3JQ9C

Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor (nadp+) and inhibitor 2-amino-6-(1,3-benzodioxol-5-yl)-4-oxo-4,7-dihydro-3h-pyrrolo[2,3-d]pyrimidine-5-carbonitrile (ax1)
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
267
structure length
248
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQSNLSIVNLCDAMVDQPMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-based design of pteridine reductase inhibitors targeting african sleeping sickness and the leishmaniases.
pubmed doi rcsb
source organism Trypanosoma brucei
molecule tags Oxidoreductase
molecule keywords Pteridine reductase 1
total genus 87
structure length 248
sequence length 267
chains with identical sequence D
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2009-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3jq9C00
1GV0A 3WG9A 4CM6A 4NR0A 4XDZA 2OHXA 3JQEA 3Q3CA 2YFHA 3WFJA 1UXGA 1LUAA 1YKFA 4IGEA 1NHWA 1TB4A 4QT0A 3FN4A 3GEDA 5AXAA 1FXSA 1PS8A 3GNSA 1YRLA 3FNEA 5JBIA 3HN7A 1KETA 1Z75A 5DCWA 3QVSA 5CEJA 2YV2A 3UCXA 2FZEA 2VZ9A 5JC1A 3NX4A 3LC2O 4PVCA 4C7JA 2FOIA 4U5QA 3GGGA 3I52A 4PVDA 4J9UE 3U49A 1WDKA 1Y9EA 4ROSA 3ZWBA 4JJIA 4CM9A 1TEHA 5AXBA 4BQPA 4URFA 1G0OA 5THKA 4CM8A 4F6LA 1CRWG 3OFSA 4O6VA 1UZLA 1JVSA 2AMFA 1Z7EA 3N74A 4EGFA 5TRTA 1EFLA 2F1KA 5L7TA 1JA9A 1ZH8A 4JJFA 4P4GA 4FW8A 3RSHA 3JQGA 4LK3A 3P2OA 4CMEC 5H83A 1YO6A 5LCXA 1EE2A 4OYRA 4EYEA 1GYRA 3WJAA 4WNCA 2Q1SA 4HNHA 4L0QA 3NTRA 4Q3EA 1LJ8A 4N5MA 3AUTA 1QSGA 2NUAA 1H9BA 5JCJD 1F0YA 5CDTA 3GHYA 4Z0TA 1Z6ZA 5CDYA 2GD1O 4YYZA 4BKUA 1M66A 5DOVA 3DMYA 3KYCA 2AXQA 4P4LA 3UCEA 4BQRA 1R4MB 4FDAA 4DMLA 4YB8A 5I7VA 1VRWA 1Y8RB 4CQLB 3I4FA 2Q3EA 1GFSA 4PG6A 3QRWA 4K26A 3O4RA 1O0SA 4CM4B 1K6IA 4YBZA 2WSBA 1KOLA 3QWAA 3FBTA 3KRTA 4XB1A 2E49A 1BW9B 2X86A 4XRGA 5KIAA 5TC4A 2HU2A 2VCYA 5L3ZA 4BGUA 3ZDFA 3PQDA 1DHRA 3OQ1A 1YJ8A 4GKBA 4BMVA 5G4LA 2ZB4A 4GWGA 2O4CA 2VT2A 3FWZA 4GVXA 3WXBA 2J3KA 4J43A 2C07A 3NTOA 5T5QA 3GLQA 1TT7A 5HA5A 1DHTA 1LRLA 1E7QA 2A92A 3HFSA 1PX0A 2CF5A 2EWMA 4G81A 1LQTA 3EZYA 4WEOA 4DPKA 4MIEA 5JMPA 4ND4A 1PJBA 3I6IA 1B15A 3ICPA 1KEVA 2SCUA 2Z1MA 2QHXA 4FBGA 3TOZA 2PH3A 1GUYA 4XJSA 3DMTC 3INTA 2I3AA 2YZ7A 4FOSA 3RUCA 5B1YA 1B3BA 1FDUA 2NU8A 4BMNA 4FS3A 2X58A 2JKVA 4MPDA 3S2IA 3BMCB 3DHNA 1K6XA 4RVDA 1PZEA 3OIGA 2PD6A 4D43A 4CMKA 1NVTA 4HBGA 4WCFC 4XQEA 3V1UA 5CEFA 1ISMA 2PY6A 1YL5A 4B79A 4E2XA 3NRCA 3TOXA 1GQYA 5KKCA 5GMOA 4WLEA 4D46A 1PQWA 3UOGA 1XHLA 2C54A 2WYUA 4HFMA 3H5NA 5JLAA 2VNAA 1HT0A 3HWRA 3L6OO 4IZHA 3RROA 3GUYA 4Q3CA 4WEQA 3PGXA 4CM3A 1M6WA 1ISGA 1X1EA 2P9EA 4FPXA 1I3NA 2I9PA 4KUEA 3C1TA 2NU9A 1MFZA 4GX0A 4PZDA 1DXYA 3RBZA 4B4OA 4DA9A 4FFPA 1U2GA 2B35A 1JAXA 3I83A 2CVOA 3S2EA 3DFUA 4KWHA 3UHAA 1GY8A 1LDMA 1LRJA 4CLEA 3LT1A 2HMTA 3WIDA 1PJ4A 4BGEA 1YWGO 4BV9A 1SZJG 1NHGA 3K8ZA 1ISIA 4YDRA 2HMUA 4RGBA 2PKRA 3GG9A 1YOVB 3GRPA 4CMIB 3WQSB 2VUSA 3OBBA 1J4AA 4LVUA 4NJMA 4DUPA 4IIUA 5GZ1A 3VPXA 1U4OA 5IDWA 2QRKA 3V2UA 2PV7A 2V7PA 1WZEA 3QY9A 3AY6A 2Y93A 3PHJA 4MP6A 4OOFA 7MDHA 2HRZA 3QQPA 2DM6A 2X1HA 1DFIA 4UUPA 5DP2A 4YWJA 1UDCA 2D4AA 4Q39A 2X5KO 4NU6A 1QXSA 2UUOA 3RC9A 5I7EA 2H63A 3JYNA 4BO6A 3F47A 4FFNA 4DLBA 2VYND 4RL6A 1C1DB 3GVXA 2EKQA 1R4MA 4R51A 5B4UA 1LDNA 3O8QA 1CJCA 2QZ9A 3ADOA 2X5OA 1CERA 3RASA 1B8VA 1JQBA 2GF2A 8LDHA 3HB4X 2JL1A 2Y99A 3R0IA 2CMDA 4DLAA 1M2WA 1YL7A 1HF3A 2J3HA 3L4BA 1Q0QA 2JHGA 2HMVA 1X14A 4XYBA 4MVJI 3VKVA 3IMFA 3TWOA 2EHDA 2X0RA 4J7UA 3TF5A 4BO4A 3PTZA 1GV1A 2ZTVA 4YJFB 3K31A 1PL8A 2VWPA 4UULA 3GVIA 4RPGA 4PGFA 1E3SA 5FI3A 4XYGA 3O26A 1MV8A 2BFPA 4WCDA 4CV3A 4DVJA 4P22A 3RUHA 1H2BA 2OBNA 5EERA 2Q4EA 4RF5A 3E9NA 5CFZA 3HDQA 3PHIA 3U4CA 3PHGA 4F45A 2G76A 3I23A 4FJ2A 3D4OA 2OP1A 2GERA 2NSDA 1JLLA 2C2XA 3IKVA 5IAAA 1V3TA 4GSLA 2C0CA 3KYBA 1OI7A 3AY7A 4PLCA 4UUMA 3Q1LA 2IYOA 3AW9A 5F1KA 2EW8A 1P1KA 3AI3A 1NQ5A 4E21A 3ZN2A 3L4SO 4M49A 4IS3A 2YUTA 4LW8A 3D4NA 4IPTA 3SLKA 3Q9UA 1L7EA 3BMQA 3GN1A 3M2PA 3QVXA 3ZCXA 4XX0A 1AXEA 3SLGA 5JSFA 2VRCA 3O9ZA 2HAEA 3MOGA 5CEEA 3V1YA 4UVDA 1O94A 5K9ZA 1PJSA 1Y8QB 3KSZO 5T6BA 4ALJA 4E5YA 3H3FA 3RWBA 4HNGA 1WAMA 1GADO 2BKAA 4J6FA 4RPJA 3ZWPA 1SAYA 3VH3A 1A5ZA 1HDGO 2EXXA 4BNTA 1J5PA 4J2HA 5JFOA 3OMLA 1ULSA 1SMKA 1GEEA 1KYQA 3SVTA 4R54A 2DTEA 1E6EA 4CODB 4RO0A 2JAPA 1A7KA 2PFGA 1EE9A 4NJMB 3DBRA 1UJMA 4WCFB 5L7WA 5JPIA 3F1KA 4WOJA 4E5MA 1B3RA 3FRJA 3X2EA 3GZ4A 2CY0A 3WYEA 2FN7A 3VZPA 1TT5A 1HDRA 4FFMA 5CHEA 1ADFA 4FB5A 1KC3A 2X22A 5EQFA 1Y8RA 4CQLA 4M8SA 4R1NA 4UVIA 3DQPA 1ONNA 4I5FA 3RFXA 2IZ0A 1PS9A 3U4DA 1D7OA 2UVDA 5C7IO 3HADA 2PKQP 4ND3A 4OGWA 4ZQFA 4AJ1A 5ITVA 1DRVA 4I1IA 3CMMA 1SOVA 3ZW8A 1KEUA 1NAHA 2DQ4A 4Q3BA 3RFVA 2P4HX 3BHMA 1BXZA 4MKRA 4OM8A 4XQCA 1V3VA 2PD4A 3FNGA 5ER6A 1HZJA 1MC4A 4B4VA 3O38A 5ER9A 4GGOA 4EJMA 1CEQA 4J49A 1WP4A 1UAGA 1E3JA 3R3SA 1ISFA 1DLIA 1ZSVA 3PP8A 5L9AA 5AVOA 1DJQA 3GF4A 2AEJA 4KQWA 3WYCA 4GPD1 4TVOA 3G0OA 4J4TA 4MJLA 2BH9A 1ADBA 3N58A 4BB5A 4BKRA 5HS6A 4CQMB 3L9WA 4Z3KA 5JAIA 3I4CA 5LDGA 1ADGA 1KERA 4WNIA 2OBYA 3OHSX 1UXIA 2VN8A 4FC7A 4E5KA 2E48A 4IINA 1E3WA 1MP0A 4HP8A 5BQFA 1B7GO 2EGGA 2IZ1A 4W9NC 2QRLA 4Z0HO 3TDKA 2A94A 1A4UA 1UH5A 2HSDA 3HSKA 4G65A 1M75A 1DRWA 3MJTA 5JO9A 2DFVA 2O3SA 2OMEA 1P45A 1W4ZA 3I9JA 1HRDA 4NBVA 3KBOA 4I5EA 5DT9A 4BB6A 2GSDA 2IZZA 2V6BA 3FSRA 1QYVA 1YBMA 3NV9A 2IEBA 2W2KB 1CETA 1DFHA 4HFNA 3W8EA 4K6CA 4GLLA 2GN4A 2HUNA 1BG6A 2CDBA 2JFHA 3WR5A 1CIVA 4JGBA 1LLCA 4CMCA 4RV9A 2IDZA 2WJPA 3I9NA 2ZCVA 3QWHA 4XRRA 4BMSA 5KCZA 2DFDA 2EEZA 1T25A 1IE3A 2ET6A 2VHZA 4AJ4A 3I5MA 4R3WA 5IDQA 2NTJA 3ZWYA 4OH1A 1O6ZA 4NIMA 3GNQA 5FEUA 1K0UA 1RM5A 4WK6A 2O50A 4I9NA 2P5UA 3S55A 3LZ6A 2F00A 1CYDA 1HDOA 2IEDA 4R5MA 4UEJA 1UXHA 4KP7A 4S1VA 4XB2A 3ZZNA 4E2YA 2BGKA 4WUVA 3WDSA 2P9GA 2VWQA 2VRCD 1AGNA 4XYEA 2HDHA 2JD2A 1RYEA 2WD7A 4M54A 4UVEA 1ZSNA 3FHLA 2O3UA 4I8XA 4QFCA 3A4VA 4R4JA 1ZNQO 3WQQA 4A10A 1K2WA 3Q6IA 1A7AA 3OJLA 3IJPA 3Q2KA 3GDOA 1ML3A 1VLLA 3G17A 1D8AA 3H5AA 4N54A 1U9JA 2PGDA 1EVZA 5ADHA 4QX6A 1H9AA 4W82A 4OL9A 4BO8A 1LLUA 3ADPA 1Y81A 1X1TA 4WECA 3E18A 1BXKA 1VC2A 3EUWA 2O3QA 1XIVA 5IDYA 3E03A 2JJYA 1BDBA 1HEUA 3BMOA 4UEOA 3TZKA 2POQX 4RPHA 3KV3O 3ANNA 3VKUA 2BI8A 1F8GA 2J6IA 1FJHA 3PJGA 2PGLA 3GFGA 2YV1A 3QWIA 1E3EA 3GAZA 3H5RA 3I9OA 3RC2A 1TLTA 1IHYA 4GGPA 2YDYA 4WGGA 3GHHA 4CUZA 2GRAA 3DBVO 3WGOA 2VRBA 4ZU3A 1H0KA 1O8CA 2DKNA 4FSHA 4B3IA 1MLDA 1M76A 5DOZA 4DQXA 5JYEA 1HKUA 2YQ4A 4BNGA 3JQ8B 5IZ4A 3F5SA 2OZPA 3HJAA 3UW3A 2QYSA 2FMUA 3GDFA 1YBAA 3VTFA 3ZWCA 3BMQB 1ORRA 2FR1A 4XGKA 3DHEA 4ESOA 1HE5A 1QRRA 1U28A 1ZKMA 2Q4BA 3K2EA 3UKOA 5DP1A 1C0LA 8ADHA 4D3DA 4MVJP 3NYWA 1ZVMA 4RVHA 3QA9A 3E1KA 2W2LA 4BNIA 3ROMA 4MOWA 4ZD6A 2DLDA 2OL4A 5K0ZA 2B4QA 1E3IA 3ROKA 4Z9YA 1EEHA 3PGJA 3OEYA 2ZB7A 2PLAA 3DBHB 4GX1A 4GMFA 4CMIA 2NTNA 4MINA 5MDHA 2XXJA 4IIVA 1Y5RA 5A9SA 4B3JA 3FBGA 3OJ0A 5AQ1A 1R4NB 1PQUA 2RBEA 3K30A 1VL8A 1ZCJA 4TRMA 2VYVD 4Y6PA 3WGQA 3AU9A 1XDWA 1MG0A 1MXHA 2OP0A 3D64A 5B4TA 3RIHA 1ENZA 5FWNA 4JLWA 1XWFA 1NQOA 2AEMA 3H2ZA 1LDBA 2EJVA 4YACA 3WGIA 4CUJA 4KDFA 2X8LA 2OXIA 1BXGB 4RF4A 4IDEA 5G4KB 2GDZA 1H94A 1P1FA 4R9RA 3ONEA 3M6IA 3A28A 4L73A 4RF3A 1Q7GA 4WLOA 4XKJA 5L4NA 1P1IA 1ONPA 1Q7BA 1VL6A 4O0LA 3PJDA 4FGWA 5CDGA 3WGHA 4Y67A 3DZFA 1GZ4A 1RYDA 5HWSA 4JIGA 2OORA 4DREA 4IQ8A 3V2HA 5KJ6A 3D1LA 1DIHA 3GN2A 1MUUA 2VWGA 4NFSA 3OIDA 4LGVA 3U09A 4PLWA 1NR7A 3K6JA 1U7TA 1HDCA 5I9NA 3RKRA 1T2AA 1SOWA 1U5CA 5A02A 3K92A 2FPPA 3LF1A 3TL3A 1TI7A 3C7DB 3TZHA 3WJ7A 2CVQA 2YHUA 2DBZA 1ZXBA 4J16A 2VWHA 3OEWA 3WWZA 4FN4A 1A27A 2BD0A 4IJKA 3ETDA 2I99A 4NHEA 3TFQA 3WYBA 1H6BA 1PZFA 4CR6A 1T1RA 5JE8A 4IDGA 3A1NA 4Z6KA 1XCBA 5IXSA 5KVCA 3DZHA 4E6PA 4IDAA 2YJZA 1DC3A 1EZ4A 3DZBA 1SCUA 2NVUB 4YAIA 4NH4A 4ZQBA 3HDHA 3DB2A 3CINA 4IQGA 2W2KA 2QW8A 4BNFA 4GKVA 4E33A 4CM8B 3ZU5A 5JNLA 3B6ZA 1ADCA 5HBRA 1T26A 2D1YA 3U62A 4M87A 5CP8A 3QHAA 1OBFO 4OSOA 3RJ5A 3DZKA 1GCUA 4B3HA 2Z5LA 4AJIA 2FWMX 2GUGA 2B4RO 1YQGA 1GPJA 3UCFA 4EUHA 1KVSA 4MVJD 4ZQGA 4BL5A 3JYQA 2C5EA 3AI1A 3JD4A 5TNXA 2JCXA 3DHYA 3V8BA 2J5RA 3BAZA 4RJTA 1YBVA 2Q99A 4FGSA 3U3XA 2WYVA 3IUPA 1HYHA 1ONOA 1I32A 4GAEA 3TRIA 3ENKA 3W4IA 5KNLA 3AM3A 4XIJA 4BNLA 3EAGA 2V6MA 1VJ0A 6ADHA 2QX7A 3CXRA 4N18A 2OUIA 3DBRB 2PR2A 3JQFA 4QSMA 4D0SA 1FMCA 3PIIA 5I7FA 3ON5A 4Y9DA 3U4IA 2DBQA 3ULKA 3MJ4A 4OXYA 5KKAA 3NUGA 3QVTA 4J1NA 2ZB3A 3MZ0A 3KOUA 3AUUA 4CM4A 3GRKA 2AA3A 3VH4A 1BW9A 2VNSA 2QZZA 1WW8A 4RDHA 3MJVA 1YE3A 3SJ7A 5A04A 1V35A 1SO8A 1HDZA 3GR6A 3OJFA 1Y6JA 3PHHA 4AJJA 5TIIA 1T2CA 1WDLA 3DO5A 1U4SA 1VJTA 1G6KA 3EVTA 3ZHXA 1BGVA 3PWKA 2VYVA 4II3A 5BSFA 3DZGA 4HADA 3F1LA 4Y8VA 1ZJYA 1P1JA 2FR8A 1FF9A 2P91A 4XQGA 1E1NA 1DC6A 1O9BA 3JQ7B 2AW5A 1NWHA 1F17A 2Q50A 3JQ6A 3ONDA 4Q3DA 1PIWA 1GD1O 1MX3A 3IUSA 3ONFA 5EJ2A 4MP3A 4XDYA 5IG2A 5F1PA 1H6DA 4L76A 2HMWA 3RC1A 1U3WA 2HJSA 2W2LD 1R37A 4MIYA 3JQ9A 3OA0A 3C7AA 4CV0A 4JJGA 4MVJH 5I9MA 1GQ2A 4R69A 3L77A 4W99A 2Y1FA 4RVGA 1Y5MA 2I66A 3NKLA 4R9SA 4TZKA 4PRKA 5FI5A 3WLEA 1LSOA 1WLYA 2GO1A 2HKIA 3B20A 1XGKA 2W98A 3VPSA 4XWYA 3WBFA 4A2CA 2VYNA 3WNVA 1ZBQA 1RKXA 2NU6A 4RCVA 1E77A 3ST7A 1JKJA 1T2FA 4GL4A 4H7PA 5JC8A 4A5OA 3JQ9C 1LC3A 1JKFA 2ZK7A 3E48A 3OM9A 4CUKA 1DEHA 1WPQA 1N2SA 4DIFA 4QEDA 2P4QA 1ZUD1 1HDYA 1NR1A 3FR8A 4J91A 3ZU3A 2D59A 5ICSA 4TVBA 5U1PA 4DBZA 4PLVA 2PZMA 3M2TA 2PH5A 3IOYA 1HSOA 5L40A 1A71A 1WMBA 3WMXA 4BO0A 4FR5A 4WPGA 1SEVA 4GQAA 4JP2A 4D45A 3ICCA 2VHVA 3ETGA 3OETA 4WCFA 4E0BA 2FY8A 9LDTA 1E7MA 4K28A 1E1LA 3F3SA 4YAJA 2GZ1A 3DOCA 2Y1GA 3Q9NA 4D44A 5EN4A 1B14A 1W8DA 2FRDA 5T67A 1VSVA 4BO3A 1JKIA 2CSUA 4DXHA 5ILOA 1D1TA 3DMTA 5TSDA 3WGZA 4J1QA 5L51A 1PU2A 4OOEA 3U5TA 1DIRA 4JNKA 4BIIA 1GDHA 4PLZA 4A26A 2TMDA 3JQAA 4KUGA 3WSVA 3AFMA 1NPDA 3JQFC 2W8ZA 3RFTA 1U2DA 2IRWA 5JW6A 2AG8A 2TMGA 2Q2WA 2CNBA 1AN9A 1YDEA 4PZCA 1S7CA 4C4OA 4S3MA 1GYPA 2DPGA 1W0CA 5CDSA 3DZIA 3KHUA 2ZATA 2PZKA 3AU8A 2ZYGA 1GTMA 3BHJA 1B16A 4IBOA 3BMOB 9LDBA 1PZGA 3PZBA 1I36A 1XR3A 3NT4A 2V65A 3PLNA 2O3RA 4NJOA 5EMHA 3H9UA 2ZQYA 1UP7A 4OMUA 1DC5A 2BELA 1ZMTA 3RUDA 3JYPA 3U4HA 1U1IA 1VJ1A 1WZIA 1P0FA 2WTBA 2OOSA 4IM7A 3RI3A 4OKIA 3WX0A 4K9DA 2EKPA 4IMRA 1PGQA 4RZIA 3PWZA 3VC7A 4AJKA 1U8FO 1N7HA 2G82A 1XELA 2UUPA 2HJRA 1HLDA 2DUWA 1DIGA 1QLHA 3E82A 4DIOA 4CQMA 1UUFA 4IGFA 3VDRA 2IXBA 4L4XA 1E1MA 1WVGA 4BOYA 3SC4A 3QWBA 4A73A 3PYLA 4ZICA 3WLFA 3A14A 2ZYDA 3L4BC 1YB1A 1HYGA 3AUAA 4Z3DA 1P0CA 1C0PA 1F06A 3WSWA 4PZEA 4HV4A 3LC7O 4YVFA 3GT0A 1M67A 3UF0A 3GGPA 3LDHA 3VZSA 5U9CA 4MVJM 1LDGA 1ZIDA 5BNFA 1VI2A 4E4YA 1I8TA 5C5IA 1GZ3A 3VZRA 1H6CA 1ZFNA 2Q1UA 4JBHA 5TT1A 4AJHA 7ADHA 4M1QA 3K73O 4E30A 1HWYA 2XPCA 4PG7A 4BNZA 2DVMA 2NVBA 5ITWA 1I2BA 4UUOA 5TJHA 3G3EA 1PL6A 4BNXA 4M55A 2RH4A 1B2LA 4BKPA 1SBYA 3V2GA 4JP3A 4E3ZA 1I01A 2YW9A 4ND2A 5U4QA 3CEAA 3DZJA 1NXQA 1KBZA 4JCOA 4N7RA 4NQZA 1D1SA 1PS0A 4CLOA 3TFOA 3FF4A 2PWZA 4D79A 4CMJA 1WMAA 3I1JA 1FK8A 5G0SA 3UVEA 1LRKA 4R5HA 4TWRA 4XCVA 4B7XA 2GN8A 4E5PA 4C7KA 5JDCC 1P1RA 2X0IA 3GAFA 1B8UA 4TKLA 3VPGA 1DJNA 3I9LA 1PZHA 2GR9A 4TSKA 3VTZA 3JQBA 1NVGA 2GN9A 3M1LA 1BWSA 3BTSA 3ZWMA 1ZO8A 1JU9A 1A9ZA 2C82A 3RUIA 1J49A 4FJ1A 2DTDA 3JD3A 2NNLD 3ZWVA 5CAEA 4BGVA 5JCXA 1H5QA 2FSVA 3CKYA 1W73A 2PK3A 2VUUA 3ASUA 4M89A 3T7EA 1DOHA 3RJ9A 5DNAA 1RM3A 1GR0A 1XG5A 5HM8A 1V9LA 4KTTE 4TRRA 2P2SA 2AHRA 4I08A 1IL0A 5LC1A 1MFPA 2EV9A 2VUTA 4ALIA 3L6EA 4R16A 4PLPA 3NGLA 3CTMA 1EK5A 3D3EA 4D7AA 1EQUA 3DFZA 4YEDA 4PFJA 4B8WA 2FPIA 2YQ5A 1CDOA 4L74A 5L4SA 1A9YA 2UDPA 1FDTA 3T7CA 4J0EA 4OAQA 3QE3A 3DTYA 3WGYA 2EKLA 2J5KA 3MJEA 1LNQA 3ZU4A 3F9IA 4J1SA 3OH8A 4MVJE 1UR5A 1NAIA 2IE0A 5TF4A 1QV6A 3RUEA 3H9JA 5BNIA 2ZTMA 1C3VA 4XGIA 3RBVA 2GN6A 3E6AA 4TRJA 1BRMA 5BSEA 3VVCA 1NNUA 1OC2A 1V3UA 2G5CA 5C3MA 5IZCA 2CF6A 5J23A 5L7YA 5EQDA 3GVPA 5DBIA 2RAFA 1QG6A 3EYWA 5C37A 1YH3A 1LBEA 1H93A 3DBHA 1Y8QA 4AJOA 3FTNA 5ILGA 2AQKA 5KJEA 2RIRA 3O03A 2NADA 2Y0CA 1AUPA 3RAJA 4DGSA 3K5PA 1R15A 1Y7TA 3BMNA 1D3AA 4RF2A 3LC1O 1LSJA 1R16A 2A35A 2RH8A 3HB5X 5H82A 3KEQA 1PJLA 1PWXA 2YY7A 4F3YA 3ZHBA 1ZK3A 4XZ3A 3KB6A 3DL2A 3EHEA 4K1LA 4NNJA 4QTZA 1IOLA 3RVDA 1IZ9A 1ZK0A 5T64A 4EDFA 4ZGWA 1MGOA 5MGBA 1EUCA 1UDAA 1DAOA 3OJEA 3GPDG 1QR6A 4OXNA 3MEQA 4YA6A 1E6WA 5KJFA 4E5NA 5G0VA 4YJGA 4GX2A 3C1OA 2CDAA 1XU7A 5TGDA 1K3TA 2G0TA 3ZU2A 1F14A 3OJOA 4LSWA 1I30A 4WLFA 3HNPA 1OMOA 5EESA 4E32A 1E7YA 1I3KA 3UAGA 3NJ8A 4ZQHA 2DPHA 3DAFA 4LCJA 5A3JA 4MDHA 4DBVO 5GZ3A 1LLDA 4L9RA 4ZQEA 1UXKA 2OGUA 5JMWA 3EC7A 4KTVE 3ZW9A 1T24A 2PZLA 3TSCA 3IAHA 4YCAA 5DDIP 3KLPX 4DYDA 1ULUA 1PL7A 1E5LA 4NMHA 1IB6A 3ITKA 4DYVA 2XOXA 1K6JA 3GK3A 3PQFA 3H9GA 4O1MA 1I24A 3CE6A 5I8WA 1P44A 1U5AA 2CZCA 3B1KA 1YQDA 3ZV5A 5BSGA 1X7DA 5AOVA 1E0DA 3R1IA 4DRYA 4ND1A 3GH3A 5CPBA 2CD9A 4O63O 4OQZA 4GSKA 1JWAB 2GASA 5F3RA 3IQDB 4U8GA 4OJNA 4WKGA 5A05A 1XU9A 2NQTA 2ZQZA 3PXXA 1NQAO 4CMAA 2R6JA 2ZJ0A 4NFHA 4ZJUA 4QO7A 2E37A 4NDNE 4RVUA 5COBA 3L9XA 5DZSA 2QG4A 1I3MA 1T1SA 1YVEI 4U0JA 2NVUA 4ZVVA 2EJWA 4U7WA 4CLHA 4P8RA 4AJPA 1Y9AA 1P77A 3H9QA 4YR9A 2B69A 2JHFA 5JY6A 3IC5A 3EK2A 2R00A 3WICA 1F12A 4AICA 2E6UX 2GZ3A 3KO8A 2BRUA 1P9LA 1ISHA 2AQ8A 2LDBA 3FNFA 3JYOA 4LN1A 4MVJG 2Q1WA 3RC7A 3HUDA 2NVWA 1JTVA 1NYTA 3DDNA 4ITUA 1HSZA 3IS3A 3JQDA 4W7IA 1V6AA 1EUDA 1UDBA 2FSSA 1W6UA 2FHSA 3KYDA 1I0ZA 1KC1A 1RM4A 1QV7A 4ONEA 3WTBA 3QP9A 2AG5A 3K9QO 3PQEA 2HK7A 5COQA 2I6TA 1I10A 3GUCA 3WS7A 5DCYA 3WOHA 2AE1A 2BMAA 3KZVA 4BNYA 3N7UA 1I33A 3ZV6A 3V5NA 3L07A 5KVQA 5L45A 3LT4A 1XA0A 3ROPA 2XAAA 1GL3A 4N5NA 4INAA 1VKOA 1TT5B 1QYWA 2Y67A 4EBFA 1LSUA 4UVHA 2EERA 4F6CA 5IFLA 2FPGA 3C3XA 2R2GA 3FPLA 5FYDA 4W6ZA 5ICMA 4NG5A 3F5QA 1QORA 1HE2A 5KOIA 4A03A 4MKZA 3LF2A 4XR9A 3VH1A 4ALNA 1DAPA 2QQ5A 4E12A 5C7OO 1NVMB 3D4PA 3A9WA 4HWKA 4JXKA 3A06A 1I3LA 3LVFO 3ZWNA 2GGSA 4PG4A 5TLSA 1K5HA 5B12A 4YRAA 4RZHA 1KEPA 5HTOA 2J5QA 3NDRA 4QQRA 1E92A 4IS2A 3GA0A 2XXBA 3ABIA 4ND5A 3ROQA 1CQIA 3BTOA 4DL9A 3BIOA 5CG1A 5A5EA 4FIZA 2NU7A 4YT5A 1IUKA 1MA0A 3MWDB 4FFRA 1YDWA 1EBFA 2BFAA 2GPTA 4PLTA 4FOOA 1CQJA 3VH2A 1ZEJA 2V6FA 4AL4A 5JS6A 1KY4A 1OAAA 1VE9A 1Z45A 4I5DA 4BO9A 4UREA 1PR9A 1EVYA 1OZAA 2HCTA 3BMCA 4DPLA 3CPSA 3NTQA 3S2GA 4EITA 3W4KA 3H4VA 4IY1A 4Q9NA 2H9IA 2Y0EA 3LU1A 2GYYA 4J9VA 1UZMA 4MVJF 3ZNPA 3H3JA 2YHIA 4BV8A 5C7LO 5KJCA 5KVSA 4YQYA 1GEGA 1N92A 4FQ8A 4PLYA 5JCJA 2C7GA 5A5FA 3NAQA 2WMDA 3UICA 1E7SA 1R66A 1SB9A 3ORFA 1T2EA 2VT3A 3GPIA 2DT5A 2IXAA 1IY8A 3VDQA 4J0FA 1GCOA 5L53A 2B0JA 2O2YA 4FCCA 3VOSA 1HYEA 2EG9A 4QFDA 4WLNA 5DCUA 2NV6A 2HK8A 4LVCA 4BHTA 4JBIA 5TX7A 1EQ2A 1TA4A 2BI7A 2EF1A 3E9QA 3FD8A 3KSDO 3PYMA 1JDJA 4J7XA 4R01A 4CV1A 2B5VA 3INRA 1ZZEA 3DBLB 3ZNOA 3KYDB 1NP3A 4EJ0A 4MVJA 2HO5A 4AG3A 1LLQA 4TKMA 4W9NA 2FZWA 1EDOA 1H6AA 3BXXA 3OIFA 3COSA 2PGJA 2ZTUA 3HFGA 1GU7A 2GNAA 3EGOA 5A3VA 3W1VA 2AQIA 3ITDA 3AK4A 3RUAA 3U0BA 2J8ZA 3OF2A 4EEZA 4J7CA 3DOOA 1I2CA 3GC6A 1Z7BA 1T4BA 5HRUA 3UN1A 4M86A 1M6HA 3HDJA 2NLOA 3OECA 3KM0A 4WLUA 4E2ZA 1X0VA 3S8MA 4YJGB 5I9LA 1XKQA 2NTVA 3LLVA 1EVIA 5TJ9A 2X5JO 4NU5A 4J4BA 4XYLA 3GVHA 1ZEMA 4ZA2A 4DTIA 2JFGA 3DTTA 1LEHA 1BDMA 4U0KA 1PJQA 3IIEA 2I5PO 1EK6A 3D5QA 3QW2A 2EIHA 4DIBA 4LMPA 4PCVA 2AQHA 2G17A 2X23A 1IULA 2C29D 3ZV4A 2GCGA 1VM6A 3AUSA 3I9KA 4BO2A 4WLVA 4D3FA 5EPOA 1E6UA 1DIAA 4B7UA 5JAZA 5DBFA 3TQHA 2V6GA 1SEPA 3MWEB 5BT9A 2WDZA 4IJVA 2C5AA 3CH6A 1R0KA 3IDSA 3KXDA 4RPKA 4UAGA 3ZNNA 1P74A 3BTVA 1AE1A 1I5RA 1YJQA 3KEOA 3VPFA 5B4VA 1C1XB 3G1TA 5THQA 5G2OA 1PSDA 3PDJA 1Q7CA 3MOIA 2RHRA 3HQ4O 4KDEA 1Q0LA 3BTUA 3G1UA 1SB8A 4R41A 1ZK4A 3AWDA 3EMKA 4OXKA 1LU9A 4NK4A 3W6ZA 3NDIA 3PVZA 4JN6B 3E9MA 2ZB8A 1ZXLA 3JD1A 2B5WA 2I3GA 4RORA 4IJWA 2X4GA 2H6EA 3JQAD 4FFOA 2NM0A 2ZTLA 2YHIB 1E1KA 4L75A 2E4AA 1NBOA 5EL0A 1R12A 3QWFA 5JDIC 5KTKA 3LYLA 1EBUA 4YJHA 3TZ6A 2ZYAA 3AM4A 4KQXA 1LXCA 2B36A 2Z1NA 1XEAA 2HLPA 2YFQA 1SC6A 1N9GB 2VTEA 2I67A 2WE7A 1YONA 2Q49A 3PFFA 4JBGA 4DWVA 3P2YA 2UYYA 5A03A 4IXTA 4GWKA 5JDCA 1E5QA 5IDXA 3HHPA 3RBXA 2ILTA 1V0JA 5A9SB 4XYMA 4R3NA 4RQTA 1NTOA 4U6QA 4ZRNA 1GZ6A 1PGNA 5B37A 5IN5A 2D5CA 3FR7A 2HRBA 3DBLA 5A1TA 3ZI0A 3BMNB 1EDZA 4LRTB 3SBOA 2WWRA 4ILKA 1LA2A 2EGHA 5IZCC 4FD3A 3GZNA 4ZRMA 3IKTA 3PDUA 1E7WA 5DN9A 1LQUA 1KS9A 1DB3A 4QXMA 4GI2A 3PEFA 5TT0A 3SEFA 3DONA 1C1DA 3EW7A 2VZ0A 5F21A 3KYCB 4BO1A 4JQCA 1TVEA 1SNYA 5G0UA 2JFFA 3M1AA 4IDFA 3IP1A 3HG7A 3ETEA 3D5TA 1BSVA 1L7DA 4I5GA 3HE3A 1EVJA 2W4QA 4NFYA 4AFNA 2D5AA 3B70A 5IJZA 2WM3A 3MJSA 4G2NA 2RCYA 3MTJA 1NASA 1ZJZA 2BGMA 4CLXA 4J3FA 2E82A 3BA1A 4R1UA 4BO7A 4XEHA 2OFPA 2X0NA 3PPIA 4NI5A 4CM5A 3JQ7A 3TZCA 3B1FA 3OQ6A 4IQ0A 4G5HA 2Y1OA 3E5MA 1O95A 3DAPA 3GDGA 2VHWA 4YJFA 3E5RA 1G1AA 2BFMA 3HDYA 3GY0A 3H9EO 4RLHA 5H81A 1ZSYA 4DPMA 4YRDA 3C7CB 4EJ6A 4TRNA 1P33A 2JD1A 2ZIZA 4PIVA 1DC4A 1F8FA 1RWBA 2Q1TA 3ZWXA 1RPNA 1NFRA 4PG5A 5L4LA 3W8DA 1T2DA 3OQBA 4HX5A 1BVUA 3GG2A 1HETA 5L95A 2VTDA 5F5LA 4NK5A 1WXDA 4IDCA 1RM0A 1QYCA 3CZRA 1NFFA 4NZ9A 4BGIA 3LSYA 4Q3AA 3CUKA 2HK9A 1N5DA 1UXJA 1WDMA 4CQMD 1UZNA 1AHHA 2UAGA 4IDBA 4L4RA 2Q45A 3TN7A 4LMRA 4H3VA 5F5NA 1GPDG 1NWCA 2X6TA 3R3JA 1MG5A 4CM7A 3BYZA 2X0JA 1JAYA 1PGPA 3GGOA 4DC1A 1VPDA 4XR4A 3QVOA 1U3TA 1WWKA 3NGXA 3H65A 5BSHA 4PLFA 2JCYA 1PJTA 3TL2A 4TMFA 5JDIA 1OOEA 4RVFA 3TPCA 1N7GA 1XQ1A 1R4NA 4RLSA 1UP4A 1I2ZA 2G1UA 3DXFA 4A27A 1JN0A 1KY5A 1EMDA 1BHSA 4FFLA 3C8MA 1K89A 2W90A 1C14A 4AVYA 3H8VA 3PHLA 3QLJA 4NBWA 3W6UA 1Z73A 3ANLA 2Q2QA 2Q46A 2CUKA 3RUFA 1AHIA 4UVGA 3D7LA 1FDWA 3EDMA 2X9VA 3GZNB 4YXFA 2X7HA 5CG2A 1QYXA 1HE4A 2DBRA 4I9HA 1DFGA 1S6YA 2B4TO 4Y6SA 3OP4A 4Y98A 4TROA 2PA3A 2NWQA 4LISA 4R68A 3P7MA 1HDXA 4XGNA 3IJRA 1C0KA 4BKOA 4BNMA 4BS9A 4NBRA 4XQ9A 1E3LA 3L0DA 4CM9D 3WGGA 4WOKA 1B26A 3W4JA 4CLRA 5DULA 3ASVA 4QUKA 3EZLA 3H6KA 3R6DA 1Q1NA 4J4HA 3WBBA 4DLLA 4YJDA 4GBJA 5G0TA 1CWUA 4BUCA 4KWIA 1P31A 4BNKA 4YT4A 2R00C 3UH1A 2LDXA 3RCBA 3GEGA 2B83A 3MTGA 2OO5A 1QKIA 5ES3A 1QLJA 1PJ2A 3F46A 4KMSA 3FPCA 4MKXA 3I9MA 1GQQA 1NM5A 3Q11A 1J0XO 2YDXA 5DF1A 4KOAA 4PLHA 4NBUA 5GZ6A 2NQ8A 1BTOA 2ZKLA 1CF2O 2DAPA 2QRJA 4HUJA 3LT2A 2JAHA 2C7VA 4OKNA 4W7HA 4YAKA 2Y0DA 3LK7A 2D2IA 2VQ3A 4MIOA 2Q2VA 1JW9B 3H7AA 4GH5A 4JROA 3VAZA 4EEXA 5FF9A 2A4KA 5JAQA 1WNTA 1XSEA 3I3OA 2O7SA 4CV2A 1IZ0A 1HE3A 4EUFA 3IL2A 2DTXA 3HZZA 5A9TA 4U6SA 1BMDA 3TNLA 1DIBA 1KVTA 4OIMA 4X54A 3ZWWA 2DC1A 1X0XA 2CVZA 4HXYA 1Q0HA 4AJLA 1VKNA 5JY1A 4CJXA 4EW6A 3JD0A 1GUFA 3STHA 4DC0A 1P3DA 1QMGA 1H2HA 3RKUA 2Y1EA 3F4LA 4BNJA 4CLDA 3DAGA 1ARZA 2CFCA 3D3WA 2VOEA 2IODA 3C85A 3SJUA 1DO8A 4B8ZA 2DU8A 1PTJA 2BLLA 3AI2A 3UXYA 5KVVA 1YL6A 1ZMOA 3PJFA 4WASA 3DWFA 4BO5A 2GZ2A 3FTPA 3OA2A 3PRJA 4B7CA 3F6YA 4YTEA 3OICA 1KVUA 4IXWA 4R1SA 3JCZA 1OC4A 3GEMA 4XIYA 1JVBA 3DR3A 1IYZA 4HFJA 1X15A 3NT2A 3AM5A 1UP6A 1HZZA 4MO2A 1LC0A 1G0NA 2XF8A 3CIFA 1L1FA 4A7PA 1GAEO 3D0OA 3WFIA 1PR3A 2PNFA 2PZJA 4CR8A 4LCEA 2VZ8A 2PD3A 3P19A 3O8QB 3PJEA 3PIDA 3WGTA 1YB4A 2Y68A 1DDOA 2ZJ1A 3RQSA 3RU7A 4PG8A 2BHLA 3GMSA 4XA8A 2CDCA 3JQAB 5I8ZA 4XD2A 3KVOA 5I7SA 3G49A 1R0LA 3AOEA 2H5LA 3JQCA 5K6AA 3RU9A 4P38A 2AEFA 3ZNQA 4CLRB 5KJ1A 4OSPA 4YAEA 4IZIA 5CPFA 5LDHA 2PTGA 1VSUA 1LDYA 1HXHA 3GQVA 1U3VA 3CSDA 4FC6A 4O59O 5BR7A 1PGOA 3ZH2A 1LX6A 2P9CA 3BHIA 3U9LA 2A9FA 3LLSA 4D0RA 1MB4A 1MXFA 5IF3A 3DEYX 3AY3A 4YAGA 4L8VA 2X9GA 2O2SA 4BNNA 1TXGA 1P1HA 5TS3A 3FI9A 3IP3A 1IHXA 2C59A 2Y1CA 4DQVA 2Y66A 3FNHA 5AXDA 1T4DA 4ZHSA 2I76A 1ZK2A 3EVNA 3LT0A 2Y05A 2H1SA 4IMPA 3Q2IA 4EZBA 4CMGA 4OQYA 1E7RA 2X9NA 4DQUA 3JQ8A 4HY3A 4H16A 3V1TC 3Q0EA 5A4DA 3QSGA 4XJTA 4W4TA 4UUNA 5AXCA 5JXWA 3ZHYA 5CDUA 1FDVA 1DPGA 1KVQA 2O23A 1PWZA 4QO8A 4JK3A 3S1LA 4Q3NA 2BGLA 3NDJA 4FJ0A 3PLRA 1N9GA 4GVLA 4TQGA 3MCVA 2QIOA 1N8KA 4CR7A 1ENOA 5K6AC 1B8PA 2Z95A 1OFGA 1SPXA 2C20A 3C1AA 5T8KA 1D4FA 1AXGA 1DBVO 2YV3A 2YYYA 4AJEA 4GLOA 3PFWO 4J1TA 4RPLA 1YS4A 3QJ5A 4HFRA 4Z9FA 3ZV3A 3WWYA 3GNTA 3D3WB 1LI4A 1IPFA 2C2YA 1KEWA 2NACA 3KSUA 4CPDA 3EY4A 1ENPA 3ENNA 1FDSA 3QVWA 4RDIA 1R0SA 1XYGA 5AYVA 1A4IA 1Z82A 1U8XX 1IPEA 1C0IA 2EP7A 4CL3A 4CMHA 3PYXA 4ZN6A 4II2A 4BNVA 3FWNA 3H2SA 2WYWA 3L6DA 2RHCA 4Y6RA 5FFFA 4E2WA 3WQRA 5IXYA 1DSSG 1JWBB 3ZWOA 4MP8A 2Y1DA 2D8AA 1X13A 2EP5A 1BXGA 3CMCO 3RD5A 3K2BA 2DUUA 3F4BA 5G4KA 4TZTA 1ZW1A 4A0SA 4B4WA 1VL0A 3T4EA 3VPHA 4YT2A 1Y1PA 3VZQA 3TZQA 1PQPA 3KUXA 1NQTA 2AE2A 3ZWAA 4CMEA 2J3JA 5G0WA 3WTCA 4H15A 3G79A 1U7HA 2ZCUA 1N1EA 4BVAA 4UEKA 1LSSA 4BNHA 2VOJA 2O3TA 4AJNA 4LSMA 1R6DA 1KIFA 4YQZA 3KLMX 3UUWA 4GMGA 4Z9XA 1XLTA 4J90A 1LTHR 2UV8A 3WIEA 3JSAA 1O5IA 4L4SA 2WD8A 1NFQA 2J3IA 3T4XA 3W8FA 4CM1A 5HS4A 5EIOA 3WB9A 1YGYA 4ALMA 1HL3A 4YRBA 3X2FA 3SXPA 1BVRA 5JO0A 1YB5A 3UGKA 3GVCA 4WJZA 4AJ2A 3MJCA 1ISJA 1C1XA 2I65A 4EI2A 1HLPA 3PI7A 4IJUA 4LRSB 5T57A 3NJ4A 1UAYA 1EFKA 3P5SA 1ENYA 1Q2XA 4GX5A 1E3WB 4CMBA 4DMMA 3LQFA 1U3UA 4RVSA 3AJRA 3B1JA 4OO3A 3NEPX 2DBVO 4KUHA 4O5OA 1NPYA 5JYDA 2D0IA 2O7QA 3KETA 4KZPA 1YQXA 4ID9A 1V8BA 4K6FA 3UFXA 4YT8A 5ENDA 2WE8A 3PZRA 4J2OA 1GYQA 3S2FA 1QYDA 1J6UA 4RQUA 3GFBA 4YJHB 4PN3A 3JTMA 3GOHA 5DBGA 2D3TA 2BFOA 2WEKA 5T8KC 2HQ1A 4B4UA 4BKQA 2EW2A 3ZGYA 4N5LA 1QP8A 1Z74A 1MC5A 3JQGB 1YOVA 2VHYA 1DRUA 3TJRA 4IDDA 4JX8A 1DLJA 3ANMA 5IN4A 4E31A 5KWEA 1XQ6A 3QIVA 5JAMA 3FCOA 3AOGA 1ID1A 2O4UX 2P5YA 2PKQO 5EINA 1RJWA 4OHUA 1PGJA 4EUEA 3DC2A 1PJ3A 4CLOB 4P4NA 3I6QA 4PLGA 4F46A 2VHXA 3C24A 1LDEA 3PWSA 1ZK1A 3K96A 1NPTO 3GMDA 3E8XA 3SX2A 4ALKA 4D42A 1HTBA 4NPCA 3HN2A 4PRLA 4BNUA 5A06A 4ALLA 4NBTA 3ZHZA 1GUZA 2BF7A 1PJCA 1O89A 1NX6A 2FP4A 3QV1A 5TQVA 1X7HA 3INGA 2B37A 6LDHA 4D41A 2WD7B 4I9UA 2P68A 4WE3A 2GLXA 3JD2A 3NT5A 1KVRA 5F1OA 3KTDA 1N1GA 3SC6A 4BNWA 5A9RA 3PK0A 2JCVA 3WNQA 3VVBA 4E13A 3AFNA 3JV7A 4HKTA 4Z0PA 2O48X 3VHRA 1B0AA 2IYPA 3JQBC 5COAA 4QECA 3DOJA 4R1TA 5BNTA 3WMWA 5GY7A 3JYLA 4IUYA 1A72A 1EUZA 3AOEC 2FR0A 1YXMA 2JD0A 3CZMA 4D3SA 4YPOA 2QYTA 5ENVA 1PEDA 1X7GA 3OSUA 2O3JA 2HMSA 4CL8A 3BZUA
chains in the Genus database with same CATH superfamily
1A7JA 3BRQA 3VI3B 4MV8A 5CX4A 2XUGA 3JQEA 3UANA 1GG2A 1OFIA 3T3IA 2YFHA 5CLGA 3C70A 1MVOA 1EXVA 1VJRA 1LUAA 1YKFA 3BHNA 3LX4A 2OGZA 2Q4OA 4QT0A 4B47A 3ZCPA 5NLLA 1QZUA 2X1MA 5BMVA 5JMTA 3CN7A 1M33A 2FMKA 3UV7A 2GTHA 2ZRJA 4D8VA 3DXZA 4BP8A 4N48A 1Q74A 2QPAA 5DCWA 3ILYA 5H80A 3QVSA 2A1IA 4X00A 1Y7HA 2YV2A 3UCXA 2VZ9A 4DJDC 4ADSG 1U2GC 2WMNB 5B3AA 5LIRA 5EPUA 3RG2A 5J5VA 3GGGA 4BVJA 3CSUA 4Y7DA 4WZBA 2PWAA 4MYDA 2IZ7A 3A9TA 3MMSA 2VPTA 3UMVA 2BTOA 3MD0A 4YUAA 2AMFA 1TD9A 3NUZA 4EGFA 1NT4A 1SOAA 1JKXA 1OXSC 4QJIA 5TRTA 4D74A 2GKSA 2W71A 1W7AA 1ZH8A 1XP5A 4JJFA 2IK8A 2O14A 5E7IA 1I7QB 4WNYA 1JHMA 5IS2A 3JQGA 4LK3A 3FYTA 3LIPA 3E3MA 5BMVF 2VF7A 4R83A 1YQTA 5E1OA 3ZZMA 4IIDA 1XTJA 3OURA 1NF2A 4GKJB 2X77A 4A8PA 4CDRA 2A57A 2CK3A 1GYRA 2C4TA 2GVNA 2Q1SA 3V7NA 3IGFA 4HNHA 4Q3EA 1OH5A 4OGLA 5ECYA 1UC5B 1KAEA 4O3MA 3ACBA 3B1YA 1QV9A 3E9RA 3L7AA 3KKZA 2CWDA 4RK1A 3PKJA 4UDYX 4JODA 4UE3S 5JCJD 4HHEA 5LKAA 1JZQA 1YR2A 2OHGA 1M66A 1PF7E 1UMBA 3WHKA 1UWVA 4DM3A 1Z0JA 1KJIA 3MMPA 1RLOA 1R3UA 4YRQA 2OZVA 4RY0A 2N1MA 3QOFA 5DH9A 3UCEA 4BQRA 3CVWA 2OG1A 5EJ9A 3TW8A 2OBXA 1NM5C 1R4MB 2IDJA 3KSRA 4DV2B 4G8DA 3OOWA 3Q3JB 4YB8A 4ZT6A 1VRWA 3I4FA 4I4NA 3KWJA 1GFSA 1C1HA 3LHFA 4K26A 3SYTA 3H2KA 4EGAA 1O0SA 3TEMA 1XTSA 2OGSA 2P5SA 1HG0A 2N47A 2X2FA 2HJHA 2JLZA 2CE2X 2X86A 1GTVA 2XCOA 4XD7A 5NULA 3WHIA 3ZDFA 2C2GA 3PQDA 4GS5A 5AK0A 3HVRA 1DHRA 2WG0A 4OBBA 1REQA 1G3UA 3DBOB 1T36B 3LUPA 2ZB4A 1K4YA 2GZSA 2CD7A 3WKCA 2J3KA 1JXOA 2O8VA 2W4MA 3GFTA 2ZP1A 3NTOA 4J43A 4IWNA 4PICA 3KOYA 4Q47A 4E1BA 1TT7A 5BRJA 1DHTA 1E7QA 4TQUS 3X1KA 2CF5A 1OXKB 2CUNA 2GM9A 1TK2A 1TMOA 3CXUA 2I2AA 3K9WA 4M8NE 3ZCSA 5KX5F 4Z86A 4ND4A 1PJBA 1T3ZA 4HH4A 4C6TA 1RQRA 2JZCA 4LHZA 5DFAA 3ZLUA 1JJIA 1YZNA 3LNTA 2D2FA 3UJDA 3AB3A 3DYBA 2FPWA 3MWYW 3QPDA 4BMNA 2CC2A 2NU8A 4EHLA 3MB8A 3I42A 4DUYB 3PXGA 1NI4A 2JKVA 4MPDA 3A3NA 3ZGXA 3DHNA 4GQBA 3RBAA 1AHNA 1B0PA 1OH6A 1OX5A 2H1IA 2JIZD 3DPUA 4HYYA 3VJKA 1TCCA 4OV6B 3AVYA 2WTNA 1RWWA 1LW7A 3V1UA 4BBJA 4FZ5A 2VLIA 4ON9A 1YL5A 4Y2TA 2QBYB 1Z3CA 2JIRA 5KKCA 4KRYA 1WQ3A 3HUTA 4WLEA 4D46A 1WVIA 2B1IA 1CBUA 2YWJA 2QBYA 3O4GA 3A25A 1QU2A 3KKMA 3KNZA 3P5BA 3TOVA 1DXQA 2AMJA 3B3GA 4WEQA 2VJQA 1NSYA 1NI5A 4FPXA 4KO3S 1P9RA 3IJ5A 3E4DA 1I3NA 5K01A 2I9PA 1R6XA 2JLQA 1Q6ZA 2R66A 1G1MA 1OZ0A 4QNRA 4MJ7A 4ZALA 1BQ3A 1IC6A 3UWDA 2QVLA 4BLWA 1VA4A 3I83A 1EXDA 2CVOA 2F9MA 5AKZA 1V3QE 4ZARA 3S2EA 3OFNA 5IXJA 4NQRA 1SXQA 1J0CA 1GY8A 3GW8A 4HDMA 1LDMA 3R76A 4HJRA 2CFRA 1E9VA 3PXEA 2GEFA 3LT1A 1T0BA 3QXGA 3OZFA 3ZD9A 1I9CA 1A7UA 2OFWA 1FIUA 3K8ZA 1LPBB 4YDRA 4WZAB 3OKFA 4JJKA 2BKXA 3FWKA 3WQSB 1R8YA 3JAWB 2VUSA 3OBBA 3GWZA 4IJ6A 2VAVA 4DUPA 5GZ1A 4CF4A 1UMDA 4MW1A 4YFVA 4F8EA 4ZGGA 2ZI4A 4NBSA 3V2UA 3GLIB 4JUAA 1WCXA 2B4YA 2OUKA 2RBGA 3PD0A 4WKOA 3QY9A 1EM8B 1N2CA 3HWX1 4OOFA 2QQ0A 2HRZA 2OCIA 3Q7PA 1FNSA 4QYWA 1DFIA 4YWJA 4D4GA 1UDCA 4Y3UA 4Q39A 5B3JA 1F20A 1MDBA 1QXSA 2UUOA 2ZS7A 3ZDRA 4U7GA 4TPKA 9MHTA 1GUDA 3AG6A 3F47A 5KDLA 4MI3A 3QFTA 2VYND 3H86A 4G5YA 5LZ4A 1IJFA 3SVLA 1JAHA 3LBHA 3WMFA 4KLNA 2WVGA 4AG6A 3D6MA 2TECE 4UNSA 3AEXA 3QKTA 1KEEA 4FE3A 2X5OA 1CERA 1JQBA 3ND9A 4UZSA 4MV0A 3C7TA 1XV5A 2Z98A 1NZJA 3QEAZ 3ZGZA 1ZRNA 3PC3A 3KEFA 4QQFA 4TV9A 4TSRA 1DO0A 1UK9A 1VPLA 2YX1A 1ODCA 4IHQA 3L4BA 3WHLA 3VVLA 3HYTA 1E2NA 2HMVA 1UBNA 4M1ZA 4MVJI 4KSCA 3TWOA 2DQYA 5C52B 2EHDA 2HLDD 2CL0X 2XZTA 3CT6A 3TF5A 3R3XA 3D3JA 2X0DA 1GV1A 4B35A 2WWFA 4MWBA 1RRCA 1U28C 2H4WA 3A4YA 1THGA 2FLVA 5EFZA 4JI0B 3ZVRA 1Y1TA 3VR6H 1SH7A 4RPGA 2CJWB 2HHHB 3EF0A 1M83A 1PK8A 3O26A 2BFPA 3EZNA 4JWKA 4EO4A 4YRSA 4P22A 5L3SA 3ETHA 4O4JF 1Q0PA 4N0PA 5FNZA 4I3HA 2XITA 1JIIA 2AFVA 2Q4EA 1KSHA 1QONA 3L05A 5FBRB 5TEVA 2LW7A 4C3ZA 3U1BA 5CFZA 3HDQA 3L7CA 4I50A 2VT7A 1JHAA 3O5AA 1FU7A 2IS4A 1CIJA 1SULA 3D4OA 1RXEA 4FJ2A 2R8ZA 2MYTA 1M5UA 1TL7C 3QLVC 1W4LA 4L95C 5HIAA 2CDRA 2NSDA 1Q77A 1QAMA 4LRWA 1BO6A 4QC2A 5HTKA 5IJAA 4RSMA 4GW3A 4NAUA 1VHQA 3PGLA 2XTZA 1OI7A 3AY7A 2HRQA 2P2YA 3Q1LA 5EKXA 5CB4B 5F1KA 1U6JA 1RVV1 1XRQA 5K8TA 3AI3A 4ZCQA 1NQ5A 3FCAA 1RXVA 3AF5A 1T9ZA 5F35A 4E21A 4P53A 1ZM4A 2YUTA 4QU0A 4XASA 1AA9A 4CIWA 3D4NA 3H0EA 1Y33E 2B34A 2ESRA 1S3FA 2VXOA 3GN1A 3M2PA 2W58A 3Q9UA 4KQJA 7MHTA 2YWEA 3TR5A 3SLGA 4TMKA 2WV9A 2VRCA 4RKFA 1Z9BA 3O9ZA 1IN5A 1Q0SA 1ZM7A 1QGED 3DDSA 1O94A 5CVJA 5FTNA 2KS6A 4MXDA 1BEZA 1FEZA 2JHCA 4ALJA 3F5FA 4JLDA 4M1OA 4HNGA 1GADO 2EQAA 4AKSA 3GRFA 4RPJA 4EJSA 3FSJX 5EZ6B 3S1SA 3BWDD 4QRDA 3SNKA 4V3CA 3VH3A 3ZU6A 1NBMA 2FX5A 4DT1B 4FHFA 2AJBA 5KKNB 2CXQA 1M1UA 2GX6A 3D8SA 3LVQE 4O2BF 5ETJA 1ULSA 1AV7A 4UEWA 5EKDA 2A88A 3LS2A 3VZCA 3SVTA 2ZZNA 1T8RA 5FO1A 3NFRA 2ETXA 5KNCH 4RMJA 1N77A 4NJMB 3VJRA 1TX4B 2QSYA 2YRXA 2YXDA 2RAVA 2WUDA 3F1KA 4AMYA 4WOJA 5FD8A 1FTGA 4QU8A 1YR8A 3NCTA 3WYEA 1YBFA 2FN7A 3VZPA 1RI5A 5CD1A 3PDWA 2CYCA 3ZVNA 3PITA 4CQLA 3RVMA 3VU9B 4LOKA 2D62A 4DN6A 1RC1A 4CNBA 4CDGA 4TTJA 5JH7F 4EQ6B 3DQPA 1ONNA 1JKMA 4I5FA 1YZ3A 5HK9A 1PFQA 1UOOA 2IUEA 3UA4A 3W77A 1D7OA 4PCLA 4B6RA 2PUEA 3AP1A 2HRCA 2WNHA 3OD5A 4KI7A 3TLEA 3DE4X 4UCWA 3BE4A 4OGWA 2A9PA 4HXGA 4OLJA 4EZIA 5AW0A 2QU7A 1EVKA 4G3XA 1RYYA 1FLDA 1UCFA 5D8DA 4AWBA 2PZ8A 3CMMA 4AWAA 1WULS 3WAJA 3U44A 2QQGA 4KI0A 1GLNA 4KIWA 1SOVA 5G40A 3ZW8A 4NHOA 3HXMA 4Q3BA 2Z5GA 2LKCA 1G7SA 2Z09A 4JLNA 4JP8A 5BMOA 5C1OA 2NO1A 1BXZA 3GAAA 3FYHA 1FE8A 2O0JA 3PGVA 4Q0MA 4Q1VA 5ER9A 2YBDA 1G2QA 5DWQA 4J49A 5JSKA 5IJ0B 1OFVA 2HWXA 4MITA 4EHIA 1ZSVA 5FOSA 1JAZA 4HWSA 3R4CA 5CFQA 3VNSA 4YPFA 1V1MB 5I4CA 5FA5A 5M34A 3GF4A 5AHXA 5FADA 3WYCA 4QLBA 4NG4A 4RTJA 3FKSD 1OXXK 1GA1A 1MHPA 2JGLA 4FYHA 3G0OA 1QZ3A 3GMIA 1RI2A 2ZUWA 4J4TA 1V1MA 2BR3A 3I3SR 2AV6A 1ADBA 4BKRA 4BB5A 5IT4A 4DB4A 2BM8A 2C3YA 1MA3A 2Q5LA 2IW3A 5CH8A 3I4CA 5LDGA 4I81A 2XZOA 1KERA 1A97A 2VDLB 4WNIA 2OBYA 3OHSX 2BEVB 3AR8A 4FC7A 4G0PA 4XLZA 2O8DB 2E48A 1YDFA 1MP0A 1V1RA 2IYFA 3BWCA 2WYOA 5KX5A 2ZRIA 3R0JA 2WY2D 4O2RA 3LXXA 3HB0A 1UH5A 2WJHA 2O1EA 5JO9A 3MJTA 1SQ0A 1U3CA 2DFVA 1JHDA 3GD7A 4E5UA 4CEIA 1W4ZA 1TZMA 1HRDA 3A9SA 3QG1A 4BB6A 1FPQA 4WZAE 1DBIA 4L5AA 4NULA 1IUNA 1YBMA 1YFZA 2QDKA 2IEBA 1P2VA 1M34E 1DFHA 2CMKA 1X8LA 1QK4A 3OZSA 3W8EA 2NV2B 3N5KA 5F9HA 3GLGE 2FR8C 4GLLA 2GN4A 4UHBA 1NYRA 5DYWA 1E9AA 3WRYA 1AMOA 3T94A 4AS1A 1DJLA 3WR5A 2PN1A 3ETJA 4BFSA 3COYA 3V4ZA 2VJNA 4C03A 4DR4B 4YMGA 4GRDA 1ZC4A 2AXPA 3S4YA 5JAUA 3QKRB 2CLKB 2IDZA 3I9NA 4ISBA 5BN3A 3TPZA 4OJQA 1KP3A 4FX2A 1T25A 3JAWA 3NBXX 1N7JA 2GN0A 4AJ4A 5ALSA 3N86A 3UTDA 5LSAA 3U7IA 4KBFA 3ZWYA 3C3BA 3AL0C 2QP3A 3S44A 4DG5A 4X94A 3D7MA 5D3ZA 4C3OB 2BC9A 5CW2A 1NDQA 1XLWA 1EVQA 3K0HA 4HLDA 4IYJA 4POOA 3QOYA 1NATA 4MCHA 2BGKA 2I3BA 4KQGA 1H5NA 3QUCA 3RSZA 1EWKA 4WUVA 2P9GA 2OVBA 4G1EB 2GXQA 4MZXA 4D4HA 1RE1A 4A2CA 2RGWA 2F48A 2JD2A 2HW8A 2AMLA 1GQRA 1WMEA 2G67A 4D0NA 2WD7A 4M54A 2QAGB 5F7OA 5IBRA 3R5XA 4LUCA 3JVDA 2O3UA 5AW9A 4QFCA 3A4VA 3SFTA 3R24A 3ZLJA 3EG9A 4A10A 3GRRA 1DPFA 3E3AA 2C1EA 4JU8A 1G5QA 3FZGA 3NAZA 1QU3A 3Q2KA 2QEQA 2XGSA 1DIOB 3G17A 4HZIA 5EVCA 4N54A 1JT2A 5ECDA 2ZXUA 3QVUA 1L4GA 2MWMA 4E70A 2FJPA 4HH3C 1YCGA 4G5OA 4UASA 4ZAVA 2GLUA 5A71A 4NE2A 4PANA 4DMGA 2REBA 1NC1A 3AZQA 4CRWB 3FHTA 1J09A 3EUWA 1NMEA 2CNKA 2O3QA 3AC0A 1KQ3A 3E03A 3QELB 2PLRA 1R8SA 2LIPA 3C5CA 4HB4A 5G53C 5J2UB 5LBUA 3IHLA 3TZKA 3FAKA 5AM0A 5LQAA 2WW8A 5DYYA 1KY2A 1XWIA 1FJHA 2PGLA 5EIXA 5HP4A 3CV3A 2YV1A 1DTEA 1P1BA 1TA0A 2M6SA 4E03A 2JATA 2YDYA 2Z3ZA 4N3AA 1TVMA 2GRAA 3C74A 3DBVO 5EE3A 2VRBA 1Z08A 2EZTA 2WNSA 1NVEA 2I6SA 4JENA 4G2TA 2ZTSA 5HZGA 4HO1X 1QKJA 3NANA 3MOSA 2ZIAA 1E3QA 1DI0A 1EFHA 1OWLA 1II0A 3DMFA 5ABPA 1PTJC 2AEEA 1HKUA 4JSRA 2YQ4A 2RB5A 3P9CA 4LZJA 4CIAA 1HLFA 3K4PA 4PQFA 4JGGA 3AFGA 1HDEA 2HDOA 2QYSA 4Q9KA 3GDFA 2CLEB 2P30A 4GNKA 3IV7A 4DLPA 1FFEA 3M83A 1DINA 3DHEA 1PWYE 1QRRA 1E89A 1NSTA 4NYIQ 4D9FA 1JXQA 4ZI5A 1ZH4A 2E4UA 1T5BA 4XUCA 1T5TA 2FX2A 3KUUA 4XJVA 4D9EA 3LUDA 4HMPA 4A3SA 2FMXA 3H75A 2G6BA 4B2PA 3RV4A 4RVHA 3ZGVA 3QA9A 3KR9A 4IEFB 1EG7A 4M0EA 3UUEA 2WKRA 1PTKA 2GBIA 2SKDA 3ROMA 1YJBA 2I1WA 3SOPA 1F1JA 3QKSB 4JBNA 4D2IA 1JSCA 4LOIA 3HTXA 1H4VB 1M8PA 1E66A 4H3HB 2GYUA 3ZHSA 2ZJAA 3DTNA 6ABPA 1EP1B 2ZRKA 5JZMA 1E0JA 2HRRA 1B8OA 1VKZA 3AIKA 1DQYA 3NIGB 4HEA6 1GZSA 3PNQA 1V43A 1VPEA 3PB3A 4QUAA 5D3MA 4GMFA 5AUQA 2NTNA 4P81A 5AQEA 5MDHA 2EYQA 3O74A 4M1TA 3SD7A 1DKUA 4KQMA 3FOFC 1RQNA 3OJ0A 3DKKA 1PQUA 1MB2A 2YYAA 1RR6A 4N76A 3DZCA 1MTZA 2HD4A 2I8AA 2BRUC 1X8KA 3KT0A 3VR4D 2D4HA 3G1WA 3WGQA 3PLAE 1E3MA 2OP0A 3E3LA 3D64A 1COWD 3ZBQA 5B4TA 1R9NA 3RIHA 1U0JA 3UKJA 3KT3A 3GLGA 5DCLA 2AEMA 5ULLA 3MJRA 1YZYA 2AB0A 1B93A 2H4XA 2RI1A 4FYXA 1YCFA 2X8LA 3B82A 1TAGA 4YONB 5TS2A 3NTVA 2R2AA 1U7ZA 1KJYA 3I30X 1H94A 1UBOS 1X80A 1D04A 1P1FA 1T8UA 2X5NA 2FWAA 2NG1A 4QVGA 3T99A 3IAS1 3CE9A 3CZ9A 2H16A 1KMMA 4RF3A 4WLOA 1W52X 3KQVA 2PNJA 3BKWA 3UM9A 4ZYLA 1W47A 2XA2A 1VGVA 2VXYA 4D8WA 5JVDF 4JA2A 4RMHA 4O0LA 1TVCA 2X2EA 3BH0A 2PE5A 1F1BA 2ZRDA 3KDSE 1JL3A 1L0BA 1GZ4A 3GJXC 4DLWA 3CUYA 2HJ9A 4JIMA 3E58A 4UNNA 2B1JA 2OORA 2WKPA 3IHKA 2QN6A 4MZDA 4Y9UA 5J2UA 3N6RA 3V2HA 4X62B 5FR2A 3D1LA 4X65B 3I72A 1FVFA 1MUUA 3FTCA 4YAWA 4ZQIA 1D4AA 3PHBE 4M2LA 2P79A 4NFSA 1BE0A 5EOVA 1VLVA 3U09A 4I2VA 4PRYA 3O7WA 5EZYA 4DSOA 5I6DA 5D87A 3AF0A 3RU3A 1A2BA 2FPPA 4H2DA 5H3LA 3I0ZA 3R0QA 1TI7A 3WJ7A 1GKUB 4NOKA 4EY3A 2HSZA 2CVQA 4CGYA 2DBZA 4FR0A 1H4QA 1CZRA 1ZAYA 1NX9A 4ZO6A 5LQSA 5KQLA 1ZY2A 3HB7A 2CFSA 3L0OA 4QATA 3OEWA 4GZ6A 4N41A 2FK8A 3W3AD 1A27A 3NEAA 2MR5A 3G0GA 4IJKA 2I99A 1BQ4A 5KQGA 1L5ZA 5AP9A 3GGJA 3IUYA 3A1NA 4Z6KA 2G36A 2E1PA 1XQXA 2C3OA 4OXIA 1S2LA 1W59A 5KVCA 2WJAA 2YJZA 2FVYA 1VKRA 4HDRB 1GPNA 2CBZA 1SCUA 1XPOA 3A10A 3OTHA 1U0EA 1E79D 2QLMA 3NP9A 2EFHB 4H59A 4OJKA 3A0RB 4KQEA 3UK7A 5HR5A 4IQGA 1CUFA 5K05A 4BNFA 5TDHA 3U2QA 2X2OA 4NCAA 5JNLA 5CA0B 2VDWB 4KXNA 5B6JA 1ZA2A 4KWTA 4FNGA 3OMWA 4BEJA 1C9NA 3CGGA 3U62A 2VA8A 2CXHA 2WHXA 4M87A 5CP8A 5BWNA 1RLUA 1GCUA 1ECPA 3K1AB 3IB3A 4PO3X 2RGUA 1UC4B 4C2AA 5K0EA 1CF4A 3G68A 1LZKA 3UCFA 5HFJA 1M6NA 2GAIA 4G01B 1P2BA 4PAOA 3EY9A 2E21A 2Y2UA 1N75A 1OW3B 2B1RA 4NZYA 2EGUA 5FOXA 4HWPA 1EK1A 1SKYE 3DQQA 3MS7A 2WBLC 3N39C 3JD4A 1JNYA 4LYAA 3O1HB 4C30A 4KH1A 1YOBA 4JUFA 3H6HA 2VTBA 1XZIA 1ZNWA 1YBVA 4Q3OA 5TMBA 4L50A 5DHSA 3FDZA 2WYVA 3IUPA 4QRIA 5JVDB 1W75A 3W4IA 4BJ5A 5CCXA 2WB2A 2V7EA 4ZCPA 2C7QA 2X4LA 3AM3A 5DGCA 1DG1G 5K3BA 4BNLA 3M0EA 1VJ0A 2CFOA 5F98A 2BKLA 2YQZA 1O57A 5CDFA 3RHSA 4N18A 3WGUA 1RAHA 4KFCA 1WMDA 4G4GA 5IEBA 3PIIA 4EK9A 1BU8A 1SQGA 4RS4A 2PZFA 4CG0A 3PNLA 3ULKA 1KHHA 4G84A 1FU8A 2IFTA 5FPQA 1KDRA 3QVTA 4U2KA 2XT9A 4LOHA 3KOUA 3MWFA 1BWRA 3WRYC 4CM4A 3EEOA 4C7VA 5AHWA 1H1LA 3ZDZB 5A2GA 4R84A 1Q17A 5AVUA 4AY2A 1X87A 2VNSA 2Q5JA 2Y6VA 1NV8A 2QZZA 3K1JA 1CSEE 3ESAA 4ZOAA 1JIJA 1JI3A 1XC7A 2XIJA 5F12A 3S2YA 4YCSA 2TMYA 3I04A 1SO8A 4HT3B 5M04A 5J1SB 4DARA 3KAJA 3GR6A 3PHHA 1ZUWA 421PA 4NENA 1WDLA 1DS6A 4UATA 3L04A 1WXWA 2GS9A 4OJMX 4YXWD 1G6KA 4LY0A 1IIBA 3SYMA 3ZHXA 1O03A 1NW9B 1REQB 2ZYTX 2O05A 2JK0A 2PKEA 1R0BA 4PZZA 1W85B 3W5HA 2VPZA 3F1LA 4DAOA 2C98A 1MH1A 4OI2A 2XA9A 2GK3A 2PVPA 3HNRA 3OZTA 4PYRA 3PVCA 3EAQA 1SXJE 4RKEA 3AILA 3GEEA 4P93A 2Q50A 5LQCA 5DM4A 1GP2A 1JEAA 3FM9A 2MSKA 5F2OA 4D3YA 5HKOA 2PVCA 4CT5A 4MP3A 4F96A 5F1PA 4TTVA 3A32A 4C6TB 1G19A 2HMWA 4Q3LA 3LPDA 2R48A 4M9RA 2WQZA 2OR3A 4MIYA 2C2HA 3BCUA 3CSSA 3GA7A 3C7AA 4B6OA 3WKEA 3EWAA 5I9MA 5EJAA 1RMYA 2Y1FA 4FDUA 5IUKC 4YRLA 4EB3A 1Y5MA 2I66A 3WGLA 4TZKA 4DLXA 4B83A 1JB9A 4J7AA 5BOSB 3CJQA 3PBKA 1FNBA 4KYUA 2PCJA 1I14A 1XF9A 2J33A 4H31A 1YS6A 3ZBUA 3DLHA 3B20A 3LHKA 2DEUA 5JAPA 2PBRA 3LUFA 3WBFA 3TTYA 1Y1LA 3M70A 3WNVA 3RADC 3K0EA 1RKXA 3F7NA 1C29B 4RCVA 3A37A 3ADKA 3UFXB 4XWTA 1FTSA 2JRCA 5C53B 1F2UB 4GL4A 1FTNA 4K6GA 1NMSA 2Z2KA 3IULA 2V54A 3OM9A 2QTTA 4XX0B 5KSZA 3MIZA 1N2SA 3BH7A 2IH4A 4BQEA 2WFLB 3OAAA 4LWPA 1ZUD1 1FFWA 2ZOSA 4I0WB 4JYPA 4OHWA 4Q9AA 4EVRA 4A8JB 2D59A 3GGSA 5ICSA 3BCHA 4TVBA 1PV4A 1UBMS 2O2HA 3ILHA 1VB3A 4PLVA 5DRTA 1PV1A 5GJBA 1OU0A 1Z6YA 3MB5A 5KYUB 2OK7A 2P6PA 2XBUA 1PYGA 4I1OA 4HMQA 4AS2A 2B99A 3F7TA 3OPNA 5BR1A 3OQOA 5TY0A 1QH8B 1UOQA 3EOBI 4MR7B 5DTJA 4DA0A 4R2XA 4TKUB 3Q8XB 2JF0A 2BSAA 4WCFA 4E0BA 5IK2A 5BYJA 1R4AA 3VOAA 1E1LA 2XTJA 4UDXX 4KMOA 5ERXA 4EABA 4JI7B 3GLTA 3Q9NA 1M8KA 4IXNA 4OCZA 4P34A 1UMCB 3EUFA 5CA1F 2FRDA 1VSVA 1Q19A 2VDRB 3I58A 4K2HA 3TFWA 1Z2AA 2H8GA 5FH9A 5ILOA 1D1TA 1UMCA 2RGBA 1G8MA 1M6VA 3DMTA 3H04A 4IEEA 2RHMA 3M5WA 3WGZA 5IWCA 1M5TA 1UDWA 4GKKB 5D85A 3U5TA 2D3WA 3PU6A 3A1DA 3EXG2 3LPLA 1MO3A 1UBLS 4GEKA 4PLZA 5JH7B 1EUYA 2GZDA 4JB8A 1QZZA 3N7AA 5EJMA 2ZYWX 3PQ3A 1M2KA 4RYLA 3CVXA 4C7MA 3CLTD 4IOLA 2BFFB 2IRWA 3LL7A 4PZLA 4ER3A 3ECCA 3R5FA 2EFCB 1YDEA 5J43A 1DCKA 1AS0A 2DUNA 3HFJA 2ZULA 2DPGA 3TM4A 4HDCA 2IPMA 3OOJA 2G9NA 1B16A 4AYXA 5HKKD 9LDBA 2H0RA 1Q7TA 3PZBA 2XWPA 3N53A 3N5CA 2OHVA 4D5GA 2D0PB 2JGIA 3N2LA 4NJOA 4OMUA 3U4HA 2DH5A 7GPBA 3JYPA 1PFUA 5ALYA 4BKMA 1BHO1 5JPCA 2PIDA 4YS6A 1P0FA 2C7OA 1Q5PA 5A3RA 3K1ZA 3QFFA 2Y6UA 4I19A 2BL4A 2PUHA 2EKPA 1W44A 3RT7A 1JHPA 3IDOA 3SI7A 4NCNA 1X9HA 2KSQA 1SM4A 3PWZA 3VC7A 3ZK9A 4AJKA 2HNBA 1EWQA 1P7ZA 3HBNA 1MPTA 2BI4A 2ZRCA 1FUYB 2UUPA 5ICFA 3DKVA 2VDNB 3E5NA 5J2UF 4M36A 1HLDA 1RXYA 3OZEA 4X97A 4ZQCB 1QLHA 3PEWA 2P9QA 4DIOA 2ZT6A 4C4PA 3VDRA 1IIRA 2ZRBA 3LXUX 2V98A 3K53A 3QW4B 4L9SA 2FGKA 1E1MA 4C0BA 1OKKA 3C43A 4O8ZA 1IQRA 3S3TA 2AC7A 1UM8A 1YR1A 2QN3A 1JECA 3FNBA 3FLMA 3KEGA 3KQYA 4LBZA 4Q03A 3RK0A 1HMYA 4PWYA 3M1IA 3PYLA 1ZJJA 3IERA 2WMYA 1NVUQ 2BFDA 1HYGA 2POCA 2YCBA 4QPCA 3UTCA 1T3HA 3AUAA 3BN3A 5AW2A 5DNCA 1Y4DE 2YTZA 1Q83A 2WHEA 4MYUA 1CTQA 4Q1BA 4HV4A 5BV0A 1BS2A 4N1AA 1G59A 4TUYB 3SBXA 5KYGA 4QNMA 4B6JA 2GM4A 4B3RB 4Y2UA 4P4SA 1ZIDA 5BNFA 1VI2A 2QLNA 3PC2A 5KTSA 4JR2A 1K6MA 1M2NA 3HBAA 2CXTA 3VZRA 4JBHA 1D4OA 4AJHA 1QGDA 3J81k 1RAFA 2J9XB 3HACA 2VZLA 1HURA 3NM5A 1Q7EA 1T29A 1KJQA 1FTQA 5TJHA 3RPEA 3G3EA 1QRSA 3ZQJA 2IZ5A 4QWMA 1B2LA 2X5XA 4QIHA 2ZJFA 1DCFA 3V4LA 3O73A 5U4QA 1XMXA 1SBNE 5AOBA 4JCOA 1KBZA 4ENTA 2V58A 4N7RA 1K4KA 1SFRA 1X2EA 3L8YA 4CLOA 3FF4A 4F21A 3PDIA 2OO3A 3I1JA 1FK8A 1MRSA 4HRVA 4HWOA 2GD0A 4Y2YA 3RS4A 3EJWA 3UVEA 2XRYA 4IF6A 4TWRA 4CKEA 5REQB 2Q62A 3M6AA 1PWEA 3KU4A 2ZRQA 4DLZA 2PZAA 4UFNA 4WK4B 1FP4B 1P1CA 2C77A 2DYKA 3FW1A 4M0PA 4E09A 3Q8KA 3DNFA 1VJCA 1W0KA 2CLFB 2TSYB 3VPGA 1BOOA 2GR9A 4UTNA 2CLLB 2EX1A 1NXSA 2ZWOA 4GMDA 4OFXA 1NVGA 1FXWA 2C9CA 3KJXA 1YRQA 3IVRA 3BTSA 4IDOA 5AW5A 1FS4A 2H48A 1Z83A 1A9ZA 1EQAA 3UO8B 1P75A 1J49A 2PJZA 3L93A 4UU1A 4XQ0A 3ZWVA 1E6KA 1L4UA 4A4DA 4WBNB 3GLUA 1OBHA 1W48A 3L43A 4BGVA 1A69A 1E9CA 5FNVA 4NOJA 1H23A 1SWVA 3CKYA 1W73A 2WP0A 4M89A 3ASUA 1HLGA 2HDWA 1TRHA 4XDGA 3CKLA 3Q88A 4F8YA 3U44B 1GR0A 4ZJYA 1X7YB 1JR4A 2RC5A 5BN4A 1QOZA 3WP1B 1WB5A 4LZWA 1OHHD 5E9WA 3CYFA 4L51A 4GI7A 2CL6X 4H0CA 1NYLA 4K3UA 4NCJA 3W1EA 4Z4FA 2X2PA 2P2SA 3RAPR 3QM1A 1XZAA 2PDAA 1IL0A 5DHAA 3KSAC 3LP6A 3QV2A 5AK4A 3T9FA 5EEGA 3TGLA 1WXHA 1FQJA 2ZE8A 1IG3A 3K0CA 5DX1A 2NSHA 3D3EA 1VZ2A 4O25A 1ZC3A 1J2JA 4EKNB 4RIHA 2BJWA 4PFJA 2OZKA 2FYTA 5C8DA 2FPIA 4DCVA 5B7GA 1N2HA 3MUEA 4RFLA 1CDOA 4JEIA 2M2IA 4GP7A 1UKVY 2I4TA 4HGQA 4PSCA 5L4SA 4J0EA 3M9LA 3DPSA 1N2IA 3DTYA 4PSAA 3HP4A 3GQBA 4ZZIA 3BAFA 1KFJB 1WOYA 1C50A 2GYWA 1WX1A 4J1SA 1ABEA 3TRHA 5JSQA 4G23A 3DOUA 2FG6C 3HI6A 2IE0A 4OHKA 1QR2A 4YUVA 1SD2A 3O92A 2COKA 5LDDC 3RBVA 4EGSA 2VBIA 3LG2A 4IKEA 5EMMA 4ZT3A 4D8XA 4QKQA 1UBGA 2O6LA 3R3UA 4PX3A 2O2IA 2QVZX 5AD1A 1E3DA 3VVCA 1OC2A 2ZWIA 1R9MA 1FX0A 2YJNA 2YWCA 3JS5A 3EZFA 5L7YA 2EDCA 1OT3A 3J7AC 3P4YA 4YHBA 1I51A 4GO1A 4DMFA 4KN9S 3ADBA 3K9CA 1T4MA 3D8RA 3SEZA 2XBLA 3K7EA 1G63A 1F0PA 1M0SA 2P67A 2XHZA 1XPUA 2E18A 2JC3A 3WISA 4AJOA 2FFHA 2VS1A 3O47A 4Y9TA 3ZCVA 2EZ8A 3FTNA 3OPQA 2CCJA 3IILA 1AUPA 4MB2A 4P3PA 3O4JA 1Y7TA 2FZ4A 3C3YA 1D3AA 2WZDA 1G17A 3CF0A 4BBZA 5FHRA 1JI0A 2YY7A 3A4LA 2ADMA 3OCCA 4XZ3A 5PNTA 1USWA 4O1HA 1Q57A 4B43A 4YP0A 4ZGWA 1AC5A 2BHTA 2PX8A 4MTCA 4JBWA 5TF0A 1KYXA 3ZQUA 3KQTA 1W19A 3E7PA 5F78A 4OXNA 2AVNA 2NW6A 1EFAA 1I7PA 1S2NA 3CRMA 3PS9A 4HPWA 1JQJC 2BSXA 4NPAA 1XVIA 3T3DA 1VKHA 2J6CA 4RY2A 5KHAA 3EOAI 4OKSA 2IYAA 3KPYA 1JJ7A 1IJEA 3OIVA 3K0FA 5KTTA 5G0VA 3EXHC 1M5RA 3W6PA 2R5FA 5J4HA 4MKHA 2WSIA 6YASA 1K3TA 2G0TA 3ZU2A 1F14A 4D8YA 4LSWA 1ZNZA 3CLSC 1I30A 1P2DA 3OM0A 3A9RA 3HRHA 1U90A 3NO4A 1NW4A 2D1QA 2RHJA 1YAJA 3A11A 4YRIA 1E7YA 3UAGA 3ILSA 1Q1GA 3VR3D 3WZMA 2REQB 4MQEB 2A58A 4LCJA 4MROA 5A3JA 4RX1A 4HDNA 5GZ3A 2W6PA 3HYCA 4KE9A 1Z0UA 5AKHA 3EC7A 4UM9D 4KTVE 3OFKA 1R9GA 5IC4A 3FPHA 3IAHA 5JJKA 3V4PB 4YCAA 5SYMA 3I5XA 4AY6A 1KU0A 5MFPA 4CQNA 2FMHA 2ZAGA 1VXOA 3TVTA 1JBEA 1WEKA 1E5LA 3TLGB 1IB6A 2I7TA 1QKKA 2AHOA 2OBMA 1ZYUA 2XOXA 3EQ2A 4R0VA 3RTGA 3VV3A 5CB8A 5J5CA 3GK3A 3GX1A 3B6EA 3H9GA 3DPIA 1XCOA 3RRMA 1TAUA 4FHCA 4BJHB 1NUTA 3DP9A 1TU0A 3SXUA 1VCIA 3GEHA 3ZV5A 3ELDA 3ID6C 2QN9A 3LWNA 3MHTA 1X7DA 2PTHA 5AOVA 3ELUA 1TYCA 2QAIA 2QAGC 3PNOA 3EGEA 1MHTA 4D9KA 2MHCA 4GKAA 5CPBA 3TZEA 3ZIAD 2DFPA 1Z2NX 2XB4A 1KBOA 1QQTA 2GPSA 4KYTA 4V0OA 5C18A 2ODNA 4HGZA 5A05A 3WMRA 2BBWA 4WKGA 1XU9A 2NQTA 2P11A 3PXXA 4FHDA 4FLEA 3SC2B 1SR8A 2C1ZA 4CMAA 1HT2E 2HTEA 1JFFA 4NFHA 3JYHA 3JWGA 3PQ5A 4ZJUA 2VCEA 2H1FA 4NDNE 5FAXA 4RVUA 2AYZA 2XMQA 1OXBB 1I3MA 2QY6A 3FYCA 2Z8ZA 2AR0A 3GLHB 4RVCA 1SG9A 2Q3MA 3V8RA 3UK2A 1SCUB 3OTIA 1CEYA 3HMQA 2VNHA 2Z9CA 4H3SA 4P8RA 3PGA1 3H9QA 3DLCA 2JHFA 4MV6A 1DOZA 2R00A 3SZRA 1CUEA 2E6UX 5J4LA 5INTA 4MJXA 3PRHA 1MB9A 1ISHA 1FFSA 3DUFB 1Y34E 1OB2A 2Q1WA 3M5PA 4UUQA 4B4DA 1BDHA 2R62A 2NVWA 2GOYA 4QJ3A 3VDXA 4W7IA 1OPXA 2WVJA 4BCCA 4YQEA 3CLUD 1WKVA 2FSSA 3AIIA 2HUPA 1SUAA 3MUOA 4GGMX 4GM1A 4MRRA 3SG0A 4PAMA 3KYDA 5CA1B 1I0ZA 2C4UA 3SIXA 3IAM1 5AMXA 1OI4A 1QVRA 3QP9A 4IDQA 2B3TA 2FE4A 4KLRA 5COQA 3QQ5A 2X9QA 2JH8A 1IDOA 5I3ZA 2QTBA 3CONA 5EI5A 3U3KA 4L5BA 3AY0A 3GUCA 3SAJA 2XMBA 3SCZA 3WS7A 1F9EA 1DRJA 4ZAFA 2PT6A 5B36A 1G3MA 5JD5A 1Z4JA 1SG6A 2AE1A 4JOCA 2XMZA 3OQMA 2RK3A 2EP8A 1WDWB 1WUKS 3N8NA 5LQRA 2FMTA 4EYGA 3ANTA 2JI4A 1UDXA 4IX1A 4MLZA 5K0JA 2Q6VA 1J8DA 2HU7A 4JVSB 1VKOA 2J4CA 2RJOA 4EB8A 4B81A 4DJ5X 4N39A 3EXFA 3EXHA 1SPBS 2Y67A 3V1KA 4F3YA 3H16A 1LSUA 1ZLXA 3JR3A 3VPBA 1QDUA 1MMFB 2MSNA 2PX6A 4M53A 1CNFA 1JHXA 1NXPA 2FFQA 4TZ6A 1FZQA 1C7RA 4JYZA 4D97A 4BXOA 4AZ3B 2EG5A 2HF8A 2ORIA 5BN5B 3V34A 2F4VB 1O87A 1E63A 1KS2A 1T9KA 5ICMA 2WR8A 2XAUA 3BQNB 2WSYB 3TIFA 1QORA 5B6PA 2BMJA 1J20A 1B0ZA 1F38A 2A3RA 1YQ9A 4MKZA 1XMPA 3EUEA 4ALNA 4JOQA 2QQ5A 3GCWA 3MXOA 4E12A 5JV5A 1OIXA 4DSAA 4F56A 5C7OO 1E0SA 1K68A 2CHUA 1Y63A 1T5HX 5KAPA 3ZWNA 4PG4A 1FRFS 3D3KA 4TKVA 5IRCD 3FYSA 3MSXA 1NF8A 4YMHA 1A8HA 3IV9A 3UT0A 2E6KA 2J5QA 5IM4F 3FVVA 2FPLA 1LVGA 2GESA 2O8NA 4IS2A 4OP3A 3ABIA 4QDJA 4AK9A 4EA8A 3URKA 3BIOA 2HSGA 1HFKA 2PZGA 2BN4A 2YMLA 3IPLA 5A5EA 3JAKB 4F4IA 3U5ZB 1UBHS 1JEJA 2DSTA 4N0DA 5EIHA 2BEKA 2ZVQX 1FVXA 1W5SA 2O2XA 4HGYA 1H2WA 2PM8A 1CNMA 3PXUA 1YTUA 1OAAA 5HCNA 3BL5A 5K6RA 2EZ4A 1PR9A 4ND6A 1JFSA 2EDAA 3S2GA 3EEIA 1JILA 2JCBA 3O0TA 3P8ZA 3T06B 4K40A 3H4VA 4CTMA 4IY1A 4Q9NA 3LU1A 4MVJF 2WG1A 1B1CA 2YHIA 3COPA 3H8WA 3TGWA 4BV8A 4OFZA 1FFBA 5JJ5A 5KVSA 2VQEB 1ZR2A 5JCJA 3A6PC 4RA9B 5C7YA 2JASA 1A9RA 3AIOA 3NAQA 3NXKA 3PUYA 1S3SA 2WMDA 4MLDA 1R66A 4REQA 5E4TA 3UT5A 3ORFA 4PE5B 4C06A 5J58A 5EXDA 1RI1A 3QBTA 4FGLA 4LA4A 2JRLA 4MEBA 4DWOA 5L53A 2B0JA 2O2YA 4FCCA 4ENPA 5A1JA