3JQ8B

Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor (nadp+) and inhibitor 6,7,7-trimethyl-7,8-dihydropteridine-2,4-diamine (dx3)
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
267
structure length
247
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQNLSIVNLCDAMVDQPMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-based design of pteridine reductase inhibitors targeting african sleeping sickness and the leishmaniases.
pubmed doi rcsb
source organism Trypanosoma brucei
molecule tags Oxidoreductase
molecule keywords Pteridine reductase 1
total genus 90
structure length 247
sequence length 267
chains with identical sequence C, D
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2009-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3jq8B00
1GADO 4J7XA 2WE7A 4MP6A 4PRKA 4ZVVA 3KRTA 2QX7A 4J16A 1EMDA 1LDMA 2WDZA 1NXQA 4IPTA 1OBFO 4M87A 3ZCXA 3HNPA 2CDAA 1I33A 3H3JA 3UGKA 4WOJA 1IL0A 5HS6A 4PLGA 3FN4A 2GYYA 3QVXA 4IINA 1ZEMA 2H5LA 3QV1A 2YV2A 3I52A 5KJFA 3B1FA 3AUUA 1C1XB 4OH1A 3RU9A 3DOJA 1AXGA 2DTDA 3JYOA 4WCFA 2CF5A 3ULKA 5TC4A 3JQ9A 3BMQA 1GCOA 1ZK0A 1UDCA 3IOYA 3AOEA 1CQJA 1U3UA 3BTUA 3QVSA 4FBGA 1UZNA 4J6FA 3DOOA 4Y9DA 1HTBA 3PHJA 2Z5LA 3W4KA 1GL3A 1NWCA 1P1RA 3I6IA 4TRJA 3BMOA 2FPPA 1YE3A 2WSBA 4NJMB 2EG9A 4PG5A 4TRRA 2YQ4A 3ZH2A 4BKOA 3I3OA 5JLAA 1QMGA 5A9TA 4TWRA 1Y1PA 3KOUA 2YQ5A 1U3WA 1IZ0A 3NUGA 3KSZO 1I3MA 1ZH8A 1LLCA 2NVBA 5CEEA 1KVSA 4JLWA 1J4AA 3I83A 4KMSA 1DHRA 3B70A 5FI5A 4WNIA 1P31A 4W9NC 5G4KB 2AG8A 2IZZA 1GDHA 4E30A 2W2LA 3A28A 1AE1A 1V3VA 4EJ0A 2PKRA 2Q1WA 4FOSA 2VRCD 2EGGA 4E2XA 1YONA 1V0JA 3E18A 1FDUA 3C3XA 3V1TC 4AICA 4RLHA 2WTBA 1NBOA 3WBFA 1K89A 4NHEA 1IYZA 3BHMA 3O9ZA 3QWBA 1DXYA 2F1KA 1NX6A 1ZK1A 2EP5A 1KS9A 2G17A 3FPLA 4ITUA 5KCZA 2RAFA 1I0ZA 1O94A 1H2BA 3ONEA 3JQAA 1HDRA 3WJ7A 5HTOA 3WMWA 3FWNA 4HP8A 1C0PA 2YHIB 5AOVA 2CVQA 1O9BA 1U1IA 3GR6A 4FGWA 1Y8RA 1VSVA 5IN4A 4C7JA 1U2GA 1V3UA 3VZPA 1XYGA 2FZEA 2QG4A 3DZGA 1UH5A 2VTDA 5I8ZA 3SJ7A 1AXEA 4EEZA 4BO8A 2WM3A 3PJFA 1KEWA 1KETA 2VRBA 3RJ5A 3ETDA 2JFGA 3GF4A 4YWJA 5F21A 5G0TA 1WNTA 1B15A 1D7OA 3PHIA 4BNIA 3TZ6A 5CEJA 3K2BA 4FFNA 3GHYA 3D7LA 1GQ2A 2ZTUA 1EK5A 4WLEA 1DIGA 2Q50A 5MDHA 1W73A 4BO2A 1GUZA 1EVIA 2ZB3A 4QQRA 1NAHA 3VPHA 3WLEA 3OH8A 3ONDA 3Q0EA 3FNEA 2PH3A 2WD7A 3LT0A 1ZSNA 3PHGA 5DP1A 4UEOA 3JQCA 4BS9A 1HKUA 2HAEA 4NR0A 4UVIA 3U0BA 4L73A 4YT5A 4YRBA 3OQBA 3R3SA 1LUAA 1ZSVA 2GSDA 1U7TA 3WGYA 4KP7A 1VM6A 4TMFA 2EKPA 2E37A 4QSMA 1E1KA 3FTPA 3TF5A 2Q4EA 3GAFA 1AHIA 1U9JA 4O6VA 3GC6A 2AE2A 3SVTA 3SLGA 1IPEA 4GX2A 2IEBA 5JPIA 4NBUA 2AEMA 4MKXA 3PJGA 2PD4A 4XJSA 1A72A 2PA3A 2C07A 3LDHA 3L77A 3LF2A 5T67A 3AI3A 1E7RA 2J3HA 2OMEA 4J3FA 1PZHA 4FJ2A 4F3YA 4B3IA 2NNLD 1IHXA 1ENOA 1T25A 5DBFA 2HRZA 1P1KA 4JXKA 1DIHA 3JD4A 3WIDA 3AWDA 2ZKLA 1R15A 3GG2A 4FGSA 3FNGA 2X9VA 1MX3A 4ZQGA 5IFLA 3G3EA 2ZJ0A 4I5FA 5JNLA 4MVJA 2VWGA 4WPGA 1I32A 2X5KO 1LDEA 1Q2XA 3E1KA 3HG7A 2A4KA 1ID1A 3PLRA 4A27A 3ZN2A 3W8DA 4DLLA 1C0IA 3INGA 1I2CA 2JD2A 1A4UA 3P2OA 4AJOA 1U3VA 1QV6A 4CMJA 1O6ZA 1J49A 3E82A 5AQ1A 2IYOA 1X0VA 4EYEA 4LMPA 5JMWA 1A71A 1ENYA 5FFFA 3W8FA 4I1IA 4J43A 2VWHA 2BGKA 1GQQA 1TT7A 2D59A 1ISMA 2R6JA 1HL3A 1DRWA 1K5HA 3T7EA 4BNGA 1PZFA 3GDFA 4URFA 1OC4A 2G82A 3HJAA 4KOAA 2YV3A 3U3XA 3VZSA 4Z9FA 2AEJA 1ULSA 1D1TA 4A5OA 1EVZA 2O4UX 1V9LA 4DMLA 1K6IA 1GYPA 2O23A 1B16A 5DNAA 4N7RA 2YFHA 3OMLA 4YJHA 3JYQA 3PRJA 4YRAA 5L7TA 3BMQB 4A03A 1P0CA 4ROSA 1P9LA 2P68A 2NLOA 4ESOA 4IIVA 3OICA 3L0DA 3UAGA 4OMUA 4IQ0A 2BFMA 2VRCA 3I9KA 3ZV4A 1R0KA 2DPHA 4MKRA 3UICA 2FOIA 5HS4A 4XGIA 1DDOA 3OIFA 4ND1A 1JU9A 4CMIA 1LC0A 1FXSA 4XQ9A 4K6CA 1VKOA 1JAYA 4M86A 4BGUA 3DOCA 1TA4A 3LF1A 5T5QA 4CMKA 3V2UA 4PVCA 4CQMD 1DJNA 4XYMA 4JNKA 2HJRA 1HXHA 3FI9A 3ZNOA 1WWKA 1XELA 5IXYA 3GRPA 5CDYA 5COQA 5TRTA 2HCTA 1JVSA 3TZCA 3DFUA 5A05A 4Y98A 3EW7A 4KUEA 3HWRA 3C1OA 2BLLA 3MTGA 4UREA 4BNUA 5KVSA 4XX0A 1GEGA 3TN7A 3U9LA 3PI7A 3HHPA 4WLUA 5G4LA 1PS0A 2X0JA 4NU5A 2F00A 3PWKA 5A5FA 3LC2O 2JFFA 2GUGA 2O3UA 2CUKA 4R69A 2XF8A 3WSVA 1JW9B 2VHVA 2W4QA 1BG6A 1JAXA 1MLDA 4PLWA 5AXCA 5TLSA 1RJWA 3DBLB 1HDGO 3RC2A 3RUIA 3PZRA 3ANLA 1Z7BA 3KETA 3VH1A 1N9GB 3ONFA 2EKLA 3QHAA 1KYQA 1KVRA 4MDHA 1C1XA 2W2LD 2ZYGA 4J7CA 2X0RA 4AJKA 1XHLA 3JQDA 2HLPA 3CIFA 1WMAA 1NNUA 3QP9A 3RC9A 2DQ4A 3ZU2A 1OZAA 1ZNQO 1EK6A 3G0OA 3RFVA 3K30A 3SC4A 1A9ZA 3O4RA 2I65A 1C1DB 1F06A 4NJMA 1BVRA 3WG9A 1I01A 4GL4A 1S6YA 4GMGA 3VVCA 3A4VA 1VL0A 1JVBA 1MC4A 2IXAA 4HNGA 5B37A 1MG0A 1ZCJA 2EERA 3GH3A 1RYDA 1SCUA 1MC5A 3GRKA 1EDZA 3PVZA 1LLUA 4F6CA 3BTVA 5CFZA 5KTKA 4JP3A 4HX5A 4QEDA 4QT0A 3WDSA 3GMDA 2HMSA 3DDNA 1BSVA 5TIIA 1LA2A 3OA0A 3I9OA 3ROPA 4J91A 5FI3A 5LDGA 3DBRB 1N8KA 4A73A 1X1EA 4WUVA 3N7UA 1U8FO 2WYVA 4IBOA 4U8GA 4YBZA 4Z0HO 5A04A 3DHYA 2J5QA 5C7OO 1YBAA 1PL8A 1EVJA 4YAJA 1OMOA 2GN9A 2Y1CA 2HDHA 4KUGA 4AJEA 1W8DA 3KUXA 1FF9A 3GDGA 3D1LA 3JTMA 3UN1A 3H5RA 5TQVA 3KEQA 4H16A 1PTJA 4ZU3A 2YYYA 3ZWWA 2X8LA 5A03A 2D4AA 3E5MA 1XCBA 1T26A 3C7CB 4R1SA 2DBVO 4CLXA 4KTTE 3D4NA 1BVUA 1R12A 1HDXA 5EQFA 1RPNA 5CDUA 3VPGA 1SOVA 5G4KA 1ARZA 3ZWAA 4PLTA 3PFFA 2BHLA 4N5NA 2X9NA 4PG7A 1P0FA 1KY5A 4BO9A 1JLLA 3I4CA 1GTMA 3PGXA 3KB6A 4HFNA 3RUCA 4BO4A 5TGDA 5JAIA 4IDFA 3OHSX 2LDXA 4CUJA 2Q46A 1EBUA 1QYVA 2FSSA 5KJ6A 4TRNA 4ALKA 1M2WA 4AJJA 4NFSA 3MJVA 4CL3A 4ZQHA 1YO6A 1C0LA 2AA3A 4FD3A 3JQ7A 3KYCA 5A9SA 3L4SO 5KKAA 4UUPA 3T4XA 5CPFA 1MFZA 2QW8A 3H9EO 1YOVA 2RHCA 2H6EA 3LC1O 3OEWA 4QTZA 3ZWOA 4CM9D 1P1HA 5F5NA 3PWSA 3KVOA 3JQFC 5TF4A 2VOJA 4DC0A 4ZQEA 3CEAA 4EUEA 4GAEA 2POQX 1V3TA 1M76A 3LU1A 4P8RA 4OXKA 4S1VA 5THQA 1P33A 2VZ9A 3TZKA 2D5AA 4EBFA 1NPDA 4K6FA 1L7DA 5JC8A 4LK3A 2J5RA 3LZ6A 1LTHR 3D3EA 5L4LA 3HN7A 5B12A 4BHTA 4PZEA 4HUJA 1LSJA 4IY1A 3I5MA 3RROA 1SB8A 2QRLA 1H6DA 4IJVA 3A14A 2FRDA 1E7WA 1P77A 1ZK3A 1XU9A 2FSVA 5IAAA 4BQPA 3OJFA 3R3JA 2X58A 4TKMA 4CMEA 5A02A 4ALMA 3GVHA 1MA0A 3K31A 3IDSA 2HSDA 3GFBA 4E5NA 4E4YA 4MINA 2YJZA 2WD8A 2Q2QA 2E48A 3JCZA 4BB5A 2PD3A 4PLCA 5JSFA 3TDKA 1XLTA 1YDEA 1B26A 3ETEA 1YL7A 2FWMX 3W4JA 4MP8A 4J90A 1QSGA 4YACA 3FF4A 3ZI0A 1O0SA 4E32A 4NH4A 1HE4A 2GN4A 1DB3A 3QLJA 4BIIA 4JP2A 3E5RA 2GZ3A 1CF2O 1HZJA 1R0LA 2Q4BA 5TX7A 4DRYA 1GUYA 1K6XA 1NHWA 1UAYA 3JQFA 5EL0A 3JYNA 3RWBA 4RVGA 1YBMA 1W0CA 4CR6A 1VLLA 4AJ2A 1NPTO 3BMCB 2LDBA 1O95A 2O3QA 3HZZA 2Y0EA 4WE3A 4II2A 4IZHA 4M49A 3B1KA 4YAIA 4AL4A 2NTNA 1CDOA 4XZ3A 3G1UA 5BNTA 3PYXA 3WBBA 1PX0A 2ZCVA 3TWOA 1UAGA 2Y68A 4DWVA 1O5IA 4R1TA 4WLNA 5AXBA 4D3DA 4RCVA 4DBZA 2OZPA 3D5TA 1R6DA 2YFQA 3DZKA 1VKNA 4NIMA 2IE0A 1RYEA 3ZV5A 2DUWA 4E21A 3OJ0A 2W2KA 2ZB7A 2ZTMA 1WVGA 3FHLA 5U9CA 4MO2A 4OL9A 3JQGB 2IRWA 4LRSB 4BQRA 1ONPA 1PS9A 2O7QA 4XRRA 1Z74A 4Z3DA 4CODB 4FPXA 1MXFA 1JA9A 1R37A 1UDAA 3WWZA 1XIVA 4DIOA 1FMCA 2FR0A 5DZSA 4CM1A 4YT2A 1HT0A 3WX0A 1K0UA 2CDCA 4FFPA 4PLYA 3FCOA 5F1OA 5GY7A 4BNMA 4E31A 2I9PA 3ZU5A 5GZ3A 2EJVA 3AOGA 2VNAA 4B7UA 4KTVE 2C59A 2CSUA 3I1JA 5L9AA 1T4DA 3K9QO 1ZMTA 2PGJA 1O8CA 1VJ0A 3AUSA 3MZ0A 3VH4A 1OI7A 1ULUA 1XG5A 3PQDA 3UH1A 3GT0A 4CR8A 3M2TA 4XKJA 3ZHZA 4BV9A 4KZPA 3PQFA 4XYEA 3AW9A 4J1SA 5J23A 1KOLA 3UHAA 2DBZA 2JCVA 5L4NA 4U5QA 4HBGA 4L4XA 3WMXA 4M1QA 5K6AC 3P19A 1UR5A 3X2FA 1E5LA 3Q1LA 3Q2KA 5G0VA 4L75A 5FWNA 3JQBC 4B8ZA 4G2NA 4IGFA 3LT1A 2PD6A 2Y0DA 2H63A 2PNFA 5JYEA 1GYQA 1BDMA 4WASA 3L6DA 3H2SA 3D4PA 5IJZA 5MGBA 2Y1DA 4D79A 2I6TA 4YJDA 1EFKA 4ALNA 1HSOA 4Y67A 3NGLA 1LDYA 4R4JA 4PZCA 4R1UA 3TSCA 3VAZA 3H9UA 3UCFA 3HN2A 4CQMB 1SMKA 5C5IA 4B79A 5IF3A 4RLSA 4Z6KA 1P3DA 1Y6JA 1TT5B 3WSWA 1AUPA 3RKRA 1I3LA 1PGQA 1M66A 2JHGA 2D8AA 1QG6A 1SBYA 4QXMA 1Q7BA 2JKVA 4ILKA 2C82A 1PSDA 3V2GA 2R2GA 1O89A 1E3WA 1GUFA 1JWAB 2DLDA 5L3ZA 2O7SA 4J0FA 5JDCC 3ZWVA 4DLAA 3ITKA 5EPOA 3C7DB 4AJHA 1EDOA 3QA9A 4RVFA 2FZWA 2OFPA 3DC2A 4BUCA 1NTOA 5KWEA 5HRUA 2JD1A 3H9GA 3MOGA 3GEMA 2OL4A 4WOKA 3VC7A 5C7LO 3BXXA 3TZHA 3I4FA 1H2HA 2EXXA 3QVTA 2CFCA 2O48X 2Q2WA 3DL2A 2DTEA 4BOYA 4BNWA 2VYND 4K1LA 2IEDA 3HDYA 3K5PA 2EGHA 2B83A 5JCJA 1MG5A 3IMFA 3GUYA 1HWYA 3TJRA 3GVCA 2Y99A 3BAZA 3DQPA 1LDBA 3F3SA 4R1NA 1R4NB 2QRKA 3TL2A 3L6OO 1M75A 4N5MA 1U8XX 4NK5A 5IDYA 2HK7A 2NADA 3GG9A 4J9UE 1ONOA 3PJEA 2V6BA 4WCFB 1LDNA 1PL6A 3FPCA 1IPFA 3TOZA 4BGVA 5JXWA 4WK6A 1F8GA 3GPDG 3WJAA 1MP0A 5H81A 4D3FA 5FF9A 4FS3A 3IQDB 4BKRA 1S7CA 3ZGYA 4MPDA 2VYVD 1QXSA 2Z1NA 1V8BA 1SEPA 3TQHA 2P9GA 4DLBA 3GAZA 1WP4A 4NPCA 5EJ2A 3ZNQA 1QRRA 1QKIA 1NP3A 4NFYA 3S8MA 1IE3A 1DC3A 2B0JA 3KEOA 1RM5A 3I9NA 4K28A 2B5WA 1ZK4A 4OOEA 4P4LA 3JQAD 1A5ZA 1EFLA 2O4CA 3M1AA 2GERA 4LVCA 4Z9XA 1QORA 2BELA 4ZQBA 3RUEA 1E77A 4CV0A 5A4DA 4RF2A 4NFHA 1SEVA 2JL1A 1BHSA 4DMMA 5IDXA 1G0NA 3CPSA 3L9XA 3F4BA 2QHXA 4AJLA 3Q2IA 3A9WA 3JQ9C 2X5JO 3LLSA 4WCFC 2W90A 3GGOA 1ZVMA 5G0UA 1B0AA 4J4BA 4E12A 1BW9B 2PKQO 3ZV6A 3D5QA 3ETGA 3ZWBA 7MDHA 3LYLA 3MJTA 4JGBA 3RUAA 2YY7A 3EY4A 2OBNA 4F45A 2NVUB 2V65A 2AQKA 2V6GA 2O3TA 3FD8A 4L4SA 2JFHA 5GZ6A 3LVFO 4CQLB 2D1YA 4W4TA 4OXYA 4KQWA 4R68A 2BGMA 3RUHA 3GGPA 3OBBA 5U4QA 4AVYA 2WEKA 3H9QA 3RD5A 4GVXA 1QYWA 5DBIA 2UAGA 5AXAA 3BHIA 3NRCA 4BNZA 4CMCA 5CPBA 1J6UA 3WGZA 5A06A 4IDDA 1BTOA 4BKPA 1G1AA 4XEHA 4YJFA 3V8BA 2HO5A 1YJ8A 5DULA 9LDTA 3EZYA 3FWZA 1CJCA 3E03A 4H3VA 4R51A 3WNQA 2EW2A 2DFDA 4YXFA 2UYYA 4UVEA 4Q9NA 5EESA 1SO8A 3IJRA 3IS3A 1UP6A 3PQEA 5GZ1A 3JD0A 4R5MA 1DC5A 2VHXA 5DCUA 1PZGA 2FMUA 4E3ZA 3R6DA 3F6YA 5TJ9A 4HY3A 3KV3O 5BSHA 5C37A 5L7WA 4RPJA 2Q1UA 2X86A 4FFOA 2VNSA 1KC1A 4FFLA 3RUDA 4R3NA 3S2EA 3RFTA 1U5CA 2W98A 4CM3A 1SAYA 4F6LA 1WW8A 3STHA 5LCXA 4WLVA 3H2ZA 3PTZA 2GCGA 2GGSA 4HKTA 3NJ4A 3CUKA 4XR4A 4H7PA 4R41A 2PFGA 3W8EA 4W7IA 1ZKMA 4ZQFA 1MB4A 2NSDA 3WFJA 3IUSA 4XJTA 3RQSA 1WLYA 1R66A 1KC3A 3DMTC 5EQDA 2P4HX 2FR1A 2FR8A 1WMBA 5IZCA 2PZMA 3WYCA 1GFSA 4CMGA 5IDQA 1IZ9A 2HMVA 5G0WA 3TFOA 4OO3A 1HLDA 4I8XA 5ITWA 4I5EA 1PJ3A 3NX4A 2PTGA 4Y6PA 4MVJF 4PFJA 1QR6A 1D3AA 3BA1A 4FC7A 3GUCA 1FJHA 3F1KA 3LLVA 4PLHA 3PEFA 2Q45A 1J5PA 4O1MA 2B4TO 1QV7A 3UOGA 2XXJA 3JYLA 2ZB8A 5G0SA 2V6MA 2R00A 4NJOA 1PWZA 4OSPA 1GY8A 3LC7O 2FP4A 3UCEA 4J1QA 5F1KA 4AG3A 4BNNA 4R5HA 4CV1A 3AM4A 1X7DA 2HKIA 3IUPA 3OJOA 4Y6RA 1LRJA 4CV2A 2PKQP 4JX8A 2DU8A 1T2FA 4YPOA 3FRJA 3JQGA 4ND2A 1X15A 3DHEA 4R01A 1F12A 3K92A 2O3SA 2DKNA 2CY0A 3R0IA 3AFMA 1TVEA 2AQ8A 3FSRA 1EVYA 1VJ1A 4LCJA 4YJHB 1MXHA 2VYVA 4U0JA 2C20A 4B8WA 2FN7A 2NV6A 4CLHA 1YL5A 5CAEA 4TSKA 1P1IA 4P38A 3DXFA 1ZXBA 2AG5A 4BO3A 4CM4A 3KHUA 3QWHA 4MJLA 3GN2A 3WGIA 1UP4A 1M6WA 4XIJA 1NYTA 3QVOA 5JAZA 5JCJD 1E92A 1EUCA 1LSOA 4J7UA 2VCYA 5CP8A 2DBQA 3WICA 3DWFA 4B7CA 5I9NA 1UXIA 3ZNPA 3EVNA 2X23A 4FSHA 3GLQA 2PR2A 3TPCA 4B4VA 4Q3EA 1A7AA 4J1NA 3WWYA 3GHHA 1UXHA 3E9NA 1N1GA 2QYTA 3VTFA 4EZBA 1XKQA 4YQYA 1Y8RB 5JFOA 4UVDA 3RIHA 4DPLA 1YB1A 4OKIA 2AE1A 3CKYA 1SPXA 4U6QA 3M2PA 1C0KA 2A94A 1MFPA 2I3GA 3N74A 4FFRA 4ZHSA 1H6BA 1OAAA 3B6ZA 3PHLA 4BL5A 3S55A 1F8FA 4J9VA 3IAHA 2EEZA 5K9ZA 3U4DA 4P22A 5KVVA 1UZMA 2X1HA 1RWBA 4GGOA 1UUFA 2Y1FA 3DAGA 3KM0A 5DN9A 1EQ2A 2AXQA 1OFGA 3EAGA 1FK8A 2GR9A 4YA6A 2OP0A 1X14A 1IHYA 1PGPA 4OQZA 2A92A 1R4NA 1N9GA 2CNBA 2H1SA 3QIVA 4J2OA 2Y1OA 3WQQA 5DBGA 3WIEA 4JQCA 4OAQA 1NVTA 4J2HA 1NR1A 2EIHA 4BV8A 4ND5A 4AJ1A 5DP2A 1U4SA 4QECA 3F47A 4UUOA 4MP3A 1E7MA 3UKOA 1R4MA 4YYZA 4O59O 3EYWA 3GZNB 3AM3A 3OA2A 2X5OA 1PJQA 4GGPA 3R1IA 4Z3KA 3COSA 5IN5A 1GV1A 5A9RA 1EEHA 3ZU3A 5ES3A 2BFAA 3ZDFA 3VKVA 1KY4A 2C0CA 2OGUA 3RBZA 4O0LA 3DAPA 4WCDA 5AVOA 1JTVA 3DBHB 3G49A 1HZZA 4XA8A 3HSKA 2E6UX 2IYPA 4UVHA 5A1TA 2C2YA 2VWPA 4PCVA 4YDRA 4PVDA 2P5UA 4B4WA 4D0RA 2IZ0A 1EE9A 3U09A 4U0KA 4OXNA 4M8SA 1E6EA 4Y6SA 2YDYA 2VTEA 1A4IA 3MJSA 2Y67A 1ISHA 3NYWA 1LSSA 4YQZA 3SXPA 2EHDA 2NTVA 4DYVA 2W8ZA 2HMWA 4MIOA 4GPD1 4R9RA 1KEUA 3AK4A 1ZSYA 4IGEA 2GF2A 4CL8A 4YCAA 3DR3A 3WGGA 3FR7A 3DZBA 1QLHA 1ADGA 1BW9A 2FY8A 2YV1A 2OHXA 1CIVA 1PQWA 4JBHA 2YUTA 4WEQA 5C7IO 4GX0A 1ISIA 3C1TA 4FB5A 4PRLA 4CQLA 1PGJA 2Y66A 2ZB4A 3NT2A 4BNHA 4WECA 3QVWA 3MOIA 5L45A 3HB5X 5CG1A 3BZUA 4G81A 2GLXA 1P74A 4XQGA 1WPQA 3TOXA 1L1FA 1H5QA 3V1UA 3IL2A 4ND4A 3GPIA 5T64A 3HFGA 3DBRA 3GNTA 3P2YA 4AJPA 4LCEA 5BNIA 1PJTA 3GNQA 4DA9A 4XYBA 3IJPA 4EJ6A 4L76A 4CJXA 5IZCC 2O50A 4PG6A 3HE3A 4LSMA 4DPMA 3TZQA 2JJYA 4D45A 2I76A 4G65A 4BNJA 2GN8A 4P4NA 3O26A 3QW2A 4QUKA 3BYZA 3NEPX 4D0SA 3AI1A 2GN6A 3O03A 5HM8A 1FDVA 1D4FA 1NFQA 1B3RA 3GZ4A 3EHEA 1DAPA 4LSWA 3SX2A 1E1LA 3CXRA 1I5RA 3K96A 1PJCA 3QWFA 3JQ7B 3S2FA 1ZFNA 1ENZA 3CZMA 4BKUA 3ZWYA 5BR7A 1F17A 1LRLA 1NM5A 4DREA 4OYRA 5TT1A 2EW8A 2GRAA 1U28A 3PHHA 3JV7A 3QWAA 5JCXA 2QZZA 1DFIA 4S3MA 3TNLA 2CVOA 1Q0QA 4DPKA 2ZYAA 3M6IA 3T7CA 2IZ1A 4DGSA 2X0NA 2XXBA 3EC7A 3I6QA 4II3A 4CM7A 3FNFA 3D0OA 3QE3A 4GI2A 3ZHBA 1G6KA 1YQXA 3CMCO 1GR0A 1LU9A 3SBOA 2D5CA 4CLRA 3C8MA 1U4OA 1LNQA 4BB6A 2JAHA 4L4RA 2Y0CA 2BF7A 4NNJA 4E33A 1VI2A 1N7GA 1TXGA 4HWKA 5KVCA 1GEEA 4RPLA 1PJBA 4Q3CA 4RVUA 5CG2A 2OOSA 3K8ZA 4KDEA 4YTEA 3VPFA 2R00C 3F5SA 2ZCUA 3SEFA 3DO5A 1XWFA 1YOVB 1Z82A 1CETA 2B35A 1NQOA 4ZJUA 3OQ6A 4HADA 4GSKA 1DFGA 1X7GA 1BWSA 3AFNA 2Q3EA 1NFRA 3WYBA 4YT4A 5EERA 1GZ6A 3IKVA 3OIGA 3VZRA 5DCYA 4IXWA 1CWUA 4EI2A 4R54A 4CM9A 4TZTA 4PG8A 4TQGA 2BRUA 3OSUA 3F4LA 3KSDO 4HXYA 1HLPA 4FJ0A 4GKVA 3WGQA 4PZDA 2AEFA 3BMNA 4I9UA 1H9BA 3AM5A 3LK7A 4A2CA 2C29D 2D3TA 4B7XA 1H0KA 1P44A 1YJQA 1CEQA 3RVDA 3ABIA 1E7YA 3H5NA 3GA0A 2C5AA 2Y1EA 5KKCA 2PV7A 3Q9NA 4CM6A 1HE5A 4YVFA 4P4GA 4ZRNA 3VZQA 5L51A 4TKLA 3GDOA 3GFGA 3VDQA 2PY6A 1LDGA 1E6UA 4BO6A 4J1TA 4IJUA 3UFXA 3VH2A 4GLOA 4CM8B 1NVMB 5CDSA 1B14A 1E3EA 2BI8A 2VZ0A 4BMNA 3RC1A 1BXKA 2VN8A 1V35A 4IDBA 3JYPA 1VRWA 3DBVO 4CUZA 2G5CA 3DAFA 4M89A 1IOLA 1V6AA 1RKXA 4GMFA 4XR9A 1KEPA 4YT8A 1DIAA 5JAMA 2O2YA 3ASUA 4B3JA 2RH4A 4JN6B 4CM5A 2P2SA 3VOSA 4RV9A 4RDHA 4YR9A 1DAOA 1C14A 5COAA 4CPDA 3OJLA 1NPYA 3AY6A 1DLJA 3HB4X 1H94A 3B20A 3FR8A 4TVBA 2X7HA 3KYDA 4NK4A 2HK9A 3DZIA 3K73O 1U5AA 3OECA 4MIYA 1U3TA 1ENPA 1P45A 2PGDA 3AY7A 4PN3A 2EKQA 3WR5A 1KVTA 3AU8A 4L9RA 1I10A 2BFOA 4FW8A 1ISGA 4GBJA 3QY9A 3UXYA 3BHJA 3BMOB 2B69A 6ADHA 3SJUA 1GCUA 5BSEA 1YB4A 4PLFA 2YZ7A 3PWZA 3ANMA 3Q3CA 4RO0A 2NU7A 4CMAA 5A3JA 1PJ4A 1QLJA 1WDMA 4O5OA 1DOHA 4BNLA 3KYCB 4F46A 1HSZA 5TS3A 3PK0A 3W4IA 2ZYDA 1WDKA 1Y81A 1RM3A 3FBTA 1XGKA 3F9IA 3NTRA 1JDJA 1IULA 3D3WA 4XDZA 1PJSA 2DTXA 2H9IA 3PGJA 3OP4A 4KWIA 1PR3A 3NJ8A 3DEYX 3E6AA 2HK8A 2OBYA 1X7HA 3H7AA 3PYMA 1VJTA 2A35A 4RJTA 1PL7A 3WS7A 1DJQA 5JC1A 2CVZA 3DBHA 1E7QA 4IDEA 1T2CA 4BNFA 5CEFA 1N92A 1I3KA 1UXKA 2GNAA 4EDFA 1ZJZA 5L95A 4GX5A 1WZEA 4DQVA 3E8XA 3QJ5A 4JK3A 1I2BA 1JQBA 1N7HA 3DTYA 3K6JA 2VWQA 4XCVA 1ADCA 1M67A 5JDCA 3F46A 1A27A 4OIMA 1T1SA 1PZEA 2GZ1A 3ADOA 5ICSA 4E2WA 3DZHA 1GZ4A 1X1TA 2VZ8A 4IJKA 5KOIA 1JWBB 1ZUD1 4DQXA 1BMDA 3WTBA 3U49A 2UUOA 5KJEA 3WLFA 4UAGA 4HFMA 4N18A 1A9YA 3ENKA 4NMHA 5IG2A 5I8WA 1E1NA 4XGNA 1LLDA 4TROA 2D2IA 4GH5A 1JKJA 2PK3A 2AHRA 4WLFA 2ZATA 4GVLA 3F1LA 2YHUA 2I67A 4NI5A 1LXCA 1Y9EA 1YS4A 4ALIA 4ALJA 2YDXA 3HDJA 5ER9A 3MJCA 1DIRA 3NKLA 4CMEC 3LT4A 2JCYA 1XU7A 2VUTA 3BMCA 4RPGA 3WXBA 5K6AA 4L0QA 4D41A 4U6SA 4DIBA 4KQXA 3EZLA 4ZRMA 5JMPA 4RGBA 2HMUA 1Q1NA 1UP7A 4E2YA 4CM8A 3UVEA 5EMHA 1FDTA 3RBXA 1E6WA 4D3SA 4RF3A 4IUYA 1NQTA 1Y8QA 2BI7A 2DM6A 3HFSA 2CF6A 5DF1A 4LVUA 3Q9UA 5IXSA 3ROMA 1YL6A 2HJSA 1Q0HA 2OO5A 3UUWA 4RL6A 5FYDA 5JY1A 2ZJ1A 1ORRA 1QYXA 2B36A 2BGLA 2ZQZA 3JQAB 3GEGA 4LISA 3VKUA 4B4UA 3MJ4A 4ND3A 3RI3A 4GWGA 2YHIA 4NU6A 4FOOA 1HDYA 4Z0TA 3W6ZA 5HBRA 2EJWA 4IM7A 1ZIDA 4Q39A 3GVXA 3L07A 3C7AA 3MCVA 4E0BA 4R16A 5T6BA 3KYDB 3PJDA 2DBRA 1KEVA 2O3RA 5BQFA 1CRWG 3PPIA 4HV4A 1GU7A 3I9MA 3NDIA 2DAPA 1ZJYA 3X2EA 1I36A 4IMRA 2P5YA 3V2HA 3OF2A 4EUHA 1CERA 3WGOA 1HE2A 4XWYA 5ENDA 1DIBA 3LSYA 3S2GA 1T24A 2J3KA 4CMIB 4XRGA 5JE8A 4MVJG 3EK2A 4GX1A 5ENVA 1IB6A 4JJFA 4WNCA 1HDCA 3DZFA 7ADHA 5JYDA 8ADHA 4Q3DA 4IDCA 1WDLA 4RF4A 4PGFA 1VC2A 2CZCA 3PZBA 3B1JA 1OOEA 4N54A 1Q7CA 3FBGA 1HYGA 3JQ8B 4RVDA 3L4BC 4NBRA 4ZN6A 3HDQA 4DXHA 2IXBA 2B4QA 1LEHA 4EITA 4BKQA 4XQEA 2VT3A 4C4OA 3RCBA 4RDIA 4DYDA 3CZRA 1B7GO 3EMKA 2C7GA 5I7EA 4I5DA 5DCWA 4DL9A 3L9WA 3C1AA 1BRMA 3KXDA 4I9HA 4J0EA 3SC6A 3BMNB 4UULA 3C24A 2FPGA 3WB9A 5CDTA 2ZIZA 2PZKA 5COBA 2XAAA 4CLRB 4CLDA 3D64A 1TT5A 1T2DA 1U2DA 4JJGA 3VVBA 4XYGA 4E5PA 4OHUA 2XOXA 5DOZA 2V6FA 1D1SA 3GOHA 4XB1A 1F14A 3KZVA 5B1YA 1HYHA 3W6UA 3DHNA 4W6ZA 1E3WB 4E2ZA 1N1EA 4OGWA 4TRMA 1EE2A 5CHEA 4LGVA 1T2AA 1UXJA 3JD3A 1SB9A 3G79A 3P7MA 1DRUA 2Z95A 1GAEO 2Q1TA 2ZK7A 3G17A 1JKIA 3D3WB 3H9JA 4PG4A 4WLOA 5JDIC 4FR5A 2RIRA 4INAA 2QIOA 3OFSA 2PH5A 1N2SA 5JDIA 1ADBA 5JS6A 2CDBA 3GGGA 4NBVA 1XR3A 4YJFB 1EUZA 5B4TA 1YXMA 4BVAA 2J3IA 5EN4A 3JSAA 1EUDA 3O8QB 1ISFA 1BXGA 2J5KA 5F3RA 1DSSG 3ZZNA 3E9QA 4OOFA 2Y1GA 1Y5MA 3JQEA 2O3JA 1B8UA 1YB5A 2OORA 1Z73A 1YKFA 3PIIA 4UUMA 4OJNA 3H65A 4BNXA 3ITDA 4E5YA 4I5GA 4XB2A 1KIFA 1PJ2A 4ID9A 2NWQA 3F5QA 3SLKA 2SCUA 1DEHA 4BNYA 2WJPA 3ZWMA 4KUHA 1K6JA 2DUUA 4TVOA 4JIGA 1XEAA 5T8KA 3VHRA 1H6AA 1NVGA 3DB2A 5TT0A 5GMOA 2EP7A 2X6TA 3ZNNA 1YQGA 2O2SA 3OIDA 4HFRA 4B4OA 1T1RA 2B4RO 1BXZA 5F5LA 5LDHA 2XPCA 1PEDA 1ZMOA 1I3NA 3V1YA 4IS3A 2HUNA 1X0XA 2NVUA 2ZTVA 4D43A 3M1LA 2BD0A 2FPIA 4N5LA 3JD1A 2NTJA 2OXIA 4CUKA 1XQ1A 1GD1O 1PWXA 3NT5A 2GO1A 4YAKA 3CINA 1F0YA 3U62A 4B3HA 4MVJH 2B5VA 4RQTA 1QP8A 3MTJA 5H82A 1UZLA 1B3BA 3JQBA 2Y93A 4W99A 1KVUA 3NDJA 4NG5A 5LC1A 1ML3A 3HDHA 4GLLA 3IKTA 4EW6A 4CLEA 5JO0A 1BDBA 3KTDA 4GKBA 2BFPA 4EEXA 3AUTA 1VPDA 5I7SA 2UVDA 2NQ8A 4E5KA 1KERA 1P1FA 2VHYA 1E7SA 1I24A 3PP8A 4XIYA 3DMTA 3QRWA 1Y8QB 1LJ8A 2DVMA 2NVWA 4NQZA 4WGGA 4FC6A 4MIEA 1B8VA 2JCXA 1PS8A 5A9SB 1TEHA 2J3JA 3AI2A 3OEYA 5JO9A 2VUSA 1Y7TA 4PLZA 5L7YA 1ZBQA 4FFMA 5K0ZA 4M55A 3DONA 5B4UA 4Z0PA 2WYUA 1DLIA 2Q2VA 3JQ8A 4RVSA 5CDGA 3GVPA 3CTMA 5ADHA 1YWGO 2Q99A 1YQDA 3C85A 4EUFA 1VL8A 4LMRA 2J8ZA 1RM0A 5U1PA 2HRBA 3MWEB 3UF0A 3KLPX 3PFWO 3RBVA 3T4EA 4D42A 2Z1MA 2NUAA 1EQUA 3I9JA 4RPHA 2TMDA 3PDUA 3BTOA 1R16A 5HA5A 1PIWA 1D8AA 4BNTA 5L40A 3D4OA 1ONNA 5KVQA 2X22A 1ADFA 5L4SA 1CYDA 1HEUA 1E3SA 5HWSA 4LN1A 3DTTA 4TZKA 2QYSA 4NDNE 1HDZA 4E13A 4IDAA 4RORA 4Z9YA 3NV9A 3NGXA 1TI7A 5T8KC 4GSLA 5AXDA 2RCYA 1E0DA 1PQUA 1J0XO 1WXDA 1AGNA 4D46A 1R4MB 2GASA 4IJWA 5BT9A 4X54A 3TL3A 2P9EA 1W6UA 2D0IA 2DPGA 3GZNA 3NTQA 4CR7A 5C3MA 4BNVA 4L8VA 4FJ1A 5ER6A 2C7VA 2AW5A 1X13A 1PU2A 1PQPA 2Q49A 4FIZA 4K26A 5H83A 3RJ9A 1C1DA 5BSFA 4K9DA 1BXGB 4U7WA 4YAEA 5B4VA 1I2ZA 2RH8A 3Q11A 3GVIA 4E6PA 5BSGA 1P1JA 1YGYA 4R9SA 4RF5A 3PDJA 3ZU4A 1Q7GA 2NU9A 1E5QA 2AMFA 3AJRA 4JROA 2X0IA 4NBWA 4W82A 4O63O 5KNLA 4XYLA 1NASA 2ZTLA 1DO8A 9LDBA 5JAQA 5TSDA 3AU9A 3U4HA 1BGVA 3GQVA 5EIOA 1EBFA 1TLTA 1Z6ZA 2QQ5A 3H8VA 4A0SA 1HE3A 5L53A 4Q3NA 1ISJA 1GYRA 3KYBA 1NWHA 5F1PA 3I23A 2X4GA 2JAPA 4J4TA 2VYNA 4MKZA 1KBZA 4IZIA 3TRIA 4AJIA 3PYLA 1U7HA 4OM8A 2QRJA 3O8QA 4FN4A 3DMYA 2RHRA 1LC3A 1GV0A 3JD2A 5ICMA 4ONEA 4WJZA 5DT9A 1OC2A 2G1UA 1UXGA 3ANNA 4DC1A 4MVJD 1YRLA 5KJ1A 3VH3A 1PGNA 1JKFA 3GN1A 4XGKA 1WZIA 1EZ4A 5FEUA 2IODA 4BO5A 5JBIA 1DRVA 2ILTA 4BO0A 3KSUA 3A06A 4BMSA 4W7HA 4MOWA 1SZJG 2CMDA 4IIUA 2HQ1A 4UVGA 4OSOA 5ILGA 4QFDA 1NAIA 1MV8A 3KO8A 4WKGA 4IDGA 4CM4B 1CQIA 4EGFA 2PLAA 2E4AA 2V7PA 3V5NA 2VHWA 3K2EA 3NAQA 4A10A 1HETA 4D7AA 1NHGA 4ZICA 2WWRA 5BNFA 1YBVA 3RUFA 2W2KB 2VQ3A 2IDZA 1MGOA 3JQ6A 2HMTA 2JHFA 4I9NA 3GNSA 4XQCA 3WFIA 2BH9A 3E48A 4YJGB 4KDFA 2RBEA 2NQTA 2ET6A 5A5EA 3OQ1A 3CE6A 1PR9A 3GY0A 3HUDA 4QFCA 2DC1A 4BGIA 2G76A 2PGLA 5AYVA 2WMDA 5DDIP 5JW6A 1TB4A 3H3FA 4PLPA 3S2IA 4BO7A 1L7EA 3EGOA 4CLOA 4MVJI 1SC6A 3BIOA 4UEJA 4RZIA 2G0TA 4C7KA 2I99A 4ZA2A 2QZ9A 2I66A 2NU8A 1HYEA 1C3VA 4DBVO 1HRDA 2JD0A 1I30A 4MVJP 4EJMA 4QO8A 5TNXA 4DTIA 4HFJA 4JJIA 1YDWA 2AQIA 4FCCA 4LRTB 2GDZA 4DQUA 3UCXA 1GPDG 2VOEA 4ZGWA 1ZXLA 4JCOA 2GPTA 4Y8VA 4YAGA 4UEKA 2C54A 2C5EA 1QYCA 3ADPA 3EVTA 4RZHA 5IZ4A 3WGTA 3NTOA 1SOWA 1Z75A 4GWKA 3WNVA 4BGEA 1LLQA 1LI4A 4OQYA 3U5TA 4YB8A 4QO7A 1ZO8A 4J49A 4PIVA 3MJEA 4FDAA 3NT4A 3HADA 3ICCA 2X9GA 4AJ4A 1ZZEA 5THKA 3RFXA 4JBIA 3WQRA 3U4CA 3RKUA 5I7VA 3RAJA 3GMSA 3L4BA 3L6EA 3OM9A 1AHHA 2UV8A 3WQSB 1B2LA 2NM0A 3CSDA 1GQYA 2NU6A 3U4IA 3AOEC 3P5SA 4CMBA 3OETA 2GZ2A 3ZHYA 2PWZA 3DZJA 3QWIA 4IS2A 4KWHA 4ZD6A 2VHZA 5DOVA 2AQHA 2WD7B 2BMAA 3H5AA 4AJNA 3WYEA 4DVJA 1E3JA 4OKNA 3PLNA 3QSGA 1FDSA 1RM4A 1UJMA 5I9LA 4Q3BA 4AFNA 1XSEA 4DIFA 3ZWXA 3DFZA 1NQ5A 3H4VA 2J6IA 4XDYA 4DUPA 1E3LA 1H93A 3CMMA 3A1NA 4WEOA 3ZWCA 1WAMA 3G1TA 1K2WA 3ZV3A 4L74A 3MEQA 1ZW1A 1VL6A 1JN0A 1B8PA 2ZQYA 1ZK2A 4YRDA 3VTZA 1XDWA 2UUPA 2VT2A 3VPSA 2P91A 3RU7A 3PXXA 3UW3A 1Y5RA 5EINA 3FNHA 2NACA 5KJCA 2Y05A 4BMVA 1VSUA 1T4BA 1GPJA 1XQ6A 4LW8A 3ASVA 1LSUA 3ON5A 3INRA 4MVJM 3GEDA 4IMPA 5JY6A 4E5MA 4CV3A 2DT5A 5KIAA 1DHTA 2PZLA 4NBTA 1N5DA 2HU2A 3IP3A 2A9FA 1LBEA 1GZ3A 1XA0A 2VUUA 3ZWPA 1MUUA 1Y9AA 5ITVA 4W9NA 3KBOA 2EWMA 1IUKA 5A3VA 4I08A 3CH6A 3GK3A 3EUWA 1DBVO 2I5PO 6LDHA 3EDMA 1M6HA 3RASA 3AUAA 3H6KA 4M54A 5I7FA 3ROKA 4MVJE 1H9AA 2P9CA 1LX6A 2EV9A 1PGOA 3HQ4O 1K3TA 4R3WA 4HNHA 3NDRA 2PZJA 1DFHA 4RQUA 1T2EA 1HDOA 2C2XA 4RVHA 4CQMA 3QQPA 1LQTA 3RSHA 1I8TA 2P4QA 1YH3A 1LRKA 1Q0LA 2EF1A 3FTNA 3ORFA 4IQ8A 3WOHA 2B37A 4YJGA 3RC7A 3IIEA 3PIDA 2I3AA 4J4HA 2CD9A 5G2OA 5I9MA 3ZHXA 3E9MA 4BNKA 4CMHA 3ST7A 3OJEA 5TJHA 1NFFA 4FQ8A 3IP1A 1VE9A 4H15A 3BTSA 2E49A 4IXTA 4XD2A 3LT2A 4QX6A 4PLVA 1YVEI 3VDRA 1QYDA 2OP1A 4G5HA 1FDWA 2TMGA 1LQUA 1W4ZA 2WE8A 4UUNA 1G0OA 3LQFA 4JBGA 3WTCA 1DPGA 5T57A 4BO1A 1SNYA 2WYWA 5ILOA 4D44A 4A26A 3DBLA 3ENNA 1E1MA 1AN9A 3VPXA 4IQGA 1H6CA 4NZ9A 2E82A 1Z7EA 3ZWNA 2GD1O 2DFVA 1HF3A 3ICPA 8LDHA 1NQAO 3IC5A 1A7KA 3MWDB 3ZW9A 2BKAA 3KLMX 3Q6IA 3ROQA 4ALLA 1R0SA 2YW9A 1PJLA 1IY8A 1Z45A 3N58A 4RPKA 4Q3AA 1ZEJA 4CLOB 1E3IA 2Q1SA 3I9LA 3WGHA 3AY3A 3S1LA 4YEDA 4A7PA 3TFQA 3ZW8A 3W1VA 1KVQA 1UDBA 3O38A 3INTA 5IDWA 2OUIA 2FHSA 1DC4A 4GQAA 1DC6A 1NR7A 2UDPA
chains in the Genus database with same CATH superfamily
1KSFX 4J7XA 2ZBRA 1JDPA 3N86A 5CTJA 1G7RA 3C3YA 1XTZA 4G1BA 1XK7A 1JXMA 1TEXA 4ZVOA 4RVCA 1OBFO 2XX3A 3CEJA 5I5GA 3HNPA 2CDAA 3R9XB 3EWIA 4WZBB 2PWAA 4WOJA 1RDFA 4PLGA 1SUFA 4E13A 1OXSC 2VDUE 4IINA 1DUIA 1ZEMA 2A0WA 2H5LA 2X6QA 1DAIA 2PGXA 3KUDA 1ORWA 3G02A 4OH1A 3RU9A 3LC0A 3DOJA 2CHUA 2DTDA 3PUZA 2YW2A 4BAGA 1WKBA 2Z6VA 3BMQA 4P3XA 5JWRA 2GTIA 3DQQA 2H7XA 1QM5A 1XDUA 3BTUA 4J6FA 3FNRA 4YLEA 1QHGA 3BL5A 5IKXA 4Y9DA 3V4OA 3ZR4B 4PTYA 2Z5LA 4EJSB 1P1RA 1Y8CA 1A1SA 2R5NA 4MHOA 2D2EA 3WBKA 1N5MA 2IY8A 4HH4A 4TRRA 1MENA 2YQ4A 3W7BA 4ASUA 5KTTA 3I3OA 1ZNXA 3UJ3X 2WPDD 2QM0A 2D6FA 2O1WA 4ITVA 3T7EA 5EGNA 1IN7A 2FEMA 2JEOA 1C1HA 2GBLA 3TEMA 3R5XA 5C8YB 1K8XB 3R5SA 2Y2VA 2Y6UA 4PWYA 3E5HA 2P2NA 1GAWA 3KSZO 1DRKA 2NSHA 1I3MA 2A6PA 4WA7A 5BV8A 1I2MA 1ZH8A 3ECAA 2NVBA 1B4DA 3NVMB 2GJSA 4MWEA 5IPFA 4FI3F 5CEEA 4D4IA 2V9PA 4MQFA 2JAWA 4JLWA 3WQBA 3B70A 5FI5A 1IIRA 3FCXA 2H4ZA 3IIMA 1FFDA 3PTLA 3EPJA 4A92A 1DKLA 1OLUA 1BXRB 1M83A 5K2OA 4PYQA 1V3VA 2AMYA 3IJEB 2V0CA 3O7WA 5E95A 2JKYA 3QEAZ 1BWPA 5ALLA 4UUBA 2LBPA 4TKVA 4FOSA 1DKRA 2VRCD 2ZB2A 4RIHA 1YONA 2VTBA 1JWLA 2PS1A 4AICA 3N9IA 4WXPA 4KE7A 3I6MA 4O4IA 1NBOA 2I34A 4RIEA 1YB6A 1UJ4A 2XITA 2KHZA 3CSUA 3LQYA 3BHMA 4M46A 4YMLA 1FTNA 3CWZA 3O9ZA 1ZUIA 3QWBA 3NOQA 3L7KA 5EHIA 4ITUA 4MWZA 1ZK1A 5F7ZA 2D5BA 3USZA 4ARZA 1Q16A 2J7KA 4FDVA 2UXBB 1RPTA 1I0ZA 1FQJA 4A6XA 2VO1A 4O2LA 1VA4A 1XZFA 4N0QA 4G1VA 4B40A 1Q74A 2BKXA 2WWHA 4MICA 1OGJA 1O94D 1BX1A 2DQSA 3ANTA 3RYFB 4INOA 1GZUA 4LE1A 2K87A 5HTOA 1TX4B 3WMWA 4DA7A 4DDVA 1OIVA 1LTQA 3PFKA 1K8QA 2CVQA 3SKXA 3U44B 1GQSA 1VSVA 5IN4A 1E9BA 1JQDA 4RIGA 2O0MA 3M4YA 5FUVA 1XYGA 2FZEA 1KNXA 2IYWA 3BXGA 3DZGA 2H4JA 4P84A 4UOZA 1Z0ZA 3PFGA 3V7NA 2HT1A 5C1BA 3TSYA 4ZKDA 1IBCA 2IYSA 3PJFA 1KETA 1USKA 3RS9A 3OLQA 2ONYA 5G0TA 3S8YA 2RKBA 4R2HA 1ESEA 2JK1A 1F48A 4US1R 3TZ6A 4BNIA 3CLSC 1Z06A 2H2DA 1BVYF 1ZY2A 2ZJYA 4FFNA 5L3VA 4Q4JA 2W2PA 1J0CA 3KB1A 1DIGA 3EDCA 3EZNA 3R3WA 1XU4A 3GUZA 1EVIA 1IWOA 1P5ZB 2ZB3A 3D7RA 4EHJA 4QQRA 1HPLA 4PQFA 1Z12A 3VPHA 1NJ8A 4XFJA 3U39A 1KRWA 1CUAA 3Q4GA 2M2IA 5BN4A 3ILXA 1KQOA 4UEOA 1P4JA 3JQCA 4JIMA 3ZX4A 3K16A 2I80A 3RVSA 3U0BA 4E03A 1TCAA 4L73A 4YRBA 2CJXA 3OQBA 3R3SA 1FP6A 3GH1A 1Z47A 3NNDA 3OZGA 2BE7A 4G4SP 1U9YA 3WGYA 4FYXA 1JFFA 5KNBH 1QHHB 4YJ3F 4E08A 5HJ7A 3KFLA 5FUYA 3FTPA 4L1KA 4ZYLA 5H9WA 3PT5A 3OOWA 1CSEE 2JBAB 4Q47A 2AE2A 4Q37A 1J5XA 5C53B 2FMKA 2H4HA 2GN1A 4KPYA 4NBUA 2CW5A 3GAAA 1KHHA 5EHNA 2I7XA 1EK2A 1ZN9A 3A8TA 3HACA 3NYQA 4IMJB 4ME6A 3M4NA 4Q7MB 4G09A 1NATA 4AXXA 3ECSA 1U0NA 3W2TA 4F5WA 1A8IA 4EHLA 5T67A 4JL8A 2V5VA 1QDUA 2OMEA 3Q0IA 1E1RD 1JEEA 3R3XA 4KC0A 3VYVA 1PZHA 1T6YA 2JIPA 2P0AA 1PNRA 4U2DA 4AMYA 4B3IA 2DXIA 2JVJA 4XAQA 1EGAA 4Q66C 2HZBA 1ETUA 3H6HA 5DBFA 3ZG6A 3UJAA 1UF9A 1Z6YA 3FCCA 2O8FB 4EMUA 3JD4A 2P6UA 2DH5A 3AWDA 2OCXA 2ZKLA 2F9MA 5FUBA 2IOHA 3GG2A 3IE2A 4OXXA 3NHMA 1YZUA 4ZQGA 3G3EA 1UZUA 1H85A 4I5FA 1DT5A 4OLHA 5C8VA 2OVBA 1OI2A 2RJNA 2VWGA 4OYYA 1NONA 3K0FB 2GI4A 3CV3A 3E1KA 4KQCA 4IRXA 3ILVA 2A4KA 2EYUA 5F35A 5AT1A 2AN3A 2D00A 3PLRA 3ADKA 1PRYA 3PC8A 2K7ZA 3ZZUA 4UKDA 3IR6A 2J0QA 1I2CA 2HBQA 1ILEA 1YS1X 3F2IA 1O6ZA 1PFYA 3E82A 3P9NA 5AQ1A 1V4VA 1X8JA 2AR0A 4PZUA 1Z2CA 2X2EA 1UKEA 2FSVC 3E81A 1YC2A 2KX7A 1A71A 4IGKA 4LMPA 4MI1A 2YZMA 4X92A 2HWUA 4M1MA 4I1IA 5FFFA 4J43A 4Z51A 2VWHA 2WM9B 1MEEA 4B81A 2BGKA 4XPZA 1SY7A 2D59A 4OXRA 1CS0A 1DRWA 4PRZA 5E2AA 1B42A 3HGTA 2GPAA 3ELWA 4H6VA 5EPEA 4UPEA 2DUMA 4CETA 2Q21A 4KJXA 2DWPA 1EAMA 1IN1A 4URFA 3MQ2A 2BM1A 2I4IA 2YV3A 3OQIA 3VSAA 2ZI9A 3TKAA 1C41A 1ULSA 5CIYA 3QG5A 3QFHA 5CGQB 3WB0A 3HB0A 2REQA 1IQ0A 1K6IA 3O8NA 4HB3A 5D85A 4N7RA 2FYTA 3I9FA 1KDTA 3JYQA 4XWGA 5LYJA 4XXHA 5KYVA 4C4YA 5FV4A 5HP4A 3BMQB 2AYYA 2F9LA 3CLRD 3UQZA 2VJOA 2BLNA 3WL8A 4HNTA 3OBIA 1V4NA 2NLOA 2VAPA 1LWNA 2FW6A 4G4SO 2L0XA 4IIVA 3THRA 4BLPA 4RHXA 3QOXA 5IKMA 3WO0A 3HJHA 2BFMA 2VRCA 3GIDA 4RH3A 3PTAA 3ZV4A 1B0PA 1R0KA 5K3CA 4MKRA 1E3TA 2VP4A 4H7KA 4Q15A 1N8TA 5DTIA 1BN6A 2XUKA 3Q41A 1Q6ZA 1DQNA 2ZVQX 4HRAA 4RKWA 4CHGA 1NQXA 3WIOA 4KL8S 1UK8A 4EGCB 4CMIA 1LC0A 2IEZA 1XZBA 5F51A 2R6R1 1SVIA 2B5OA 3FJ1A 5CLHA 4U7DA 2XB2A 1KK2A 1NBWB 4ISBA 2HA7A 1K8RA 3ESBA 1O95D 5DYNA 3LKVA 4EYEA 3H1AA 4JBLA 3LF1A 3WWPA 3EXAA 3OM1A 1FUUA 2Q7XA 4CMKA 1KZ4A 3ND6A 1PK8A 4HQLA 4R84A 1H2YA 5I5EA 1SCDA 4UARA 1NJFA 3Q88A 1IU9A 2L17A 4X1YA 1XELA 4QJ4A 5LP6F 1JVSA 1VG0B 2FSHA 1PJAA 2NSYA 3BB1A 3MJDA 4KXFB 4Y98A 3EW7A 2HF9A 3ZJ4A 4M0CA 4R8VA 5ENZA 1H1DA 3C1OA 1P2BA 2I7TA 2GZHA 4XX0A 2C8KA 1RJGA 1T6ZA 4QUJA 1E3MA 1XROA 5IM4A 2RAPA 5G4LA 2ZRBA 4NU5A 1RWXA 4OREX 2MSDB 4RS4A 3V3TA 2JFFA 2GUGA 2QROA 2CUKA 5BV7A 2HL6A 1BYIA 4DVGA 4R69A 2IDKA 3ILYA 2XF8A 1BCSA 4RS3A 1JW9B 3WSVA 2VHVA 2DPMA 1JAXA 1MLDA 4PLWA 3IERA 5EE1A 1HDGO 1Z3CA 4Y9SA 3IBSA 2WTAA 5CMLA 5E7IA 3RC2A 4MCIA 2OO3A 1Y3DE 3UMCA 3ONFA 1JNXX 3IGFA 1CQPA 1KYQA 1H5UA 3QHAA 4NWIA 5KHAA 1IMJA 3LBNA 2JGFA 1MOPA 4A16A 3AFGA 1QAMA 3MJFA 4HATA 2W2LD 5FOXA 4QJIA 3K9GA 5IH7A 1BNCA 1KEZA 2QQ0A 4AJKA 2Z3WA 1DQSA 2RC5A 5EJIA 5LUAA 4K46A 1KY3A 4CCSA 3G0IA 1TJNA 3QP9A 2Q5FA 3HJFA 4D56A 2GAOA 3GZTB 4YRGA 1GCIA 1NI3A 1TU3A 2I3ZA 5JRJA 3SC4A 3J80A 4UOQA 1NN0A 4NJMA 2W2XA 1BVRA 4S1OA 4AAYA 1UT8A 1ULHA 4X94A 4GMGA 2P9QA 3KL4A 4B33A 5B6PA 3A4VA 2ZRAA 2OWDA 2QAIA 1JVBA 2QSJA 1MC4A 2IXAA 2O1EA 2QN9A 3PPVA 4LPSA 4AD8A 1WETA 2OYCA 1RNLA 3RODA 2EERA 4DCUA 1NNEA 2QBYB 1BJRE 1SCUA 2R8XA 5HOEA 2EFHB 3PX7A 5EOVA 1JDTA 1PLKA 5DH9A 3T9DA 2XUZA 4G0VA 1WEHA 2C1ZA 3BTVA 4YUVA 1XTTA 3SG0A 1XCPA 4OXQA 4QT0A 4QEDA 3WDSA 3L6RA 2BBWA 3GMDA 2F3RA 3LQRA 1E4EA 3PC7A 4PW0A 2BM9A 2X8JA 1G19A 3I9OA 3AZQA 3OA0A 3RM3A 5FI3A 5LDGA 1Y8AA 3WLTA 1ZGCA 4IDNA 5LSAA 1RVV1 4A73A 5I7RA 1X1EA 4QU0A 3AF3A 4U8GA 4YBZA 1FX0A 3D1JA 4QRHA 2SCUB 5A04A 1QFJA 1EGHA 3ILSA 1EDEA 4YUAA 5JJCA 4CT5A 2GN9A 1HGXA 1XD9A 2K2WA 3GBVA 2PVCA 3DM9B 1C4KA 2HCJB 3H7IA 5D5HA 3ZDBA 1GSOA 2GCIA 2PV0A 3G23A 4UXJA 1D2HA 1UPTA 2YZKA 5FB3A 2I87A 4CHTA 4JI0B 3GDGA 4JZYA 5LLTA 2HA6A 3D1LA 3UUFA 3WGMA 3H5RA 5BOVA 2AVNA 1DEXA 1W0JD 4H59A 4PX5A 2WF7A 5CM8B 3KEQA 1A7JA 2QTNA 1TRKA 2ZAGA 3V4FA 4BV2A 2OFFA 2AL7A 1HV8A 1PTJA 4ZU3A 2O8FA 1AGXA 1D1PA 3ZWWA 3KWMA 2A0YA 3KZNA 3CLTD 1TQ2A 3V2IA 2PRYA 3DKPA 3OI7A 5KREA 1XCBA 3L1IA 4WSOA 4CT4B 3RVPA 3SLRA 4DXDA 2WR8A 1R12A 2ZSKA 1RXSA 3BS4A 3AF4A 5EQFA 1YT5A 1SOVA 2H7CA 2VDLB 4P98A 4NZNA 3KNZA 1QBKC 4RH1A 3RC3A 4CG2A 4DV6B 1A4RA 3E3OA 4PLTA 4ZEOA 4XWTA 4N5NA 2YYSA 4F5ZA 3MGGA 1D03A 1VIDA 4E09A 3G2IA 2QRPA 4C4ZA 1P0FA 4BO9A 5EJMA 1WULS 1SZCA 4RK5A 2ZJ2A 3NRJA 3F6RA 2LNDA 3FGPA 3RWMB 1TLFA 1HKHA 5TGDA 3RV3A 1JH8A 1ZW6A 2EJBA 1UZAA 5B36A 3QPUA 4C07A 4AYWA 1F4VA 5KTRA 3BH7A 4MRPA 4JB2A 4CL3A 4ZQHA 5LQNA 4ENPA 2QMOA 3JWIA 1PWHA 2PGNA 1YO6A 1C0LA 2AA3A 1ZM4A 3JQ7A 4FLEA 3OJCA 2NXEA 4QOFA 5A9SA 1Z18A 2PX6A 1B0ZA 3L4SO 1C29B 5KKAA 5E9AA 3T4XA 5DGHA 4HC4A 1U65A 2ZWAA 2RHCA 1INLA 3HZOA 3LC1O 1LPNA 3QLUA 4KAFA 5LQSA 3ZWOA 4RGYA 3KVOA 5B30A 3IALA 2CZQA 3A1WA 2VOJA 1APBA 2I7CA 2XB8A 4ER6A 2POQX 4YRLA 3JY6A 4O4IF 4S1PA 1U7UA 2CNLA 1UDXA 2VF4X 1QKKA 5JC8A 1W2GA 2PGIA 4LK3A 1U1FA 1S2DA 3M6XA 4URZR 4CKCB 3EEYA 5L4LA 3D3EA 5DU2A 1YNSA 2JHPA 4LBVA 1T9DA 2DY0A 4QXPA 1ND5A 3IUBA 2XJ4A 3W5HA 3TXXA 5B12A 3SHOA 3DDOA 3OIUA 3QMWA 4PHFA 5TR9A 3DOUA 4E22A 4F6RA 4IY1A 4RULA 1OAKA 1W94A 1SB8A 2QRLA 1J97A 2EU8A 2HRCA 3HV0A 2XWSA 3OQVA 4IH4A 4CDMA 1P77A 5HEKA 2W71A 4K6MA 3ZY5A 5DLQC 4ML3A 1N9ZA 2R8YA 3INNA 4TKMA 3MAAC 3U4MA 4WQMA 3GVHA 3DDSA 1ZMBA 1B1CA 2FMHA 2R86A 2X7XA 3EGXA 4DDWA 5JS1A 3GFBA 4E4YA 1RCUA 3C48A 3OZRA 1G2PA 4R1LA 4UM7A 5GINE 4F92B 2Q2QA 1ZQ1A 3KR1A 1CNEA 1JSXA 2E48A 3ESZA 5AKKA 5HCUA 3ZLBA 3EH1A 2WA2A 4K1XA 4PLCA 5K0GA 3JATA 1N2IA 1XLTA 3A4MA 3ILHA 4TMZA 5T4EA 3TDKA 1UJ5A 4N01A 1B26A 4UUQA 4UZSA 1IOZA 1LPAB 2FWMX 5IJ0A 3NIDB 2R6ZA 3C7TA 4MP8A 1G3UA 4J90A 1DCMA 2B94A 2FPLA 3G2QA 1C8VB 3QUSA 1O0SA 4Y2XA 5HCIA 4E32A 1U0GA 3BN3A 3C4QA 3AW8A 1ATZA 1SOMA 1DB3A 3QLJA 3L8CA 4DSTA 5B57C 4JP2A 3E5RA 5I3ZA 3QKWA 3F49S 5I4KA 2QD1A 3LZDA 2AFIB 1SBHA 4UOEA 3GQBB 2BFFA 4Y0VA 1GUYA 5CJJA 3KQOA 3JQFA 3TQRA 1Y6RA 1E1RA 4CR6A 1FP2A 3UMRA 3RS2A 1VLLA 2IYQA 1NPTO 2XNCA 2LDBA 2O3QA 2XA1A 1HI9A 4P83A 2COEA 1Q0UA 1XQYA 4MA5A 2Q5OA 1F2TB 3ZBUA 4KN5A 4IZHA 3AV3A 3B1KA 2NTNA 4XZ3A 1KZYC 1X7WA 2G9QA 2R7MA 4WTOA 1U8UA 5I9TA 3VV2A 3PYXA 5BNTA 4G86A 1PX0A 3CYFA 2A5FA 3JTEA 3MWKA 4R1TA 5AXBA 3SHFA 1E2LA 2F2TA 4RCVA 3K0SA 2C9OA 2OZPA 3LQQA 3T12A 3DZKA 3HXPA 2O2CA 2YIMA 2W2TA 1RYEA 3ZV5A 1BA2A 2AS0A 3OCXA 4QVGA 4D99A 1UINA 4P4TA 1KH2A 2ZLBA 1Z6XA 2ANCA 2ZB7A 4HI0E 2ZTMA 4PO8A 2NU7B 3KVYA 1KFEB 2JJ1A 3FHLA 1XK6A 4E2FA 5LLDA 4L27A 3B1YA 2JJ1D 4LRSB 3WK8A 4DV7B 1ONPA 5H5JA 3F7NA 4PIPA 1UBLS 3SHVA 5KSWB 3QXGA 2X2FA 1TQ8A 2YY6A 2ZP1A 4CODB 5A0VA 2IHBA 1MXFA 1OAOA 1SCBA 2M9MA 5DT2A 4IOMA 1NJGA 1XIVA 2F1OA 4DIOA 2CN1A 4MV8A 4TGLA 5LJIA 1H2XA 3GROA 3ISTA 4HX9A 4R7ZA 5DIFA 3ZU5A 3TXYA 4RYDA 4E94A 4B4DA 1NQVA 2C84A 1R2QA 3WYNA 2I78A 1OF1A 5DXFA 5KOYA 2PGJA 2YH2A 3D6NB 3R3HA 3FMGA 5KYNA 4MPTA 4Z1MA 2C2WA 3HO1A 1X1DA 2HLHA 2QTWB 2Y1LA 5FBQB 4XUCA 1PG0A 1CZLA 2G6TA 4CR8A 1U0EA 3E3AA 3M2TA 4G85A 4KZPA 5BNZA 4XYEA 2DSNA 3KE8A 2UKDA 1N6RA 3UHAA 3OX2A 5L4NA 1CRZA 4D0LB 4M7OA 1TQ4A 3DL7A 3WGJA 1CHNA 1T3HA 2NO5A 3DCJA 1TKCA 3FRHA 1N32B 2IPAB 4KPUA 4M1QA 2ZRPA 3SQMA 5CXQA 4U63A 3IE0A 3M9XA 4DADA 1GKIA 4L75A 2FVXA 2O8VA 4EI9A 4B3RB 1XVUA 3CX6A 3LT1A 4LJYA 2PD6A 5A4IS 5IANA 1N2OA 4Q1BA 5EEGA 5BR1A 2AG0A 3AT1A 2JPDA 2ZU6A 2AJ8A 2O5VA 3JVEA 4KPFC 3ZXIA 4DZTA 2ALJA 5C8DA 4KR2A 3WNCA 4JGIA 3ND9A 5MGBA 2Y1DA 5LOVF 2PQ6A 1EFKA 4G07A 2G80A 5AICA 1NP6A 1DXQA 1I5EA 1M34B 4R1UA 2DHCA 4FDMA 3H9UA 1Y48E 3E4DA 4TWZA 1RSZA 2A8YA 1OA0A 4AZSA 3M82A 3QPWA 1JH9A 4Z6KA 3PKZA 3L8GA 4W5QA 4BP1A 1AUVA 3WSWA 4ATNA 1AUPA 1SN7A 4MYTA 2JLCA 1PGQA 5CLJA 1OILA 1QG6A 1SBYA 2C8VA 4QXMA 2YVLA 4TYPA 1JYFA 5L3RA 2H1VA 2IYLD 3OLXA 2ODQA 2H1FA 4ASUD 3V2GA 1T3TA 4WT7A 1SUSA 3K6SA 1GUFA 3RRJA 3GJYA 1RHQA 2JAOA 4R2XA 3IPLA 5AJXA 4ZEVA 2WIFA 5JDCC 4Z4QA 3ESXA 1EDOA 4GZLA 3AINA 3S2YA 1KI2A 2FZWA 3MJHA 3TUJC 4HUTA 3WB1A 1NJ2A 3L8HA 1G20E 1JYEA 4ZT4A 4S24A 2BSQA 2JD1A 1AN0A 3E2MA 1GPKA 2SBTA 4FMDF 4QSHA 5C7LO 4LWQA 5JLJA 3I4FA 4AQ7A 5HTKA 4RSGA 3I32A 2DTEA 1OFUX 1K7SN 2F8TA 4BNWA 1XEWX 5JI2E 1DKQA 3K5PA 4MW9A 2D7CA 2ZBPA 1E6KA 4FMDB 1HWYA 2PUTA 3UMGA 4EY5A 3TJRA 2O54A 2NZJA 5FV7A 1D6SA 3E23A 4R1NA 1X42A 1M9NA 4OGKA 3TL6A 3CLUD 3L6OO 1XPRA 1U8XX 2P27A 5KPDA 1XA4A 3L92A 2OSVA 3BSWA 1LY1A 4CNQA 3GG9A 5JSZA 4CDNA 1V96A 2AZ4A 1C80A 1QG0A 1QIDA 1V8PA 2DUJA 2V4MA 2V6BA 3C41J 3GLKA 3ZD8A 2UYHA 4EENA 3FPCA 2AMVA 3GEIA 4Z3OA 1IPFA 4F1JA 4CTMA 1KFJB 5JXWA 3GPDG 5HJEA 3IHKA 1VECA 4D3FA 1MO3A 1W49A 3IQDB 1Z62A 1QFXA 1G20B 2J32A 4IH1A 1RKBA 4IL5A 4EKGA 5B6IA 1SHZA 2D1SA 2OT3B 2GJKA 1V8BA 2IITA 3EQ6A 3LYHA 4V3BA 4DLBA 1AS3A 1SG6A 1WP4A 2PWYA 4NPCA 5EJ2A 1O5OA 4PX3A 1NUSA 5A0FA 3ZEAA 4BASA 1BU8A 1QKIA 1WEKA 3S8MA 2XE8A 3D8SA 2G8LA 3L01A 1N8NA 4EELA 3LWBA 3ZE2B 2B5WA 4DJJA 2ATIA 1MB9A 3JWEA 4GNKA 1Y1KE 4E5DA 5BRJA 3EQZA 2ZUVA 4QDKA 1IHPA 1JT2A 3B6KA 2GKSA 4N6NA 4KNYA 2ZI7A 4EJFA 2GILA 5JH7B 3AX6A 4Z9XA 3ZNQA 5HBGA 2RAUA 4ZQBA 4JELA 3KB2A 1E77A 4M4SA 1EM8B 3C3JA 1YE5A 3KQWA 1SEVA 4GS5A 4Q93A 4QTTB 3FZGA 4FMBB 4RF2A 4DMMA 1EXDA 2MR5A 3CR8A 2BEUB 4LY9A 3E22A 3HV2A 4D9IA 5CVEA 2F1JA 4ZV7A 4JR2A 1C9EA 3Q2IA 2CJWB 1Z56C 4Y2RA 2FH5B 3LLSA 2JFPA 5I7UA 2F1HA 2ZS8A 2P9JA 1ZVMA 4F9EA 1B0AA 3TLXA 5HQTA 5DHFA 3C8HA 2PKQO 2V4UA 1EUCB 2E4XA 4QJBA 3U7EB 1B1AA 2OG1A 4JGBA 3RUAA 3IX7A 4KBYA 4TTIA 4MUAA 4F45A 2V6GA 4L4SA 1RWMA 6AT1A 1I7QB 3BVPA 2JFHA 5GZ6A 4BAUA 3KSRA 3V00A 2D1YA 3C70A 2Y71A 3AHJA 2XGMA 3WLIA 2BP7A 3MFQA 2H51A 2DWCA 4BQOA 2CXSA 1TZBA 5BYAA 2JF0A 2WEKA 2VK8A 1KJJA 1QYWA 1OASA 5DBIA 2UAGA 3NV7A 4HN9A 3E9RA 1LZKA 3NQ41 3FFWA 4BNZA 2IYYA 3EXFB 3NRCA 4DF3A 4I46A 2C7RA 4QQKA 4M53A 1B41A 5KYYA 2XHEA 2XTNA 1PTKA 4BKPA 1KS2A 1G1AA 2JJ2D 5AHKA 2WHEA 5H1YA 2JLBA 1P75A 4BB0A 4CF7A 1CJCA 4Z4HA 3C3EA 2XT9A 5MN4A 3A6FA 5FTMA 4BLRA 3ZOZA 1FRVA 1BE0A 2QL6A 4NYMR 2WJZB 4YI5A 4HDSB 3O1IC 1X70A 4WOPA 3EIEA 3HA5A 5EESA 5FUQA 3IT2A 3AVTA 1UP6A 3A9UA 4F2PA 2WB2A 3JD0A 3ML1A 5CFLA 4UW9A 4R5MA 4Z5XA 3W8NA 4R8LA 5DM4A 1FFGA 4OGGA 5TJ9A 4EFKA 1YVDA 1IHDA 4RK4A 4RPJA 5MFZA 1YSCA 1OH7A 3TH5A 4ZI3A 5ISMA 1EHYA 4AWXA 2VNSA 4LG1A 1KC1A 2A7XA 2XUJA 2J5XA 3B5JA 3RUDA 1W36B 4ZYXA 3PEWA 3ABQB 5ULLA 1TD9A 4R3NA 2PNJA 4CL2A 4OD0A 1U0SY 4EY8A 4ER7A 1MDBA 1WXGA 1SAYA 3GEHA 4Z99A 1WW8A 3STHA 5LCXA 3QFFA 5EKXA 3COPA 3FG9A 3WHPA 4DCPA 4P3YA 2GCGA 1X80B 2ACVA 2GGSA 2CJFA 2VBFA 3NJ4A 3TZLA 5A3RA 2WC1A 1GFZA 4H7PA 3O3OB 2PRIA 1GRQA 1RJ9A 2FOXA 1RAAA 1T13A 3D8TA 4AMGA 1ZKMA 1H1LB 2WKPA 1VPWA 5JCZA 5LKAA 3IUSA 4XJTA 1KYWA 2AFIE 3MIZA 4TT8A 4TOIA 3WY9A 4C05A 1WMBA 4LZAA 3RFFA 2MJLA 4DOMA 3HP4A 4TVKA 4R2IA 5EGSA 1IZ9A 2HMVA 5G0WA 3TFOA 1VIYA 4JMPA 1BJKA 4GKAA 2G5TA 4I5EA 4XASA 1GG9A 3NX4A 4KVAA 3TLMA 3O8BA 4W1SA 2XYVA 3OM8A 4F4UA 3L8EA 4AB1A 1WU7A 1NURA 4O02B 4PLHA 5K03A 2VHCA 2Q45A 5CYGA 3TD6A 1J5PA 5B2FA 2YR0A 2B4TO 1QV7A 4O4JF 5EKDA 3TRKA 4TKUA 5G0SA 2VL7A 2XVXA 2H92A 3AR8A 3FMVA 5HZHA 1OX4B 1DVRA 2OUKA 3F6SA 2R00A 4NJOA 1PWZA 4F9FA 4OHOA 1GY8A 2CCKA 5IC6A 1AD2A 3QPBA 2JHCA 2W6IA 4XD7A 4AUMA 3AM4A 3LPNA 2O9JA 1X7DA 3IUPA 1USIA 2JANA 3DLIA 1LRJA 2I3DA 5E6UB 3LOUA 2NO0A 1IDN1 4DSAA 1N57A 3B9RA 4ZO7A 4QT4A 1O03A 4GZ6A 4IHJB 3ESDA 3EARA 2O3SA 1O6GA 2P2CA 3FDZA 1Z0SA 3AFMA 3EODA 3NGMA 5FIUA 1TVEA 3DPIA 2AG1A 2JFWA 4QBFA 4QDUA 5M3BA 2CLMB 2PQ2A 4LDJA 2VYVA 2FN7A 2NV6A 4H17A 3A1CA 3X1WA 3QOWA 3ASZA 2HPZA 2P4UA 3G6WA 4P38A 5HIAA 1QHFA 4YIHA 1XEXA 4DZRA 3EXG2 4JEHA 2HWKA 2VSYA 1SRQA 2OCDA 2PBRA 3NOVA 1AO3A 2IEIA 3LIPA 2HQRA 3QVOA 5I7HA 1N6OA 1AKNA 3PGLA 4G4GA 1X9GA 5SZKB 3EJWA 2Q0SA 1JIJA 4OEHA 4J7UA 2Q07A 4OI0A 4ZVTA 2DBQA 2I6GA 3PGKA 1BEZA 4RDXA 2OHJA 1D2AA 3LYAA 1JZSA 3ZQ4A 3QE9Y 3TG2A 4EPVA 1MO2A 2X23A 4FSHA 5FNVB 3UYKA 4DM4A 3GLQA 3SEAA 2XT0A 3H17A 3NDPA 4J1NA 1DC8A 2CMHA 4EPTA 2ZYTX 3H83A 1SUEA 2X8AA 2XLCA 3PXAA 1HQYE 3IQEA 3QEKA 4P7KA 4TN5A 5CNMA 1XHEA 2J0UA 4QEZA 4YQYA 3JR7A 1JXQA 4DPLA 5FJIA 5C32A 4MRSA 4ZI2A 2CXUA 2G71A 1SPXA 3BXEA 4RHCA 2PMCA 1SKMA 3M2PA 4L5CA 1NSFA 1MFPA 2I3GA 1J2EA 2EKDA 5EIEA 3PHLA 3WXMA 10MHA 3S55A 2G8NA 3DR5A 2IS1A 2BEUA 1PZNA 2CFOA 1U11A 2KW5A 4P22A 5KVVA 1ODFA 4UNQA 3DWEX 2WABA 2VSOA 5KTMA 4IO0A 3KM0A 2WWYA 3CRRA 3G8CA 1A50B 4FEEA 3CUWA 2O8EA 1EQ2A 1M2GA 2AXQA 2OHIA 3CEHA 3EEFA 4IX1A 1OTXA 1FK8A 2GR9A 2NX2A 2W0MA 1EFPA 4OJTA 4ARCA 4ZVLA 1X14A 1AF7A 1Z6QA 5FA5A 2C3YA 2A92A 1TYCA 3KZKA 4RW0A 3GGSA 1ZXXA 3PNSA 4FKBA 1DWUA 3GLGB 1Q1EA 2JI4A 2ZYSA 3LY7A 3FOCA 2WF6A 3WIEA 4JQCA 2LGJA 3G88A 1QG4A 1T3GA 1XN1A 4OAQA 4J2HA 4PC6A 4HS9A 4XVQA 1XMSA 1JIXA 1G3MA 1Z5PA 3SY8A 3WDKA 4ND5A 5LQUA 5DP2A 5H3LA 1U4SA 3NBQA 3AVXA 1W59A 3UKOA 1E7MA 3NBAA 3L79A 1LPPA 1XQWA 2C3UA 3M4JA 4DWWA 1KDPA 4PAQA 4YCSA 4YYZA 4LYJA 1YVPA 5AKEA 5B58C 3AM3A 6GPBA 1FNMA 5HSGA 5HVNA 3EF1A 3EXFA 2F59A 1AUOA 3A4TA 3OPXA 2DSTA 4EB6A 4CN9A 2VYQA 5ERYA 1N25A 3VPBA 4OG2A 1E98A 2TSYB 3VKVA 1XZKA 2OGUA 5J4VA 4DKJA 3DAPA 4WCDA 3TLCA 4V24A 4MR9B 1IAVA 1CZNA 2DWOA 3WIBA 4FU0A 1COZA 5KS2A 3HUUA 1JG7A 3LX8A 3DDCA 3HSKA 1BIFA 3WKDA 2E6UX 2IYPA 3ZQKA 2C2YA 3W3ZB 2CXTA 2VWPA 4ND7A 4YH1A 4G56A 1C30A 1O77A 1ZGAA 3SZLA 2IA5A 2LR0A 2ASEA 3BL6A 1NZDA 1EE9A 2IZ0A 3FSGD 3U09A 4OXNA 1IWPB 2JBWA 1XRSB 1LBIA 4M8SA 3B13B 1D7AA 4PSKA 4Y6SA 4YMWA 4F8EA 4ZZ3A 3ZJUA 1JBEA 2BMEA 2Q5LA 3EWAA 1G59A 2IHVA 4KDRA 3VDMA 1ISHA 2AKYA 2ZJ6A 4Q00A 3PC2A 4ENTA 4PM4A 1XZLA 2EHDA 2W8ZA 1WUIS 1G21E 1Q1QA 2HMWA 1R00A 1CQWA 2FZVA 4GPD1 1KEUA 1XLTC 4IHKA 4MIOA 4R9RA 4RKRA 4UAUA 1ZIPA 1EZ1A 2XECA 3MCWA 4OLFA 4TN1A 1Z63A 2HHAA 3CLSD 3VJMA 1Y9JA 3WGGA 1TZCA 4KAAA 1HUQA 2ZWPA 4KIWA 5DMXA 3VZDA 4MYUA 2YRFA 3G0GA 1DINA 1G5PA 4HAOA 3A6LA 3FOWA 1M1YE 1QVVA 4HJRA 2JRLA 2NT3A 1QE5A 2YUTA 2XWQA 4PHTA 1KE1A 3PR2B 1HEYA 2WHXA 3BF8A 4OUDB 1XZMA 1CVRA 1W4AA 2BJHA 1V5GA 5EUMA 5HFJA 5KOHB 4KI7A 1A9XB 1S02A 1S9DA 3FCYA 1VGVA 3NB0A 4EI7A 4PRLA 2VLBA 2F3SA 3F5FA 4N3NA 3O0TA 4WECA 1SRRA 4QUIA 4BNHA 3MOIA 4F2GA 3E3NA 2EKZA 1SOAA 4G81A 3ABSB 4PGGA 1P74A 3K3PA 2FGJA 1RZVA 5AKHA 1CIPA 4PHGA 1ISSA 1SU6A 2CK3D 4PICA 2H7VA 5NULA 2F43B 1FFYA 4B09A 3QUQA 4LCEA 3H42B 1Q1ZA 1ZZGA 2J87A 4DA9A 5A6SA 1TC1A 4X44A 3FZEA 3K4PA 2PUHA 5IZCC 3EUAA 1KEEB 4DPMA 1KOGA 2O57A 3K9BA 4KLRA 1CQIB 1QIHA 4GUDA 3BKXA 3SYMA 4ESVA 1RADA 5JJKA 1AG9A 3RS0A 3R0QA 4TLAA 1UPBA 5DB4A 1EWTA 2MT9A 2H1CA 4DR4B 1FDVA 1ZM2A 1B3RA 1M8GA 3GXOA 3GZ4A 2VT6A 3SX2A 2XMPA 5JD6A 1I5RA 1YCDA 3QWFA 4KWTA 3DTVB 4KWCA 5FPKA 3EC2A 3S2FA 5E6SB 1ENZA 1Q7RA 2WY2D 3R0JA 3IAXA 5FPHA 2HA5A 1NM5A 4B47A 3OZVA 1AKEA 2XMGA 4R81A 1P6XA 2JC3A 3LUFA 1CD5A 4DIDA 5JCXA 2QZZA 2EARA 1Q0QA 2ASVA 1I1HA 4DPKA 4KR3A 3M6IA 3ES9A 2IZ1A 4RM3A 3MTAA 3T7CA 1O97D 2XXBA 4BTLA 1Y4AE 4CM7A 4LFCB 1OLXA 4ARAA 8OHMA 5GVSA 1L4MA 1R74A 1PBTA 3CHYA 2Q8NA 1EIZA 1XTPA 5EXDA 5FBHA 3R7LA 4V2UA 4D82A 5DNWA 3K9NA 4PNPA 1GL9B 2JAQA 1LU9A 3E35A 3PXBA 2D5CA 2X2PA 1AHPA 2QT1A 3GLIA 5KSZA 3IBCA 1U4OA 4X20B 4JWKA 4M1YA 4L4RA 1RZUA 2BF7A 4OJQA 1CCWA 4Q02A 2AIRA 2OXTA 3RT9A 1L4UA 1TXGA 1TIKA 2YXBA 5JNRA 5KVCA 3LRPA 1Y42X 1VG8A 2O2DA 4RPLA 4OL0A 4YTEA 1FDIA 3ENWA 2R00C 2YBEA 2ZCUA 3GRAA 4S0ZA 3RYIB 1ECJA 2AG6A 3DO5A 3A9CA 3N8GA 4ZXPA 3SEFA 5DM0A 1GA6A 1YOVB 4GPAA 5BVGB 1UPXA 3QX9A 2B35A 2WICA 1NNSA 4CIYA 4GSKA 1ANKA 3BM5A 2Q3EA 2WVAA 2XVMA 5D01A 1PV2A 1U0JA 3KC2A 5C8ZA 2I6FA 2I6XA 3AKEA 1XRMA 3AFIA 1CWUA 4LJKA 5DCYA 3I1IA 4MV1A 4TQUS 1YU6A 1GZSA 4UJ5A 2QVXX 4BJ1A 1ZX1A 4LFBB 3GFQA 2X8WA 3JW8A 4PHCA 3HBFA 3K1ZA 3NASA 2OCLA 2AVDA 3KSDO 2HWYA 4HXYA 3AVVA 2YVUA 1UJBA 5CBKA 3AM5A 4A2CA 2OCYC 5A0TA 1IHOA 3R20A 1TF5A 3V97A 3RSZA 3OZTA 5E3JA 3EUFA 1DAFA 2UXCB 4ZTBA 1DPFA 4QGHA 3KV1A 4RTSA 5EJ8A 3T38A 3OZSA 1G8JA 1H8HA 2PV7A 3CONA 4XM2A 3ZQUA 4HGPA 1E9SA 4OAOA 4KWEA 4YVFA 4F4HA 5EP1A 2XA2A 4JQZA 4B8YA 3NHAA 3GFGA 4X1KA 4A8PA 2XTZA 2JI8A 1FMJA 2PY6A 3ZVLA 4DILA 2Q9UA 3AUJB 2R44A 4XDHA 4MMZB 1OLSA 2A4MA 2WFLA 3VGJA 2ZS9A 1SQSA 5LBIA 5EJGA 4J1TA 4RZQA 1L5FA 4MS1B 5AI8A 3R7DA 3F6EX 1ZU4A 2FMXA 3UXHA 4PPGA 4N47A 1E1YA 1U2RA 2BI8A 4BMNA 2R79A 3A58B 1QH9A 1D09A 2VLIA 3AR6A 1DKOA 3KPYA 2AW3A 3AESA 4MKIA 2DRIA 5IBCA 1VRWA 3IPXA 3DBVO 4KR7A 1TZ2A 3R0VA 2Y1XA 3MD9A 3NEYA 4XJXA 1OFUA 5ELMA 1FP4B 4Q4CA 1KEPA 4YT8A 2HREA 1EHCA 1R9JA 4MQFB 3JASA 5CRIA 1S2MA 4OIFA 3EQ8A 4B3JA 5SYMA 3I0NA 4N5IX 3ZXUB 1HQKA 1Z15A 3NHUA 4JXZA 1QIMA 2QPTA 4RV9A 1K88A 3BJMA 4ZAZA 2YS7A 5JZMA 4HTAA 3AY6A 3LUHA 5AI6A 5I4CA 1J70A 1K68A 5F78A 1HNNA 2A33A 1F6BA 3SJZA 1MT0A 3ELBA 4TKVB 3GPCA 3P1JA 4NK4A 2JLYA 1Z6GA 4NOJA 2G36A 3DZIA 1J99A 3BBLA 5FBWB 1U3TA 4I5IA 1DO2A 1P45A 2PGDA 3GJ5A 5K0LA 4C4RA 2SECE 1KVTA 3O8OA 3AKDA 1BJTA 1I6WA 5KC9A 2ZVJA 1ZCAA 1XCJA 4LZPA 4LJAA 4TKZA 2FPPB 1Y6GA 2B69A 2FUEA 5CU7A 3JALA 4TLEA 1Y1QA 2OE2A 3V4LA 1YIOA 1JHYA 1W85B 3PWZA 1M72A 1SXJD 1RHKA 3FFAA 3MCZA 4UMEA 1AA6A 1G64A 2DFNA 4MV9A 4QULA 3X44A 1SQFA 3EDOA 4AO8A 1T36A 4UQLA 3A1TA 5KMGA 4HDAA 1UPUA 4NJEB 2CUTA 3K09A 4BNLA 1Z08A 4JT9A 1QDLB 5TS3A 3PK0A 3PDHA 1YQ9A 3W4IA 1UKVY 4GM0A 4S1WA 1FYXA 1WDKA 3ZLVA 3FBTA 4NRDA 4YMVA 1XGKA 3F9IA 5DX1A 4ZWNA 1JDJA 1K66A 3U1VA 2O8CB 4YIKA 2DTXA 1XCOA 3IXQA 3ZGNA 2IY7A 3F8WA 4OHCA 3U7FB 1JJ7A 3TE7A 3RS4A 5ABPA 3DEYX 3E6AA 2HCRA 4IZOA 2G07A 2JI9A