3JQ8B

Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor (nadp+) and inhibitor 6,7,7-trimethyl-7,8-dihydropteridine-2,4-diamine (dx3)
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
267
structure length
247
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQNLSIVNLCDAMVDQPMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pteridine reductase 1
publication title Structure-based design of pteridine reductase inhibitors targeting african sleeping sickness and the leishmaniases.
pubmed doi rcsb
source organism Trypanosoma brucei
molecule tags Oxidoreductase
total genus 90
structure length 247
sequence length 267
chains with identical sequence C, D
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2009-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3jq8B00
3C7DB 4R1UA 3GRKA 1Z75A 4CV1A 1H2HA 3ANLA 5JW6A 1PTJA 2IE0A 2YYYA 5HBRA 4JBIA 1XKQA 1WLYA 3OFSA 1LRLA 2CUKA 1E3WA 4NBVA 1KEPA 4RVGA 4D3FA 5GY7A 4EUFA 3WYCA 1A9ZA 4IDGA 5G0TA 5HS4A 3D4NA 1LJ8A 1E3SA 1GEEA 4BGIA 2YJZA 4OXYA 2J6IA 2DBQA 1LC3A 4JCOA 3DZGA 5TJHA 2B4TO 2WD8A 4D45A 5ADHA 3SJUA 4CLOA 5B4UA 1G0OA 2V6FA 2ZCVA 1BXGB 4EI2A 4N54A 4UVHA 4XYGA 2BH9A 2W2KA 1WDKA 1E1KA 1PR9A 1A7KA 3TL2A 1YB4A 3CINA 5CDTA 4ZQHA 4BKPA 1I3LA 4JGBA 5DBGA 2DFDA 5IG2A 5TQVA 5JNLA 1UR5A 4QUKA 3BMCA 2X4GA 3B20A 3O9ZA 5CPFA 2X0IA 4EBFA 3IS3A 4A7PA 5I7SA 1U28A 4XX0A 4NJOA 2X0RA 3HFSA 3ITDA 4BGEA 1YO6A 1XG5A 1ZKMA 1MV8A 2JAHA 1I2CA 2PKQP 1BG6A 2HRZA 3BMOA 2CDAA 5DT9A 3LDHA 5A4DA 4QXMA 1PQUA 3ZWYA 5HS6A 4IBOA 4CLHA 1UXIA 3IUSA 4ND1A 2XXBA 1NVGA 3JQ8B 3OH8A 2P9GA 3KYBA 1KYQA 2NTVA 2EEZA 4OH1A 4RLSA 4OAQA 1BMDA 1MUUA 1PJ2A 1U2DA 1XU9A 2J3KA 3E48A 4M87A 4FFRA 3G1TA 2O3UA 1VRWA 1IB6A 3BHMA 4GX1A 1OAAA 1I3MA 3AY3A 2ZTVA 2BGKA 1NFQA 1D4FA 4B7XA 3IP1A 3NV9A 5JDCA 1B7GO 1BWSA 4JJIA 4CMCA 1I10A 4FFOA 4FPXA 1A72A 4B4OA 2AEJA 4GKBA 2QZZA 3S2IA 4R4JA 4DA9A 5BSGA 5JY6A 3ROMA 4LSMA 4WLEA 5JC8A 3QHAA 2IEDA 1I24A 3DFZA 3JQAD 3NX4A 4WUVA 3O38A 2CVOA 3H2ZA 4MVJE 1C14A 1RKXA 4PN3A 3KXDA 1EZ4A 2BHLA 3FNFA 2PA3A 6ADHA 4WECA 3IUPA 5TGDA 4CR7A 3DAPA 3IMFA 4RV9A 2JFHA 5BQFA 2DUUA 1OZAA 3LYLA 1F06A 5CDUA 3OMLA 3V8BA 1J0XO 1RM3A 5ER6A 4K9DA 2HKIA 5TIIA 3AM4A 3GK3A 1QYDA 2OL4A 1DHRA 3MTJA 3OICA 2GGSA 1XCBA 3GDOA 4RPKA 3UKOA 3V1YA 3AUSA 5I7FA 4WASA 3ROQA 1H6CA 3UVEA 4DWVA 4UUMA 2O3JA 1EVIA 1NQTA 4DIOA 5TT1A 3ZV6A 4AJIA 4D44A 4HUJA 2NM0A 4UULA 1HE3A 2O23A 4FS3A 5BNIA 5A3VA 4NHEA 1FMCA 4ND3A 3KEQA 4ZICA 3G79A 3IC5A 2YHIB 5C7IO 3ASUA 4J7XA 3GFBA 5B12A 3WFIA 3S8MA 3FWNA 2O2SA 3EVTA 5F3RA 1EVYA 4E2YA 1BW9A 4L73A 1P77A 4R41A 3ZNNA 5K6AC 1Z73A 1LNQA 4DQXA 2GZ1A 2NTNA 1W0CA 4ALJA 4J1SA 4NFYA 4WEQA 1LRKA 5KJFA 4R1SA 1MXFA 1QLHA 1T4BA 1WAMA 4NNJA 5L7TA 3DZKA 4NMHA 4B4WA 4BV8A 3GMSA 1XHLA 2ZYGA 3PWZA 1OC2A 1JN0A 2BFPA 2Y0EA 2WJPA 3B1KA 5COBA 2C2YA 5ER9A 4IDFA 3D64A 1PIWA 3ROPA 2Q4BA 3W6ZA 3WWZA 3GN2A 3PWKA 4R1TA 4CJXA 4IDCA 2ZB4A 3F9IA 4G5HA 2AE1A 4QTZA 3M2TA 2EKPA 2B0JA 2VNSA 5JDCC 1LDEA 3C1AA 2NTJA 5GMOA 4BNYA 1ZK4A 4HWKA 5JO0A 2E4AA 5L4SA 4BNXA 3HDQA 4BS9A 4DQUA 5B4TA 2X23A 2O50A 3GG2A 3VH1A 1X13A 4I5EA 5BNFA 5F5LA 2YV2A 2QG4A 3LC2O 4IS2A 5GZ3A 4KDEA 3H5RA 3PDJA 4B8ZA 1KEWA 2EP5A 2Z1MA 2XOXA 5A03A 1U4SA 4QSMA 2O4UX 2JCXA 4NBRA 3IDSA 1A71A 1PZHA 1U2GA 1ZO8A 3JYQA 4UUOA 4BNFA 4CR6A 1Z6ZA 4HFRA 1EQUA 4CM3A 4YACA 3ZZNA 2FR8A 1WVGA 2NU7A 3DBLB 4PG8A 3DZBA 1C1DA 4GL4A 5TNXA 5ICSA 4D3SA 4YAIA 5DNAA 3RC1A 4DREA 2VZ9A 1E6UA 4XB1A 3ZHBA 2Y05A 4A73A 3WSWA 4ALMA 1MFZA 1R0LA 2XXJA 4W9NA 3LU1A 2G82A 3DHEA 2W8ZA 4ID9A 4ZRNA 2OBYA 4BMSA 2OBNA 3AJRA 1LSJA 1I0ZA 3FNEA 3DL2A 4BNHA 1P74A 4MO2A 1CEQA 1Z7BA 5L95A 4B3JA 3PHHA 2H9IA 1BGVA 5DCYA 5JPIA 3FPLA 5JS6A 4H15A 4O6VA 1YOVB 3OHSX 3Q1LA 1JA9A 1PS8A 2B69A 3QIVA 3R1IA 4GLLA 3WGGA 2Y1CA 1X1EA 3ZU3A 3FNHA 1KVUA 4NU5A 4GQAA 5L7WA 3ONFA 4A26A 1LUAA 4II2A 2VRCD 2W98A 3VZQA 4IZIA 4J49A 5DDIP 3GZ4A 4OYRA 4TVBA 4AJJA 4XB2A 4DIFA 2Y66A 2X22A 4YJFB 4FN4A 2DLDA 4F46A 3ENNA 2CDBA 2WD7B 4U0JA 1M66A 3KM0A 4CLRA 4M49A 2CMDA 1ZSVA 3GH3A 1HE2A 3DOOA 3OQ1A 1ADCA 4PLHA 4YT4A 2DU8A 3OEYA 8LDHA 1VC2A 3L6DA 4MIOA 1ID1A 3LF1A 4JNKA 4N18A 3G3EA 2WDZA 1LC0A 2VWQA 1SPXA 2WEKA 1H9AA 3I4CA 1YJ8A 5JLAA 2A94A 1PJ4A 2VYNA 1KEUA 3DBHA 5L7YA 1VKNA 3C3XA 4IDDA 3ICPA 1CQJA 2YHIA 5AXCA 2DM6A 4M1QA 3WOHA 2CD9A 2W2LD 3S2EA 4NFSA 5ITVA 1JQBA 4CUKA 2ZCUA 4XQ9A 3V5NA 4EZBA 1H9BA 2NNLD 3KLMX 4MVJF 1O89A 5CG1A 2HJSA 1SO8A 2JD2A 3AK4A 1IHYA 1AUPA 2D0IA 3JQCA 3WFJA 5ITWA 1ENZA 4BNLA 1ISMA 4PZEA 3UXYA 4MKXA 1E7RA 5CDYA 2PGJA 4KMSA 1GPJA 4GX0A 2YQ4A 1PZEA 3U3XA 3TF5A 1BDMA 4II3A 4W9NC 2FSSA 1R4NA 5H82A 2JFFA 1KVRA 2P68A 1ZW1A 2YHUA 2O3TA 3A06A 1HLDA 4ALNA 3GMDA 4GH5A 3DHYA 3G0OA 4KDFA 2O7SA 3VH2A 3ZWAA 2VZ8A 4UVIA 4EW6A 4RQUA 4MIEA 3FCOA 3PJGA 3FI9A 1C0PA 3RU7A 3VZRA 1X0XA 3S1LA 3KVOA 4YAJA 3WB9A 4CL3A 3TZHA 2IYPA 2OUIA 3LT4A 1HETA 4J91A 4L0QA 3I52A 4WLOA 4NPCA 3N7UA 4RDIA 3P2YA 4TKMA 5JBIA 4J4TA 2ZATA 3K96A 3WYEA 4HXYA 4HBGA 1O9BA 4J43A 1I36A 1WP4A 5IN4A 3I3OA 2AXQA 1P9LA 4IMRA 1CYDA 2C29D 4I9UA 4PZCA 4R51A 4DLLA 5BSHA 1J49A 3PJFA 1HL3A 3EY4A 1JKFA 2IODA 3NTOA 3A1NA 1Y8QB 1MX3A 5K9ZA 4QO8A 3WIDA 4YT8A 5I9LA 1YONA 1TEHA 2WSBA 3C7CB 4PFJA 2GN9A 3PGJA 4AJHA 3K5PA 4HY3A 4OO3A 1LDYA 1NR7A 3W4KA 1PJSA 4K6FA 3OP4A 3GA0A 3U4HA 2O3RA 1PJCA 4GWGA 5EQDA 4AFNA 1KIFA 4LMPA 3JYOA 2OXIA 3NJ4A 1LLUA 4PLVA 4U6QA 1GL3A 5DBIA 1AN9A 1JVSA 2JHFA 2E49A 3F4BA 1HT0A 4XRRA 2EXXA 3SEFA 4CUZA 2RAFA 3WLFA 5TJ9A 1ZK1A 4F45A 3RUDA 1ISFA 5IZ4A 3KHUA 1U9JA 4O63O 5DOZA 4MKRA 2CVZA 4PGFA 2JHGA 4DBVO 5C37A 1P0FA 2JD1A 3JYPA 3RKRA 1CIVA 4KP7A 4D46A 1M67A 2EW2A 1PJBA 1YGYA 2YV3A 1ZSYA 1PGPA 4EJ6A 4O1MA 4CM8A 3K6JA 1ML3A 3WLEA 5ES3A 2HO5A 4YJFA 1E3WB 3F47A 3K30A 1EUCA 2C20A 3VPHA 1YL5A 2DTXA 3F5SA 2WD7A 3L6OO 1RYDA 1TVEA 2BD0A 3K31A 3GY0A 4PVDA 1UDCA 1LI4A 4Y67A 2VT3A 3CH6A 4FJ0A 5TSDA 3UH1A 3BZUA 4BGUA 5G0SA 3ON5A 4GVXA 1GR0A 4P4NA 4IQGA 1JLLA 1DOHA 3ZWOA 4BGVA 1EE9A 1CF2O 2Y0DA 3K2BA 3WQSB 1PWXA 3GGPA 4TRRA 1VSUA 4XCVA 3GVXA 1HE4A 2W2KB 2YFQA 2Y0CA 1IPEA 4J0EA 2QHXA 3AU9A 1EMDA 4YB8A 2X58A 2GN6A 1ZBQA 1VLLA 2O3SA 2Y1EA 2NV6A 5JAMA 1U5CA 3TSCA 2NU6A 4I9NA 4XDZA 4JN6B 4BO8A 4WK6A 1FDUA 3LSYA 4FJ1A 4ONEA 2DKNA 4AJLA 3RC2A 4I1IA 2V6BA 3BMCB 4YWJA 2Q2QA 3UCXA 1GZ4A 1VJ0A 3PVZA 4WLVA 4B79A 1R6DA 3ONEA 3JV7A 2O48X 4XD2A 5G0WA 3NT5A 4M89A 4BL5A 2IDZA 1RM4A 2HMSA 3U49A 1I5RA 3KV3O 4DLBA 3BMOB 1YXMA 1AHHA 2BI8A 5KTKA 5KOIA 2HK8A 1Y5MA 1TXGA 4NDNE 3BTVA 1P45A 3T4EA 3Q11A 3PZBA 2GD1O 4U6SA 1KVSA 2ZB7A 5IJZA 4NIMA 4HKTA 3WDSA 4CV2A 1H0KA 2XF8A 1IE3A 1N7GA 3HUDA 5KVQA 3AI3A 3RFTA 3HJAA 1GFSA 4L76A 1UXHA 4IJWA 2BGLA 4KUEA 4ZHSA 1Z7EA 1MA0A 2WYVA 3F6YA 3VH3A 4NBTA 5FYDA 3QVWA 2PK3A 2YZ7A 2DC1A 3HDHA 5I9NA 1UDAA 3OIGA 1BHSA 3PGXA 3BTSA 4JJGA 4OQZA 2GR9A 2H6EA 1D1TA 1U4OA 3O03A 1E7SA 1IPFA 1YB1A 2Y67A 2TMDA 1G0NA 3CMCO 4ZQFA 4Z6KA 2I99A 4Q3AA 1EEHA 3Q6IA 4X54A 4RVUA 1O5IA 2I5PO 4ILKA 3M1LA 3NRCA 1FF9A 1PJTA 4FBGA 4MJLA 1P3DA 2BFMA 4MOWA 1T24A 3MZ0A 1QV7A 1ZFNA 2Z1NA 3JQ9A 4ZQGA 1E92A 4LN1A 3UN1A 4YRAA 3IKTA 4YJHA 2AEFA 3KYDA 4BNTA 3FNGA 2Y1GA 4ALKA 5EESA 2WYUA 1GV0A 3OEWA 1R16A 2EIHA 3FR8A 3WSVA 4KUGA 2NADA 2RBEA 3DOJA 4PCVA 1ZZEA 2GUGA 4N5MA 2AQKA 1ZMOA 3PIIA 1KY4A 1LU9A 3PLRA 2GNAA 3PWSA 1C0IA 3HN7A 1V35A 1V8BA 4WNCA 4NFHA 4N5NA 1JWBB 2R00C 2FWMX 4PLFA 1W4ZA 3UF0A 1E1MA 2BLLA 4RLHA 4OSOA 4M54A 1BW9B 3ASVA 4CM9A 4J1QA 3SX2A 5JCXA 3UGKA 4Q3CA 4TKLA 5JCJD 3ZNPA 3VDQA 4FSHA 5TS3A 4U0KA 1YDEA 3N58A 3SVTA 1GADO 4PRLA 3GVHA 2ZTMA 3TQHA 2EV9A 2BMAA 4RPGA 1LLDA 3JQ7B 5TLSA 2JJYA 1ISHA 1HDRA 1E0DA 1EK5A 3I23A 3T7EA 2UUPA 4CQLA 3VDRA 3DEYX 3DR3A 4XKJA 2X5JO 3UCFA 3MJ4A 1K5HA 1ZCJA 2D4AA 4CQMA 2GYYA 2HUNA 4R69A 4E5MA 3DONA 3GVIA 4E3ZA 1K6JA 2QRJA 4PG6A 3BHJA 2EW8A 5ENDA 3T4XA 4JQCA 1SMKA 4R5MA 2J5KA 1L7EA 3KSZO 1NHWA 1C0LA 2HK9A 4EUHA 3PHGA 2W90A 1EUDA 2NSDA 1H93A 1NWCA 3WTCA 5IDWA 2BFOA 3QE3A 4Q3DA 4JROA 3IJPA 4DXHA 3QRWA 4XQCA 4CM4A 4RZIA 1GDHA 2FP4A 4J9VA 1R0KA 4IPTA 1LDNA 3K92A 1OOEA 3P7MA 3NGXA 1Y1PA 2DBVO 2JAPA 4YQZA 3V1TC 1QMGA 4BO2A 2QRLA 5K6AA 3ZU4A 3AW9A 1I30A 4LRSB 3JD3A 3OF2A 2BKAA 1WMBA 2BF7A 3JQ9C 2RHCA 5AYVA 3LQFA 2EJVA 1FK8A 4RDHA 2GO1A 1E1NA 4RJTA 3CZRA 4H7PA 1MG0A 1C1DB 1N1GA 1ZUD1 2POQX 4RGBA 3CPSA 1XWFA 4CM5A 3WGYA 1S6YA 4RL6A 4DIBA 1B3BA 3KOUA 2JCVA 1XGKA 1AGNA 1PU2A 5EQFA 1IULA 1XQ1A 4J2OA 4GMGA 4GKVA 3TJRA 1UZNA 4F6LA 4BNUA 2Q1SA 4DPKA 5KIAA 5G2OA 3AM3A 4XR9A 4BB5A 3DO5A 4BO1A 3NGLA 1M6HA 3GG9A 4CV3A 1DLJA 3GNSA 3KB6A 3OIDA 4L4XA 3EDMA 4FW8A 1NPYA 1F0YA 2IXBA 5IFLA 1BSVA 3GVPA 4K28A 2VHZA 2V6GA 3VPFA 4IGFA 3MEQA 4GBJA 5C7LO 4RCVA 4OM8A 4BMVA 4XJTA 1E7YA 3NT2A 4Q3NA 1EVZA 1IZ9A 1T2AA 3U09A 1WMAA 5ILOA 1PL6A 1WWKA 3WX0A 1J5PA 5A1TA 2PH3A 2IXAA 4TWRA 4HFNA 2B83A 1UZMA 3TFQA 2OHXA 5G0VA 4AL4A 3TL3A 3B70A 1NVTA 4CLRB 3ULKA 3VC7A 4GX5A 2UAGA 1CQIA 5L51A 2OO5A 3JQBC 3VKUA 1MGOA 4PG5A 1H2BA 1HDOA 3WBBA 4NQZA 4I08A 4W6ZA 4OKIA 3GPDG 3SBOA 3UFXA 4BNVA 2OP1A 4MINA 3PHJA 3DZJA 1OBFO 4FOSA 1MLDA 1HXHA 1SAYA 3DBHB 3E6AA 2FOIA 4RVDA 1HWYA 4QX6A 1VL6A 3ZV5A 3F4LA 1J4AA 4BIIA 1LX6A 2YFHA 4J0FA 4FGWA 4B4VA 1GV1A 2E48A 3GDGA 2J5QA 2OORA 1FDTA 3HNPA 3ZCXA 2Y93A 2E6UX 4BOYA 3VVBA 1F17A 4E4YA 2IYOA 1VJTA 3D4OA 4IDAA 5L3ZA 4RVHA 3G17A 1PR3A 4YXFA 2D59A 3WGOA 1E3JA 2VYVD 3JYLA 2GDZA 3F1LA 1Q2XA 4I8XA 4A27A 1XDWA 2NUAA 2VHXA 3R3SA 3VPXA 1B14A 3JQ7A 2IEBA 2ZYAA 1Y81A 1Y8RA 5A06A 3OA2A 2NVBA 3FTNA 3ZWVA 3OBBA 1R66A 3I9KA 2JKVA 1UXJA 1ZK0A 1WXDA 3LVFO 3GGOA 1R4NB 2NVWA 5C7OO 5JAIA 3K73O 1ULSA 4XYBA 3G1UA 3ZWMA 5HM8A 2P9CA 1ADGA 3FBGA 4J90A 1H94A 3DFUA 2CF5A 1BXKA 2AHRA 3FD8A 3NTRA 1GYPA 3M1AA 1B26A 3LLSA 1QV6A 2UVDA 3KYCA 3L4SO 3ZN2A 2FSVA 4P4LA 3H9UA 3C1TA 5JE8A 1QYWA 4CMAA 4Z9FA 3U0BA 5I7VA 2FRDA 3JQAA 3Q9NA 1AXEA 2F1KA 4BNIA 3DAGA 4EUEA 4G65A 2A4KA 1H6AA 1TLTA 1MC4A 1HTBA 3H9EO 1DXYA 1W8DA 1NVMB 3GDFA 4E12A 3KRTA 1YJQA 2DVMA 5F1PA 1TB4A 2IRWA 1X14A 1P1KA 4R5HA 4E5YA 2VOJA 5IAAA 3WR5A 1R15A 1HDZA 1I2BA 3IAHA 5COQA 3BYZA 4XQEA 5EPOA 1KOLA 3SLKA 2PY6A 4IUYA 1NXQA 1EK6A 1V3TA 4IINA 2JD0A 3INTA 4F3YA 4D79A 3ZHZA 1V9LA 5KJEA 5KKCA 2QYSA 5L40A 3WNQA 2B5VA 5A9SA 3Q9UA 4R3WA 3EHEA 4W4TA 2TMGA 1Q7BA 4E5KA 4PG7A 1NTOA 4YR9A 1ZIDA 3ITKA 4P4GA 3X2EA 3G49A 3VPGA 1F12A 2NWQA 4PLYA 5DULA 1ZK2A 1DHTA 3E9NA 1P31A 3TNLA 1N5DA 1UDBA 2G17A 4IZHA 1UP7A 1KVTA 4KQXA 1V3UA 2H1SA 4URFA 4CR8A 2V7PA 3JD4A 2D5CA 3OQ6A 5ICMA 4AJOA 4ZN6A 4EGFA 4IGEA 4XR4A 4FFMA 3WMWA 2X0NA 3PDUA 4NJMB 1X7HA 4W7IA 4IDBA 4XJSA 4BO3A 2UUOA 4XIYA 4D0RA 1HDXA 2H5LA 3WTBA 3D4PA 1QYCA 1M75A 5A3JA 1IZ0A 5KCZA 4BNGA 4CM8B 4FFPA 1YL6A 2HAEA 1XELA 4BNMA 1LA2A 4Y6SA 3A28A 4FOOA 4LMRA 5CEJA 5L9AA 2ZIZA 1D8AA 1I3KA 1B2LA 3K8ZA 4PIVA 1P1IA 2PWZA 4FD3A 3S2GA 1F8GA 2VQ3A 4N7RA 4J7CA 4NK5A 3RC9A 3HADA 3RROA 5DOVA 3O26A 4IMPA 3K9QO 3PHIA 5THKA 1QORA 3AI1A 2Q1UA 4WPGA 2NQ8A 3AM5A 5DZSA 1K0UA 2RCYA 3JYNA 2P5YA 4PG4A 4HFJA 4IIVA 2QW8A 3TOXA 3W4IA 3WQQA 4FR5A 4ROSA 3OJFA 2J5RA 1JDJA 4EDFA 1P1RA 1E6EA 4XZ3A 1HF3A 4HFMA 2UYYA 1K6XA 3CXRA 3ZU2A 3I9MA 2EERA 1LXCA 1U7HA 2CSUA 3AWDA 4D42A 3TOZA 2GERA 2J3JA 1TI7A 3DMYA 5I8WA 1P44A 2DBZA 4ZD6A 1K89A 1XU7A 3T7CA 3WWYA 4Z9XA 3DMTC 8ADHA 4D43A 5TX7A 3INRA 3MOIA 1ZH8A 5B1YA 1MFPA 3D3WA 3MJCA 1N2SA 2C07A 2H63A 1U8XX 1JVBA 4QT0A 4LK3A 5BSEA 1WDMA 5KVSA 3AUTA 5G4KA 3V2GA 3QWAA 2C7GA 2VTEA 3RBXA 1PL7A 3W6UA 1P1HA 3I4FA 3EC7A 5KJ6A 4Z0PA 5FF9A 2Q1WA 1WNTA 5H83A 3QA9A 4JXKA 5DCUA 2I3AA 2X6TA 4L4RA 4WOJA 1UP6A 3EMKA 2GF2A 5AXDA 1LDMA 3KEOA 5F21A 1E6WA 3H3JA 3C24A 3UOGA 4BMNA 1U3UA 3HZZA 1ULUA 1KVQA 4EYEA 3JQDA 1LLQA 1F8FA 1KY5A 2EJWA 2Y1FA 4DL9A 5EINA 1FDWA 1CRWG 1YBAA 1EFKA 1QYVA 4XQGA 3WBFA 2IZ0A 2EG9A 2VRCA 5CPBA 4HX5A 1Z82A 1Q7GA 1YB5A 3NDJA 4DPLA 5TF4A 2VWPA 1ISIA 2D2IA 4U7WA 1ZMTA 4BNKA 2G76A 2YDYA 3FSRA 3HWRA 4S3MA 5JDIC 3QP9A 3DWFA 1LDGA 4XA8A 1A7AA 4D0SA 3RFXA 1E3EA 4XIJA 1SC6A 4IJUA 3L77A 3MJVA 1N9GA 4UAGA 4W7HA 5CP8A 5DF1A 1C0KA 3VTZA 4YAGA 1DEHA 1E3IA 3KBOA 2VCYA 4IJKA 1ARZA 1U3WA 4GVLA 3RJ5A 3COSA 4TZKA 2AA3A 3RD5A 4YJHB 4IXTA 1RM0A 1Z74A 3KYDB 1N7HA 2VUUA 4MIYA 5TC4A 1DO8A 2R6JA 4UUPA 3H9GA 5KVCA 2B37A 3GEMA 1ISJA 3PIDA 4YVFA 4GMFA 4AJPA 3DQPA 3ZWBA 1HEUA 2W2LA 3R6DA 2Y1OA 5BSFA 1HZZA 3D5TA 3AY6A 2DPGA 1YQDA 4ZU3A 1C1XA 1TT5A 4M86A 1PL8A 3U5TA 5DBFA 1UAYA 2DBRA 1ONOA 1LDBA 4J3FA 1NQOA 1GZ3A 1U3TA 1JKJA 1ISGA 4OXNA 5ENVA 3RVDA 1E1LA 3E5MA 1DIGA 4NJMA 5JFOA 2P4HX 2Y1DA 2P2SA 1PZGA 2PZLA 4KOAA 5H81A 1EE2A 1OMOA 3V1UA 3KETA 5CG2A 4MKZA 4KUHA 5JAZA 1YBVA 1G1AA 3I9JA 4MVJG 4ITUA 4D7AA 1NAIA 3RUFA 4U8GA 5FWNA 3QVXA 2GN8A 3LF2A 2GCGA 3PFWO 3ZI0A 1PGJA 1DRVA 4J16A 2EHDA 1ZJYA 3ZWWA 4R1NA 2NVUA 4WEOA 4CQLB 4DBZA 4IY1A 3ZU5A 1DC5A 3D1LA 2J3IA 3ICCA 4IDEA 1C3VA 4HADA 4YEDA 4LGVA 4CQMB 1AHIA 1RPNA 1WZIA 4UUNA 2NU8A 2HU2A 1B8VA 1PQPA 3GR6A 3AFNA 5KVVA 5JC1A 4PRKA 2X1HA 3MJEA 1YL7A 1LSUA 3RBVA 3QWBA 4OJNA 2VUTA 4PLTA 4WCFA 4XRGA 1CDOA 5AXBA 4BV9A 3AOEA 4OL9A 1SOWA 1MB4A 3AUUA 4YDRA 2V65A 4B8WA 4BNJA 1HSZA 1O94A 4E21A 4NH4A 1G6KA 2EGGA 4CMBA 4CM4B 4PZDA 5KNLA 4OSPA 2R00A 4TROA 1M6WA 3EAGA 3C8MA 3NKLA 1PX0A 3EW7A 4PLGA 4DLAA 1QG6A 4EITA 3FHLA 3QVOA 4FFNA 1JW9B 2EF1A 3GUCA 4MVJD 4DPMA 2LDXA 2QZ9A 2D3TA 1GUFA 2FMUA 3W4JA 4LCEA 5JO9A 5DCWA 5JAQA 1DSSG 3ANNA 2ZTLA 1OI7A 4IJVA 5F1OA 1GQYA 4RZHA 1NWHA 1H5QA 5BR7A 3M2PA 1E77A 4PLPA 4XGIA 3PJDA 2HDHA 1GYQA 1P0CA 1T25A 1U1IA 2DAPA 3X2FA 3D5QA 4XDYA 1EFLA 3QVSA 1W73A 2X5KO 1B16A 4Y9DA 2HK7A 1B8PA 4GGPA 5G4LA 2Q2VA 2FPPA 3DOCA 3DZIA 1IUKA 4MVJM 4DUPA 3UHAA 1BXZA 3AOGA 3OIFA 3Q2IA 3D3EA 5AQ1A 2AMFA 2CVQA 2AEMA 2UV8A 3ETEA 1PJQA 3PRJA 4QFCA 4DRYA 5I7EA 1IL0A 4R54A 3LZ6A 1DFIA 2PH5A 2X86A 3GPIA 1LRJA 4LRTB 3WNVA 1PS0A 3EGOA 3L0DA 5T5QA 4KZPA 3L9WA 5IN5A 1SOVA 3S55A 4M55A 3C85A 3WQRA 3HSKA 4Q3EA 4ZRMA 3E5RA 3QSGA 4XYMA 4AJEA 4AJKA 4KQWA 1ZEJA 3DHNA 4D3DA 5B4VA 1ZEMA 1Z45A 3IQDB 2PNFA 3FBTA 3LT0A 1B3RA 4WOKA 2CF6A 5T8KA 1GD1O 1I8TA 4GSLA 3VZSA 1QYXA 4FC6A 3CUKA 4L74A 5K0ZA 4FC7A 3OJOA 4MP6A 3LC7O 1XIVA 3GAZA 3NDRA 3NAQA 3PK0A 3QVTA 3HHPA 1GUZA 1XLTA 3EYWA 3L9XA 1A4UA 4OGWA 4JP2A 1A4IA 1N8KA 2ZQZA 2I66A 2GASA 2EP7A 3DBRA 3W8DA 3I9LA 2BRUA 3I1JA 5TT0A 2C5EA 2WTBA 3IJRA 4JX8A 3BHIA 4WCFC 4ESOA 4FB5A 5GZ1A 3AOEC 2VWHA 3LK7A 3Q0EA 4GX2A 3BTUA 1DB3A 4RO0A 4XGNA 1KS9A 4M8SA 4HNGA 1Q0LA 3GEDA 1BVUA 2NQTA 1EBFA 1PSDA 1YH3A 3NTQA 4HV4A 1VM6A 3KSDO 1U3VA 4YQYA 1PJLA 4RPLA 4UREA 1AE1A 4MP8A 5BT9A 2ZJ0A 3VKVA 4ZJUA 5IXSA 1EBUA 3OJ0A 3H7AA 4ND4A 2Q4EA 1RWBA 4TZTA 5TRTA 4ND5A 3MWDB 1K6IA 3ETGA 4MP3A 2NU9A 1ADFA 3WICA 2FZEA 3CEAA 4FFLA 4KTVE 2B4RO 2D1YA 3CZMA 1YWGO 4RQTA 1EDZA 3RI3A 1PGQA 4BB6A 3ZW8A 2ZB8A 4GAEA 4TRJA 4GGOA 3FTPA 2C82A 2XAAA 4BKUA 5A04A 1GUYA 2OZPA 3U9LA 4PLWA 1HDCA 1YQGA 3OA0A 1CJCA 3OM9A 1VSVA 5AVOA 1V6AA 1Y8RB 1VPDA 3KUXA 3RASA 1DFGA 4ALLA 1MXHA 4UVGA 1U8FO 4YPOA 2FPIA 2JL1A 3ANMA 2X9VA 3GAFA 3JQBA 5L4NA 3GN1A 2FR0A 3JQ6A 4FQ8A 4NR0A 4XGKA 3PQEA 3RBZA 3BAZA 4ZQEA 3KYCB 4WGGA 1UJMA 4R68A 4OXKA 1NYTA 2P91A 5HTOA 4YJGB 3JQAB 3EZLA 4DMMA 3OETA 3ZWPA 2AQHA 4A10A 4MVJH 4TSKA 4J4HA 1LQTA 3GGGA 4YCAA 3QW2A 3IP3A 1T4DA 3RUIA 4BKOA 1NHGA 2QX7A 4E13A 1Y9AA 3RUEA 2PLAA 3WG9A 1HLPA 1HE5A 1K2WA 4OKNA 3KZVA 5T8KC 1LTHR 2I76A 5EERA 4RF5A 1PQWA 5T64A 3A4VA 2EGHA 1R4MA 1HDYA 1QRRA 4YA6A 2FY8A 1GQ2A 3IIEA 1FJHA 2VNAA 3KSUA 1PEDA 1D7OA 1KETA 3GNQA 4TQGA 3U62A 2A9FA 2PKQO 3F3SA 3UICA 3ZWXA 1JU9A 4JK3A 4QECA 4BO0A 1SBYA 3RJ9A 3KTDA 1YE3A 4Y6PA 2ZK7A 5KKAA 2LDBA 4UVDA 1GYRA 2PV7A 3JQFC 3TZQA 3CE6A 4BKQA 1XQ6A 3RKUA 1LBEA 5A9SB 3TZ6A 1I01A 1Y5RA 3E18A 1V0JA 5BNTA 4B3HA 2HQ1A 1X7GA 5CDGA 2Q3EA 2O4CA 1DC4A 4YT5A 1ZXBA 5C3MA 1RM5A 3VHRA 1JTVA 1SEPA 2G0TA 1ENOA 3RCBA 5JY1A 3FWZA 4MPDA 3TRIA 5EMHA 4FGSA 4KWIA 5JCJA 1SCUA 5A02A 1DDOA 1KBZA 2P5UA 3FRJA 4IQ0A 3WGTA 1LQUA 3JQGB 4GSKA 3PYLA 2VN8A 3OJEA 1B15A 1SB8A 2ZYDA 3ZV4A 3WGZA 1BVRA 3QWHA 3AU8A 3FPCA 4JP3A 1CERA 3DTTA 1VI2A 4HP8A 3JD2A 5AOVA 4R9RA 1NP3A 3ZNOA 1Y9EA 3I6QA 1HDGO 3QWIA 3WMXA 9LDBA 1ZJZA 1Q7CA 2X9NA 4Y6RA 3U4DA 4CMGA 2PFGA 1UAGA 5MGBA 4DMLA 4EEZA 1CWUA 4CMEA 3H5AA 5JMPA 1GY8A 1VL8A 4K6CA 1UZLA 2GN4A 2OGUA 2ZQYA 3WGQA 1YRLA 5EN4A 3NEPX 1E5QA 2VUSA 3FF4A 4DC0A 5I9MA 4UEOA 4H3VA 3RFVA 4MDHA 1OFGA 4J1NA 2V6MA 4H16A 4E2WA 1P1FA 3U4IA 3BMQA 1FXSA 1WW8A 4KTTE 4L4SA 3BMNA 1T2CA 4YTEA 3WGIA 2C5AA 2Q1TA 3HQ4O 4CPDA 1XSEA 3PLNA 4LISA 2F00A 3DDNA 2X8LA 1MG5A 4YJDA 2I3GA 1V3VA 5COAA 1SB9A 4YAEA 1GZ6A 2WE7A 3Q3CA 1JAXA 1UUFA 4CM7A 2D5AA 3H5NA 3R0IA 3NT4A 3VVCA 2VHYA 3I9NA 4CLEA 5IZCA 7ADHA 4BQRA 1PWZA 2C0CA 4P22A 4RF2A 3GHHA 4XYEA 7MDHA 1QXSA 2J8ZA 1E7QA 3JSAA 1NBOA 5CEFA 2RH8A 5LC1A 3D3WB 1I3NA 2OP0A 3ONDA 1HZJA 3GZNA 3PJEA 3VPSA 4PVCA 5G4KB 3TZKA 5CDSA 3TWOA 4PLCA 4TMFA 4YRDA 4MVJP 4YYZA 4L8VA 1VE9A 3W8EA 3VH4A 2VRBA 3ENKA 1YBMA 4CUJA 3IKVA 1HSOA 4Q3BA 1UXKA 3EUWA 3JD0A 4CMIB 1Y7TA 3WS7A 5G0UA 2HMTA 1IYZA 2CNBA 4J9UE 1T2DA 3MWEB 3RAJA 1UH5A 3PYXA 4B3IA 1A27A 4BQPA 1FDVA 3BTOA 3VZPA 2DPHA 1P1JA 2CDCA 3HFGA 2XPCA 4N5LA 3ST7A 2C59A 2PD3A 2AG8A 3GNTA 4YJGA 3OQBA 5L53A 3R3JA 2Z5LA 1VJ1A 4B7CA 4AJ4A 4A0SA 4C4OA 5T67A 1ZNQO 4E6PA 2PGLA 3MCVA 4I9HA 5LDGA 4G2NA 1ENPA 3AFMA 1X0VA 3JD1A 2ILTA 3JCZA 1T1SA 2QQ5A 4BNNA 3E9QA 3QQPA 4W82A 5GZ6A 3EK2A 3RSHA 1BXGA 3F5QA 2HMVA 4DTIA 3OECA 1EDOA 3HG7A 4J1TA 5HA5A 3AY7A 3CIFA 1DIRA 2PZMA 4CMEC 1NPTO 3MJTA 5B37A 5IDQA 1DRWA 1N9GB 5IDXA 3DMTA 3ROKA 1ZK3A 3B6ZA 2VYND 2WE8A 1BRMA 2CFCA 3W8FA 4RPJA 3UCEA 1I32A 1ZXLA 3E1KA 2CY0A 3RU9A 4C7KA 1HYGA 2Q45A 3ORFA 1EQ2A 3E8XA 4PLZA 2ET6A 4AVYA 3DC2A 4XEHA 1LSOA 2AW5A 5KJ1A 5LDHA 2YV1A 4EEXA 1Q0HA 6LDHA 1F14A 1TT7A 3PPIA 2R2GA 1NX6A 1O0SA 5A05A 4Q39A 4C7JA 5CEEA 1W6UA 2FZWA 5U1PA 2HRBA 2OMEA 2ZKLA 5F5NA 4BO4A 3ZHXA 4YBZA 1WPQA 4WLNA 1C1XB 1TT5B 2PZJA 4Z0HO 3DTYA 4WE3A 4DC1A 3Q2KA 1D1SA 3TDKA 3HE3A 1L7DA 3JQ8A 2PD6A 3MOGA 5AXAA 4IQ8A 1A5ZA 4YT2A 3ABIA 3DZFA 2I65A 3JQGA 1A9YA 4BUCA 4GWKA 3H8VA 2JCYA 5IZCC 5KWEA 2RIRA 2VYVA 2G1UA 3SXPA 1R0SA 1T26A 3NJ8A 3PHLA 1PS9A 3V2HA 4AJ2A 4BO6A 2HSDA 3BIOA 1TA4A 1ONNA 1AXGA 1YDWA 2HMUA 3B1FA 1JAYA 5JDIA 2GSDA 3VTFA 2BGMA 1U5AA 2AQ8A 3RC7A 3S2FA 5A9RA 1LEHA 3I5MA 2B36A 2VOEA 2NVUB 3WXBA 4AJ1A 5C5IA 4OHUA 4CM6A 4YAKA 1RYEA 2WMDA 3LLVA 4Q9NA 1O95A 3BXXA 4I5GA 5JSFA 2ZB3A 3GQVA 4TVOA 4A2CA 1DJQA 4ZQBA 2QIOA 5J23A 4DGSA 1M2WA 1KERA 5JYEA 3O4RA 4NBWA 2YQ5A 1QP8A 3SLGA 2P9EA 4AG3A 3HN2A 5I8ZA 3UAGA 2IZZA 2PTGA 1O6ZA 4WCFB 3GLQA 1WDLA 1I33A 2WYWA 4E5NA 3O8QB 3C1OA 3I6IA 4NK4A 1GCUA 2YUTA 5A5EA 1DLIA 2GPTA 4J6FA 3GOHA 3PI7A 5F1KA 1L1FA 2O7QA 4IIUA 1U7TA 4RVSA 1N92A 2DTDA 2VT2A 4L9RA 2Q2WA 3ADOA 1E3LA 2C54A 1PGNA 4JJFA 2P4QA 4KWHA 1KEVA 4LCJA 1IY8A 1UXGA 3EZYA 4P8RA 3GVCA 4ZVVA 5CAEA 1DAPA 2O3QA 2ZJ1A 4JLWA 4E5PA 2O2YA 1I2ZA 2C2XA 2Q46A 2JFGA 3GEGA 3E82A 3PXXA 3WJAA 4Z3DA 2HLPA 4E31A 3HDYA 1NQAO 2DFVA 1X15A 4CMIA 1X7DA 1O8CA 3P19A 2EWMA 4INAA 4JIGA 2E82A 4NZ9A 3P2OA 3GUYA 1NFFA 3VAZA 3K2EA 3WGHA 5EIOA 4BVAA 1ADBA 2W4QA 4B7UA 2DT5A 3OSUA 3FR7A 4L75A 2NACA 4AJNA 4O5OA 3FN4A 4CL8A 3A14A 4E2XA 4FCCA 3ETDA 5DP1A 3GC6A 3QWFA 1GEGA 1JWAB 3RWBA 4BHTA 1H6BA 1KC3A 5L45A 3LC1O 3DZHA 2Z95A 2I6TA 1NR1A 5MDHA 1QLJA 2HCTA 2VZ0A 2VHWA 2X7HA 2GZ3A 3H2SA 4G81A 3ZDFA 1YS4A 3LT2A 3DXFA 2FR1A 1FDSA 1DIBA 4IM7A 5THQA 3PTZA 3WIEA 4J7UA 4I5DA 2B4QA 1P33A 3F1KA 2EKLA 4OQYA 2EKQA 2VTDA 3QY9A 3IL2A 2Q99A 1YVEI 5DP2A 4BO5A 2BELA 3RIHA 4CODB 3TZCA 1KC1A 3E03A 3PQDA 3JQEA 4GLOA 1SNYA 4QO7A 1VKOA 1YKFA 3P5SA 3KLPX 5FI3A 1HRDA 3WYBA 4CMHA 1PGOA 3DBRB 9LDTA 1MP0A 1XYGA 3GRPA 1HYEA 2OOSA 3PEFA 4JBGA 1ZSNA 4F6CA 3E9MA 1H6DA 5DN9A 1B8UA 4K1LA 1WZEA 1E7WA 1ONPA 3SC4A 1HKUA 3DBLA 4A03A 3HB4X 4GI2A 1ENYA 2AQIA 4R3NA 1NPDA 3OJLA 1J6UA 4YRBA 3ZNQA 3L4BA 5JXWA 4RVFA 3NYWA 5IF3A 3PFFA 3VOSA 3ZWCA 2RHRA 3NDIA 3PP8A 3STHA 1LSSA 5HWSA 4LSWA 4AICA 1HYHA 2QYTA 5FFFA 5A9TA 4RF3A 4E33A 3PYMA 3TPCA 3H65A 1N1EA 1DJNA 4HNHA 5ILGA 4D41A 5T6BA 3RUCA 2IZ1A 4P38A 3B1JA 3N74A 3U4CA 1QR6A 3WJ7A 2HMWA 4Z0TA 3SC6A 3D0OA 1Y6JA 4RF4A 3GT0A 5IXYA 1YOVA 4CLXA 2DTEA 4J2HA 1B0AA 2X9GA 3NUGA 2NLOA 2J3HA 5JMWA 1NFRA 3L6EA 5EL0A 3ZHYA 2RH4A 4NG5A 3QJ5A 2GRAA 4A5OA 2Q50A 3DBVO 3INGA 3CMMA 3UW3A 4MVJI 1M76A 1R12A 1Q1NA 2YDXA 4CLDA 4LVUA 1T2FA 3A9WA 1PZFA 4IS3A 4WJZA 3ZV3A 3KO8A 3O8QA 2PZKA 5FI5A 1DBVO 4J4BA 2Y99A 3AI2A 3AUAA 3CTMA 5T57A 5KJCA 4R01A 4CLOB 1ORRA 2CZCA 2GZ2A 2PKRA 4FDAA 4OIMA 3ZGYA 4QQRA 4E0BA 5HRUA 2PR2A 4BO7A 2QRKA 1OC4A 5U9CA 4OOFA 2A92A 2X0JA 4UEJA 1IHXA 4E32A 1MC5A 1R4MB 1X1TA 2Q49A 4TRMA 4WCDA 3V2UA 1DPGA 4E2ZA 4BO9A 4Y98A 3HB5X 2DUWA 3BA1A 4QEDA 4FJ2A 2FN7A 1EUZA 3JTMA 1SZJG 2Y68A 1XR3A 4XYLA 4E30A 4OMUA 1GU7A 1T2EA 4ZA2A 1R37A 1NM5A 3DAFA 3PZRA 3UUWA 4B4UA 3MTGA 4I5FA 2BI7A 4CM9D 1K3TA 2BFAA 3CKYA 3RUAA 3ZH2A 2E37A 4W99A 4EJ0A 4DYDA 3H9JA 2I9PA 4WLFA 4BNZA 1T1RA 1GAEO 3HDJA 2C7VA 3IOYA 3L4BC 4O59O 4UVEA 4CM1A 1BDBA 3CSDA 4TRNA 4R9SA 3ZW9A 2GLXA 1QKIA 4U5QA 3W1VA 2G5CA 4WKGA 5JYDA 4Z3KA 5IDYA 1YQXA 2PGDA 4EJMA 4GPD1 4RPHA 1E5LA 2A35A 3C7AA 1DRUA 4NU6A 2ZTUA 5CHEA 1E7MA 1DAOA 1XA0A 2B5WA 4OOEA 2X5OA 1NNUA 4CQMD 3L07A 3TN7A 2WM3A 2VHVA 4BKRA 1GTMA 4ND2A 4LVCA 2FHSA 3GFGA 3H6KA 1NQ5A 3QV1A 4S1VA 3RUHA 3RQSA 3LT1A 3MJSA 1DC6A 1JKIA 4BNWA 5CFZA 2WWRA 3SJ7A 3ADPA 3JQFA 3H9QA 5LCXA 4DVJA 2OFPA 1PJ3A 1Q0QA 3H3FA 3I83A 4UEKA 4Y8VA 3GHYA 1DIHA 2AE2A 2D8AA 3BMQB 2PD4A 4CMKA 1Y8QA 3ZWNA 3BMNB 1IOLA 1RJWA 2UDPA 1DIAA 2AG5A 4ALIA 1UP4A 1NASA 3GF4A 4JBHA 4WNIA 2VWGA 2YY7A 5FEUA 1LLCA 1QSGA 1BTOA 4MVJA 2HJRA 1EVJA 3QLJA 1ZVMA 4R16A 5U4QA 1GPDG 3F46A 1GQQA 1VL0A 4WLUA 4Z9YA 4CMJA 1D3AA 2I67A 3M6IA 4IXWA 4RORA 3DB2A 4DQVA 4NBUA 1SEVA 4XWYA 4FIZA 1CETA 3I9OA 4ZGWA 2B35A 3TFOA 4K26A 4LW8A 1DFHA 3H4VA 1GCOA 3GZNB 5EJ2A 1DC3A 2SCUA 5A5FA 4CV0A 1S7CA 4NI5A 4DYVA 3EVNA 5L4LA 3PQFA 2YW9A 3D7LA 4O0LA 1XEAA 2FPGA 1NAHA 4QFDA 2DQ4A
chains in the Genus database with same CATH superfamily
1BD4A 1Q14A 1PWHA 1TQ6A 3A04A 1U1FA 4HTAA 1PTJA 5F9FA 4MZXA 4ZK6A 2O19A 4ZVSA 1FYXA 1J8VA 2R79A 3A2NA 1JG2A 5HBRA 1GRCA 1KDTA 3OFSA 3VNQA 2Q5EA 4CGZA 2LVBA 2JJ1D 5GY7A 2YWFA 4I3GA 1AT1A 2BFEB 3D4NA 3RAFC 4BGIA 3QEOA 4XB6B 3WYNA 2QBYA 1DOZA 1T8SA 2J6IA 1U1CA 3HR7A 1DX4A 1KI6B 2WNSA 5HPYB 4C2AA 4BP9A 3SJUA 5L3RA 1C9MA 2N47A 5B6JA 2D8MA 4PYOA 4YP9A 4W5WA 3N5CA 3A26A 4I36A 4PAOA 2B7CA 3CLRD 4B8YA 2OZLB 4YHBA 2ZXFA 2G83A 5GM1A 4WKPA 4NYIR 2Z5VA 2QWXA 5CVEA 3CJTA 2MMCA 2CWDA 4H1HA 2VSYA 3CBQA 3NETA 3TL2A 4ZOLB 5FPTA 3ZE1B 3OZFA 5CDTA 5JYBA 2BE9A 2G9QA 3MJRA 1IAQA 5B1DA 1I3LA 2WSMA 4P5EA 4JGBA 5ELLA 1KTVA 1QGUA 3STUA 3OZGA 2MIIA 3D7MA 4MA5A 5JNLA 4NMLA 3E9CA 1KNXA 1Z18A 2C8VA 1YR3A 3T3PB 3VV3A 4ESHA 1JPUA 3A10A 3FPKA 3SIRA 2X4GA 3O9ZA 1HG0A 5CPFA 5DHQA 5AD1A 1EFRA 4MUMA 1RMQA 1U28A 2CL7X 4XX0A 1YD7A 2IPAB 1L4BA 5F9MA 1WQ4A 2ADMA 3M33A 1FQOA 4G01B 4JLUA 1U9IA 4PAWA 5I7RA 1LLFA 2Y0PA 2K87A 1L8XA 1ZKMA 4AG6A 1MV8A 4G1UC 5D6NA 5C4GB 4UM9D 3UNXA 4L2IA 1BG6A 3AHIA 4DLTA 1B0ZA 1SOUA 3FPJA 5DT9A 1L5FA 1FQKA 1FSSA 4MRSA 2LP4Y 3O73A 4MUKA 4DUZB 1GL7A 3LM8A 1V8FA 1TEZA 5LA6B 2YZNA 1U81A 3ND6A 3JQ8B 4H18A 4PYIA 3T34A 2EEZA 4RLSA 1XMXA 2ZZKA 1ZJJA 3B51X 3UO8B 1KZ9A 2HMAA 4HWOA 4D3ZA 1MUUA 1PJ2A 1U2DA 3M82A 4YWHA 4C4ZA 3FVTA 3UJHA 4FFRA 2BT4A 4O4LA 5FORA 2O3UA 2PT6A 1ZS9A 1NMEA 4RJ2A 1M1ZA 4DC9A 1WETA 1OW3B 2GPSA 3BHMA 1S89A 1OAAA 3MLAA 3HL0A 2VK4A 3NP7A 4Q4LA 4DLYA 3I2JA 3VR3D 4EM6A 5DW3A 1KQGA 1XVAA 2BGKA 3AERB 3NVDA 4X6UA 4A3SA 5FXMA 1D4FA 1WPXA 3AJ9A 3LG2A 4US0R 5ELMA 3OCWA 4JL6A 3IP1A 4FXOA 3R74A 3NV9A 4IIFA 1B7GO 1Z2EA 1TZCA 4YGXB 4CMCA 1I10A 1YE5A 4IX9A 1TJ3A 1M1XB 3KEFA 4FPXA 1P6UA 4DDHA 1P4AA 2YOHA 3MHPA 4N4AA 5CYPA 5FA5A 2OPBA 2JGLA 1QANA 1A9OA 2G4CA 4I5IA 4WLEA 3R5TA 3GA5A 2O59A 1Y3IA 2IEDA 1JECA 1JPVA 4KMMA 4GW3A 1PTJC 3O38A 1Q83A 1OXTA 1U7PA 3VJKA 2QPLA 3RH0A 1O3YA 2J9FA 2XOKA 4IR7A 3V7FA 3EZ2A 3ZDAA 2VPZA 2REXB 2GCIA 1P72A 2CMFA 3QNMA 1DP4A 4Q93A 3C70A 3RVJA 1L8OA 2BHLA 2R47A 3RSOA 1CCWA 3ZE6A 4ZT3A 8AT1A 3KE8A 2F17A 5TGDA 3K70B 1TDJA 2JFHA 3D8BA 3ZKWA 2VHJA 1OZAA 1F06A 1NLUA 3OMLA 4E14A 1YS7A 3V8BA 2P9QA 4UHEA 5A4KA 2JRLA 3NHUA 4RHFA 1M2FA 5K3SA 2IYNA 2G4LA 3T3EA 4UOEA 3ZJ4A 3VAAA 2IOYA 5DLEA 4PAMA 3UKOA 3PXCX 3V1YA 5JSQA 1MF7A 4BFWA 4DT1A 1EK0A 2CHFA 3ROQA 1H6CA 3LE8A 4HQRA 4DWVA 1UF9A 4UD2A 4HK4A 3FLBA 1Q5PA 2I6UA 1UBCA 3HZHA 3VAYA 4ARIA 3QBVA 4KQKA 5AKZA 3E2MA 2ZUVA 3SFTA 3WMRA 4UULA 1MRSA 5IDVA 1TKAA 2BHTA 4YN3A 2Q3DA 2B6HA 2CCJA 5A3VA 2WKSA 5CAEB 5TB5A 3TO5A 3IC5A 5C7IO 4IW3B 4J7XA 3OM0A 3LQ1A 2GN0A 1VRCA 2PUWA 1CXZA 4DA7A 4BWGA 5JAOA 3AEUA 1R3UA 2M6RA 2JBWA 3S8MA 3FWNA 4B3BA 3ZTWA 1Z4PX 4LZAA 1Y1LA 3T6KA 1PR0A 2X4DA 2R66A 4Y0NA 5F73A 4L73A 1ZI9A 5IW8A 4R41A 1NSFA 1XA4A 2BJHA 2PN1A 2PJRA 1Z73A 3JRXA 1F0NA 3AVQA 3AEQB 3M4ZA 2WZQA 4OF4A 5HQ3A 1W0CA 4M0KA 3CE9A 2XNKA 4O2BB 5AVVA 4TS9A 1D9XA 5CFRA 1M10A 3UBTA 3KQMA 1VHQA 4BJ3A 4XWOA 2XRFA 3CU5A 2CXTA 2Q6KA 2N3ZA 2NYAA 4B4WA 1SG0A 1NOJA 2ZYGA 4TTAA 3J81A 4MDEA 3Q9LA 1N2CA 4DILA 5KPDA 2ISSD 4OL0A 3EA4A 1TYAE 1VB5A 2B0CA 2WJGA 1P80A 1OE0A 2EIXA 2ZBEA 2Y0EA 2WJPA 1U2DC 2X6QA 1U8EA 5HJ2A 4RZUA 3ROPA 4YRRA 3SHVA 3WLRA 2PL9A 3WWZA 1N6PA 4R1TA 3M6XA 4MV8A 1AF4A 2ZPAA 5AJTA 3TIXB 3UENA 4CJXA 2O8FA 1O03A 1RQPA 3I09A 4EKYA 1ILWA 1IOWA 1M2VA 2QTVA 3F9IA 1FP7A 4G5HA 1A96A 4KRGA 4R2KA 4CIYA 1K27A 2QD1A 2WD9A 4IOJA 1SKAA 5CA1A 1AQYA 2BDEA 3C1AA 2NTJA 4BNYA 3EJWA 3VM6A 4HWKA 3C87A 4POAA 2QRQA 3U3MA 2IHBA 4D5EA 3LP5A 3O93A 3HDQA 4AKEA 3I2YX 5IBPA 1U9YA 3GLTA 3FA2A 3KLOA 2QSYA 3RO7A 1R0ZA 4LNUB 3VH1A 4R8MA 4I5EA 5LKAA 4XD7D 1N3IA 2YV2A 5CXUA 2VT6A 3CKMA 5GZ3A 5D7NA 1U99A 2DLNA 1A9QA 4B8ZA 3PXDA 4LC0A 3ZCQA 4RA9B 3LGSA 4QWMA 3RS4A 2BEWA 5A03A 3ZD7A 4UTPA 1X77A 2HGSA 3PNYA 4GC5A 4DE5A 4U4AA 2RHGB 4BFTA 3RVNA 3TRKA 1PZHA 2DUJA 2FKAA 3SEQA 3V8VA 5JH7F 1A98A 3I4LA 1AA6A 3G68A 2OAP1 4YIKA 3WOVA 5KYWA 3WKBA 2AVDA 4V0QA 4YACA 1MNAA 4C08A 1Y7IA 4LBWA 3DBLB 3VOBA 1B42A 2NV0A 5GAJA 4D3SA 2H7XA 1QK4A 4TL8A 2I0FA 5IUNC 4TWJA 2Y05A 3CZ4A 1ISSA 3HCFA 4R2HA 1SCKA 4NBKA 4A73A 1I51A 4NOMA 1OIWA 1EX1A 4ZRNA 1I7QB 5E7IA 1C30B 3LQRA 4BMSA 2GESA 3ZKAA 1LSJA 4JEUA 5DTIA 3DL2A 4BNHA 2HHCA 3CV3A 4XPIA 4CDMA 2RHOA 2XUJA 3RADC 3HKBB 3FOFC 4HUQB 1M1NA 2O2XA 3LUGA 4U63A 2N0SA 4M1TA 5FADA 1FFGA 4X24A 1JA1A 3D8HA 2VDKB 3MUOA 1X38A 2DR0A 4R8SA 4DCVA 5AM2A 3FPLA 3H7IA 4O6VA 1IZYA 2I3ZA 3S7ZA 3CQ9A 1KHTA 1US8A 5HEKA 8MHTA 5FBZA 1EFTA 1MQSA 2B69A 1VI6A 4GLLA 5K0TA 3ZU3A 3KVVA 3DFKA 2QRGA 4DRXA 4P7GA 2JI7A 1SD2A 3F7OA 1X7YB 2HOQA 3FNHA 2I4NA 1KVUA 4NENB 5HKLA 4D9CA 3SI7A 5IMSA 4NBSA 1VJRA 1NA5A 2OCXA 3N2ZB 3OQHA 3ONFA 4C4AA 1E3MA 1SVWA 1Q15A 4EL0A 2IS2A 3EQ8A 1YB7A 4RS4A 5DDIP 1E63A 5JXGA 2PGAA 3DTNA 4ZEMA 5FOTA 4YJFB 1QZXA 4FN4A 1FFSA 3ENNA 2VUIB 4Q4HB 1QFSA 4B31A 1U0NA 1E1YA 3CZPA 4EGJA 3W5CA 1AQIA 3K4HA 1G8KA 2HPVA 2O0MA 4RENA 4M0UA 2CMDA 3GH3A 4DA6A 3QHPA 1HE2A 1LPPA 2N75A 3OQ1A 3CUYA 1P4RA 4QZVA 2BEVB 3PNVA 5HFJA 3OEYA 3RK1A 1XMOB 2Q4OA 4ZZIA 1A5SB 2C2GA 3L6DA 2I54A 5PNTA 5EZSA 3W7AA 1IEVA 1TX4B 3GFVA 3OURA 5JR3A 4ETIA 4DUGA 2WDZA 3EF1A 1H9AA 1QGZA 5JLAA 4AG5A 1YQ9A 1PJ4A 1Q20A 1KEUA 1W44A 5CIWA 4V0SA 5I7AA 1IDOA 2FWRA 3KL2A 4W8GA 1BJTA 4PXSA 1KEZA 4GPAA 2JH3A 1IWBB 4IDDA 5J9FA 4QLBA 4FBMA 1U5BB 3FPSA 5AXCA 4BE7B 2HBZA 4EQ6B 4M1QA 2IFTA 4F85A 1BEUB 3S2EA 1WXEA 4DW8A 5ITVA 1JFVA 1QFZA 2XWQA 3TLXA 2ZJ5A 5ICGA 4F7WA 1AG9A 2ZCUA 4B35A 4BX0A 1Z4QA 2QX8A 3JAMA 3T0GA 4JYMA 1H9BA 1YE8A 3KLMX 2B1RA 1O89A 3WLAA 4FFWA 1HDEA 4RNDB 1SUPA 2OBMA 5CK5A 1IHYA 2JIZD 3VJRA 1E99A 3JQCA 3LHKA 2XD9A 4FR0A 4E15A 5ITWA 3RHTA 3I1IA 2YS6A 1G59A 1ENZA 4LZPA 3ZLVA 3GOQA 5D3MB 1FNMA 4UOZA 1E7RA 1LBQA 5CDYA 1GNQA 1VTKA 5FOQA 1AO0A 3BUSA 2D1SA 4YJKA 2P9HA 3FZGA 4LJ9A 2XBUA 3HR4A 4TN1A 3VDXA 2QAGB 4I0WB 3R6GA 2A57A 1Y3BE 1KMHA 1R4NA 1Y3FE 4Y1RA 3OPQA 4NS1A 1ZW1A 3LYUA 4ZCIA 2YHUA 3KSRA 4UEQA 2WQ7A 4OG2A 1HLDA 3GMDA 1KWKA 3HV0A 4GH5A 3GCDA 4FYXA 5CFQA 4ES6A 1EUYA 2P4UA 2GA9A 5C9ZA 1OFVA 2MSWA 3BULA 4MIEA 1OLOA 5EIBD 3DT6A 1JR6A 2H48A 2VF5X 2K7ZA 4KPYA 4YAJA 4KXNA 3FH0A 3ZCTA 4PNZA 2IYPA 2O2JA 4LZLA 5E7QA 4XEUA 1HETA 3LCCA 2R60A 2JLQA 1DX9A 2HSGA 3I52A 4J91A 4XLTA 3HXQA 3NHLA 2ZIEA 2H5JA 4JJKA 3P2YA 4PPNA 1YR7A 1OWPA 2WIAA 5B7NA 3ISVA 2IELA 1O94D 4KNVA 3I3OA 4QOSA 4WZBE 2ZUTA 1HX7A 2UZ3A 2C29D 5HF6A 5BSHA 1PWEA 4JODA 5JI3E 2C78A 4IVPA 3I28A 4RHEA 4WIAA 4DQ0A 3LDAA 1HL3A 1M83A 3ZE8A 1SCNE 2XB9A 3ZVRA 1JKFA 3HA2A 1D0IA 3Q7QA 2BISA 4OB7A 1Y8QB 1MAUA 4PSUA 4EY3A 2YBEA 3W5DA 5JNSA 3MT8A 3TSAA 1TEHA 3MIIA 1Z36A 4PFJA 2GN9A 4JBYA 3PGJA 1OSNA 3MRSA 4AJHA 1QYRA 2B3TA 4U7JA 4M9RA 4EYKA 3C4JA 4PGAA 3FDZB 4NULA 2PMEA 1PJSA 4K6FA 1X7XA 4GR5A 4JLDA 4DKXA 1FXWA 4UHJA 2DUMA 3FUCA 2WIGA 3I58A 1SXJC 2VK8A 3DDCA 5FO1A 3RTAA 1PCXA 1FUYB 5EQDA 1EG2A 1R0YA 2Z9DA 4NHOA 1J0AA 2OXIA 3JYOA 3ME5A 3GT4A 3H8WA 3M6AA 5DBIA 1L2TA 1CUGA 1HT0A 1QIJA 2EXXA 3A1DA 4CUZA 2RAFA 4CXMA 1XWWA 1QLWA 1N8SA 3WLFA 5TJ9A 2UYOA 1ZK1A 3SYMA 2SCUB 4CT5A 2QTGA 4W1PA 3ZE2B 5JXWA 5K20A 4MWGA 4O63O 3R0ZA 1ICEA 3RARA 2CVZA 4LFBB 4PGFA 1TO6A 3RT7A 2ZB2A 4ITRC 3W1EA 1S2LA 4B46A 1P0FA 2JD1A 2QTMA 1LY1A 3MTQA 1STOA 1RKQA 1T36B 2OHHA 2ZDHA 4KP7A 2EW2A 4B85A 2ECQA 3GLUA 1YGYA 4BU0A 1QS0B 1Z0FA 4B2YA 5BXQC 2ETXA 2V54A 4F92B 4Y2JA 4IOKA 4GLFA 4O1MA 3BSFA 2FA9A 2FEMA 2W2VA 1FRVA 5K8IA 2O7NA 2HO5A 2WB4A 4I1SA 1E3WB 4AY5A 2IPMA 4OQDA 5ALDA 4BN5A 1G60A 2ESRA 4OU5A 5I9TA 2DTXA 1NVVR 1UC8A 3N8DA 3L6OO 1Z07A 3UOAB 4CKYA 2IPOA 3FVWA 1WR8A 1HMPA 2OZKA 1G55A 3BMXA 3V7UA 2PKCA 1YB6A 1YS6A 3I62A 1DRKA 4U7HA 2VT3A 3CH6A 3UH1A 1QFMA 3C6XA 5K2OA 4BGUA 1SKYE 2WMOB 5KYUB 1IM2A 2PLFA 4EG6A 3K7EA 4P4NA 3WLTA 3ZJTA 1DTWA 1EE9A 5LQKA 4AMVA 5A2GA 1PWXA 3KU1A 4QQFA 5AIBA 4TRRA 5C34B 1QTRA 1RQ2A 2NZWA 1DBPA 3GVXA 2BL4A 3OEED 1QRSA 1CV2A 3HP7A 2ZJOA 3A4NA 1Q57A 2H1WA 2Y0CA 5CFOA 7REQA 2WQ6A 4YB8A 3K6KA 4TTQA 1Z6YA 1TAQA 3QUSA 1R4ZA 4MYTA 1D2AA 3VR6H 5JAMA 1OWLA 1XNRB 2ECPA 4BO8A 3IJEB 3HXKA 4R31A 1EU1A 2KB0A 2F9FA 3T9CA 2ZGVA 2ZYHA 3BMCB 3EUFA 1IN7A 1TYBE 4YCCA 2CB0A 5EHZA 1VJ0A 4WLVA 1ATZA 3GH1A 1QX3A 4B79A 1SCDA 1W25A 2XKJE 3OPMA 4WESA 5G0WA 1N0UA 2PS1A 5KYYA 4M89A 5E6UB 3ESQA 1IOZA 1AB6A 3ROGA 2CNKA 1L4GA 1YXMA 1FFBA 4F93B 1NR5A 2HK8A 2NTEA 3UGQA 1CB0A 3EUAA 4P7BA 1P45A 3T4EA 4EWLA 5BYAA 5J2UB 3Q11A 3W3ZB 2ZB7A 4QDUA 4DNXA 2OBBA 4BE4A 3O8OA 4CF3A 3FYCA 5IYZF 1ZQ1A 1H0KA 1N7GA 2CXUA 3DZDA 3IV6A 3U2QA 1Y98A 4EG0A 1N5KA 4IZOA 1Q11A 4MSUA 5BWMA 4L76A 1HZZC 1UXHA 4GM1A 4JT4A 2EJCA 4Q16A 4V3CA 5M2QA 5HVNA 3D8NA 3V4FA 2ID4A 1BRTA 1KXZA 1D2CA 4G9BA 4K88A 1UJBA 1H2RS 1JG1A 2WYVA 4IKEA 4RBNA 3VH3A 4D4KA 3R8XA 4B7AA 2V9PA 5EWJB 1VGRA 1JFFA 1KY3A 5ADVA 3U5ZB 2E4XA 3HDHA 2GNPA 1KE2A 4M98A 5I9NA 1Z5VA 2EW1A 2WZDA 3ZDXB 4RFVA 2PAFA 1FCJA 2AXPA 3EH2A 3R09A 1T91A 1TCUA 1TZMA 3GJ4A 3N75A 4DHWA 4URXR 4IP0A 1EBBA 4J29A 3RRBA 3Q8MA 2XEDA 1IPFA 1WMFA 1DUVG 4AKSA 3I5XA 2NSJA 5EE3A 2CWWA 2GFHA 2VF8A 1U4NA 4Q3AA 2QRHA 5C8YA 3AF6A 2J46A 1S4QA 2YOFA 2VDUE 2YV5A 3HVIA 4I46A 2OOKA 4X54A 5BSWA 1P4GA 1W34A 4ILKA 3VU9A 5JHHB 3M1LA 4HQ0A 2GHIA 1FF9A 4N8EA 1N8TA 3CUTA 2MYNA 4FBGA 5ALWA 4BCDA 1KYXA 2WTAA 3N05A 2BFMA 1IEXA 3MZ0A 2ZI4A 4C07A 2CV0A 3SHWA 1KZGB 2Z1NA 3AW8A 3JQ9A 4ZQGA 3BB1A 1K3FA 3WL5A 5D5QA 3MD0A 4PNHA 1BU8A 4YJHA 3R3ZA 2J7PD 3KYDA 3PR1A 4QU8A 4BNTA 4R84A 1NQVA 3H1FA 5EESA 1GPH1 2WYUA 5KC8A 4RTLA 3T8YA 4HT3B 2XMSA 2IE8A 2NZVG 3E9RA 2YNMD 4D80A 1R16A 5GIPE 3FR8A 3HI4A 4HG2A 2ZSAA 3K4QA 5FTLA 2CW5A 3CVWA 4NDZA 1X39A 5IEJA 2ZJAA 3DOJA 4U1RA 4ZK2A 1ZZEA 4OATA 5JALA 4EVQA 2D74A 5KEIA 3QK7A 3EVDA 4XCXA 3SEZA 2CV2A 1T2VA 1T9BA 2AQKA 1GNRA 5E7JA 2DWUA 5DNVA 4JI0B 3QH4A 1NJ5A 1Q16A 3NS7A 3HN7A 1V8BA 4MQ5A 1JV2B 3OHPA 4IV8A 2HA6A 4NAVA 2P6NA 4NOJA 3UF0A 2GPJA 4OSOA 4BFLA 3IAAA 3TS1A 5EHGA 3HA3A 3LFHA 4UM9B 5BVHA 2OD7A 4GOXA 2E9SA 1ULAA 4TKLA 3WAGA 3ZNPA 4HNAB 4A6PA 1H65A 3QUBA 1JG7A 2WT9A 3N3AC 4JLNA 2X0EA 2IBTA 4Q9HA 4BJ5A 4CT4B 1Y7LA 1ZW6A 3BIJA 1GADO 3K2QA 2ZTMA 3UK2A 4MB2A 2JGEA 5IKOA 3TQHA 5H9WA 5J3JA 4W5JA 4LMBA 2LW7A 4OHWA 3X1YA 1Z5WA 1LLDA 4OJMX 2NUAB 5LZ5A 1BHO1 2BFCA 1P7CA 5TLSA 1TM1E 4JEHA 3TTYA 2XDWA 2LCIA 3DLTA 1ISHA 3G7NA 3T7EA 3I23A 3EXIB 3OCXA 3BXEA 1SA0A 5CFMA 3L6BA 4U9IS 2X5JO 3DVLA 4KEAA 4KI0A 2FUEA 4O25A 4TXHA 2HEGA 3A1WA 3YASA 2GYYA 2HUNA 4R69A 4RD6A 1Y6RA 3USCS 3NHYA 1Z5GA 3HLKA 2QRJA 4PG6A 3IT0A 2Z5GA 4B84A 3BHJA 2LZ0A 1J7JA 2EW8A 3FXAA 1VMAA 1E2DA 3GIWA 4JLMA 3WIUA 1TCCA 2BFDA 4AQ7A 4PE5B 1SMKA 3ZD8A 2HK9A 3PHGA 1HT2E 2FQXA 2NSDA 1JIXA 2DEUA 1N4DA 2H8GA 2IYRA 3MOSA 2BFOA 1OT5A 3DDUA 3IJPA 2EC5A 5IKMA 4CEJB 4C5CA 2DKOA 3QRWA 5T4FA 3FYSA 3M4YA 4RZIA 1ZVQA 2BUBA 1J1ZA 1ZA2A 3CF6R 2JBHA 3WK7A 3ZLTA 2F43B 3PUVA 1OVGA 3BEOA 4EB8A 4LXHA 1M5UA 2RHTA 3HKDA 3P7MA 1PT6A 3NGXA 1RLJA 2DBVO 3OZCA 4FEGA 5CLGA 1GZDA 1L8LA 4C4XA 4BO2A 4YQEA 3QVGA 3JARA 1DCMA 2Z2XA 3W3AH 2YL2A 3GP8A 2QJRA 1DQSA 5JQGA 2BKAA 4MW9A 1KDRA 1TD9A 5HUJA 4UHHA 1JDBB 2BF7A 2KE5A 3JQ9C 3MILA 2V59A 5JZSA 3IDZA 5AYVA 5HHTA 4AP9A 4ZZ0A 1E1NA 2NU7B 4ZT5A 3T7AA 3F3KA 2Z8YM 1C1DB 1N1GA 1OBHA 3QKTA 1SBTA 3DV2A 1ZL2A 5H9VA 4EGCB 3F49S 2ZBPA 2SHKA 3WGYA 2B7LA 2XVYA 3PF8A 1JIIA 2WG0A 3G8CA 4G25A 5LPNA 2HB6A 1RHQA 5MHTA 2NYRA 3G5LA 2PG3A 1V5EA 4MLPA 4J2OA 2H2DA 4R83A 3TECE 1MOPA 4XAQA 4CEIB 4QIHA 3DVAA 3HCRA 1EINA 2QL7A 1JGTA 4O33A 1YZTA 2O5CA 4BV2A 1TU0A 3CEJA 3DO5A 4KE8A 4UBIA 3VYVA 1DJLA 2H1IA 1RKBA 5KX5A 1TKRA 1RI3A 3AFIA 1OAOA 3ZVLA 3VX4A 4ZOEA 4L4XA 4N41A 1F0YA 4WV3A 2IXBA 5L3QB 3MRVA 5IFLA 2GHTA 5AW7A 3F74A 1F48A 4KB5A 3VPFA 3HBLA 3MEQA 5LDDC 2R11A 4RCVA 4XJTA 3PD0A 2JLZA 3BKXA 3L02A 1CZRA 2WWFA 1KDOA 3B6KA 5BN4B 5TGZA 3U09A 1WMAA 4ZWNA 5DYNA 4AUNA 1P73A 1J5PA 3PCTA 1YIAA 4IX1A 2H07A 5A1TA 2H2HA 3U80A 4TWRA 1KNQA 2VHCA 4R0NA 4CRWB 4Q05A 1F6DA 1OHHD 2B83A 2MDTA 2IZ7A 2HT6A 2OB2A 3A6GA 3DOEA 3TFQA 3GUUA 2BGWA 3ZDCA 4NP6A 3TL3A 1Z3IX 1KOGA 3ULKA 4GX5A 5C3UA 1GKIA 2UAGA 3GFTA 1SRQA 1U8UA 3LVRE 1K2VN 3JQBC 1MGOA 2D2EA 4PG5A 3RVBA 5BSKA 1T0HB 2BM1A 3FMFA 1E20A 4JI4B 1BWQA 4HYTA 5DI3B 4I08A 3DF7A 1NMQA 2FPXA 3CG4A 1GL6A 2XYRA 4WKCA 3X43A 4BP8A 1T3ZA 1WCYA 1II8B 1RAEA 4HGRA 4BNDA 2H7YA 2C92A 1OBFO 1VLZA 1MLDA 3D02A 4LJ5A 1SAYA 3IKLA 4U02A 4ZTBA 1RZUA 4QPCA 3WZ2A 3ND5A 4B32A 1GZSA 2FOIA 1LPNA 3IFSA 1HWYA 3DE2X 4PCLA 3KEGA 3QZUA 1C9YA 1LX6A 2BZGA 2FUG6 2HWYA 3PVSA 3ZYZA 2E6KA 4FGWA 1I1QB 2FRXA 1DADA 1FVHA 3IAM1 3DNPA 3KQOA 1RD4A 1H2AS 2J5QA 4FVTA 2VPYA 1FDTA 4IFEA 5EMMA 4KLAA 4EOGA 1J5EB 2GSWA 1H1LA 2CNLA 4PSVA 2FSGA 2HL6A 3QFTA 4L0DA 3BRCA 4BOYA 2WTEA 2FE1A 3PEWA 2VZLA 3IXLA 4E4YA 1GFWA 1GTSA 3RTCA 3VYWA 5FHRA 2J6BA 2A1TR 2ZRCA 3SJBA 4IDAA 3D4OA 2O20A 1V95A 2GCOB 3FWPA 1NG1A 4YXFA 4DDKA 2D59A 1ZRSA 2WOJA 3MTEA 3NATA 3LYHA 3NNDA 4AY2A 1RPAA 3IEPA 1E3JA 2VYVD 3LY8A 2VR1A 1UL1X 3OE4A 4XGQA 3ZZMA 3QEBZ 3ADCA 3NBXX 4QULA 1Z7WA 5C0OE 3JQ7A 3KIPA 4KAXA 1YQEA 1YB2A 3L7DA 2FFQA 3ZCRA 4E11A 1KPHA 4KRXA 4NARA 4UHCA 3L6UA 3VV2A 4CBVA 5FA8A 1ZICA 4EJ2A 2RI6A 2ZYUX 3FTNA 3G9QA 3V4ZA 3ZWVA 3OBBA 4OP1A 1UXJA 1ZK0A 2OD9A 2ZRJA 1AOXA 5SZHB 2AG6A 2A9PA 5C7OO 3BG5A 2QTNA 3K73O 4XYBA 3G1UA 1ITZA 3ZWMA 4KMOA 4H4EA 2EFDB 5GVSA 2P9CA 4RKFA 4UUAA 4DV1B 1P39A 1NI5A 1U3DA 1DKOA 1PK8A 1XEFA 5BW6B 3FD8A 3M1AA 1OXMA 1WXXA 4JLPA 5A6VA 1O95D 1OAOC 1X92A 1FYVA 1ORVA 2UVDA 3L4SO 4LHXA 4K7JA 3STVA 4P4LA 5JE8A 3C1TA 2JLCA 4IDQA 3RGGA 2Q9CA 1JHMA 2ST1A 3NWBA 1JYEA 3Q9NA 5K0EA 2YWEA 4MW0A 5SV2A 1NULA 2F1KA 1R4AA 4I3HA 3RYHB 4KR3A 3BGWA 4JBXA 4LWPA 5TDHA 1KI4A 4H35A 4CG0A 3F5DA 3IEKA 4UPEA 3S70A 4BGDA 1H6AA 1ZM2A 1A1VA 2ISCA 3FOAA 2ZT6A 4M53A 2MJLA 1RJEA 4L3OA 5CT8A 5D84A 4MV3A 4B2LA 3HPQA 1EG7A 3KB2A 1YJQA 2BEUB 1JIJA 5F1PA 2DXIA 1TB4A 5DX1A 4YMIA 3LPCA 5CA0B 4N39A 2XQIA 1JXOA 5H8WA 1TFRA 2XA9A 4MUIA 1PV2A 2VOJA 3LX6A 4R5HA 4TQUS 4UNQA 1IQUA 4H2DA 1I2BA 5B5SA 4CIXA 1OFHA 1QVRA 3BYZA 1DOAA 3MT7A 4R05A 4XQEA 5EPOA 5SYAA 4HDMB 4P7FA 3SLKA 3WY9A 4GPTA 4IUYA 5AESA 4JZKA 3D2BA 1P2GA 1V3TA 2HFJA 2LE0A 4KE6A 4MQFA 4Q7LA 4XXHA 1W581 3LOPA 3FCSB 4DR7B 1YUMA 4URZR 2G28A 1GCIA 3NWJA 3O3NB 1V4NA 3C8DA 2G1AA 1HNNA 5TE9A 4EJSA 5LBTA 3CUWA 1LK7A 4P86A 5FPHA 3EHEA 4W4TA 1POXA 1Q7BA 4MO9A 3IXMA 5HJEA 4YRNA 2IA5A 4YR9A 1ZIDA 2FDCA 4DCNA 2PX0A 3RS3A 2WJHA 3VPGA 3ESAA 3KB8A 1MO6A 3P4UA 2NWQA 4KX5A 3NMUF 2NAPA 2I4OA 2HEIA 1DHTA 4FR2A 1RSZA 5CIYA 4YJ2F 1S3IA 5IJ0A 4IZHA 1JR3A 1EDEA 4G4SP 4JJEA 1ESCA 2XYHA 3KD3A 3IQFA 4JXXA 2BKEA 2JS7A 3OQ6A 4AJOA 2QP9X 3NG1A 3IDOA 3UAYA 3OU6A 4FFMA 3RFCA 3WMWA 3AXSA 4XJSA 2QLJA 4DQLA 4BO3A 2UUOA 1ETUA 2QL9A 4XIYA 3SKVA 2XV1A 3MBKA 4UDXX 1PW5A 3SYNA 3D4PA 3ZXYA 1QYCA 3B3GA 3DE6X 3K0EA 5A3JA 5REQA 2J3QA 2J08A 2OBLA 4YDHB 4XJVA 5ALRA 2ZM5A 4CM8B 2XYVA 3NP9A 4EF6A 2ETVA 1CJSA 3BL5A 4QREA 2DCMA 4U2BA 3L8YA 2P67A 2HSEA 4DDVA 5CEJA 4KQHA 3B7PA 1I3KA 3K8ZA 1J23A 1ZN8A 3U17A 3ZGZA 2Q0SA 2WSLA 4PIVA 2Q7XA 2BGUA 2JGNA 3GPCA 1ZM9A 4ZT2A 4C0QC 2J0UA 1BVHA 4IMPA 1RXIA 3PHIA 2WFAA 3H18A 4R1OA 3MK31 4BMOB 5DI9A 5BN1A 2H4JA 3AI1A 4WPGA 2QTHA 4NE2A 4CNBA 5JMTA 3VRHA 2K6GA 4PC3A 4XUEA 1M0TA 1VYVA 4HFJA 4IHJF 4IIVA 4ROSA 3BWDD 1P2VA 4FE7A 5LNK6 1GUBA 1CVLA 5CGQB 5CX1B 5J4VA 1TJPB 2DFLA 1WLSA 4XZ3A 3U19A 2AG1A 4AMYA 3PE3A 1L7OA 1YDMA 3E8MA 4IIJF 2JZOA 4M46A 1K6XA 4X61A 1KYWA 2G7MC 1E6KA 2PXCA 1UBTS 4I50B 1U7HA 4BAGA 1RAIA 3VYTB 3G7UA 3DLPX 4D42A 5JNVA 3FLAA 2A9OA 2O6LA 3TOZA 4DSAA 1EX9A 1P44A 1DRJA 5KS2A 1K89A 2Z2ZA 1PQ4A 2PV0A 2XY4A 3DB1A 4XWKA 1S3GA 2BGIA 3JAWA 1RYFA 3MYYA 3D3WA 4HNVA 4ZEWA 2HN9A 2XAUA 1NJ8A 1QG0A 3ZW7A 1JVBA 4QT0A 4LK3A 3TDMA 3U37A 4B6FA 4FZVA 3AUTA 5G4KA 3TGLA 1FFEA 4ESVA 1PDWA 3KAKA 3M34A 1NDQA 2ATIA 1PL7A 1KP3A 4HTFB 4TUYF 5CVCA 3Q7EA 2DPXA 5KCMA 3SF8B 3EC7A 1QIEA 4YPVA 2RK4A 2JGRA 3I6ZA 5EMNA 1DIOB 5H83A 1BE6A 4FMDF 1T3SA 2I3AA 2QUZA 2X6TA 3F96A 4Q1BA 3M81A 4R2XA 2Y1XA 4PC1A 5CVJA 1WG8A 3B9BA 4TLCA 3GLIA 4FEYA 3MGCA 4Q00A 3KKKA 4F2GA 1Z6XA 3WAJA 1ZC4A 5C52B 3Q3IA 3R0VA 4D25A 2MINA 5LOVA 1E6WA 4LZOA 4LC9A 1OLSB 1VKJA 1ZY2A 1U3UA 3CF2A 4GVPA 4OBEA 1ULUA 3DWGA 2RJNA 4Y6LA 4DCCA 2R2AA 3KXKA 1NI3A 2EJWA 2ZRHA 5KKNB 3DNFA 2ATXA 1YBAA 1EFKA 4UNPA 1QYVA 4JC8A 5G1PA 4QOFA 4NCIA 4ARBA 4BBAA 2JLXA 1DAGA 1L3BA 1SJ9A 1UPAA 2YOGA 5LUBA 4Z8YA 5CPBA 5BMVB 2J3DA 4REMA 3NDJA 4DLXA 4Z49A 3V1MA 2ODTX 3KKNA 3PNLA 5TF4A 1ISIA 4N03A 5DNDA 3NANA 4QPDA 5CCEA 2YDYA 5GONA 3HWRA 2OC4A 3UWSA 5FWXB 5FV7A 1PNTA 4HWPA 1K7EB 3NTXA 1E2EA 1F8YA 4AWBA 1SELA 4ETNA 2RHMA 3RYFA 4TVSA 3ADBA 3AKCA 6REQB 1RE1A 3BE6A 1PLJA 3MJVA 5JUWA 3BGSA 3L01A 1DEHA 3NWPA 2XGOA 2VCYA 1WZUA 4PHHA 3BXHA 1Z8NA 3RJ5A 1SCJA 2G6TA 2A5YB 4JVNA 3GW8A 2EF0A 1N7HA 4MI1A 4WN9B 5DYWA 1C7IA 5KZMB 3B2EA 1B1CA 1QK5A 2PUBA 2LWIA 4JDUA 4KVFA 2VJYA 1HH4A 3OSZA 2OCAA 3IMGA 3K70C 1XZIA 3VGJA 2P2GA 3DQPA 3MXTA 3VO8A 1HEUA 3R0QA 3ZWBA 1PYDA 4AT1A 1YMVA 1DEOA 2CEAA 4U2CA 4UU7A 2ECOA 4D8UA 2ATVA 2W2LA 2D1TA 5T4EA 5AKJA 3FOEC 3SSAA 2QVXX 4MV0A 3M6WA 4RE6A 1P5HA 2DPGA 4N82A 2ROQA 3B3QA 1TT5A 2BOVA 4TL6A 3SS8A 3PFNA 3U5TA 2C88A 1Y7HA 4CF4A 4C7XA 1ONOA 1V11A 2ID8A 1LDBA 3B53X 5B1SA 3T52A 2CYCA 1NI4B 1T5BA 5CCBA 1WKBA 1L5HA 4DF3A 4OXNA 2Y71A 4DVGA 3RVDA 2R1VA 2X8JA 3E5MA 2W2TA 4H77A 3DO8A 4BVGA 5HKOA 5JFOA 2VSFA 1R50A 1XTVA 5AKIA 3WIVA 3BDVA 1QO0A 1W4AA 1FX0B 1OMOA 2W93A 5LMCA 1N77A 4MKZA 1TQHA 3N7TA 2LPMA 1RHRA 1G1AA 1NNSA 3I9JA 3OX3A 4MVJG 1NAIA 4OD0A 1JDNA 2XSZD 3QVXA 3T1HB 2GCGA 1CK4A 2R96A 1SXJE 1PGJA 5ALKA 3ZI0A 2PH7A 4Q9LA 5BOVA 3GBPA 1QCYA 2EHDA 4EO7A 4R1NA 2NVUA 1ZMXA 1ZQ9A 3E9DA 3KS9A 2FGJA 4U3JA 4UM7A 3T3GA 4CQLB 4Z4HA 4L7VA 3ZU5A 3D1LA 3K72B 2J3IA 4B5LA 1PNVA 3K8QA 3LO5A 1AV6A 3X1ZA 3BEDA 5AO9A 1GGKA 4OFBA 1Q12A 3IPXA 4EPXA 821PA 1OLUB 1VG0B 2JAUA 1UIRA 5FNVA 5JC1A 4PRKA 3MJEA 2JKZA 1XFAA 2AN9A 1COZA 4DMKA 3AILA 2DFNA 1X86B 3QWBA 4OJNA 2Y1WA 4PLTA 3OM1A 4HGZA 4ARZA 4XRGA 1ZJ6A 2VRWA 4E94A 1G6HA 1SOWA 1MB4A 3AUUA 4Z4FA 2E5WA 4BNJA 4CI9A 1TQDA 4E21A 3L0OA 3P2MA 1G6KA 5DO9A 4CM4B 3UMYA 1W52X 4DDTA 1E1CB 1DARA 2FP4B 2B98A 4EY4A 1EFHA 1W0KA 4KG7A 3EW7A 2CT8A 4PLGA 2CUNA 2RBGA 3QVOA 4FFNA 1JW9B 3GUCA 2ZR9A 4DPMA 1GSHA 4J0IA 1OFUX 1KSFX 3UUGA 3VPAA 4ARVA 1KEKA 3Q5GA 4LCEA 3QA3E 4TPKA 5JO9A 3SS9X 4RABA 3OZDA 1LBHA 3ZHSA 4RZHA 2JGIA 1H5QA 5EY5B 1G18A 3M2PA 3K09A 3ZY2A 5K2MA 1KY2A 2V7UA 1GYQA 5DJ5A 2HHAA 3AVOA 3ET4A 3F9RA 4N7MA 1HL7A 4QQNA 3VSAA 4B82A 3IQGX 1EFLA 4BZQA 3L8EA 2IPNA 4DQDA 4V1CI 5LJIA 1W73A 2X5KO 4IIBA 3W2FA 4GGPA 4I9FA 4QG3A 3MAGA 2JHPA 1GG2A 1S01A 2ZUDA 4RIIA 2WT8A 4WINA 2IUUA 4PO1A 1A1SA 2WFMA 5AQ1A 3W6NA 2FP3A 3CLKA 1PZXA 5J5VA 4ZKEA 3R9XB 1KFEB 3PRJA 1YC2A 2GYUA 1DJOA 2ZI6A 3JVVA 4I8IA 5CYOA 1IL0A 4YIHA 1PX2A 1DFIA 4I66A 2XIQA 2F59A 3IOCA 1PS0A 5BY2A 1H2ZA 2AZTA 1AD2A 1ESNA 1SOVA 2C57A 3P9YA 4KZPA 3CBGA 2CDNA 1CUZA 3C85A 3HSKA 1XBTA 3ORHA 2IHKA 4R8RA 2YRWA 3OIVA 1JHDA 5CX4A 4XYMA 2KM1A 3TBFA 4LOKA 3W2HA 3ZEIA 4AJEA 1IN5A 2NZJA 4AJKA 1RQRA 1GZ5A 3DHNA 4JVSB 2YJGA 3TYXA 3ESZA 3QI2A 3DQZA 3QXXA 4GI5A 1E94E 4W5QA 5J4KA 2M98A 1A8QA 4WOKA 1E1RD 2CF6A 2F1JA 3DCYA 4M0DA 1ZIYA 3QE2A 1G7SA 3LDUA 4OQMA 2JIQA 4EGAA 5IT0A 1NP6A 2DPMA 2WF9A 1O58A 2QMEA 5K0ZA 4FLMA 2AD1A 4ZT7A 3R6LA 1XIVA 4ZC8A 1KI3A 3PK0A 2BI4A 5LN1A 1CQIB 2I3DA 1E2NA 1XLTA 3LCJA 3FW1A 2YFYA 1K7YA 3AB7A 3H2HA 1MQAA 4JP2A 3C8HA 2D06A 3KCQA 3SX4A 2QVGA 2XQVA 3W8DA 4PPQA 1SR8A 3S5UA 4BQFA 1BMTA 1J99A 1X87A 1OVMA 3UWPA 3NHFA 4EJSC 1JE1A 2ORIA 1XXHB 3GPLA 3BHIA 2JB9A 4G41A 1TUBA 5LB4A 2GD0A