3JQ7B

Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor (nadp+) and inhibitor 6-phenylpteridine-2,4,7-triamine (dx2)
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
267
structure length
246
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVKTVETQVAELIGTNAIAPFLLTMSFAQRQNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-based design of pteridine reductase inhibitors targeting african sleeping sickness and the leishmaniases.
pubmed doi rcsb
source organism Trypanosoma brucei
molecule tags Oxidoreductase
molecule keywords Pteridine reductase 1
total genus 94
structure length 246
sequence length 267
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2009-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3jq7B00
3WOHA 2Q99A 4MVJE 1HT0A 1WWKA 2EJWA 2YV1A 4M1QA 4CMIA 3D0OA 2Y05A 4M49A 1QG6A 4PFJA 1H2BA 1BMDA 4JXKA 2YFQA 3IDSA 3LF1A 1ZBQA 3DOJA 1ZMTA 5TS3A 5CDGA 2JFHA 3LYLA 4Z9XA 3EZYA 3RQSA 3P2OA 3DONA 3WXBA 2VNAA 2UV8A 4EBFA 2PH3A 5H82A 3UN1A 2VYND 3HE3A 2PV7A 4B3JA 3H8VA 3H7AA 4N5LA 2P2SA 5ER9A 4QXMA 4E2YA 3D3WA 3A9WA 5EJ2A 1DRWA 3DZJA 1WVGA 4C7KA 5JY1A 4DIFA 1R66A 3WIEA 3ZWWA 1N1EA 2YV2A 3VZPA 4GMFA 5AXBA 3PIIA 1Q2XA 3VH3A 4CM9D 3TOZA 4ALJA 2AHRA 2OBYA 1T1SA 4KQXA 1A27A 1N5DA 3TZHA 3OSUA 1K89A 1NR7A 2NU8A 3D3WB 3LLVA 1E1KA 4AJ4A 1GL3A 3CMMA 2B36A 2GLXA 3KLMX 2NTNA 1JLLA 2GD1O 2XXBA 4DPLA 2VZ8A 2G5CA 4WCFB 4BKPA 2ZKLA 3ZHYA 1PQPA 5JYDA 5T6BA 2DFVA 3G17A 1O95A 4OQZA 3GG2A 4DMMA 4DIBA 1V3TA 3FRJA 4YJDA 3TZKA 5I9LA 1ADBA 1Y6JA 4U0KA 1EDZA 2C0CA 2DBVO 5L7YA 3U4DA 3ZDFA 3L07A 5IXSA 1YB4A 4J1TA 2EGGA 4RVUA 5IFLA 4M54A 2X6TA 2EJVA 5DBFA 4ZA2A 2EP5A 4DPMA 3JYPA 3PFFA 1HDCA 3A06A 3IKVA 1HE5A 1X0XA 2IZZA 4J3FA 3C85A 1I33A 4E3ZA 3NTOA 4J4BA 2W8ZA 3JYQA 4NMHA 5A3JA 1A7KA 2NV6A 3BTVA 4BNNA 4Q3DA 4R51A 2E37A 3GR6A 1DIHA 1E7QA 3HFGA 5I8WA 3K5PA 4DA9A 1LA2A 2RHCA 2Q50A 3DAPA 3C1OA 2LDXA 2X58A 3E48A 1E92A 4TROA 1QP8A 5L45A 3HZZA 3GMSA 4PZEA 1TT5A 4F46A 2GERA 2DBRA 5DCWA 5BSHA 3GVIA 3VPXA 5T67A 4IMPA 1IPFA 3WGOA 3OBBA 4QT0A 4H16A 2IE0A 3M2TA 1AHIA 1B16A 3PLRA 1MA0A 2BGMA 4A2CA 4JJFA 1R4MA 2EV9A 3JQAD 1UZNA 5FI3A 3VZSA 5G4LA 4YYZA 1KC1A 2Y1DA 4YR9A 1QMGA 2ZJ1A 2OHXA 4CMJA 1UUFA 2VYNA 4Y67A 3JQ8A 3U4CA 3GQVA 3PPIA 3LT4A 3OQ6A 4TVBA 1UP4A 2R2GA 3TRIA 1XYGA 1LDBA 1E6EA 3HDHA 4NHEA 4PLZA 3SXPA 5AXCA 1BW9A 1NPYA 3INRA 1ZIDA 1A4UA 1ZK3A 3TN7A 5DCYA 3DEYX 3LT0A 4J0FA 4MKZA 1YJ8A 4W7IA 4QQRA 4GVLA 4BNMA 1LRKA 2SCUA 4WLNA 2QG4A 2DTXA 2CDCA 4KUHA 1E1MA 3GDFA 4WE3A 3U3XA 1XG5A 2X5KO 4R1NA 5BSEA 4MO2A 3TWOA 3WSVA 2PY6A 3C7DB 3R0IA 4LVCA 3DOOA 2W2LD 4CMIB 3OECA 1DC3A 2X5OA 4MPDA 1CETA 4NFSA 4ROSA 4FS3A 1VRWA 2O4UX 3HFSA 3R1IA 1P45A 4CLHA 4QTZA 4XKJA 3H5NA 1N9GB 5TNXA 3WGZA 3F5SA 5I7EA 3LQFA 4PVCA 4B7XA 4TVOA 5TC4A 3EHEA 1YB1A 4J6FA 4IY1A 1K5HA 1GDHA 5A05A 1R37A 5KTKA 3INTA 1PX0A 3JQDA 3RFXA 1YH3A 1DAOA 4BNLA 4XB2A 3DZGA 1JAYA 4R5HA 1O0SA 1H2HA 2ZB4A 3EAGA 2YV3A 4BNTA 4ALLA 3UGKA 3I23A 2FY8A 3KBOA 3RCBA 4KQWA 5CG1A 2OP1A 3IIEA 2VT3A 2I76A 1E77A 4E12A 1E6WA 1A9YA 1LDGA 2YQ4A 4R3WA 1CIVA 2YZ7A 4DUPA 4BNIA 1W73A 5BNFA 3ANNA 1JVBA 4WLUA 4KWHA 3U49A 1PS8A 4O0LA 3OQBA 1NHGA 4ALMA 3V8BA 4DLBA 5EQDA 3KV3O 1WW8A 3GVCA 3B1KA 3T4EA 4CM8A 1J49A 1U2GA 3WNQA 4PVDA 5A1TA 1Z82A 3JQFC 4RVDA 4C4OA 4IUYA 3B1JA 1Y8RB 1IZ9A 3AM3A 1AHHA 1GZ6A 4RF2A 1A7AA 3I9OA 4BNXA 4KZPA 3MJVA 3WX0A 3HB4X 5TJHA 4BO5A 1DXYA 5JCJD 2BRUA 1EVJA 2G82A 5IAAA 3GA0A 1GYQA 1HE3A 4NI5A 1V9LA 2FMUA 3JQ6A 3BA1A 3WYEA 1VE9A 3I3OA 4YT5A 3JQBC 3AI1A 1I3MA 1P0CA 3L4BA 4BNZA 1NM5A 3GFGA 3WS7A 5JNLA 5J23A 1HYEA 2HKIA 4RO0A 5B37A 4J7CA 2YHUA 1O89A 2DAPA 2LDBA 3L6EA 1CQIA 1NPDA 3ORFA 3PJDA 4BNJA 4TSKA 1JA9A 4EJ0A 3OFSA 3LSYA 3MCVA 1HDRA 2JL1A 3KSZO 3K8ZA 1P1KA 1HETA 4DIOA 2CNBA 3OH8A 3KSUA 2RH8A 4IDBA 3RUAA 4B4WA 1L1FA 3VTZA 2D2IA 3DDNA 2NVBA 3P2YA 3PYXA 5DP1A 1KIFA 1GYPA 3V1UA 2P68A 2BKAA 1MGOA 1PL8A 4PG4A 5ILOA 5C7LO 3DZKA 3H5RA 3RWBA 1ID1A 4IQ0A 2B37A 4MP8A 4HV4A 4E32A 1GD1O 3PQFA 1MLDA 4BGUA 1U3WA 4O6VA 3AUTA 3JQ9A 1JKFA 4CM5A 3I6QA 5MDHA 5A03A 2FSSA 1IPEA 2P9CA 4KDFA 4MVJI 3JQ8B 3QW2A 4ONEA 2D5AA 4I9HA 3GDGA 3NKLA 1EDOA 3KXDA 3RBXA 2NQTA 2PGJA 2WEKA 4HWKA 1DLJA 2X0JA 3BZUA 2GZ1A 4JBGA 4W6ZA 3SBOA 3BMOA 2O50A 1QV7A 2VWHA 1E1NA 3K92A 3TQHA 4LGVA 2VRBA 1GFSA 1LSJA 5GZ1A 1LQUA 2DTDA 4ESOA 1M67A 5TIIA 2ZIZA 4GSKA 4QUKA 3M6IA 2I66A 3QWHA 2YUTA 2OFPA 2O4CA 2E49A 3DXFA 2CZCA 3V2GA 5B1YA 3VDQA 4DQUA 4IDDA 3PTZA 1DIAA 4W9NA 2WM3A 5G4KA 1Y5MA 4D0SA 2B0JA 3EZLA 2PZMA 4BVAA 3E18A 4INAA 4QO7A 4TRJA 3W8EA 1SCUA 3IQDB 5KJ1A 3FR7A 3GFBA 3WFIA 1BG6A 4DWVA 1IUKA 3I52A 5HS4A 3K31A 2JHGA 3Q9UA 1LRLA 2FR1A 5TT1A 1LTHR 3QV1A 4AJPA 4BO6A 3HB5X 1Q1NA 4PRKA 2O2YA 2RBEA 1SMKA 1F17A 4DL9A 1BTOA 4XR4A 5JDIC 3TPCA 1B15A 1OFGA 1P44A 5BNTA 2V65A 2G1UA 3KZVA 4CLRB 4JN6B 3GPDG 4QX6A 3V1TC 1ZFNA 4WLVA 2NWQA 1NWHA 2I6TA 4RCVA 3D4PA 2HK7A 5A9RA 3ICCA 3RI3A 2NU7A 1EE9A 2V7PA 2GN6A 3DHEA 4J2HA 1H9AA 4XCVA 4YAEA 1JDJA 2VRCA 3GT0A 3PHIA 4NJMA 3G1UA 1DC6A 1N2SA 2I67A 1WNTA 4AJOA 1C1DB 3ROPA 3LU1A 2ZB8A 5T64A 2X7HA 1J5PA 4FC6A 4NJMB 2PZJA 3AY6A 1PJLA 3D64A 3UCXA 5HA5A 1GCOA 1YRLA 5T5QA 4NZ9A 1I2BA 4MVJP 1YL5A 4RL6A 4ZQBA 2Y66A 1KVQA 3DO5A 2JD1A 5IZCC 4QEDA 1QLJA 4M87A 4AJHA 4XD2A 4Z9FA 3PVZA 4FGWA 4MIOA 1Z6ZA 1E0DA 4J9UE 3WTBA 4CMAA 4LW8A 1HYHA 4OSOA 4FQ8A 4YRDA 3JYOA 3DFZA 3H9GA 2OXIA 4CJXA 4RGBA 1KEWA 1DC4A 1S7CA 3GZ4A 4EUEA 2PD4A 1IYZA 4CM1A 3BYZA 3OIDA 4PZDA 1NFFA 3AI3A 4RQTA 1AUPA 3ONFA 3RKRA 2WJPA 3UCEA 4RQUA 4E0BA 5G2OA 4XQ9A 1VPDA 3RUFA 3UVEA 3LC7O 4JROA 4GAEA 4OGWA 1U28A 3MJ4A 4HP8A 4BL5A 3T4XA 4LCJA 1P1IA 4RVHA 5K6AC 1DLIA 3ZWCA 1NWCA 2BFPA 3GG9A 1Y81A 1ZUD1 2BF7A 4L75A 2NQ8A 3UICA 4IJUA 4XX0A 1E6UA 1E5QA 3F1KA 1NYTA 3BTOA 5CFZA 2CF6A 3VC7A 5ITVA 5TQVA 1PZHA 5FFFA 1R16A 3HJAA 1EUCA 4D0RA 1D1TA 3ZNNA 3ULKA 1E7MA 1X1EA 4HBGA 2W4QA 2A9FA 3EGOA 1RPNA 4M86A 2Q1UA 4YJHB 3WMWA 3I83A 4GKBA 4FOSA 2OOSA 2QIOA 2V6MA 3AOEA 1LUAA 2BMAA 4UVEA 4Z6KA 3KYDA 1VKNA 4FD3A 1ISHA 5IDWA 4RVGA 5L4LA 3UHAA 1ZJZA 3KYCA 3MOIA 5DOVA 5EIOA 4D7AA 4CQLB 3ZN2A 2ZCUA 1H0KA 1I8TA 1P74A 4WNCA 5JPIA 4BQRA 4H15A 1K0UA 1Z73A 2O2SA 2Q2VA 5JAZA 1UXJA 4P38A 2X9GA 1ZXLA 5COQA 3RUDA 4BUCA 3B1FA 2AW5A 2VHVA 4GGOA 4CV3A 2VZ9A 4GX0A 4CQLA 3ZWNA 3ZNOA 3FHLA 3VVCA 4I9NA 4E5NA 1P0FA 4C7JA 3D5QA 3W4KA 3NJ8A 1PL6A 2E4AA 4JBHA 3GMDA 2X22A 4DBVO 3JYLA 2P4QA 3GHYA 5EN4A 1T2AA 2AQIA 3N74A 3CPSA 1G6KA 3ZHBA 1WDKA 2Y0CA 4UUPA 2GO1A 5FF9A 1H9BA 4WJZA 1I30A 3PJGA 4A73A 2DUWA 3OJ0A 2I5PO 3PHLA 1NAHA 5CPBA 5T8KC 4NG5A 3TSCA 5JDIA 2P91A 4UREA 4DBZA 1VI2A 5U4QA 3ZV4A 3MOGA 4CQMB 3HN2A 1ISFA 1HEUA 3ZCXA 1GZ3A 1SBYA 4HFNA 4M89A 4GMGA 4PLYA 4GLLA 5A9SB 3W4IA 3QSGA 1B2LA 3RAJA 4J0EA 5IZCA 3JCZA 1PS0A 4XIJA 3OJLA 1U9JA 1WLYA 4UEKA 4HKTA 4AJEA 1O5IA 2B5VA 4K6FA 3H9EO 2VHWA 3ZHZA 4PLCA 3OA0A 5JO0A 2Z95A 3ZU3A 2ZQZA 2X86A 5A9TA 3GGPA 4MDHA 1NQTA 4NBVA 1N7GA 8LDHA 2YY7A 4CM3A 2NNLD 2HMWA 3GVXA 4XGKA 2VUTA 1SEVA 4K6CA 4A5OA 2J3HA 4M55A 2AE2A 2J5KA 4U6SA 4ALNA 4ITUA 3PZBA 3I1JA 3RU7A 3I4FA 1HF3A 4EZBA 1U2DA 3NEPX 3ZNPA 4YAKA 4LISA 5HM8A 1ZH8A 3GY0A 1WDLA 4BS9A 2IZ1A 4TKLA 1A5ZA 3GNTA 5CDYA 4XGNA 1GZ4A 1KY4A 5A4DA 4JJGA 1I3LA 2I99A 1KVSA 4U7WA 5CDTA 3BTUA 3EDMA 3BMCA 4II2A 4N5NA 3CUKA 4OOEA 4OXNA 1JAXA 4XJTA 2Q46A 3PQDA 4J7UA 2RAFA 2NVUA 1U4OA 2WMDA 4DVJA 4IGFA 4EGFA 3LF2A 4E2ZA 3FBTA 1HXHA 2GYYA 2CVOA 4TRRA 4YT4A 2ZTMA 3NV9A 4Q3BA 1YGYA 2O48X 3MZ0A 1E3SA 3JD2A 3D4NA 1QYWA 2NVUB 4IZHA 1VLLA 3G1TA 3R3JA 4ZQFA 4XYEA 6LDHA 1V0JA 3AY7A 4E2XA 1CJCA 2PNFA 3CINA 3C7AA 3MJEA 1E3LA 3FSRA 3RVDA 1LDEA 1MUUA 2C59A 1U8XX 3GRPA 5IG2A 4IZIA 2X1HA 4LK3A 1ENOA 4FB5A 1C0KA 4CUZA 2A35A 4R1UA 4BO8A 1C0PA 4XA8A 4CPDA 4KTTE 1I0ZA 3GGGA 1A72A 3IUPA 1A71A 1V6AA 4URFA 3OJOA 3E03A 3WYBA 1QKIA 3KYCB 4CM4B 3H3JA 2IRWA 4PN3A 1MC5A 4FDAA 3RD5A 3DBRB 2OZPA 4ZICA 4EI2A 3JD1A 4BO3A 3ETGA 1H94A 4YT8A 4XYGA 1C1XA 5LC1A 3W6ZA 3TL2A 4GQAA 2IYOA 4CM4A 3PFWO 3QQPA 4UVIA 2DBQA 4ALKA 1B14A 3IP3A 3IAHA 3P5SA 2HK8A 2NU6A 1MXHA 3F5QA 4JNKA 3W4JA 3DBRA 5C7OO 3V2HA 2Y0DA 3AJRA 2Y1GA 2V6FA 3V5NA 3G49A 3VH4A 1IULA 2XF8A 1NVTA 4NNJA 4E2WA 2AMFA 2J3JA 2TMDA 4ZD6A 4BMNA 1NVMB 1YQXA 2JD0A 2PR2A 3ADOA 4RPGA 4GKVA 3WQQA 1MG5A 4WLFA 4BNWA 1KEUA 3ZGYA 5L3ZA 1E7SA 2YHIB 4TKMA 3SJ7A 1WDMA 3GEDA 2EXXA 3BTSA 1F14A 3HHPA 3FCOA 4HY3A 3OF2A 3I5MA 2D59A 2H5LA 3IP1A 5JDCC 3UXYA 3QWIA 4PG8A 3PQEA 3JSAA 4E31A 2NTVA 2OL4A 1XKQA 1AGNA 2YHIA 1BXKA 3TNLA 4WOJA 5DBIA 3HDYA 2B69A 4R1SA 1EQ2A 1BWSA 3DZHA 5IN5A 4YDRA 5KJ6A 2VWQA 1Q0LA 4IDGA 4UUOA 4YRBA 3ZWYA 9LDBA 4BGVA 1VL8A 2ZJ0A 3NGLA 1GUZA 3E8XA 4FR5A 5CEJA 1HSOA 5L40A 1K6IA 2E48A 1I36A 5JBIA 2HQ1A 5A5EA 4NK4A 1JVSA 3STHA 2FR0A 4CMHA 4CUKA 4WOKA 3RASA 3H2SA 1FF9A 5F5LA 1ML3A 2HO5A 1R4NA 4TRMA 3F46A 4PLTA 4BV8A 3AWDA 4MVJG 1I01A 3L77A 5KCZA 5FWNA 3HDQA 3FWZA 2C5AA 2X0IA 1UDBA 4BHTA 4F6CA 4MP6A 4Z3KA 1P1HA 1YKFA 4J90A 2I3AA 4QSMA 4UVDA 3CE6A 1T2EA 1ISJA 4ND2A 3E5RA 2BD0A 4BMSA 1E7RA 1DFHA 2X23A 1IE3A 2GZ2A 5HS6A 3GPIA 4I5DA 3OHSX 3A14A 4CR7A 1BXGB 1QYDA 3VHRA 2W98A 5THQA 1NASA 1NBOA 4LRTB 4MJLA 3H6KA 1E3IA 2EERA 3AW9A 3CXRA 4CV1A 5F1KA 2GR9A 1D3AA 1XU7A 1UDAA 2F1KA 4J1QA 3PGXA 1Y9EA 3K2BA 3GN2A 3ST7A 4BO4A 4XWYA 3HUDA 4ZRNA 4AJLA 2FPPA 3VH1A 4L74A 4XQCA 5KJEA 3ZWBA 4CMEA 4TZTA 3E9NA 3K30A 1DHRA 5AVOA 3OM9A 2J5RA 3CZRA 4JLWA 3ICPA 4MVJA 3KLPX 1TVEA 2PGDA 4Q9NA 5U1PA 4JIGA 1WMBA 1M6WA 3EVTA 1T25A 2WTBA 3NYWA 2X0RA 4CM9A 2WD7B 3TL3A 5JE8A 4GBJA 4OL9A 3VDRA 4L8VA 1NQOA 1ZCJA 1B0AA 4FFOA 1HYGA 2JCXA 1B8PA 1WP4A 3NJ4A 3ZV5A 5A02A 3QIVA 4WPGA 1UXHA 4HFRA 3DBHB 3H9UA 2Y0EA 3INGA 4NBWA 2VHYA 3U62A 3VZQA 3T7EA 1X7DA 4D79A 1P1RA 2J8ZA 4RV9A 1P1JA 1R4MB 3LK7A 3O9ZA 2C2XA 1I32A 2UAGA 3QVXA 2UDPA 1NXQA 3AFNA 4BGIA 5FYDA 3BIOA 5JCJA 4XYMA 3FN4A 1SNYA 4Z0HO 3WJAA 4NPCA 1P33A 5JYEA 3C3XA 2RHRA 1DIRA 1EK6A 2EG9A 1LNQA 1PJ4A 3FNFA 5IF3A 4R5MA 4FFLA 2GN4A 2ZTUA 3S8MA 2GSDA 2HUNA 5DULA 4KP7A 1LLUA 1ENYA 4L0QA 1LLQA 3H65A 5CG2A 1DJQA 1GQYA 3PIDA 4R4JA 5BSFA 1DB3A 2JFGA 3JQCA 3K96A 2JD2A 2PD6A 3ASUA 4J9VA 1EBFA 2XAAA 1PGNA 2OBNA 1Y1PA 2P9EA 4TWRA 3OEWA 1EVZA 1PZGA 1AXEA 1MV8A 3FI9A 4YJFA 4AJIA 2ZB3A 2NU9A 1I24A 5IN4A 2VTEA 1YQDA 3RFVA 4G5HA 4Y6SA 3RFTA 3PHJA 1H6BA 3IS3A 1T2FA 4A03A 1X15A 3ZU4A 2VTDA 4CLEA 2HJRA 5JMPA 2YFHA 4YEDA 4P8RA 1P1FA 1XWFA 3ZV6A 1ONPA 1X7GA 1SAYA 3O8QB 5GZ6A 1PJCA 3D4OA 1ADFA 5I9NA 3KVOA 2HAEA 3WGYA 3GK3A 3QJ5A 3MWEB 1X7HA 1QORA 3WGGA 1ISMA 1EBUA 3JQ9C 1R0SA 3KOUA 1BVRA 3QE3A 4ID9A 4BNUA 4WLOA 5ENVA 3O03A 5G0WA 4WEQA 3DTTA 3GDOA 2O3QA 4J49A 5KJFA 1EVYA 1MFZA 3I4CA 4FFNA 3ZW9A 3S55A 3CMCO 4NFYA 1TA4A 1YDWA 5DP2A 4EEZA 1BDMA 2Z5LA 1NQ5A 5L7TA 3TFOA 1KS9A 4NU5A 1M76A 3S2IA 1MC4A 2JFFA 3PHGA 3Q2IA 4WUVA 4ZRMA 2O3TA 1FDWA 3W6UA 1BSVA 3PDJA 1BXGA 1EVIA 2B4TO 1H6CA 4JCOA 2IEDA 3F47A 1PR3A 3ANLA 4I9UA 3UFXA 3F9IA 2DPGA 1I3KA 3RKUA 4G65A 2CSUA 2W2LA 4FJ0A 5HWSA 5H83A 3QWBA 1T2CA 2AA3A 4P4LA 2OUIA 3AM4A 1VL0A 2ZK7A 4N7RA 2WYVA 4RPHA 3SVTA 4WCFC 1FDSA 5EL0A 3GEMA 3S1LA 3HG7A 4HFJA 3T7CA 1TT7A 2PZKA 4F45A 1YS4A 2J6IA 1BRMA 1OAAA 3CTMA 2VRCD 1U5AA 2YJZA 1UZLA 3ONEA 2VCYA 1ZZEA 2GDZA 3L4SO 4YA6A 4DYVA 3ZW8A 3EUWA 4AJJA 4DQXA 1J4AA 1PZEA 5T57A 3VVBA 5AQ1A 4MKRA 3IL2A 1T2DA 2VZ0A 4MVJH 2PZLA 2D1YA 3U0BA 3GN1A 4S1VA 4BV9A 1PGPA 3GOHA 1K6XA 2QYSA 2ZYAA 4M8SA 3JD3A 1FMCA 3QWFA 4YBZA 4OQYA 5BSGA 2V6BA 3FBGA 4NBUA 1WAMA 2P5YA 3GHHA 5TT0A 1HL3A 1T26A 4ND4A 1PEDA 4D3DA 1WPQA 3S2EA 2C7GA 3GF4A 2FSVA 5ADHA 2AQ8A 2EKLA 3HADA 3OMLA 2Z1NA 4LMPA 4AG3A 4AJ1A 4D44A 3JQEA 5KNLA 4UVHA 3OP4A 2BI7A 2HCTA 3OIGA 2BH9A 3GAZA 4O5OA 4U0JA 1HTBA 1YVEI 1SOWA 4XDZA 2Q3EA 5JAQA 3ETEA 4I8XA 3ZH2A 2BI8A 1V35A 4B4UA 1UR5A 1LLCA 4YACA 4NQZA 3RUCA 3L9XA 1FDUA 2YQ5A 1DFGA 3LC1O 3SX2A 1GEGA 1ADGA 3ZNQA 1ZSVA 1SB8A 4UULA 3L6OO 4I08A 1XQ6A 5L4SA 3PWSA 3WIDA 1F06A 4JP2A 5G4KB 2BGLA 4NR0A 5EMHA 2FZEA 4YJGB 2HU2A 1M2WA 3V2UA 3W8FA 4BO0A 4AVYA 1HRDA 3EYWA 2R00A 4GL4A 5BR7A 4OYRA 2DPHA 4IJKA 4Y6RA 3TJRA 3KM0A 5KKCA 2VHZA 4Z0PA 1VL6A 2W2KA 2P5UA 3F3SA 5A3VA 2HLPA 1P77A 1N7HA 3OICA 3UAGA 4YJGA 3FTPA 4BIIA 5JW6A 4R9SA 4GWKA 4BKOA 1ULUA 1L7DA 1PJQA 2J3KA 1PL7A 3IOYA 2Y67A 5F21A 5THKA 3TDKA 2UUPA 1GV1A 5CDSA 1SB9A 3O8QA 4HXYA 1HDYA 1YWGO 3JTMA 2Q45A 1ZO8A 4KUEA 4KUGA 5KVCA 3P7MA 4QECA 1GQ2A 3GVPA 1LC3A 1SEPA 5CP8A 5T8KA 1HLPA 1U8FO 1A9ZA 2WYUA 1DFIA 4Z3DA 1X0VA 1EFKA 3DMTC 1DC5A 4MIEA 1NAIA 1RM0A 2Y1FA 2PLAA 5BT9A 1ENZA 1LU9A 2D5CA 4YQZA 5K6AA 2NUAA 1J6UA 3GGOA 2O7SA 3DHYA 2OMEA 1PS9A 1C3VA 3DMYA 1ZK2A 1CRWG 1MXFA 1TEHA 3ETDA 1D7OA 4J1SA 1DJNA 4DRYA 3F6YA 5JSFA 1T4DA 4E5MA 4IDAA 1G1AA 2GASA 1HZZA 1K3TA 5IJZA 1PJSA 2Q1SA 2ET6A 1FJHA 3LVFO 2Z1MA 3E1KA 1RM5A 4YAGA 4FW8A 3B70A 1PGOA 3CSDA 3SEFA 5B4TA 5L51A 1CERA 1ZK0A 1EZ4A 3PRJA 2DFDA 4U8GA 3A1NA 4UAGA 4OXKA 7ADHA 1XELA 1O8CA 1KBZA 4WNIA 1N8KA 5ITWA 3GH3A 5DDIP 3PXXA 2B83A 2Y1OA 2GCGA 2PA3A 2W90A 5G0VA 5BNIA 5L53A 3PJFA 2AQHA 1UXIA 5JC8A 3UH1A 3BHIA 3WLEA 5HTOA 1KVRA 4HX5A 3DBVO 4GLOA 1HWYA 4N5MA 5B4VA 3DC2A 4KOAA 1UZMA 3DMTA 3ITDA 3QP9A 1EMDA 1Q7GA 5C5IA 2NLOA 3F1LA 3PP8A 4WKGA 1C0IA 2DTEA 4K28A 4AL4A 4BO7A 1VSVA 3E6AA 1DHTA 4IJVA 1HE4A 1VJTA 4BO2A 2VUSA 4CQMD 1KVTA 3VAZA 4HNGA 3FNHA 1GU7A 1LSSA 2EKPA 4D45A 1GADO 1R0KA 2DU8A 2G0TA 4YAJA 4AJNA 4GSLA 1C0LA 1CDOA 2UVDA 2HJSA 3WICA 3NX4A 3EC7A 3I9JA 4CR6A 4D46A 3AFMA 3JV7A 3I6IA 1GTMA 1E3WA 4KDEA 3NRCA 2H63A 4R01A 5EINA 1IHXA 2IDZA 4RF5A 1FK8A 1E1LA 1ZK4A 4Q39A 5COBA 2C82A 3DHNA 3ROMA 2BELA 4PGFA 3JD4A 2NVWA 2VN8A 1DO8A 5GMOA 3O4RA 1O9BA 4S3MA 1OMOA 5F3RA 1FXSA 3AK4A 2ZB7A 3NDRA 2POQX 3DWFA 1G0NA 4CMGA 1JWAB 4Y6PA 1YL7A 4UEOA 4D43A 1BW9B 4FC7A 3ZWVA 1LLDA 3RBZA 5KIAA 2H1SA 4OMUA 4GX1A 1ZNQO 2FOIA 4XRGA 2C07A 3ENNA 3OETA 1SZJG 2Q1WA 4BNKA 2UUOA 4MVJF 1BDBA 3JQAA 4OJNA 4EUHA 1E3EA 1DRUA 2WE8A 1YBMA 3AUSA 4ZN6A 1LEHA 3V1YA 4YTEA 4DC1A 4PLVA 4Z9YA 3G0OA 4PCVA 3DB2A 2GPTA 2JJYA 2E6UX 1JN0A 3WGTA 4NBTA 5U9CA 4YAIA 3E82A 3UCFA 1LX6A 3LT1A 4XEHA 3FD8A 1N9GA 1WZIA 1X13A 3JQFA 4XDYA 4FPXA 2ZTVA 1R15A 4J4HA 2C7VA 4BNVA 4J2OA 2X9VA 1YO6A 5JC1A 2O3SA 1EUZA 4LN1A 1ZMOA 5JO9A 1JQBA 1OOEA 4FCCA 1EUDA 4JP3A 3QWAA 4LCEA 4Q3EA 3H4VA 5C7IO 2DKNA 4I5EA 5KWEA 5JAIA 1G0OA 2F00A 4PG6A 4PLHA 4CL8A 3S2GA 1WXDA 4RPLA 4JK3A 4E21A 2O3RA 4L4XA 4OKNA 3ZI0A 4RLHA 4Y98A 3BAZA 4GX5A 4CLRA 1P3DA 5FEUA 2VT2A 2Y1EA 4P4NA 4EITA 3WSWA 2ZYGA 4B3IA 2PKQP 1HLDA 4PLWA 3LZ6A 1GAEO 3C24A 1PGJA 4MOWA 4R41A 2EWMA 3M2PA 3QLJA 4WCFA 2VWGA 4LSWA 2VQ3A 4TQGA 4X54A 4CM8B 5DOZA 5F1PA 1NFQA 1U1IA 2P4HX 3DAGA 1QYCA 3WBFA 1EFLA 3RBVA 4UVGA 2O7QA 1U3TA 1U3UA 1Y8RA 1C1DA 2VYVA 1KYQA 1PQUA 4RVSA 4XYBA 1V3VA 4ZVVA 3VPSA 3U4HA 1RWBA 1XCBA 4IMRA 1VC2A 3GVHA 2PK3A 5DNAA 4XRRA 3D5TA 5CHEA 1IZ0A 1O6ZA 5TRTA 5TJ9A 5JCXA 1N1GA 1PWXA 2BLLA 4DYDA 2WYWA 5G0UA 4WK6A 4FIZA 4EW6A 2Q2QA 3B6ZA 4IS2A 5ES3A 2ZATA 4B4OA 3DBLA 2FR8A 4Y8VA 2I3GA 4E5PA 1BHSA 2PTGA 2G17A 4JX8A 1U3VA 1UXGA 3Q6IA 3VZRA 4BMVA 5IDXA 2G76A 3FF4A 5CEFA 1X1TA 3JQBA 4CR8A 4G2NA 1YJQA 4WEOA 1LBEA 1ORRA 2Y1CA 2C5EA 4XQEA 4AICA 3ADPA 3Q3CA 5ER6A 1OC2A 2J3IA 1W0CA 4RDHA 2Y99A 1TT5B 3MTJA 1Y5RA 1JKJA 3IJPA 4YCAA 3ON5A 3SC4A 1YBVA 2Q4BA 3LLSA 1B8VA 1NPTO 4BB6A 2X8LA 2QRKA 3RUIA 2JHFA 3D3EA 4A27A 1JTVA 4NFHA 4FFRA 5CPFA 4R3NA 4II3A 4J91A 4BOYA 4E33A 4IINA 2DBZA 3ENKA 1ZVMA 1W4ZA 1Z7BA 3OJFA 5F5NA 5I7SA 2XXJA 3E9MA 1T1RA 4ZU3A 2BGKA 4OHUA 2R6JA 3KRTA 3K9QO 1NTOA 1P9LA 9LDTA 2IODA 2WWRA 1HE2A 2VNSA 3I9KA 5LDHA 1BGVA 4MIYA 3O26A 3QVOA 5TGDA 4QFCA 2C29D 3CIFA 3E9QA 2A92A 5ICSA 1XIVA 2HMUA 2NADA 3QRWA 2HMVA 4OIMA 4PIVA 1KEPA 3AOGA 2FN7A 4RF4A 3WFJA 4D42A 4GH5A 4HADA 4B8WA 1Y8QB 1LJ8A 1DDOA 3DFUA 4BNGA 5TF4A 2YW9A 4CMBA 3ZU2A 5AYVA 5MGBA 3W8DA 3QVWA 1E7WA 1ZXBA 5LCXA 3A28A 5DN9A 1VM6A 3IKTA 3LDHA 2VYVD 3Q11A 1U7TA 3EW7A 4R68A 4LVUA 2I65A 2ZCVA 4GVXA 3WG9A 4Y9DA 3JQ7A 3PJEA 2GZ3A 1YONA 4U6QA 3VPHA 4N54A 1HDXA 2VOEA 3GLQA 3JD0A 2B4QA 1D8AA 3CKYA 2WSBA 4FJ2A 2JCVA 4A10A 1PJ3A 1LC0A 1Y9AA 1PJBA 1A4IA 3NT2A 1Q0HA 1NP3A 4E5KA 3NDIA 1GY8A 2X9NA 1EQUA 2HRBA 1JW9B 2R00C 3HDJA 4RPJA 4UUMA 5I9MA 3ANMA 4NIMA 3SLGA 5B4UA 3PLNA 4YWJA 2D3TA 2QW8A 4W99A 4ZQGA 4FJ1A 2C2YA 3TZQA 1Q7BA 1RYEA 4L4SA 1NX6A 1UP6A 4ZJUA 3DZBA 3TF5A 1CYDA 1I3NA 4K26A 2D0IA 2CY0A 2A94A 2BFAA 2FWMX 5LDGA 2QYTA 3BMNA 3IUSA 3KSDO 1XGKA 5JFOA 1B3RA 3VPFA 4CQMA 1XEAA 3HQ4O 3C8MA 4BNFA 4F6LA 5CDUA 4K1LA 1PGQA 1GUFA 7MDHA 2CMDA 3DZFA 5G0SA 1DIGA 3GNQA 1GQQA 3H5AA 4FSHA 4MVJM 1GUYA 5A5FA 2JKVA 3O38A 3FPLA 3ZWXA 1E7YA 5JDCA 1R4NB 4RVFA 1YOVB 1KVUA 1MG0A 3TOXA 3ZWAA 2EF1A 3L4BC 3GEGA 2FHSA 1QXSA 4NJOA 2PKQO 2NSDA 2OP0A 1PZFA 2ZYDA 1DAPA 4E13A 4CM7A 4Q3NA 4BQPA 4ND1A 2A4KA 4ZGWA 3FR8A 4ZQEA 4A26A 3E5MA 3DBLB 3TZ6A 3F4BA 4NU6A 4YT2A 4CLDA 5KVSA 3MJTA 4FOOA 4GPD1 3UOGA 4E30A 4PRLA 1PQWA 4XJSA 3WTCA 1C14A 1QRRA 4OAQA 4DLAA 1DRVA 4OSPA 2QZZA 4G81A 3OQ1A 2HDHA 2FPGA 4CM6A 4EYEA 3TZCA 1LXCA 4N18A 1NQAO 4BGEA 4EDFA 1DBVO 1NHWA 4BO9A 2GNAA 4FFMA 1Z75A 4RZHA 4OKIA 3K73O 4IGEA 2IYPA 3BXXA 3WWZA 3I9MA 1R12A 2EEZA 4IM7A 1H6AA 2AG5A 4LMRA 3BMCB 3OA2A 1V3UA 2QRLA 2BFMA 3PHHA 3AUUA 5DT9A 4BNYA 4CMCA 5AXDA 4F3YA 4JQCA 1YDEA 2WD8A 4AFNA 4J4TA 2RCYA 3W1VA 2JCYA 5JMWA 1VSUA 1ZEJA 4R69A 4MKXA 2Y93A 3MJSA 4XR9A 3FPCA 2FZWA 4IQ8A 2AEJA 4JJIA 1K6JA 5L4NA 1SOVA 3EMKA 4IQGA 5TSDA 3AY3A 4DXHA 1UAYA 5EPOA 3PYMA 5EESA 3M1LA 4PZCA 1DEHA 3H9QA 3IMFA 3AU9A 3COSA 1D4FA 5AXAA 5IDQA 5TX7A 3X2EA 1ADCA 1U5CA 1J0XO 1W8DA 1HDGO 1YE3A 1ONOA 5B12A 3L6DA 2JAHA 3BMOB 3EY4A 3L9WA 3UKOA 3NT4A 3RJ5A 4YB8A 2O23A 4OO3A 1TLTA 1CQJA 1LQTA 2PKRA 2YDYA 3PK0A 1KC3A 4NBRA 3DTYA 4W7HA 3U9LA 1Y8QA 4IXWA 1GCUA 1YQGA 4KTVE 3HN7A 4IIUA 4ZHSA 3Q1LA 1LSUA 1TXGA 4NK5A 1S6YA 1SC6A 1Y7TA 3HSKA 4DGSA 1N92A 1I2CA 1VKOA 1R0LA 4UEJA 1FDTA 4RZIA 2EIHA 3QHAA 1UP7A 2ZTLA 3G79A 4BKQA 1RJWA 4D3FA 3JQ7B 2GN9A 1OZAA 4U5QA 1LSOA 2C54A 3X2FA 4OOFA 3RSHA 3U5TA 1M66A 3HNPA 2BHLA 3I9LA 4EJMA 4LRSB 3WWYA 3PI7A 3ZHXA 2H9IA 2QZ9A 3BHJA 4L4RA 1UH5A 4WECA 3MEQA 1I2ZA 1YL6A 3C7CB 3SLKA 2CDAA 1ISGA 3DL2A 1ARZA 3MTGA 3WBBA 1LDYA 1XU9A 2J5QA 3Q0EA 3NT5A 2PD3A 1PTJA 3LT2A 4W82A 4CMKA 3PEFA 3UW3A 3WR5A 3RC9A 4D3SA 4WGGA 4BO1A 3KO8A 1NNUA 5AOVA 4E5YA 3D7LA 2TMGA 1U4SA 4HFMA 3RUHA 3RC1A 3RUEA 4IDFA 1ULSA 5DBGA 5GZ3A 3BMNB 1OC4A 3ZWPA 4YVFA 1HSZA 1ZSNA 3GZNB 4H3VA 4L73A 1OBFO 5A06A 1ZKMA 2VUUA 2DVMA 1D1SA 3CEAA 3U4IA 2O3JA 3Q2KA 1XA0A 1I5RA 4XIYA 2VOJA 1RYDA 1ZW1A 2GUGA 4XQGA 5EQFA 1QYXA 3QVTA 4B7CA 5L7WA 2JAPA 1EEHA 1GPJA 1YOVA 5C3MA 1DOHA 1YB5A 4H7PA 4IS3A 4JGBA 4Q3CA 3ROKA 5DZSA 1T4BA 1MFPA 4B3HA 2QHXA 3ABIA 1FDVA 4ALIA 2AQKA 4CMEC 1B8UA 1F8GA 3DR3A 2GN8A 4YXFA 4I1IA 3JYNA 5JS6A 5F1OA 1AE1A 1MP0A 1IY8A 1NVGA 2CVQA 3H9JA 5C37A 5I7VA 3KEOA 3QVSA 4DQVA 3NUGA 5IZ4A 2Q49A 4J7XA 3VKUA 1LDNA 2IXBA 4XGIA 3F4LA 1YXMA 3NAQA 2H6EA 1H6DA 3ONDA 3PWKA 4PLPA 3RIHA 4BNHA 1E3JA 4RLSA 2GF2A 4GGPA 3SJUA 2V6GA 2HRZA 1ENPA 2DC1A 3KHUA 1BXZA 2PWZA 2XPCA 5GY7A 5JY6A 2RIRA 1PU2A 3MWDB 3KTDA 4MP3A 3R6DA 1XLTA 3UUWA 2ZQYA 1HKUA 2YYYA 3R3SA 2Q1TA 1KY5A 3JQGB 4TMFA 4NH4A 2CUKA 2X5JO 2O3UA 3NTQA 5I8ZA 2D8AA 1GYRA 3OJEA 4GX2A 4QFDA 4IDCA 3C1AA 3IJRA 5KVVA 3WMXA 3DAFA 4O59O 2HMSA 3N7UA 5HBRA 1LRJA 2IXAA 3D1LA 3GAFA 3BHMA 1Z74A 3ZWOA 3RC2A 4GWGA 4J16A 3RU9A 1M6HA 3BMQB 4CODB 2X4GA 3QY9A 1H5QA 3NDJA 1JKIA 3WNVA 4YJHA 2E82A 3LC2O 2WD7A 4AJ2A 4PLFA 4B7UA 4B79A 1C1XB 1EK5A 1KEVA 1RM4A 2FRDA 3DQPA 3KYDB 4P22A 2GGSA 4B8ZA 1PWZA 1L7EA 3H2ZA 1IL0A 5HRUA 1QYVA 4K9DA 3AM5A 3QA9A 4CLXA 1CF2O 2IZ0A 3FNGA 1KETA 1DSSG 2BFOA 2CF5A 2PFGA 5JXWA 5K0ZA 2DM6A 2FPIA 6ADHA 4L76A 4DC0A 3H3FA 1QR6A 5KVQA 2X0NA 1MB4A 2I9PA 2CVZA 3ZWMA 4JBIA 3WLFA 3GUCA 3VTFA 1UDCA 3C1TA 4R16A 2EW2A 1SO8A 4RDIA 5FI5A 5COAA 4CLOB 2FP4A 2IEBA 2PGLA 2VWPA 5BQFA 1GR0A 1JU9A 1TB4A 5KOIA 2QX7A 2OGUA 3AUAA 1WZEA 4R9RA 2QQ5A 3OIFA 4CV2A 1MX3A 2DLDA 3L0DA 2EW8A 4CLOA 1ZEMA 1AXGA 2AEMA 3HWRA 2OO5A 4CV0A 1JWBB 2CDBA 4RJTA 1YBAA 4DREA 4KMSA 4W9NC 4J43A 2Y68A 2HMTA 3G3EA 2DQ4A 1XSEA 2W2KB 2C20A 2D4AA 4HNHA 5IDYA 5KJCA 1R6DA 1KERA 4TRNA 5H81A 4YJFB 4PG5A 5JAMA 5K9ZA 1XHLA 3ZU5A 3GZNA 5L95A 3EVNA 4TZKA 4AJKA 4RF3A 2AXQA 2DT5A 3KEQA 4FN4A 4IBOA 4IIVA 3CH6A 4MINA 5A9SA 3WDSA 5CAEA 2Q2WA 3KYBA 4FBGA 1OI7A 1P31A 1PR9A 5DF1A 3ZV3A 4D41A 2UYYA 1QSGA 2Q4EA 3GNSA 1HDOA 4I5GA 4Z0TA 5L9AA 1RKXA 4FGSA 2AEFA 4XYLA 1PSDA 3WGIA 1H93A 4EJ6A 2RH4A 1BVUA 3AU8A 4YPOA 2AE1A 3K6JA 2NACA 1ISIA 3PDUA 1U7HA 1PJ2A 1QV6A 4P4GA 4R1TA 4IXTA 4Q3AA 1M75A 2EKQA 4DTIA 3FNEA 4EEXA 1GEEA 3KUXA 5JLAA 3KETA 1ONNA 3PZRA 1TI7A 3K2EA 4YRAA 4WASA 4B4VA 4BB5A 1HZJA 3VPGA 2XOXA 2YDXA 2WDZA 3CZMA 4W4TA 2P9GA 1W6UA 1NR1A 5DCUA 2CD9A 1VJ0A 1K2WA 4PG7A 3ASVA 4A7PA 4XB1A 4GI2A 3WQRA 5TLSA 5IXYA 1HDZA 1KOLA 4ILKA 2QRJA 3GC6A 1DPGA 4CUJA 3N58A 4HUJA 1X14A 2ILTA 1GV0A 1B3BA 3JQGA 3PYLA 3ITKA 4NDNE 1IHYA 2CFCA 4J1NA 3Q9NA 2NTJA 3RC7A 2GRAA 2EGHA 3EK2A 2EP7A 1ZSYA 3FWNA 4ND3A 4RORA 4DPKA 1WMAA 1CEQA 3PGJA 3U09A 3VH2A 3NTRA 2VHXA 4R54A 3FTNA 3UF0A 8ADHA 1F12A 1F8FA 3WYCA 1SPXA 4A0SA 3RROA 1CWUA 1B7GO 4WCDA 3DZIA 2DUUA 3BMQA 3WB9A 4YQYA 3B20A 2HSDA 4UUNA 3GUYA 2EHDA 2WE7A 3TFQA 1I10A 1UAGA 3GRKA 2B4RO 1DIBA 3DOCA 3DBHA 3WGHA 4E6PA 1IB6A 1IOLA 1E3WB 1ZJYA 3SC6A 4IJWA 3S2FA 4MVJD 1Z7EA 5CEEA 1XQ1A 3I9NA 3OEYA 4ND5A 5A04A 3WGQA 1XDWA 2AG8A 1O94A 1T24A 5KKAA 4IPTA 4I5FA 2OORA 3ROQA 3VKVA 3A4VA 3WJ7A 3IC5A 1LI4A 4DMLA 1EE2A 1NFRA 2NM0A 4PLGA 5EERA 4DLLA 1V8BA 1LDMA 4XZ3A 4L9RA 1RM3A 5ENDA 3MJCA 1F0YA 4FFPA 3ZZNA 2PH5A 4O63O 1B26A 3AOEC 1E5LA 2B35A 1ZK1A 1VJ1A 1Q0QA 1QLHA 4OH1A 3JQAB 4QO8A 1PJTA 3KB6A 4OXYA 1Z45A 4E4YA 4OM8A 4O1MA 5ILGA 3WQSB 3P19A 4IDEA 3VOSA 4EUFA 1GPDG 1PIWA 3M1AA 2B5WA 1AN9A 4LSMA 5ICMA 3NGXA 5G0TA 4BKRA 4BKUA 3AI2A 3RJ9A 4CL3A 4RPKA 4ZQHA 2HK9A 4WLEA 5I7FA 4KWIA 1UJMA 1UXKA 3PWZA 1Q7CA 1XR3A
chains in the Genus database with same CATH superfamily
2BR3A 1AK9A 2Q99A 3BX1A 3HM2A 4MVJE 3ADBA 1K66A 2YV1A 1F9EA 3KV1A 1ATZA 1XMXA 3SZRA 2Q9UA 4MYTA 1CW2B 1QG6A 3NBZC 4IIEA 4F6RB 3RRZA 4PFJA 1H2BA 2A3NA 5IJ0B 4IIBA 2YFQA 4QEZA 3WLAA 1R9MA 1N0UA 4Z9XA 3P8ZA 4L2IA 3DONA 2VNAA 3VAAA 3OKFA 3PNYA 2VYND 2NO7A 2AOXA 2PV7A 2GCNA 3BWCA 3O9MA 3OE5A 2CDNA 4M9UA 3FIJA 4DGQA 5H9WA 3ZV7A 1M2VA 3F6PA 4O2BB 1DRWA 3LJKA 5BP7A 2Q5FA 4C7KA 2IXFA 4NJEA 5JY1A 5E6SA 1VRVA 3AVQA 4D98A 4FDLA 4ZI7B 1N1EA 1NSFA 3QVGA 3VH3A 3SXUB 1CQPA 1LWOA 1NW3A 3DFMA 1R74A 3IPXA 3MLEA 1OJ7A 4PZ9A 3TOZA 1A27A 2JK0A 5JSQA 3TZHA 1G1MA 3LPNA 5J4KA 3W9SA 5F4ZA 5DIFA 4X97A 4QGGA 1YCFA 2OV3A 1GL3A 5JS8A 2B36A 3HXPA 2GLXA 2NTNA 1JLLA 5LBUA 2H4HA 2FPSA 3IDFA 2HIHA 4YRPA 5CBKA 3T1VA 1PQPA 4FFWA 3T5GA 4G0YA 1J8FA 5JYDA 3G17A 2YZGA 3H0EA 1YULA 1V3TA 3ZI7A 4KQFA 1QG0A 2OXEA 3MMXA 1XRJA 3TR0A 3UXEA 4U0KA 4ABYA 4DXAA 3BRWA 1OXXK 5AM2A 3M6MD 1V9CA 1E9CA 3VYSB 1I7SB 2NGRA 2Z9DA 4BMYA 4WY5A 4RVUA 2VF5X 3GP5A 1NDQA 1VG1A 1X6VA 1W59A 4V0ME 1OTYA 2X6TA 1XHFA 4LZAA 5DBFA 5FH9A 1PKXA 2BFBB 1WG8A 1P7YA 2XMBA 1F2VA 3BF7A 4NAHA 4TSFD 3PXAA 4MI1A 5F78A 3UWOA 4A3SA 1M33A 4DPMA 3GFSA 4Z53A 3PQ7A 4DHWA 2DY1A 3S3TA 3S6JA 3U61B 2A1UB 4YNBA 2HNAA 3VSEA 5LWHA 3LHKA 4IV0A 3OCWA 5IU6A 2YMPA 3C85A 1DJPA 2F3PA 1Z0ZA 3SDBA 3MT9A 4BLWA 5D51S 5TPZD 4Y2QA 3TW8A 4J4BA 2XB9A 1CVIA 1P2DA 1Z5GA 3PE6A 1KJ8A 1C7QA 1LKZA 3LOQA 5DNUA 4O8ZA 2XEDA 1U04A 2JNWA 2NV6A 2A4MA 2IX9A 4BNNA 4R51A 4RWZA 2E37A 3GR6A 3H8SA 5DNYB 1B2RA 3AESB 4DSZA 3EA0A 3K5PA 3LCCA 5TARA 4JI5B 3NASA 4OJYA 1JEQB 4BMOB 5JD5A 3K9FC 5K03A 1KNXA 2VSOA 4NHOA 4RKQA 1L5KA 1VGQA 2A9PA 2REBA 2QTTA 2HWKA 2X58A 1E92A 1OREA 3CV3A 3DE1X 4TROA 1QP8A 1F3OA 1O4WA 2ZRGA 3HZZA 3IQGX 5L45A 1QFMA 2R6AA 4QUBA 2O2GA 3DWEX 3B6KA 4WN3A 3FIUA 4GXTA 3NNNA 4N7JA 2C7QA 3HKBA 1IG0A 3L6UA 5DM0A 1CNMA 2CNNA 1XN4A 4H16A 1AHIA 1AU9A 4OB6A 1NW6A 2H5JA 3PLRA 1IZZA 1MA0A 3GBSA 1A9RA 4PONA 1R4MA 3W2TA 4COOA 5F23A 2AFVA 4MHOA 4C87A 3KEMA 3CPEA 5KX5B 4L5BA 5HE8A 2IS4A 2QJOA 1GU0A 4H7DA 4ZAFA 5ITZB 2ATVA 1KC1A 3LGAA 4RMJA 3SS8A 1XKTA 3WNCA 3V4LA 4A0FA 4BVHA 4YR9A 2ZJ1A 1M7HA 2RG7A 4CMJA 1SQFA 2Y0PA 2A1TR 1MOSA 3U7IA 4EG0A 1GTL1 1PNVA 4KJZA 4PYOA 3PPIA 4J0GA 2V7QD 3LT4A 3OQ6A 4BTLA 5L3VA 3FGNA 3EA5A 4LECA 4B3RB 1BQ4A 3REQA 1LDBA 1E6EA 1P2SA 3CF2A 3WB1A 5AXCA 1NPYA 1HX7A 1Z18A 1JHRA 2PCJA 3EVCA 1T8UA 1UINA 3LT0A 1YJ8A 1DEOA 2BP7A 1MIHA 2D54A 1I4WA 1HG0A 5AJZA 5IH7A 2XNCA 3AJEA 3TSAA 5ADVA 3UOWA 2FPOA 3GAMA 4G56A 4WLNA 5CU7A 2MINB 2H18A 2CDCA 3U3XA 1IEXA 4MJXA 2X5KO 1QQBA 3D7SA 1C9KA 1U2TA 5IJXA 4PAOA 4ZAZA 1RXYA 2XYPA 5E0KB 5I7OA 3TWOA 1DT3A 2E85A 2ESRA 1Z16A 3Q10A 4RH0A 4CMIB 1UBNA 1R8JA 4N1AA 4JI1B 1H23A 1JB9A 3P9SA 1Q83A 1WXIA 4CNQA 2AZXA 2PWBA 1VRWA 3D6VA 4FS3A 2ZRDA 3VJMA 1SCNE 2HUPA 2OCPA 4JP5A 1U7ZA 1XUOA 3H5NA 2W6JA 3L7IA 4BECA 3DM9B 4DDMA 3WGZA 3C6BA 3NJRA 3F5SA 2ERYA 3VTKA 3LQFA 3TOSA 4WFKA 1Z5PA 3HYTA 4B7XA 4IF6A 4O2BF 3GLFA 5IP5A 2XA9A 2GX6A 5A5VA 4QPCA 3UWMA 4F85A 5BV2P 1SWWA 2CXPA 2ZITA 3C6ZA 4N3GA 1K5HA 5EEGA 1R37A 4C05A 4LF4B 3IUEA 1T3GA 4KQKA 2CMKA 4OHFA 1UPAA 1QKJA 3JQDA 3JRNA 4QJ4A 5CVVA 3RFXA 4F5YA 4AQDA 4BNLA 4WSOA 3KALA 1KP3A 3KPJA 2E21A 2MT9A 2ZB4A 2R1VB 3EAGA 4GKJB 1ZMXA 3V4ZA 4LF5B 1NBAA 3FFAA 5AVXA 4BN5A 1DT5A 1NY6A 3EGCA 4P93A 3KBOA 3KJEA 1Y4UA 2GD0A 4WKNA 2B78A 2BMFA 4J7AA 2I76A 1YJBA 1E77A 4G0QA 5TGZA 1KSHA 1MBZA 1TUBB 1E6WA 1TPZA 1DINA 1UK6A 4I50F 3ZHOA 1LDGA 4B09A 4ZYTA 3PQ4A 3MMPA 1CIVA 4XFDA 3N0RA 5B55A 4BVGA 1V5IA 3T12A 2J3QA 3ANNA 2Z43A 3FCSB 2XECA 3KPWA 4HLNA 1ABEA 4IJMA 2F1JA 2QLLA 1PS8A 3ZGZA 1RI3A 1WW8A 5K0JA 3WYAA 4PN7A 3CCCA 4A1OA 1H8EA 1J49A 2JLZA 3OU6A 1QCCA 4JEIA 1LVGA 1G63A 3JQFC 4C4OA 2YIVX 4AC9A 1D9XA 4BEJA 3FPEA 4IUYA 4F11A 1YZGA 3PR3A 4R7ZA 2ZJ8A 4UHDA 4RF2A 3HP4A 4QZVA 5CYOA 1ORIA 1BGWA 4I1VA 3HB9A 4OSEA 5ALTA 1ZL2A 1IJEA 4W5WA 3HB4X 5TJHA 3WX0A 2NXEA 3O3OB 1JQ3A 4MV4A 4HDMB 3ONVA 3IBFA 4ENRA 5KINB 3GA0A 4X6YA 4YRFA 1GYQA 621PA 13PKA 4GU5A 4P7BA 2I7CA 3BA1A 2YFYA 5DTEA 4R0MA 3ZHUA 4NXNB 3QQ5A 4JUCA 3PICA 3RT1A 4JKIA 3JQBC 1Z07A 1P0CA 4UD2A 1NQWA 2EYQA 3GFGA 3WS7A 2PSSA 1A69A 1HYEA 1U28C 5IKOA 4DCJA 4Q66C 4TS4A 1PAUA 1YZHA 2OGTA 3QEJA 1DVRA 1HL7A 1O89A 2DAPA 2LDBA 3LUKA 4HX2A 4L85A 3AJ9A 5C35A 2IUUA 1D2NA 1CQIA 5CGQB 3PJDA 4BNJA 1Z3CA 2GCOA 4RA6B 3HXOA 2V7WA 2VK4A 3EYAA 3LUHA 4MRMB 5LA6F 3DVAA 1V41E 3MCVA 4I4TF 4QLBA 2JL1A 3K8ZA 3DCYA 1IHOA 5DLQC 2CNBA 3OH8A 5FHRA 1D9ZA 2BI4A 4ZAGA 2V96A 5DNVA 2NVBA 3P2YA 1JRLA 1KIFA 5HF6A 4N3BA 4A8JC 1MGOA 1PL8A 4H27A 2DGDA 2W48A 1ID1A 5J2UB 1TMKA 2FMFA 2PBZA 3OZWA 2B37A 4MP8A 3UPDA 5BV0A 3EAFA 4L28A 2OCGA 2QD5A 3T3NA 1J39A 4RD2A 2GEJA 1QHIA 3BXGA 1DARA 2O7RA 3CO0S 1Y98A 4DLSA 2ID4A 1VLZA 2XWJI 3QW2A 5H8WA 1OA1A 1NKTA 2D5AA 1NOIA 2QM8A 4I9HA 4LC0A 1FE8A 3I61A 1PJZA 1TF5A 3KXDA 4M22A 2VDWA 3BZUA 2E3JA 2GZ1A 3OQIB 4GI7A 4JBGA 4Y2GA 4IFEA 3C3CA 3K92A 1QV7A 4R40A 1E1NA 3HC7A 1GFSA 2FUG1 1LQUA 3VC2A 1ZIOA 3EXG2 5FI0B 5TIIA 1P5JA 3L5OA 4GSKA 3R3WA 2E4YA 2X42A 3FYSA 1C8KA 3IMCA 1RZRD 1K98A 1J7KA 2WJ3A 2WG0A 3O4FA 5P8WA 2E7ZA 2DR3A 3H4IA 3QVUA 1QJ4A 5HK9A 2CZCA 3G5UA 1J33A 1DU4A 1GZUA 4CF6A 1A88A 2OYSA 4IDDA 5I9IA 5JQGF 1OSNA 1KJJA 1MEOA 2VKTA 3AT1A 5GM1A 4LF7B 1ACLA 4MMZB 1RWMA 2JIBA 3A3OA 1P73A 2FFHA 1PFQA 4OXRA 2OKCA 2OK8A 3EZLA 1OZ0A 2M2IA 1BMFD 2D4HA 3NH6A 4BVAA 3E18A 5AM0A 2Y1LA 2W6MA 3CHYA 4MRSA 5JMOA 3PEEA 2EL9A 4BU0A 5KJ1A 2VQFB 3CY6A 1E3MA 3S28A 1H1DA 1GRCA 1SUPA 1M8KA 2G63A 1PK9A 4OBWA 4B35A 4IDOA 3N6RA 1LRLA 3R44A 4QUAA 3COYA 1NN5A 2A9VA 4KJXA 2HU5A 4RGVA 1MZPA 2H8KA 4IDPA 5AI9A 4BO6A 5E8JA 3SSNA 2WVAA 5E38A 3FYTA 1Q1NA 2RBEA 1E0SA 2YICA 3SCZA 1SMKA 3WYDA 1F17A 3I04M 2OG2A 3DZ8A 1X39A 2W70A 3CF0A 3HI6A 1ISRA 4NONA 1OAOA 1BTOA 3B7WA 3BSSA 3CZCA 3MQ2A 4OXIA 4DYHA 5KB3A 1NQUA 4J94A 5BNTA 5TDHA 2F2TA 1AXRA 1JG7A 4JN6B 4KPUA 4PM4A 3GPDG 1KJIA 4ZKDA 2I8LA 5FO0A 5AH0A 2ZRPA 1PD1A 3LXUX 4P7KA 1NWHA 2I6TA 3IR7A 3HXMA 2XHEA 1A82A 1YAJA 2D7CA 3CKKA 3HUFA 3OLVA 2QW1A 2XCLA 1EE9A 5PNTA 3HCFA 4YAEA 5JHGB 3PBKA 1KO4A 2WSYB 4F5ZA 2XT6A 1DKPA 3MIIA 4RHCA 1DC6A 3C6QA 2AWOA 2I67A 1WNTA 2Q0XA 3OCJA 2RAVA 4G86A 4N82A 5ALOA 2BFWA 3E0QA 1S3SA 2EFYA 3LU1A 5T64A 3UJPA 3MCTA 3NTVA 1E62A 3HWX1 4KE6A 5LLSA 2P6UA 2X7HA 5K0EA 1V16A 3PI6A 5BMVF 4FC6A 3CX8A 1L5HA 2M98A 2F3SA 2HA0A 3GLKA 4LQCA 3D64A 2REQB 5AVKA 1CY7A 2RSLA 1PFKA 4L4UA 4LHXA 4UNQA 4NZ9A 1PI3A 1RYBA 4PCUA 1MQAA 1YL5A 4O2AA 2YOHA 4MUFA 4ZOQI 1XWWA 4AJHA 3QEMA 4Z9FA 2CLFB 2NPIA 1IK4A 2Z3ZA 3M5PA 4I8IA 2ZS7A 4OGGA 4J9UE 5GV7A 5MFZA 1NKVA 4CMAA 4LW8A 1HYHA 3ICWA 5AKXA 5LP6C 4U6NA 4YRDA 2DB3A 4UZSA 1GA4A 5H5JA 2WQ7A 4WESB 3HZHA 4C2BA 3NBYC 3OZAA 4CJXA 10MHA 1DC4A 4QXQA 5CNMA 1QF9A 3VVMA 1N0WA 3FPGA 1KDVA 1IYZA 1GDDA 2MHCA 2J9FA 4R83A 4NE2A 3OIDA 3AI3A 3GA7A 3HKEB 3ONFA 5D87A 4DR3B 4DADA 4RIHA 4UMEA 5G2OA 3LHDA 4JOQA 4F3NA 4XQ9A 4CIBA 1VPDA 2GAIA 3UVEA 4JROA 2IUFA 2VJOA 4GAEA 3GXOA 3TLGB 5FNZA 1OI3A 5IBRA 1U28A 4I46A 2WI8A 3JVUA 3LRXA 4EGSA 3AIOA 4MLCA 3HLTA 1ZN7A 2HNBA 1UPFA 2ZT5A 3LW8A 1DLIA 3A1VA 1IDN1 2JIZD 2V8OA 4G9BA 4RVNA 4G6ZA 3TQCA 3ZWCA 1HBJA 1OA0A 2OFWA 1RYZA 2RC6A 2WAMA 3C87A 4MXDA 3RGGA 3E9DA 3X44A 3FOEC 1SD1A 1SC3A 2FMIA 821PA 1E6UA 1QHGA 2CLLB 2FG7C 4E07A 1UOEA 1WCIB 2H1VA 1GSIA 1QVWA 2HH9A 2FWIA 5FFFA 1X2EA 1R16A 3HJAA 3N3BC 1U0FA 4PTYA 1PJ8A 4AQ7A 2GK7A 3ZNNA 4IHJA 1Z5WA 3ULKA 2XA2A 5CA1F 4HBGA 3D31A 1B23P 1K5GA 3EGOA 4LDAA 3DT8A 2DCUA 2Q1UA 1J1IA 1KDPA 3WMWA 3C2QA 2HPZA 2R3SA 3EJ6A 1PDOA 2QSZA 4GYKA 5BN1A 1LUAA 4TYNA 5ALPA 2PKXA 2XVMA 5CA0A 1FSPA 2CL6X 4PC2A 2I4MA 1GNSA 1RQGA 4RPCA 1IJKA 3H6HA 5L4LA 4QPNA 3MIZA 2QTMA 2WJVA 1ZJZA 4JNCA 4OFWA 3VR4A 2FW7A 1V1MB 1ZIXA 1R9NA 4C4PA 4F9EA 3WGKA 3IE1A 1EHIA 1VGRA 2WINI 4GNRA 1ITZA 3TXAA 1T91A 2CVFA 2QBYA 3KDPA 2CJWB 2OZLA 2ENUA 4WNCA 2AG1A 2FPIB 1L7MA 2X8BA 2WYHA 3F3KA 1Z73A 2O2SA 2Q2VA 4OGLA 2ZUFA 2OLKA 3RUDA 1R18A 2FKNA 1ZXLA 4XH9B 3S1AB 5KNDH 3B1FA 4E7OA 3OIWA 3TH5A 1KFEB 4R3UC 5TMBA 4GX0A 4U5XA 5D6NA 3KKLA 4KLCA 4KGZA 4BMXA 4DLWA 2JARA 4DQLA 1R27A 5EMLA 1FJXA 1E98A 4V39A 2C5HA 3NETA 2WAAA 3DGEC 3ZWNA 3TBHA 4AXBA 2IYLD 2UZ3A 2YJ5A 3VVCA 4RMNA 5C18A 4C7JA 5JH7F 1HZZC 3A6KA 3OPMA 4KQ9A 1PL6A 3LPDA 1JEYA 1NLZA 4OAOA 1NUUA 2DX7A 3OCXA 2PJDA 3RIXA 3A1EA 3JYLA 1KMHB 3GHYA 3OT5A 4RXUA 5EN4A 3PUHA 1Z0JA 5HM6A 5KMGA 1OBOA 1G6KA 2SKDA 1LVHA 2ZUTA 1ZN2A 1RC8A 3V4OA 3EVBA 1H9BA 4WJZA 4Q5IA 1I30A 3WYFA 1JG1A 4MGKR 3PJGA 1WULS 4N47A 3GLHA 1KMNA 3TSCA 2A3RA 4QAQA 2R6HA 3CEPB 4JBNA 2C83A 5K3FA 4C5AA 4F91B 1GTVA 3AF2A 1A2BA 3A2NA 1X1CA 3V1MA 4YV2A 4C03A 4ZOEA 1E8MA 4W8HA 1NC3A 4CQMB 3DEIA 1GNQA 3ZCXA 1AX9A 2VJLA 5ILQA 3KEGA 2QE7D 1U31A 2QRVA 2W6CX 1BXRA 4GMGA 4OUDA 4GLLA 2F7SA 3AKDA 1K8RA 4LAFA 4TWIA 4ZANA 4DJEC 5A9SB 3LAWA 4WBSA 3RAJA 2FAXA 1X7WB 4EYGA 2VJQA 3ZXSA 4XIJA 1L5VA 2WJGA 2ZSFA 2QDKA 5DJ5A 1FUIA 3EIHA 4ZYZA 2PTHA 2OCXA 1O5IA 2WYIA 4FZVA 4EUNA 4K6FA 2X0FA 2DWPA 1PLLA 1V8DA 2VHWA 2WUGA 2Y92A 3M9XA 4PLCA 5JO0A 1N6NA 5LQCA 4E08A 1PFWA 4TXLA 2VNHA 1N7GA 3W5AA 2ZT6A 8LDHA 2EJBA 1G5PA 2ZI5A 2NNLD 4F7WA 3F3MA 3P9PA 3GVXA 4Z0NA 4CXMA 1J22A 1Z5ZA 4FB4A 5BQPA 2P79A 4U6SA 2B34A 2GO7A 4ITUA 1Q95A 4QOIA 4BJ1A 1R0XA 1RLTA 3ORQA 1XTKA 3CXUA 1HF3A 1TKBA 3CT6A 5LKAA 3UWSA 1U2DA 4I1RA 3TKYA 1J2UA 3ZNPA 4LISA 5LD2C 5IJWA 3D0RA 1YZ3A 1ZH8A 1N0IA 4NYMR 3C5HA 4UMVA 4MUNA 3GY0A 5HM8A 3MK31 2HFJA 3LUBA 3LS2A 4BFSA 1AZTA 1NUSA 3O8NA 5A6SB 5JANA 3OQMA 1HOXA 4GYYA 4BUZA 4TKLA 2VNIA 2VJNA 1EWQA 5CDYA 2E18A 3FVQA 4XGNA 4DIEA 4GL2A 4K87A 2BKLA 4OQFA 4W5TA 5A4DA 4JJGA 4JFRA 1IVNA 3OUTA 3UNXA 1Y1KE 4U7WA 2BKEA 5BYJA 4PS0A 4Q12A 1M6EX 4II2A 1YFZA 1FZQA 4HNRA 4R1MA 1KO5A 1C9YA 3GLHE 4XJTA 4PO8A 4FX2A 3T41A 4UOEA 1G9TA 3QXSA 3PUJA 1Z36A 4ITRC 4KR9A 2ZUCA 4EGFA 2CDRA 1YUBA 2FDRA 1USWA 1I4TD 2IHUA 1H4VB 4I1UA 4I6JA 2GETA 3WQBA 5CITA 1KH2A 2H0QA 4TRRA 3W0LB 4YT4A 2H9AA 4Q3BA 4CIYA 2ZXUA 1YGYA 4ND8B 1ECJA 1E3SA 4PSCA 1GCGA 2WTAA 4AYXA 1U1CA 1SURA 2H1WA 2BUBA 5JNUA 3R3JA 4DM4A 2V55B 2X7JA 3F90A 1SZPA 3WGVA 2P62A 2PNFA 4ARZB 1N2HA 2JFYA 4GUAA 3LPCA 3LWNA 2C59A 1MUUA 4BP9A 1U8XX 2N3ZA 2AZDA 4LK3A 5EA2A 4DKJA 3DNPA 2OQRA 3UHFA 2QN6A 4CYMA 4R1UA 1UBKS 1SD2A 5ISMA 2CHGA 1Z13A 4KTTE 5CFMA 1A72A 3IUPA 5EHGA 4REQA 1JDVA 4IOJA 3E03A 2XQKA 2FMKA 1FYWA 1NYLA 3HVKA 4X65B 1FQJA 4KN6A 4V1CB 1PHPA 1QKIA 4M2LA 1PQ4A 2YYAA 3NVMB 1HLGA 4TUYB 4AZ0B 3W8RA 2YY6A 3H3JA 2JPDA 1ZVVA 5JAHA 4PN3A 5CBPA 1Y63A 5JNRA 3NRJA 4QASA 3F7OA 4MW9A 3ZJTA 2XNSA 3JD1A 3HBFA 3KKPA 1XKLA 4YT8A 4F2DA 1Q17A 3P9QA 5LC1A 3KAQA 1TIPA 4I1OA 4GF5A 3SFVA 3P27A 1AHNA 4ZYUA 2OAP1 4K05A 1DAKA 1ZINA 3SC3A 3P9IA 3TX2A 4BMCA 2IYOA 4DA8A 1KF0A 2VSNA 1P1BA 3QQPA 1UC8A 5HPYB 5JVDF 2ZW9A 4ALKA 3IP3A 2HK8A 3F5QA 2WF7A 3DBRA 1U5BB 4HAYA 1U02A 2Y0DA 3D7MA 3FI0A 3P97A 1NNSA 2ECFA 3REFA 2Y1GA 2O1WA 4NMLA 3RS8A 1AVTA 3IR6A 4R6XA 1X7XA 1RHQA 3N53A 3G49A 3NKFA 3VH4A 1IULA 1SIBE 4ZXPA 2C92A 4NNJA 5EWMA 2J3JA 1I0LA 2M1ZA 3NGMA 3RRYA 4BMNA 1YQXA 1TQHA 2J6HA 2PR7A 3ADOA 1M8PA 3WQQA 3LDGA 2HJWA 3JZMA 3O8DA 4WLFA 5EIWA 3NRBA 2JFZA 2VP9A 1KEUA 3IUJA 4IVNA 3UJ8A 4UXHA 4TKMA 1W581 1WDMA 2VAPA 3DA8A 3GEDA 4X7PA 3T6KA 3HHPA 3VHQA 2JBAA 4HY3A 2JHAA 5ALHA 3TPFA 2O8EB 3FCCA 5EKXA 5LZ5A 2YWCA 4RK6A 2XGMA 4HUTA 4UTPA 2NUPB 4YC7A 1GPBA 1NDHA 2IITA 2Q2NA 4RV5A 3WHIA 4CL2A 1BXKA 1YZUA 4IHQA 3TRJA 3QMPA 2IOFA 4WOJA 4F38A 3DW1X 1G8FA 3HDYA 2B69A 5FWAA 5C1OA 4R1SA 1EQ2A 2AI1A 2RBGA 3EJWA 5IN5A 4YDRA 4OXXA 4IIGA 1DXHA 1WUHS 1Y89A 2VWQA 3LCVB 4EQZA 3AMVA 2OCKA 5IJ0A 2QWXA 4PNEA 2LPMA 2P2CA 3O47A 3R8FA 3K9WA 4FD2A 4BFLA 9LDBA 1FS6A 3ABOB 1Z0UA 2ZJ0A 3K0SA 1JJ7A 3N2IA 1XEXB 5I5GA 3E8XA 3B3AA 1ZL0A 1HSOA 1W8IA 3H2IA 1QE0A 2BZSA 1N5IA 4FR5A 3RODA 2CHUA 3D4LA 5JBIA 3AVPA 1BNCA 1QO7A 1WNFA 3H9CA 2FR0A 1AH2A 3T5MA 3DDHA 2X6RA 1VIMA 1XMIA 2ZIXA 3H5LA 5AHOA 5KTMA 4ZI7A 3KTAA 2HO5A 5AI6A 3LV8A 1OPXA 3DZDA 3EFOA 4FZ3A 4YDQA 3H3XA 2J9ZB 3ZHCA 2ROQA 1QO0A 3R3VA 3HDQA 5FWNA 5ABPA 1PT9A 2C5AA 2IOFK 1VKRA 4OJMX 5E4TA 3HCPA 5EPUA 1MO4A 1JDBC 2VPTA 3R6TA 4KLZA 2CZGA 3MUNA 4F1JA 2V7TA 2DE0X 2BMWA 4I19A 2H5EA 4ND2A 4ZYLA 4P1ZA 3EEFA 1CF9A 2GZ2A 5A4FS 3FWPA 3BDIA 3CLRC 3ILSA 4I5DA 4LJYA 1BXGB 1QYDA 3VHRA 2M6SA 3PRHA 3WP0A 4LXHA 1NASA 4LRTB 3S8EA 4PAGA 2WSSA 3UYKA 4RCYA 1WLSA 1M1NB 2YL2A 4PZYA 4CV1A 3KL2A 2Q7XA 2AR0A 1KAOA 2GR9A 2HI0A 4M0FA 1D3AA 2H4JA 4X94A 1Y9EA 4IHJF 4MZXA 2ZRLA 1YMUA 1TKCA 1ZJ6A 5F2EA 3SF8B 4X20A 2W2XA 1CJBA 3CB2A 5JPCA 1WOYA 3SHFA 4M46A 4RZUA 3KSMA 2IZOA 4AJLA 2ID7A 3EIUA 4L74A 1ABFA 4XQCA 3ZWBA 2XUKA 4CMEA 4U7DA 1M2FA 1MOQA 1T4CA 1W36C 3E9NA 4L0DA 4EO9A 3IAEA 3IKMB 3OM9A 5K3OA 4CNBA 2XOKA 1VDZA 2PFSA 4FUTA 3CZRA 1CULC 2EGUA 2P6RA 2FEPA 1QIKA 2KI5A 3KLPX 1FFCA 1MO2A 2J33A 4MS1A 5FLKA 1S1CA 1T25A 4ZV9A 3ZG6A 2VJDA 2PL5A 3IOBA 2PX0A 1VMIA 3DEKA 1U0TA 1JLRA 3FDJA 4LFBB 3H8JA 5JASA 3VDRA 3DL7A 4A5SA 2BM8A 5JNTA 4FFOA 1TEVA 2QT0A 2CMHA 2JCXA 3OC6A 1D6NA 3LBAA 4XJVA 3ZV5A 3HM9A 3VI3B 1ML4A 1H2AS 1M6NA 4M4SA 2Z2IA 2J9RA 3NHZA 1XZPA 2C2OA 4PHGA 5JSZB 3KE9A 3DBOB 1AC5A 2Y0EA 2IU6A 3Q5GA 3VZQA 3CB4A 1OPRA 2HIGA 4DJAA 3FNQA 4HWTA 4WN9A 1LPSA 3FVVA 4JVMA 4IO1A 1M74A 4KPGA 2FPKA 1K9SA 3AR9A 1R4MB 3GYGA 3ODPA 1JEAA 1P61B 2UAGA 3QVXA 3WMRA 3MPOA 4NCBA 4KXNA 2Q27A 1RFGE 3LHFA 8GPBA 2O6HA 3WGLA 2X0EA 3BIOA 3TLXA 4EKGA 1CEEA 1IOVA 3EHDA 1T36B 4ZT7A 2PUHA 2GBFA 3TIXB 4NPCA 4P36A 1QV9A 4I7EA 4KQJA 3CNEA 3W6PA 5JYEA 3FNFA 2EG9A 4R84A 1PJ4A 2VDVE 4LGCA 1QIEA 4R5MA 1NJ8A 2C99A 3HY6A 4O4JA 1R2QA 2ZTUA 3S8MA 2GSDA 4Z2YA 1RHMA 5DULA 3LUGA 3GRVA 3H65A 4F4JA 2XI4A 4R4JA 4Y6LA 3DLHA 4F4UA 2Z83A 5DRYA 5ADUS 2VDNB 3PDIB 2IDKA 3NHRA 4EY4A 3UPTA 3ZGNA 4UMFA 4PZ0A 5IAJA 1PGNA 3QF4B 2OBNA 2RGBA 4TKUB 3ER6A 2SCUB 2E5LB 3JS5A 1CCWA 2MINA 1Z4LA 1GSOA 5D1NA 1EVZA 1MV8A 3LX5A 4K9OA 2O8BA 4QATA 2AN3A 3H2JA 4WVLA 4TUYF 3Q72A 1KDRA 3V9PA 5FBWB 5BQOA 2FQ1A 3LIPA 3KXPA 2CK3D 1XZNA 2ECOA 4F3CA 1JXOA 5ALRA 1L5NA 4HJRA 5EJMA 1A9XA 1ULTA 3G2IA 4BVBA 2CNDA 2CWWA 4BDTA 2P3QA 1T2FA 4POOA 2QVGA 4A03A 2HTEA 3WRYC 1OWOA 3ZU4A 4XM1A 2EKBA 3H4TA 4QUEA 1SUWA 5AJHA 4G0VA 5BQ5A 3VSDA 4HLUA 3KQOA 4IIXA 4P8RA 1BGXT 4UOZA 3CUYA 5H7XA 1U1DA 1M54A 2ZQ5A 3ZV6A 3KG2A 4O4HA 5GZ6A 1PJCA 1RIFA 3NPMA 4A23A 1T5SA 3KVOA 1ZJWA 3PEUA 3OM0A 4IH4A 3WGYA 3GK3A 2BEVB 1V1RB 2ZWMA 4BNUA 4ID9A 1BVRA 1NV8A 5CM9C 2JGNA 5ENVA 1BROA 3TQTA 3ENWA 3NOQA 1ES9A 2ZAGA 3W8NA 2AN5A 2GKGA 4JYCA 1NXWA 4J49A 3B38A 1TZCA 1S2GA 4PZUA 2X0KA 2NUAB 3MTEA 4IEFB 2A7XA 3MRVA 3QHQA 1QGUB 3PKJA 4B5LA 2UYCA 3F0TA 1ZNXA 2X4IA 4P3NA 3VU8A 5DP2A 3P1JA 9ATCA 1YHNA 3B6IA 3P20A 5F76A 121PA 4UPVA 1BDMA 1NQ5A 4YGXB 1V2HE 2A88A 4L6CA 3IP9A 4FLFA 5L7TA 1VKJA 4ZZ2A 1E9FA 1KS9A 1ZICA 3S2IA 3QENA 5D5HA 4ZRMA 2J3EA 1FDWA 1XLUA 4RYDA 1BQ3A 4Q9DA 3CCBA 3RT7A 5H3LA 2GTPA 1A4RA 3MN1A 2Z6VA 1OBCA 5CT4A 1KO7A 2HQBA 1B6GA 2PPLA 3ANLA 4I9UA 1OWMA 1BHQ1 1PHRA 1E2LA 1C4KA 2JB9A 2XUHA 3DKVA 3MBKA 4LDRA 1BCRB 3A37A 4AAYA 5GGYA 1SH7A 5HOQA 3BVPA 1XRQA 3DZCA 1FP4A 4AIIA 1W5FA 5HWSA 1C4XA 1H2RS 1Y7HA 1Y5IA 2VRWA 1J8VA 3LW7A 4K81B 3TNDA 4C7MA 4ZGGA 1S1MA 3D81A 3AM4A 1VL0A 1Q12A 3E5NA 4RD6A 4LNHA 1ND6A 4N7RA 3SVTA 4H08A 4WCFC 1FDSA 1OT5A 4HSGA 4WXYB 2JJ1D 1ORVA 3IQXA 4PZLA 2VLBA 4QHYA 2YQZA 2HWYA 5GOZA 2OPHA 2PZKA 4GPTA 1TK9A 5DVZA 3EPHA 5E3IA 2A86A 5JUWA 1PNOA 4NDZA 2WTXA 3ZIAA 4Q4DA 1GKKA 3G2PA 3STXA 4ERXA 2VRCD 4OHOA 3TM5A 3Q5DA 5A2QA 4RTMA 1E9SA 2CL7X 1UZLA 2VCYA 2ZBGA 5EIHA 1ZZEA 3BCRA 2ZSIA 3UAOA 1ZM7A 2YWHA 1CR6A 2IXTA 3LKVA 4CG3A 4YA6A 2QAGC 5FQOA 3T7AA 3TVDA 3ZW8A 3BC1A 1HT1E 2WFAA 4DQXA 3GUZA 1PZEA 2O8FA 4PYJA 4CF4A 4MKRA 4FDTA 5FWXA 2P69A 3QTLA 2Q8PA 1JIIA 2IHTA 3IL2A 1G98A 3IEPA 2HT1A 2XLCA 2JRLA 3KU1A 2BEUB 3DMPA 3KOOA 1AQIA 2C0QA 1L8AA 5IH3A 1XQYA 1Z5OA 1K6XA 3MERA 4BV9A 4QM6A 2DSNA 1P0MA 2HB6A 4Q1FA 4RESA 1FMCA 2ORIA 3SQMA 4DCSA 4WXRA 4OQYA 4BC0A 1GPWB 4M9ZA 4FXPA 4NBUA 4MIKA 1R9JA 2Z58A 1HT2E 3FMPB 1RAIA 2Q3CA 4ZC8A 5LP6A 3GHHA 221PA 5TT0A 8ABPA 1K6MA 4ND4A 1WQ3A 1V1JA 1HH4A 5KTSA 4ETNA 2R6DA 3KSRA 4PCAA 1NZDA 1RKUA 2OYRA 1JG3A 2FSHA 2FSVA 3BEOA 3HADA 3OMLA 3M70A 5ADHA 3JZAA 3I34X 3F97A 3JQEA 4AUEA 4BP1A 4ETIA 4NL4H 4UVHA 2BI7A 1GAJA 2HCTA 2BH9A 3K9LA 5LA6B 1Q0UA 4LMBA 2XE6A 3DDCA 5JAQA 1YJCA 2IPLA 2JJ2A 4KB5A 1H2ZA 1X9HA 1NX9A 2J85A 1IAQA 2CHVA 2PLRA 3WO1A 1D0VA 4IO0A 1UR5A 2VK2A 3TNYA 3W9BA 3RUCA 4K9MA 4F3TA 2Y1WA 1QU3A 4X60A 2HSGA 2XUOA 2JGDB 1DFGA 1Q7TA 2YQ5A 4QARA 4TYPA 4LJLA 1GSAA 3SX2A 1XP8A 1LZLA 5JJBA 2WY2D 2J5XA 3GEBA 3C14C 5L4SA 4QXRA 4E70A 1QP4A 4I2VA 2IYZA 2QQEA 3KZ1E 3WIDA 1UBMS 5G4KB 1LH0A 2JIQA 2WT4A 4NR0A 5EMHA 1IG3A 2B92A 4KSCA 1L9XA 1P4SA 1Y4DE 4Q3KA 5CIQA 4YJGB 5JVDB 4D9IA 4AVYA 2AC4A 5LXTB 4Y1RB 1S9HA 1ATIA 3TJRA 4KH1A 2H4ZA 4Z0PA 3T1OA 3CH5A 3GJTA 3CURA 1O5TA 2FSPA 3EMDA 1Y0BA 4V02A 5DK6A 1CQZA 3JR3A 4F1WA 3DD1A 3UAGA 4LUCA 4YJGA 4XTRA 5EJIA 1WZNA 5AMXA 3T0IA 2ZSHA 4D6PA 5JW6A 2ZU0C 4GWKA 2CT8A 1PJQA 4OB8A 2J3KA 1DGQA 5THKA 4JI7B 4GBMA 5CMLA 3TDKA 5HYVA 1BYUA 4OB7A 3REOA 1BEZA 1HDYA 1K7XB 1M2VB 1S3GA 2OQ2A 4GE3A 4KXXA 3GFPA 1E5XA 1PX2A 1JI0A 2ZDHA 4KUEA 4MS3A 1W4CA 5PGMA 3L7BA 4EOGA 4MR8A 2UKDA 1SEPA 4YUWA 1U8FO 2WYUA 2QP9X 3DMTC 3G9UA 3TMKA 1GKYA 2PLAA 1LU9A 1A2QA 2NYAA 1N1DA 2Z30A 2AOTA 3I32A 2V3WA 4LI0A 2AC7A 2IVZA 2OHOA 4UTVA 4MMXB 3DMYA 5A4JA 3QBJA 1JSXA 1ZK2A 1CRWG 1MXFA 3DMGA 1QB8A 2AJ8A 5AESA 1D7OA 2BEWB 3DPUA 3OLCX 4J1SA 4QQNA 3LKDA 5C80A 1NULA 2DKFA 3F6YA 4JEMA 1JG6A 3DO6A 4RENA 1A9SA 1T4DA 4IUCS 2GASA 1O95D 5DK4A 1HZZA 5KVCA 1FFSA 5HKOA 5IJZA 3ZY4A 1JBQA 1PJSA 1GGVA 1XOIA 3K6SB 3FKSD 3VYWA 1FJHA 2N75A 2PGXA 5FUYA 1LCIA 2XQJA 3ESDA 3W2HA 1SQ5A 3CSDA 1T8WA 3FOAA 5EWLA 3CSUA 1FSGA 3ZE1B 4H1WA 3PRJA 4U8GA 4UAGA 7ADHA 1PRYA 3BEDA 1C9EA 4UEQA 5DNEA 5FPYA 1N78A 2REQA 2OXRA 4G63A 4RS4A 2V0CA 4TSFA 2Q6KA 3SYLA 2B83A 2FR8C 2ZXFA 2JDIA 2Y1OA 4MWCA 2VK1A 5G0VA 4JLOA 3EQZA 2L69A 5EWLB 4CW7A 4OP1A 1UXIA 3LC0A 4J0DA 3TZEA 3T4UA 3OPNA 3BXEA 5B4VA 3O92A 4ZT4A 3R9IA 5ESXA 2GT1A 5AK3A 2B1GA 3ETJA 4YRZA 3TGWA 1JSCA 2BE7A 3HXQA 1K8ZB 3QP9A 1Q7GA 1ZGJA 2AFIB 2PMKA 4HLDA 4PHHA 3UW1A 4BFUA 2VYQA 3G23A 2WKPA 5CH3A 1L8XA 5BMVB 4IIFA 2YRWA 1G2QA 4RLFA 1YR6A 4MTCA 4DQKA 1XI2A 4LF9B 3DUFB 3N39C 2J9FB 5D3ZA 4QU8A 4K03A 4QC2A 4BO2A 1H0RA 1ZLYA 2E9SA 2QORA 2VUSA 3MOSA 2XR1A 3HKDA 4K6OA 3TQQA 4DJTA 3QX8A 4HNGA 4LWZA 2EKPA 1GADO 1R0KA 2DU8A 3N7TA 1Q3HA 1DC7A 2XD4A 1E89A 4AJNA 4C6SA 4EDHA 2ZAYA 2JGIA 3E9CA 2UVDA 3HU1A 2HJSA 2Q3DA 4S04A 2G1PA 1J2EA 2DFNA 1KIAA 1VGVA 1YQWA 1Z08A 3I9JA 4IFTA 4X8OA 3ABSB 3AFMA 1XK6A 3JV7A 1TLLA 1UANA 4FFSA 3NRCA 2H1LA 4F86A 4R01A 5DE3A 5EINA 1IHXA 3FWKA 4MAFA 5FOSA 3TM4A 5JNWA 1FK8A 1THGA 5KX5A 1N2CE 2VJYA 4WXMA 2W6ID 1A95A 1ZS9A 4Q39A 2C82A 1TPYA 2IHZA 3D7NA 3IVRA 4PGFA 2H2DA 3ROEA 1U8EA 2IZ6A 1MOZA 5GMOA 1KAGA 4ZT6A 1OIVA 2BGWA 3GLGA 3BSYA 1W9HA 2PU7A 3KXIA 4N0MA 3CC8A 3ZD7A 3T3OA 1KFBB 2PVPA 2ZWIA 3NDRA 2BHRA 2POQX 3SJBA 3W2EA 4D92A 3IBCA 4TLCA 2FA9A 2X2PA 4Q7JB 3N2KB 1JWAB 2BFFA 1YL7A 3NHWA 4Y6PA 3REQB 4QE3A 2ZWPA 4Z4QA 1G38A 3N2YA 3ZWVA 4EHKA 1LLDA 1GG5A 2NO4A 1ZNQO 4PSVA 4YROA 2Z8ZA 1SZJG 3GLGB 4BEBA 2Q1WA 2I34A 4MW0A 5M2QA 2R65A 1PJAA 3ESRA 2WIBA 1QS0A 4IICA 1HDEA 1SXPA 1E79A 1DBWA 1L5SA 1RLUA 1YBMA 1UKZA 3C5WP 4IGAA 4ZN6A 2G70A 4OHYA 4YTEA 4FHGA 2IP1A 4DC1A 3E53A 4LYFA 2HGZA 4ZOCA 5E3HA 2CFRA 3DB2A 3C39A 3SBXA 2JJYA 3SZUA 1JIJA 3E61A 1L1QA 1E58A 1KZ9A 1MKYA 4L51A 2XNHA 3THOA 3GFOA 1GNTA 2A1IA 1XVLA 5EIEA 3OX1A 5SZHB 2VR1A 4YAIA 1FSSA 3E82A 3IH5A