA 1BGXT 1QHSA 2YL2A 1L7OA 3MMPA 2Y0BA 4W5HA 1J39A 1C30A 3QVTA 4D8UA 2P5UA 1JA9A 4YJHA 3RC9A 2VNHA 3ZGOA 4KDCA 1M5UA 2O2XA 4CTJA 5LQRA 3TLYA 1H3NA 3QQ5A 5ER6A 1ZS9A 4LZJA 5CVUA 5F3DA 3KPYA 3THRA 4MWDA 1UWLA 3WNQA 5C0OE 1KIAA 4QPCA 4FFMA 3CZPA 4FBGA 4LQDA 2NU8B 5HJ5A 4IIJB 3NBKA 1K4YA 3QELB 1DX4A 2O3JA 1SK9A 1QIIA 4WK0B 1I2DA 2NTNA 3KZCA 1QO0A 2ZWPA 2DECA 3UV3A 4F7WA 3LHSA 1LDYA 2CZQA 3CVYA 1ZQ1A 5ED0A 3CSUA 5DI3A 5ENZA 2QLJA 4L28A 5EI5A 5F2NA 3GNQA 3WL5A 3OX2A 3ZQKA 3OEHA 1W2HA 1Z17A 4RJLA 4C1NA 3LHDA 2A5YB 4TXMA 3L46A 4X7MA 3KB6A 1NONA 2PUHA 2ZE7A 4N4AA 2XCRB 1HE1C 4I6GA 4A10A 2PLFA 5BYBA 3EOAI 3ZV4A 3ZQ4A 5J58A 2FWBA 3SSAA 5K0FA 3UGJA 3NIWA 3TXAA 1MRZA 1T0IA 1U6KA 3DOEA 4AT1A 1FDUA 5LXTF 3VJLA 1KEZA 1SIUA 1JHOA 4AJEA 3DE0X 5EP4A 2HV8A 3D7KA 2EQAA 3M0EA 5H80A 1ONSA 1V71A 1YHYA 4X7PA 3NPMA 1DBPA 1HF3A 3ZHBA 1Z7BA 1XC7A 1ZK3A 5ERXA 2G1AA 3OIUA 2OPBA 1Z75A 1I7QB 2J9GA 2XA2A 1E0KA 3G3EA 4N1AA 4GR9A 4DR4B 2WWIA 2YVUA 2FV8A 2AFHE 4HEJA 3BMCA 2BFFB 2YZMA 3K1AA 3L0IB 1YRYE 3X0DA 5HZGA 1FNCA 4QXQA 4E94A 4WECA 5H68A 2Q3FA 1ML3A 1N8KA 2CF5A 2D4AA 1JSZA 2CVHA 2FZKA 4B6GA 4R8VA 4UATA 1A9QA 1UFVA 1QPGA 1ZSNA 4R7GA 5DRTA 3BJZA 5A0VA 5AHWA 4OHPA 3G8AA 2HGZA 4R1SA 3HYTA 4Y9DA 4XGQA 1T1SA 4PQYA 3MGKA 3NHSA 1RHKA 4GWLA 3IHLA 3TLGB 1BNCA 4MW6A 1NVWQ 4JGBA 2X0NA 1U2DC 3JW8A 4FOOA 4P0QB 3KB2A 3WL7A 3NHUA 1QIFA 2H0RA 4ILEA 3ZCQA 1DC4A 5DM60 4KODA 3GLFA 1AB5A 4RXTA 2W2MA 3P0FA 2PK3A 1P2FA 1N6HA 3FJ1A 2G88A 1RXSA 3I6ZA 4YP9A 2IS6A 4PS0A 2AG8A 3OZRA 2J46A 3ANMA 5CEFA 1PFQA 5TT1A 3QWFA 4ZO8A 2XKBA 4E12A 1ZA1A 3HUFA 4CKZA 1Q21A 4LXXA 3R8XA 3VU0A 2E85A 4TMZA 2YBDA 2Z1DA 4LIPD 4F5ZA 1UEXC 3EPRA 2RG1A 3HKEB 5EKSA 3UMCA 1USIA 5BSHA 1NURA 2GEUA 5EQDA 4NMXB 1Z5UA 3QTLA 4S2UA 2QJFA 2PMKA 5FV7A 2R8PA 4Y2PA 2HA0A 5LIPA 3K8YA 1YB5A 5EZQA 2OKGA 3QFRA 3RJMA 1WP9A 3AUYA 3PU6A 3QBVA 4MB2A 3AR5A 3WLEA 5H4GA 3QY0A 4GU5A 3VTAA 1YE5A 3Q87B 2PBLA 1WW2A 4PAQA 3M3HA 1RWMA 3TD6A 1ESDA 1AUQA 1XZFA 2HOQA 1JHYA 1J25A 4BMSA 4C3UA 3JXEA 2BFEA 4DLNA 2NNLD 1U9CA 5EN4A 3PLAE 1I2BA 1XV5A 4FCVA 5E9AA 4R3UC 4Q93A 1HFWA 1RPNA 2QIPA 2Z83A 4TT8A 3MHPA 4BL5A 1Z07A 3DB2A 4L8WB 5BOVA 4MR8A 5A03A 2GI4A 2GR9A 4FU0A 3VO9A 1PRYA 3U7FB 1L5MA 2JFOA 2PMCA 1PE0A 4HDCA 2QZPA 2AN4A 4QQ8A 1F17A 2Y67A 3HBJA 3NFYA 2ZDGA 5IS2A 1GG2A 1PFGA 2CLOB 3SICE 4Z49A 3QF4A 4FSDA 3I5XA 1NVKA 4U6SA 4AMVA 2H2WA 3TAHA 2FX2A 2FW6A 1CIVA 3FRJA 2W6NA 1HTBA 5EWLA 1P2UA 1U9YA 3TBHA 2JFNA 3WGOA 3H2SA 1G8YA 5FO1A 1Z5WA 1SCDA 2RMKA 3BJRA 4FFVA 2CYBA 3LUJA 4QUAA 3X3HA 3JQAA 1J2YA 3L1JA 4YRNA 4ZI2A 3F3MA 3B36A 3UICA 1QE3A 4QFCA 3KQHA 1UKVY 2IP1A 5CUQA 5AKLA 1MB0A 5A02A 5HOQA 3GUUA 2BFCB 4HRYA 3MLAA 1UK7A 2O3QA 1YJ8A 4C2AA 1OV6A 1B8PA 1DMRA 2GFQA 4H4EA 4INAA 3UJAA 3UZUA 3AVQA 1IM5A 1NF3A 4HQOA 2VDQB 5MDHA 1XEWX 4Q39A 1N1DA 4JV5B 1P7PA 4G23A 4RMJA 3IEIA 4MVYA 1PGPA 4O2BA 5BO5A 5AXBA 1HZZA 2RK3A 3PC3A 2XAUA 5E7MA 4F9TA 5EZYA 3ZDRA 1NXTA 2W70A 2PKCA 1AK1A 4GDMA 3RG8A 5DWDA 3ZC3A 4RSGA 3G9QA 3MAGA 4RHTA 5HIIA 4PCUA 2PZLA 4D45A 2BHTA 4MUHA 1VL0A 2YFQA 2C9CA 4PNHA 4CMEA 5A3RA 4RM3A 1E1MA 2FFHA 5TIIA 2ZUUA 1XLUA 2JBHA 2QF7A 1PV4A 4BVHA 4QTXA 2W2PA 3PFFA 4ZOBA 3IQHX 3TSAA 3PWTA 2EG9A 2GOYA 2XNHA 1RC8A 4HH1A 2G9RA 1QPBA 2CLSA 2HA5A 4U9UA 5DASA 2G5GX 3RQSA 4EPTA 2AKAB 2K2QB 4JBWA 3BT7A 3OCZA 1XKLA 2YZKA 3BFVA 4BRSA 4YNBA 4A8PA 1OLSB 3LYAA 1UPXA 2FLVA 5GOZA 1IWBB 4PZZA 4WA8A 5LBUA 2FMIA 5DCLA 4F3CA 1XTTA 3SQMA 1JEQA 2VPZA 1J23A 1P0MA 1QB7A 1SEVA 2C77A 2QNBA 2Z9CA 1AQJA 2XCQA 5CCBA 4NDNE 5ALVA 1GPNA 3QNUA 4NE7A 3W06A 2CMKA 1H1TA 3W5DA 5FWXB 2KMLA 1S2MA 2VBFA 2BGGA 3RRXA 2LKCA 2FMUA 1NXOA 1WY7A 4BO6A 2FPIA 2K2WA 3L7NA 1ECCA 2F67A 4HC4A 2G4LA 3CVOA 3OMXA 4WXHA 5BYAA 3QYJA 2X4LA 3OY2A 4UKDA 3OVMA 1I3OA 1KVUA 1GDDA 4I5GA 1PUJA 3ESBA 5KBYA 5IAAA 2BBWA 3KJIA 4Z7QB 3BIXA 4KV9A 3K05A 4HDKA 4S0XA 2IXEA 1CJCA 1GAEO 1G5PA 1L5HB 1OIVA 1WSBA 1L8OA 3BXZA 3RJ9A 1OZHA 1I2ZA 1U3DA 2HMVA 2OCAA 3KVRA 3VPHA 1K7EB 1VDMA 3L4BA 4O4JF 4BMVA 3E22B 3DE5X 5LQUA 1YR1A 1BE0A 4DCPA 1X74A 5CVJA 2P5YA 3AI7A 3BH6A 3C97A 4UCWA 1VJ0A 5L3SA 4QARA 3SVTA 2VBGA 2B2XA 3VR4D 5E6UB 2O5CA 4X6YA 3F6YA 3AEKA 2V7PA 2GXSA 2I54A 2IPOA 2YC4C 4J0GA 4CHTA 4R3NA 1RXVA 5E4YA 5E0KB 4YRIA 3HLTA 3JQ9C 1W7AA 1F5SA 1OFVA 1NBWB 4KOEC 1B0PA 3KNZA 5B5SA 2VTBA 1EBBA 5KKAA 4YAEA 2O9JA 4OQQA 3SDBA 1ISSA 3JX9A 2CFTA 3BFXA 4U6NA 3BTOA 3NBFA 5F21A 3TUIC 5J2UA 2WUWE 2JH3A 4DR2B 2ZSJA 2J5QA 3DBRA 3VZRA 3GLVA 3KZOA 3QSYA 4YACA 2PYIA 2F62A 3Q1KA 5CNIA 3REQB 1TM5E 3WIUA 3KZKA 3MOGA 3PXCX 5EUQB 1CUZA 3KTOA 3UCEA 3RUCA 3QLUA 1GTRA 3WOVA 1O8CA 4G97A 4MAMA 1I36A 1UBUS 1UANA 2AMYA 4D5EA 4RL4A 5ER9A 4TMYA 3ZS8A 3OT5A 1B74A 2GPBA 3ZLJA 4L7VA 2QPOA 3IT0A 5AK5A 1W8DA 2HT6A 3UHJA 1I33A 3SX0A 4E51A 2PUCA 3DNPA 2PUTA 3QYAA 4KIWA 2Q1UA 4JBIA 4IDCA 4D8XA 1B6GA 4OHKA 2AI1A 5A3VA 1CR0A 1ZUNB 4CV2A 1O5TA 2H18A 1AQLA 4UMFA 4BP8A 5AM1A 1ZJ6A 2MSLA 4MUYA 4EJ2A 1ZGBA 3E6AA 4CGYA 1F8YA 4WH0A 1C4WA 4ZZ2A 3DKPA 3IV9A 1EXWA 3FZGA 3NYRA 1JFFA 4TV8A 2CCKA 4GKVA 1MDBA 3WMFA 2FPXA 3SIPA 2Q21A 1GYQA 1V7CA 1CIPA 1ZEMA 2HPHA 3F2IA 1H5UA 1JDUA 5JVDF 3U1BA 3LQKA 4CEJA 2UUCB 1EDDA 3ANSA 4D4IA 3MJDA 1SIWA 2FQ1A 4O2AA 3CZMA 1P1RA 1RWKA 1WUTA 3DC2A 5ITVA 3RS4A 3NTUA 3I9V1 3PI6A 2H5IA 3PB3A 1XROA 4M86A 5BRNA 3QE3A 4BO3A 4YXFA 2FPLA 1U94A 2J85A 1GITA 2JGNA 4XM1A 2B83A 3D54D 2OESA 1PZGA 3SU8A 4WL0A 2C0PA 4ZVSA 4HDAA 1R0SA 3BMQA 4CUZA 1J99A 3R5JA 4HDOB 4IHQA 1NUSA 4W4TA 2CHQA 3A4YA 2HLDA 2C7QA 4XDYA 4QQNA 4IICA 4B6RA 2WHXA 3IP1A 5CFOA 1QKJA 3ESYA 1KPHA 1UK8A 1CS0A 4M83A 4WMLA 1NM5A 3JYPA 4BYGA 3TNJA 1F20A 3ONDA 4PG8A 2PAFA 3OSUA 5F33A 3K2BA 1XWIA 1X7HA 1IY8A 1K2VN 3HADA 1Q20A 1QUFA 1IB0A 1HUQA 3E2IA 4BZPA 2O59A 2BTQB 4ARCA 2BJWA 2WMNB 2ZSUA 2HHJA 5E4FA 2X6RA 2C92A 3P27A 1QCZA 1MC1A 4JXKA 5LNK1 3X43A 2BBOA 3LLCA 3N59A 1KP2A 1HE4A 2YQ5A 3BEDA 2YTZA 2QSZA 3CC8A 3QWBA 5FX2A 2F55A 4LF5B 3AFGA 2KWIA 1QH1B 3IE0A 4AQDA 1LBHA 3HRIA 1FSFA 1D2CA 3HFRA 4D46A 4OX9Y 3ADBA 1TQ4A 2P79A 1MEEA 3DW1X 3HMQA 2A0KA 1L7XA 4QOSA 1ISHA 5SICE 3QX3A 2ORIA 4OOEA 1PK7A 2KB0A 4AKEA 3KLNA 2E82A 4I6EA 4MW2A 3K53A 4L4SA 4KQJA 3GOHA 4KMSA 4B2IA 5T5QA 1IN7A 4RY8A 3G0IA 2P78A 3D2AA 3QLVA 1W93A 2WE7A 1FMJA 4D4LA 3RM3A 4XQCA 2UXCB 3ROTA 4BPRA 3SM9A 1OFHA 2WBLC 5CDGA 2CWWA 1LBTA 5JR3A 1V6CA 3A14A 3IIMA 2D1YA 3MZ0A 3RU7A 4WKOA 3OOHA 3PGMA 4Q3CA 2DSTA 3D0KA 4AP9A 2H1LA 2P67A 3ILVA 3ZI4A 4DQLA 1BDHA 4HXYA 3ZEAA 2FZVA 3EGCA 1IPHA 1ZK4A 4LRUA 3THSA 1NU8A 1AMOA 4IXNA 1T91A 3F3SA 1M34B 1M0WA 1J2RA 1OGYA 1XDWA 2BLNA 3DV0A 4OHBA 4FC7A 4LBVA 5E2IA 1JH8A 2JA2A 1TM2A 4PY2A 5LYYA 2V0CA 5AOCA 1ST3A 4JUAA 2ZS9A 2BL4A 3O4JA 3LUDA 4MLZA 1D1TA 2C2OA 4GO1A 4N5HX 5BNIA 2I4IA 3RJTA 1QNFA 2CFOA 3AGQA 3H9CA 4OP1A 3ZY6A 3A3PA 3CLRC 2FR8C 3M6UA 1UJNA 2Q4OA 4ZVKA 3G59A 4PSVA 2WICA 2O57A 2ZRMA 3ADKA 2RC5A 3DLAA 4LBYA 4OHFA 1IONA 1AB6A 3KKLA 2VJMA 1YC2A 1TVKA 1ZWLA 4FDUA 2ODNA 2FZCA 2JI9A 3DDZX 3K0AB 3VZCA 4EHHA 2JJ8A 4DDKA 3B1YA 2F3SA 2X9NA 5IC5A 1JJBA 5K01A 4HAOA 2I2AA 1M1NB 4UVIA 4BUCA 5ALQA 1Z2PX 3NS7A 3DE4X 4XKJA 3SSNA 2FMFA 4WGGA 2Z3WA 4XSVA 2HPZA 4DT1A 4L78A 1XO1A 3QUAA 5K3CA 1NPDA 1S7GA 2HJVA 2O2EA 1ADBA 2PT5A 1YB4A 2QI9C 2YN2A 3QVGA 3R0JA 4JJ7A 2NT4A 4O25A 1Y3FE 1H2FA 1A7AA 2JGRA 2Q3CA 4ENUA 1EFDN 4DJAA 3R0ZA 4GBGA 3ZI7A 1K0FA 3ENQA 3A6HA 4MS4A 4ZAXA 1KE1A 1JR4A 1OWMA 3GWZA 1XLTA 4I1PA 1U9IC 3S40A 4MLPA 4YWHA 1T35A 3E2PA 3ZJYA 2ZQ5A 5JI3E 3QFTA 4MB6A 3N2EA 1FPQA 3IHKA 2PV7A 4KN8A 5C46F 5ITZB 3G49A 3HL4A 5I8PA 3RHSA 5L4SA 2P2YA 3NXSA 3PUJA 1IPFA 4MAFA 3R7FA 4F1KA 2FUG1 4Q7LA 3TW8A 5KX5F 4FGLA 1FXWA 1T2EA 2ZWIA 3M6FA 2CVPA 1C0EA 2RGYA 4LSMA 3IS3A 2HHAA 1NNI1 3CT4A 3OUTA 4DLWA 4ISCA 4F9EA 2ZIFA 1U5CA 2I6GA 3H2HA 1HOXA 2F3TA 2CJWA 1IM8A 4EJSA 5LD2C 2G1JA 3FIUA 1CUXA 3I76A 3MWYW 3GJTA 4I5EA 1NMQA 4RK0A 1H1LB 1O9BA 1L5SA 1PUXA 5BR1A 3ET5A 1NYRA 1VI6A 1TEHA 1BXRB 4CM4B 2P4SA 3AR2A 4IVRA 4KQ2A 1PEDA 4NBLA 4QU9A 3T7AA 4DEVA 3U1VA 3PNBA 1VJ5A 3WICA 1J0AA 3FPEA 1F4PA 3MWDB 4OG2A 3ZHOA 2IYTA 3G2OA 2Y2VA 4ECAA 2IYUA 4XWGA 1A4XA 3ER8A 3X1ZA 1G5TA 1LDEA 2JFUA 3AOEA 1XD2A 3PKJA 4ENQA 1EXVA 1Y7TA 2XV1A 2XYHA 3F7TA 2ERXA 3G9ZA 4MPJA 2D5IA 3C8ZA 3C3JA 1VZ2A 2BGTA 2VZEA 3KKZA 3ONFA 1C1XB 1G8HA 2G5TA 3P52A 1LI4A 1QVWA 1IMJA 1MT0A 3ZCXA 3ZDBA 5FBHA 2I4LA 2O8FB 4KE9A 5CDTA 3VKGA 1R0KA 1W47A 2JIZD 3I1FA 4DLAA 3HCAA 4H6WA 5AJUA 2W2OA 1JG2A 1KBOA 4BLRA 3B78A 2X8AA 1R12A 3P4YA 2IUYA 4YONB 1K08A 4DA6A 5J4KA 4EG1A 5EIBC 2PMBA 4RA6B 3UFXA 5EWJA 1OX5A 5AK0A 4EBFA 1GTZA 3HL0A 4ZT3A 4BV2A 3MOSA 2BEJA 3PPWA 4HQLA 4HDNB 2O50A 1GUBA 2O8DB 3LC2O 2BCGY 1SBZA 2D2VA 3JYLA 4PYIA 5EIBD 5AT1A 3HCWA 2AEEA 1JJVA 4D02A 1PWYE 4PYKA 4RGVA 2IHJA 1GPMA 4GBMA 2RHHA 4H59A 4RMHA 4ARIA 2D2EA 1KPGA 1OYOA 1OH6A 2X2PA 4DNPA 1KYZA 3HY4A 4NTZA 2NP7A 2FF7A 3ASVA 4IHJB 4W8OA 5G1OA 2G7ZA 1MO4A 1XNHA 1JKJB 3CBGA 1IXZA 2OZPA 5FYDA 1XU4A 2GYVA 1JIVA 2IGBA 3M8KA 1K4KA 3OEED 1U11A 2C82A 1A72A 3TQTA 4JLBA 4LF7B 3FFXA 2YCLA 3L7MA 4Z4QA 5CTAA 3I4CA 4RYLA 4RSMA 1CF4A 2O07A 1YCGA 4KLCA 2R1VA 2JGIA 4ZCRA 3PXXA 4R98A 2NU8A 3VVCA 2HRBA 4CLOB 1DBVO 2HK7A 3K6KA 5TARA 4Z4FA 3O03A 1RQ7A 2Z2XA 3G5UA 4HP8A 1DG9A 3KAKA 5HX7A 4II7A 4YROA 3UUGA 2YUTA 1CP3A 3IUEA 3HV2A 4QOEA 3ADOA 3AVOA 5A9SB 4BIMA 1IBLB 1GKUB 2FX5A 3GXOA 2CVFA 3KLBA 3RSSA 1P4HA 3SPXA 2I55A 3QRWA 4AJPA 5K0CA 4LBWA 1F8GA 2R6AA 4YAKA 1CV2A 1K7XB 5FPQA 4GYYA 3IOCA 3NM5A 2X0DA 3ZCPA 4PN7A 1LBSA 3TWOA 3WLLA 3LW7A 2WWTA 2HQRA 3F9CA 2FWJA 3R4VA 1E8MA 1XALA 4O2RA 1KH1A 4Z9YA 2E37A 4C4XA 1STOA 3RRFA 4F12A 4DVGA 1K4MA 3PGA1 3RU3A 2HA7A 2J7PA 2AJ8A 1RE0A 2VP2A 5FUBA 3I30X 3RPEA 3B1ZA 3GUHA 2VSXA 3H1EA 5HWSA 2BSQA 4YMSA 1JU3A 5JMOA 4TS1A 4BNIA 4BOYA 1MQSA 2JANA 2IEIA 1MABB 3P20A 4AECA 4OYRA 3IYLW 5JAOA 4IXWA 2FHPA 2Z04A 3F67A 5C81A 4BX0A 4BBPA 4F1WA 2BFFA 3ITKA 1E96A 3FHLA 4PFQA 1ZA2A 3ZD8A 1TYDE 3IVMA 3B9PA 3P2MA 5INTA 1XDBA 3EWNA 3G9UA 3O8LA 2OQRA 4H3SA 4MI1A 4KO1S 3TD9A 5KIAA 3NAQA 3I4LA 2FN3A 5C8ZA 4UQOA 3K2IA 3P2YA 4EMBA 5AFSA 1YB6A 2ZUBA 4OI4A 3K70B 2PMEA 2Q0SA 1CUHA 3TLGA 1JMYA 2ZITA 2NXEA 4YREA 3DVAB 3P4XA 3GLUA 4M1OA 2OVBA 4JMPA 3RAPR 1YUNA 1ODIA 1U81A 2BZ0A 2WZQA 3PDWA 4EI7A 4JODA 3A28A 5CHEA 5IP5A 4FW8A 2P1ZA 1HQKA 3MELA 1WIWA 1N6IA 1VMIA 5U9CA 4MVJH 4DLUA 4WKNA 2WFLA 1Z4PX 2HREA 2CSUA 3WIEA 1F60A 2JK0A 4RADA 3LK7A 4UVHA 3ZPXA 2VA9A 5FADA 1FNSA 4XQ9A 5CFMA 1TF2A 3IBCA 3EXAA 2PT7A 3KALA 2IOYA 2VP4A 3L6EA 2K6GA 2OK8A 3EVGA 1CLEA 3HKEA 4IDBA 1DZ3A 3CPSA 4GIBA 2GZRA 5K8UA 3ZV7A 1ZWKA 2NZXA 1ONOA 1ZLXA 1NW3A 2C2HA 1RM0A 2IUFA 2W8ZA 3KXIA 3VI4B 3ENVA 1PIWA 1J7JA 1EFVB 1HNXB 3D3WB 5JV5A 2WAXA 1E7RA 1NW8A 1PF7E 4NS4A 4NBVA 3C14C 5HHTA 2LP4Y 4J2OA 2FE4A 2ZT5A 3UV7A 1XDZA 2HMUA 4L4ZA 1NW9B 1N2BA 1W36C 1JILA 3T7KA 2I4OA 4QPDA 3AQIA 5DWVA 1VHLA 3WY9A 2OOKA 2ZRCA 2CHVA 3MW8A 1M6WA 2WD7B 4J16C 5MGBA 3LXXA 4R9VA 1MX5A 2A84A 1NLZA 3BUSA 4O1IA 1TF5A 1A8IA 4CFZA 3A04A 2FG5A 1SQ6A 3P9CA 3FPGA 4PPGA 1CB0A 4QDXA 3HM2A 1U98A 1JDBB 2XBMA 4S3MA 1TO2E 3MCWA 1ZCBA 5FV4A 3IOEA 1NF9A 3VH4A 1H0RA 1MJHA 1GD1O 1NOIA 1XVAA 4HPXB 3IDQA 3OH8A 4WRRA 5CX4A 5EMMA 1F8XA 1A50B 1PP4A 1Z36A 3WHLA 4ZK6A 4QPZA 5CG2A 2FQXA 2FSSA 4FOLA 3ZI0A 3QVUA 3CEMA 4FGKA 3QUCA 5JHGB 2L42A 3OQNA 1CUJA 1NQXA 4A8JB 1A97A 3CH4B 4IUBS 3WB1A 4Q34A 4F7DA 1NVMB 2JJ2A 3R0QA 2UVPA 1FUKA 4HPWA 4GX0A 3DPSA 4S12A 3RS0A 5KJFA 2Z2KA 3IL2A 5ECGC 1FB5A 3CX4A 1RM3A 5GWXA 4C29A 3HC7A 2AJBA 2AOUB 10MHA 2PJZA 2QA5A 3DTNA 3VR3D 1HC7A 3PTAA 1HRKA 2I7VA 3UT5B 1DKRA 2H2AA 1ZIOA 3AHCA 3GVCA 4IQ8A 4OJYA 4BYMA 4BQFA 1EX1A 5IPFA 2QP3A 3ZG6A 3K9GA 3COJA 4BV9A 1TNDA 1OBHA 4ZVLA 4GI5A 3KP1A 1ODLA 3E8XA 1S8NA 2C84A 5BUZA 3R7NA 2ZR8A 4KIGA 5LXTB 2NVOA 2ISSD 1U2RA 1V8OA 1YB1A 2X15A 3AIIA 4GX5A 4O5AA 4BVGA 2R6FA 5DN9A 2X0RA 2X1LA 3HUDA 2Q5JA 3G82C 4MPPA 3W5VA 4HR7A 3IVXA 3WDSA 4PPFA 1WLSA 1XNJA 4ITVA 3RAJA 1D0SA 1P4JA 3EC7A 3GG2A 2QTRA 3EVZA 2B21A 3C6KA 1JALA 2QP9X 4C3ZA 4EG4A 1OLUB 3JYQA 5IFKA 2I91A 1H2RS 2VAVA 5JG7A 1W4LA 1ATIA 2EFYA 3KKOA 4GC5A 3WGZA 1QGUB 1Z13A 4IUYA 4DV3B 3TW6A 2IOHA 1E18A 1G2QA 3F49S 3ACDA 4RJJA 1MPXA 1AX9A 3G8YA 3T9CA 1CEQA 4CM1A 4WBNB 1JBKA 3F78A 2ZRPA 4J07A 1HTTA 1OLSA 3KE8A 4G5QA 5IKOA 4F4IA 3S2GA 5MN4A 1DHRA 2VBCA 3T94A 3SX2A 2GRJA 2IUUA 4YMLA 4AJLA 1UQUA 2O0JA 1EUZA 1Y3DE 3GDWA 2V65A 3CF6R 3EMKA 1BMFA 2PXXA 3G0HA 9MHTA 4MO2A 1FZQA 4F97A 4E2WA 2QRLA 4CG2A 1ZD8A 2FG7C 4WLUA 1OHHD 5FWXA 3U61B 1NN5A 1V1RB 1KFEB 1TCAA 1W85A 1NPYA 1SRQA 3LVQE 3IUMA 4KX5A 4LHYA 4N5DA 5ARCA 4C7OA 5BOSB 1J24A 2XTZA 4X6XA 3ST7A 3T06B 3QBJA 1G17A 1HDYA 5M7EA 5F9HA 3HJTA 1UKEA 1CF2O 2QRHA 1EFKA 2DHRA 3MJTA 3K8ZA 4BMCA 1JBEA 5HKLA 2QL5A 4HEQA 2NXCA 4RCZA 3FPCA 4JQYA 3O1JC 5TVKA 3IKTA 2OD2A 3HH8A 2DPGA 2D1QA 1L5HA 1T5BA 5JNUA 1P3JA 4MMXB 4ZAYA 2DPHA 3AEUB 1XXHE 3BB4A 4KMMA 3E22A 4PAOA 5EUBA 2NZVG 1LBEA 2Q2NA 1TCVA 5AJYA 2Z3ZA 3LSTA 4GL4A 3ZWAA 3WL3A 3T95A 1LFDB 4QDJA 5CMLA 4I1IA 4JEUA 3CIOA 4HH3C 4LN1A 3WE7A 2OCKA 2XNJA 5LP6C 4CEHA 3RVRA 3U4IA 1ZRSA 2ATIA 5E6UA 4EELA 1UOEA 4H7HA 2KYRA 4PHGA 5CLQA 1BROA 1CFZA 1NY5A 1XTVA 4XIGS 5ALFA 1E2DA 3K8OE 4B47A 4ER5A 2CHUA 1O5IA 5ALSA 4S2EA 4XM2A 3RW9A 3WMWA 4EBBA 1P77A 4BWYA 2E4AA 3U9SA 2OM6A 1Z2EA 1JHVA 1TJ4A 3FWZA 5JPIA 3UH0A 3LQYA 1B16A 4CQMD 2X0JA 4NFLA 1QHEA 2JGMA 2NZUG 3B6IA 1G20B 5KAMA 4GOND 3KXPA 3REQA 1W4AA 1PX2A 3H1FA 4MIEA 2VF2A 4OHMA 4X63A 2WPDA 5HQ3B 4DGQA 1K7YA 2ZRKA 2A6PA 4YRAA 1ZOIA 2R25B 3CSSA 3KQVA 4AKTA 1OT5A 4GZMA 1TMOA 1NDHA 3QKUA 4GBJA 1QC5B 3ZK8A 5B1YA 5TQ2B 1CQIB 1A3CA 2AUNA 2DFLA 2ADMA 2H5JA 2P6UA 1C7IA 3E1KA 1KEEB 1T5IA 4TWAA 4XX0B 5H02A 1A9PA 4HXEB 4IMIB 2P6OA 2R6CA 1PI3A 2AL7A 1YJXA 2HU7A 1HT3A 1NVAA 3GDHA 3VNAA 3CNBA 1ZUNA 4PO9A 2NO0A 3WQBA 4DQVA 1V6AA 2WK1A 1IHDA 1RFLA 4UMEA 4QGSA 1W0CA 3V8VA 1I80A 4Y6OA 1H2EA 1JL3A 1JLSA 3GFPA 4P53A 4RQAA 4K28A 2R1TB 1VC2A 4K9NA 3CZQA 1C9NA 3IERA 5FJJA 3TAXA 1NT4A 2FWNA 1A9ZA 1J06A 2FSGA 2QTZA 2WMYA 3EXEB 3I32A 4YUWA 4WZBB 1MQ8B 4Y9TA 3L7OA 3KUCA 1SU6A 5ES3A 2J32A 5ICMA 5JZVA 1YE8A 3LO5A 2QVBA 1DC6A 3RANA 4ZAWA 2XUAA 1NLMA 3HUTA 4RNCA 1ZZEA 3VR1A 4E11A 2FWPA 3I2JA 5L45A 1XRRA 3FAKA 4Z4HA 3TKLA 3OMWA 1VMKA 1EX9A 3P9SA 2PFSA 3NBQA 4M6WB 5AKXA 3FCYA 2DLCX 2I7DA 5C32A 3HCCA 3N7TA 3VR2A 4BV3A 4OU5A 1UZMA 4BNYA 4DSUA 3RF6A 3GLHB 1F5NA 1RIIA 1I51A 2IDJA 3CISA 5HW0A 1EFLA 2GWHA 2R6R1 4P2BA 1UXJA 3FPKA 4RKFA 3RJ5A 2GT1A 1QS0A 3RROA 3HFSA 4MUMA 4DNOA 3VOSA 4AF6A 5IRCD 2J4CA 1ZI8A 4RHCA 1J8VA 2I0FA 3HPQA 1IDN1 2CL0X 2BTQA 4KR6A 2RB4A 3AR3A 3DDOA 1PR2A 5DX8A 3VA7A 2YWDA 5AVZA 3OY7A 3IUSA 4YRJA 4BWVA 1NLYA 4UHHA 2XE6A 1C7FA 4EENA 4X85A 1TF7A 3KHSA 4GOJA 4BLSA 1N5KA 1JHUA 4RVSA 2PR2A 2YYAA 1QH1A 2E4YA 2NUTA 4O4LF 4KUEA 5FEUA 4JI2B 3CZRA 3TLXA 1S7CA 1JKXA 3IQZA 4QTZA 5LUBA 3SYNA 3OJ0A 2HA4A 1C8BA 3G85A 2C1XA 3LGSA 2ZAGA 2OZVA 2Z3VA 1L5WA 1A7KA 3UAYA 3Q3HA 2VRCA 3SYTA 4HD8A 2WFMA 3ORSA 2HT1A 5CLFA 2ENUA 4B3BA 5CU7A 3PFIA 1VZ3A 2GCNA 3EZ9A 4L0QA 1UFRA 3IVAA 1XZNA 4IOLA 3G88A 4PBSA 1YRQA 4UBKA 1IHXA 1Z4QA 1KEWA 1KFBB 4YCCA 3TJRA 2B3DA 3ETDA 4CG1A 4MLDA 4A5SA 1ICEA 4WFIA 2ORYA 1TKCA 1QVRA 2FSVC 3N1UA 3DJFA 3DZJA 4N9QA 2B37A 2A9RA 4J7CA 1O89A 3DC7A 2XMGA 3GA7A 4PZEA 4WKBA 1Z7GA 2CLLB 3A9VA 1HPLA 1WB4A 4WCFA 1M34A 1VKNA 4PIVA 5ITZA 1ZM3A 1ZX1A 4QULA 5CK5A 3D6UA 1X86B 4NCJA 1LCIA 1RHMA 5DBEX 2PMDA 5DK6A 1VYVA 2YJGA 3OE7D 1P0IA 4KYUA 1VHDA 1RKUA 5CB4F 1EDZA 1NPTO 3ADCA 5EXPA 4N8SA 3I73A 1W5AA 4NCXA 4KR0A 5HZMA 1UXKA 1KO5A 2A5GA 4TWRA 1QKKA 1N5DA 4CT4B 2ZI5A 3NQ41 2J5RA 3GZJA 1Y5NA 5AK4A 3C4VA 1SH7A 3R5FA 1A9XB 4WDQA 1ZY2A 4PX5A 4BMYA 5AXCA 4RTLA 4QOJA 2CJPA 4HX2A 1DB3A 4TTAA 4XLLA 2JFXA 4BVKA 3NUQA 4B74A 4U5XA 3TNLA 2XZPA 2OENG 2VRNA 3NHFA 1M1NA 4Q6BA 3QXGA 3UGTA 4TL8A 5DHTA 1QO0D 3GH3A 1VMAA 1RQ2A 3FYCA 4L4UA 1UFOA 1C5KA 4BJ3A 2HWYA 4IIDA 3OICA 5CW1A 1KZGB 4LTNA 3LF1A 3OZGA 2CNOA 1KJZA 5FOVA 3I28A 4YX9A 3NU1A 1OC4A 4NX2A 1W1IA 2A0FA 4XPZA 2BT4A 3IQWA 3TSCA 1AZSC 3TSYA 1RADA 3MCTA 4RD6A 3QXHA 3THWA 4F11A 4HT3B 1I9CA 3I2HA 1YRWA 3SGLA 1T9GS 1ZIPA 3ZBPA 2BM8A 4ZI7A 2Y1KA 1DOAA 2IKQA 4WUVA 3VC2A 4E5YA 4BDSA 5EP1A 1R5OA 5TXGA 3RC1A 2P9EA 3T3DA 4BATA 2D5BA 3CT6A 4BWGA 2O2CA 2Q1YA 3R23A 3CPJB 1LFAA 3FOCA 3FZNA 4I8XA 5DZSA 4LHSA 1L4LA 4OLAA 4B3FX 3WAGA 3IC5A 1P7ZA 1Y3AA 1P44A 4LVNA 2FUKA 5DNYB 2UV8A 1TIPA 3LTEA 2COEA 6YASA 3DNMA 3NC0C 4TWIA 5THXA 2DPLA 2OM2A 2D2IA 3PICA 4BLQA 2JIRA 1IHYA 2G77B 4L6CA 2Q7OE 4PYJA 2MDTA 2WIAA 2DC1A 1TD1A 1WDWB 4ZKEA 1DRKA 3C3MA 4PVCA 3OCYA 1XVUA 1FP1D 4QUHA 4Y6QA 3THOA 1NQUA 4L07A 5F78A 3TFQA 2V74B 5C1DA 2W98A 5LMNB 4DJJA 2OB2A 1MIOB 1ISFA 4G4SO 4EX7A 2JIQA 2BHSA 3E58A 1N8TA 1H1LA 3H87A 1MAUA 3PCXA 4MGZR 5J2TF 3C15C 2J09A 4UAJA 3USZA 4RHXA 5EE1A 3C3PA 3RWOA 1BXRA 1Y82A 2ZI6A 1JHRA 1IN8A 3IUNA 3V4ZA 1SURA 2F9FA 2W8BB 3SBOA 3MWDA 4OF4A 4JLAA 1KMNA 1FYVA 3DCJA 4HWKA 1OB2A 1TT5A 4JR2A 1CX9B 1OREA 4YGYA 5THQA 1JJ7A 1AS2A 1K06A 3YASA 2CXHA 5C31A 1VSUA 1EDOA 3WLQA 4PLYA 1D6MA 2Z4TA 1NQTA 3FYTA 1C1XA 2PD6A 5LLDA 1C9MA 1EM8B 2O8FA 1KARA 4WFQA 4K6CA 2E2WA 2F00A 4B6QA 2VUTA 1C3XA 2QORA 3E5RA 5KB3A 2VQ6A 4D5GA 5K4HA 1FDSA 2HTEA 4ERNA 4EPXA 5L9AA 3HCRA 4JYAB 1EDBA 1UOOA 1PWXA 2PS3A 1AT1A 2WHPB 2QTMA 4QHTA 1KOLA 4GKJB 4QNRA 1JEEA 4PZ9A 7ADHA 1E4EB 4RA6A 2XGOA 1IRIA 1JAZA 1YZLA 1ISJA 1KFKB 3PG5A 4F85A 4F2DA 1BJRE 1G8AA 4RH0A 3F96A 4QD3A 5LZ4A 1YVEI 2C5EA 2KM1A 2XMRA 2ZJ3A 4ZYVA 1NZJA 2O8DA 1OE0A 2DR2A 2C3UA 1JF8A 3WWZA 4BEBA 3C3XA 1EAMA 1NDQA 2EL9A 3WK8A 2RKWA 1YS7A 5HF9A 5TPZD 3FPFA 1MMFB 4UHCA 5IKEA 4N48A 4CTOA 3M4NA 4C30A 2EP5A 3E0XA 1N3IA 2VHQA 3IPXA 4IHJA 4WJLA 4MKGA 4E5KA 1OFIA 1HYQA 2RGWA 3C98A 2OLKA 4Y8VA 3JVEA 3L1VA 5HNKA 4IQFA 1C9YA 4WXRA 3GCDA 1LGYA 4DRYA 1OAOA 3IPLA 3NH9A 4MCAA 4Y9UA 1VIMA 2Q5HA 4LJRA 4NH0A 3C6QA 2H1IA 5CVCA 3BWYA 5DYWA 4CLOA 4G0MA 5LNK6 3DVQX 2F7SA 2PUFA 2CHEA 2IFTA 1Z4LA 3CZCA 4GZLA 1Q83A 3MOIA 4H31A 4NYMR 4A92A 3D3EA 1K6XA 1XD9A 3K73O 4MVJI 4KFTA 4HVAA 3ONEA 3HYRA 3W5BA 4AZ3B 4YPVA 3AXSA 2CBGA 5KWVA 1V8FA 2TECE 3AKEA 2CB0A 3D6TB 3L8MA 3JQAD 4Q9DA 2RH9B 4R68A 4Q9KA 4OK5A 1ZRMA 3H6KA 4DRXB 1JR3E 3GLQA 4UCFA 3UJ9A 3ROMA 2PTHA 2AJCA 2Z5LA 5AQ1A 2WF8A 1OD6A 3ENZA 5EPUA 3SZLA 1WULS 3C87A 3SHFA 4XVRA 4I8DA 4KFRA 5F7ZA 1Z6TA 4PZDA 2P40A 2QG9A 2BJHA 5JSYA 3Q8MA 3N2GB 5I45A 5DGXA 2RHOA 3F4BA 2EKQA 4UE2A 4B8YA 1DUIA 4XCQA 3QXXA 2WIDA 1UP7A 3UHFA 3X1WA 4YV7A 2IE8A 4GKAA 4IFTA 1F4VA 1MABA 3EDOA 4M9UA 2WJ6A 1E94E 2AQIA 2EC5A 2H4ZA 2BGWA 2J3IA 1RMTA 1P9LA 2AR0A 4HX5A 1VE5A 2CYAA 4KV7A 1V16B 1ZSYA 5G53C 1O95C 1V95A 2P9HA 3RTEA 5DCWA 1GHTA 3ZHYA 3LPNA 4RCVA 3KCQA 3RSZA 1RYYA 3HBAA 5IUJC 3ZCSA 5KX5B 3TPZA 1WBJB 1MZVA 1JHDA 4QGFA 3RWBA 2Z8ZA 1C8LA 4J0DA 2C96A 1QGZA 3ESRA 1O95D 1ESNA 1IXRC 1P1IA 1X2BA 3LYUA 5SY4A 4EY5A 5ALKA 3OA2A 1Q7BA 4DDUA 1G21B 1XIVA 3DVAA 1T3GA 4P4GA 1PGNA 4IRXA 4NP6A 4EABA 4NC9A 1WU7A 5JNRA 1KOFA 1R9NA 2OV6A