3JQBA

Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor (nadp+) and inhibitor 2-amino-5-(2-phenylethyl)-3,7-dihydro-4h-pyrrolo[2,3-d]pyrimidin-4-one (dx6)
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
267
structure length
249
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pteridine reductase 1
publication title Structure-based design of pteridine reductase inhibitors targeting african sleeping sickness and the leishmaniases.
pubmed doi rcsb
source organism Trypanosoma brucei
molecule tags Oxidoreductase
total genus 94
structure length 249
sequence length 267
chains with identical sequence B, D
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2009-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3jqbA00
3VC7A 3QY9A 1WZIA 2UAGA 1PX0A 3VH2A 3MJVA 1PL8A 3WBFA 3D3WB 1NBOA 2X0RA 3SLGA 5L7YA 4BO8A 3MZ0A 1GQ2A 3ABIA 4Q3BA 1B26A 3JQ8A 4TRMA 3ZWPA 1W73A 4FCCA 3TZ6A 4NFHA 3MEQA 3DL2A 1E3LA 3G1TA 4DREA 1D3AA 2C82A 4PLCA 1EK6A 4PRKA 4OKNA 5JS6A 1IHYA 1T26A 1I2ZA 3GVIA 3F1LA 3RQSA 4A5OA 4ILKA 4PG5A 1YH3A 1LUAA 3LZ6A 5G4LA 2POQX 1GZ6A 3RI3A 1EVJA 3WTCA 1PGNA 4II3A 2ZTLA 4MVJP 3NYWA 2VT3A 5JDIC 3JQAD 2WYUA 4XYEA 2O3JA 3MJSA 5JAIA 3CUKA 2FY8A 4HFMA 5JCJD 4GI2A 4PZCA 5CDTA 2HLPA 1HDCA 2JD2A 1ZXBA 3ZV4A 2C29D 1LNQA 4DQXA 2NLOA 5C7LO 2IZ0A 3QRWA 3GEDA 2DM6A 2FP4A 3E5MA 2AQHA 2FPGA 3RSHA 3PIIA 2CDBA 4AL4A 1YBMA 3W4IA 2WD8A 2B4QA 1OZAA 3PP8A 2JCYA 2AQIA 1H93A 1QKIA 2D4AA 4FQ8A 5T8KA 3UCEA 3JYNA 4CUKA 3T7CA 4HFRA 1Q7CA 4J16A 1GZ3A 3HE3A 3DFUA 4YAKA 3TWOA 3GUCA 3VZRA 4GBJA 4CPDA 3PGXA 1PJBA 3O4RA 4X54A 3WNQA 1LBEA 2PGJA 5L51A 3GN2A 3AY3A 4B4WA 5BR7A 3D4NA 3AUTA 3FPLA 1I3LA 4Q3NA 2E49A 1RM0A 3WXBA 4A03A 2DTEA 4PN3A 3JCZA 1SEPA 2VYVA 1NAIA 3A1NA 3BYZA 3QQPA 4YEDA 5FWNA 3M1LA 4GMGA 4R51A 4BO5A 5CG2A 3E6AA 3KEOA 2Y93A 2Q2WA 1UAYA 4UVHA 3OBBA 5ES3A 1T2EA 3GPIA 4DL9A 3LLSA 3ICPA 3JQ8B 4BO7A 2F00A 4HP8A 4ZQBA 5A4DA 2AEJA 1I32A 4CMCA 4IS2A 2EG9A 4AJEA 4IPTA 3VTFA 3BA1A 5T6BA 4BNMA 1V3VA 4BQRA 5BNFA 4NBTA 1QYWA 2Q4BA 3RKUA 2IEBA 3L4BA 3VZPA 1E3JA 2ZB8A 4XQCA 4UUOA 4E3ZA 3JQ9A 5G0UA 2FWMX 1I3KA 5A3JA 2C07A 3WJAA 3VDQA 4JGBA 4H16A 1LC3A 5HA5A 2VRCA 2X1HA 5BSHA 5G0SA 1YONA 2Z5LA 3ZWVA 1XU9A 4ZICA 2Z1MA 2C2XA 2JAHA 4OHUA 4PLGA 3RKRA 1YJ8A 1U4SA 1UDCA 1KVTA 5CDSA 5G2OA 3UOGA 1DIGA 1PWZA 3JQBC 3OSUA 3VPHA 4WCDA 2EKQA 3B70A 1J6UA 4Z9XA 4BGUA 1R37A 2DPHA 2OBNA 1OC4A 4CMKA 3GR6A 2RBEA 2GASA 3PWKA 3QVWA 2J5QA 2X5JO 1Z7BA 2GN9A 4M86A 1B8PA 2NVBA 3WQRA 5DZSA 3WSVA 4W9NC 1XQ6A 1JWAB 2VHZA 3LT2A 2A35A 2PLAA 2P5YA 3LC1O 4E31A 2EV9A 5B4VA 3PVZA 3K31A 4ZRNA 3U09A 4JNKA 1AHHA 1EVIA 1U3WA 4JCOA 1B3RA 3C7CB 1E6UA 3VHRA 1SNYA 1K5HA 1YDWA 2VHVA 1BG6A 3PGJA 2I67A 4WEQA 2OP0A 3ZWCA 4D45A 3H9UA 3VDRA 1DHTA 4LCEA 1LU9A 2LDXA 4L74A 4JK3A 4WUVA 4E5MA 2IZZA 3L4SO 3HB4X 4F3YA 5G0WA 4DMLA 1XWFA 4BNGA 1DDOA 5JDCC 1HYEA 2VZ8A 1LA2A 2V6FA 3DBRA 3FTNA 1GQQA 1WW8A 1I10A 2AQ8A 2VQ3A 5EERA 3ZZNA 4IMPA 3ZDFA 4OMUA 3ZH2A 1UXKA 4JBIA 3FCOA 3SLKA 1EQ2A 2WD7A 3EHEA 4CMAA 1BXKA 1K6JA 1H2HA 1VL0A 2AXQA 1VSVA 4P8RA 5TLSA 1YB5A 1CJCA 1UJMA 2X58A 4CMJA 1CERA 1CYDA 3D5QA 4OM8A 5F3RA 4XZ3A 2O3QA 5BT9A 3TDKA 2QHXA 1ZH8A 1DEHA 4XQGA 3PXXA 3H5NA 1XCBA 2Q49A 1WWKA 3WFIA 2AEFA 4I5GA 4R1NA 3ZWXA 5KTKA 4K6CA 2VZ0A 2OXIA 3WGIA 3HNPA 1ZCJA 5AQ1A 5T67A 2DUWA 1XGKA 4QTZA 1LRJA 4BKRA 4ZD6A 1O89A 1UH5A 1YGYA 5KJFA 2YFQA 1SBYA 3GMDA 4BMNA 3TPCA 4U0KA 1PGQA 4L75A 5C7IO 4MKXA 1HLPA 4LRSB 3AU9A 1DFGA 4YT5A 3JTMA 3ST7A 3LC2O 3S2EA 4BNKA 4K28A 5AXAA 4NJMA 1SB9A 3RCBA 1EEHA 2P9CA 1E1KA 2QYTA 1BDBA 3PRJA 3DZGA 4E5NA 1DIBA 3O26A 1HDGO 9LDBA 5EMHA 3BIOA 4BB5A 4Q3CA 3OQ1A 3GNSA 2SCUA 1KY5A 3E18A 4RF2A 2QIOA 2WWRA 3IC5A 3KEQA 4BGEA 3LU1A 4E5YA 3BHIA 4D79A 1GCUA 3AM5A 1WDMA 1GUZA 3DBRB 1E3SA 4DVJA 4WPGA 4UEJA 2HJSA 3VTZA 1JVBA 4FFPA 4W7IA 3Q9UA 3OJOA 2HCTA 3L9XA 4RPHA 1PJTA 4WLEA 2WD7B 3GVHA 1W4ZA 4CLHA 4XDZA 3I52A 4B8WA 5KNLA 1HETA 1RYEA 5EN4A 4MP3A 4XB2A 5IDQA 1C1DB 2VOEA 4EDFA 5A5EA 5KJEA 4GGPA 1I33A 1TA4A 2VRBA 3GFBA 3I6IA 4CODB 1E1LA 4S3MA 3L6OO 3NKLA 1BDMA 1VL8A 1W0CA 3OECA 3GEGA 2PZLA 3OMLA 3C1AA 1GCOA 3X2EA 1PJ4A 3H3FA 5DBIA 1LSOA 1NTOA 2PD6A 4XRRA 4XA8A 2DPGA 4E4YA 4OSPA 3M2PA 5CDYA 1JKFA 5ICSA 3FWZA 4M55A 3VPXA 1HTBA 1PR9A 1X13A 2O2SA 3CKYA 3LVFO 3IDSA 3DTYA 3PYMA 4NG5A 2IEDA 1GUYA 2PFGA 5AOVA 3I9MA 4L73A 3ZU2A 4PG8A 1DRVA 4CLRA 4PIVA 4DBZA 1E7RA 5COQA 1GL3A 4MINA 1FF9A 2HUNA 2V6BA 1UXJA 4XGIA 4PZEA 1CIVA 4NJMB 2NQ8A 4FJ1A 4M49A 3GA0A 4LMPA 2GGSA 1QYCA 3ETDA 1EUCA 3VZQA 1Q0LA 3HHPA 2VUTA 3PFFA 1NNUA 3CPSA 4D0RA 3CXRA 1KVRA 2WYWA 3KYBA 1NX6A 1P74A 3O9ZA 4OO3A 1WMBA 4F45A 4CLOA 1MX3A 1HE3A 3GNTA 2I76A 1U8XX 2YW9A 2R2GA 4QXMA 3G3EA 1CEQA 2Y1CA 3CZRA 3C8MA 1U9JA 1KVSA 5CPFA 2C5AA 4CM7A 5DBFA 3NUGA 5C37A 1KC1A 1PL6A 5TNXA 1SEVA 4LRTB 4NIMA 3WOHA 1DRWA 2R00C 3HQ4O 4BNZA 1FDUA 1P1IA 3INRA 4YWJA 1UXIA 3DHNA 4JIGA 4XYGA 4UEKA 1J5PA 4XD2A 3WG9A 1MFPA 4OOEA 2WM3A 3I3OA 4BNJA 1FJHA 3H7AA 2V6MA 1AXGA 3F3SA 4B7UA 1BRMA 4JN6B 2BI7A 1DOHA 3UFXA 3QVTA 3V5NA 1RYDA 4J0EA 3JQAA 3GDFA 3ZCXA 1BVRA 1GUFA 3W4JA 1P31A 2UDPA 4J4TA 4PLHA 4J2HA 4ZU3A 1U5AA 2ZIZA 5L40A 4NBUA 1WAMA 2CZCA 4XQEA 3TNLA 2Y1EA 3KSDO 3U4DA 5A02A 2RHRA 1A4UA 4BV8A 2X8LA 4KOAA 3D4OA 4E32A 5L4NA 3AJRA 1QMGA 4NU6A 2OORA 2JJYA 1DLJA 4QSMA 2WJPA 5T5QA 1DO8A 2AW5A 4XJTA 1HDOA 2IXBA 2GRAA 1ENPA 2DBZA 2FPIA 4CLRB 2I65A 3VVBA 3ENKA 5C3MA 4FGSA 2CVQA 2ZTMA 1DAPA 1YVEI 2D8AA 5CAEA 3U9LA 1QRRA 3I83A 4J9UE 1LXCA 1ZXLA 1IZ9A 3EDMA 1N7GA 1JU9A 5GZ1A 1NHGA 2ZB3A 2C0CA 5A1TA 5IXYA 1ZK1A 4BNLA 3HFSA 3H8VA 3UH1A 2X22A 3IOYA 3GGGA 4Y67A 5TRTA 5LDHA 4CLOB 4QECA 3W1VA 1ZVMA 3LLVA 4PG7A 3FN4A 1NM5A 1MC5A 2ZYGA 1E7MA 3WYBA 5L45A 3PDUA 4QFDA 4MVJH 4TVBA 2JCXA 2PK3A 4I5FA 4A7PA 4FOSA 2BGKA 2YHUA 4AVYA 4BV9A 4ND3A 1A5ZA 5DF1A 3R1IA 1DIAA 3A4VA 4IJWA 5DCWA 3PHLA 3WIDA 4BNUA 3HG7A 3DAGA 6ADHA 1RKXA 5HS6A 4Z9FA 5JSFA 1F8GA 3OJFA 3I4FA 2YQ5A 1L1FA 1S6YA 1VLLA 1EMDA 4XR9A 1U28A 1T2DA 2HK8A 1QYVA 3JD1A 3Q6IA 3RASA 3WGZA 4ESOA 1Y9EA 3D7LA 3GGOA 3F5QA 3BAZA 2EWMA 3NGXA 2X0IA 2QRKA 3JQAB 3PIDA 4BGVA 4EUHA 3RFVA 4WK6A 3LQFA 1PS0A 2EERA 3DZJA 4E0BA 1N1EA 3WGQA 2IE0A 4PVCA 1ISGA 1EVZA 3PPIA 2Q4EA 2D2IA 4WGGA 2Q99A 3DB2A 1YQXA 3IUPA 4HNHA 3TF5A 1Y8QA 1PS8A 5JE8A 5FYDA 1D7OA 3AOEC 1Q0QA 4NBVA 4UVDA 4BIIA 3MWEB 4K26A 4P38A 4EBFA 2RH4A 4NFSA 2BKAA 4GWGA 1F0YA 4ZA2A 1U3UA 3QWIA 3Q0EA 4FFRA 4IS3A 4QEDA 4YYZA 2P4HX 1RJWA 4QO8A 5TSDA 1HYGA 1HSZA 5LCXA 1WMAA 2EKPA 1EUDA 2OO5A 5EINA 5LC1A 2ZATA 4BO0A 4MVJD 4OOFA 1VKNA 1DXYA 3QJ5A 3OJEA 1DC3A 3WQQA 2VHWA 3R0IA 2EP5A 4NH4A 2LDBA 1A7KA 3NT2A 4CM4A 4J1SA 1I8TA 1X1EA 1YBAA 3EC7A 4GLLA 3JQCA 4J7CA 1DPGA 5TF4A 1B14A 2G17A 2P9EA 3UAGA 3ZU4A 5I8ZA 3ROQA 3VKVA 1PGJA 4JXKA 1PS9A 1UUFA 2I99A 1U5CA 2B83A 2YV2A 4CM5A 4YQZA 4TZTA 3I1JA 4RVHA 3M6IA 3U62A 5JLAA 5CHEA 4DLAA 5L4SA 4QO7A 1UDBA 2QX7A 3V2UA 1GPDG 5FF9A 2BMAA 1B0AA 3HFGA 4PRLA 1E6WA 1QP8A 4ALJA 1PR3A 2DT5A 4RPLA 3ZWWA 2C54A 1ISMA 1ZMTA 4MKZA 3MTJA 4HADA 4E6PA 2X23A 4U8GA 1Y5RA 4IDCA 1G1AA 2E48A 4Q3DA 1CETA 5HTOA 3V1TC 4F6CA 2ZK7A 3TZCA 5CPBA 5KKCA 1H6AA 4KWHA 3GHHA 1ZW1A 2ZJ1A 1RM5A 1PTJA 3RUEA 2CVZA 3E9NA 3GUYA 4MIOA 2PD4A 4XGKA 3T4EA 4J0FA 4MP6A 4NK5A 4Y6SA 1Y8QB 1KYQA 5COBA 3KUXA 4XRGA 1NAHA 2AE1A 3CSDA 5JW6A 4R9SA 4NMHA 4R5HA 2B5VA 1JDJA 1M76A 3TSCA 5JAZA 3HWRA 3W8EA 3WYCA 2X0NA 4XR4A 1Q2XA 3L07A 3ONFA 3K6JA 1TT7A 4BKUA 4Z6KA 2Q50A 3E48A 2Q45A 4MVJI 3IAHA 2WE7A 3O8QA 4BQPA 2J3JA 1PWXA 1NYTA 1TT5A 5COAA 3MWDB 1LDNA 3IKVA 3HDJA 1UR5A 4LK3A 2AG5A 4PLTA 2DBVO 2PR2A 3I9OA 4DPLA 1QV6A 5BNTA 4XYMA 4CM4B 1IULA 2G82A 4PLWA 1UZLA 3NV9A 3NTQA 4JROA 4Q9NA 5B37A 1WDKA 2UUPA 2WE8A 3G49A 4BMSA 5DNAA 1SAYA 5JY1A 4GLOA 1B8VA 2IDZA 1NR1A 1LLQA 2CF6A 4G81A 4A2CA 4GAEA 3GZ4A 2O7QA 3RBZA 2YDYA 1MP0A 1DC6A 3HUDA 5AYVA 4I8XA 3WR5A 1Z74A 1LDYA 1PZEA 3JQFC 1WDLA 3Q9NA 5KVVA 5I7EA 3IJRA 3WWYA 1ULUA 2ZJ0A 4H15A 1R15A 1T2AA 2Y0EA 1JQBA 1NPYA 4Z3KA 4IY1A 4XWYA 5U1PA 4R5MA 1C14A 2G0TA 1XG5A 4GX5A 1GAEO 4GKVA 5JNLA 4FBGA 4FDAA 5CFZA 1OOEA 1U3TA 3CMCO 3NT4A 4CUZA 1I30A 2I3AA 2UV8A 3MJTA 3JYPA 3B1KA 3GVXA 1E7SA 4BNTA 1CF2O 4JJGA 1LX6A 2DTDA 4OAQA 1NWCA 2I6TA 3QIVA 1ADCA 4YVFA 3EUWA 1P0CA 4FN4A 4RL6A 4FIZA 3GVPA 3SEFA 3PJFA 4PZDA 5AXBA 5A9RA 4J3FA 5I7SA 3AI3A 4D3DA 3QW2A 1GYPA 4J49A 4WOKA 3RJ9A 1LTHR 1HLDA 3O8QB 2HMVA 1CQJA 2EP7A 1TT5B 4YBZA 4BHTA 2VTEA 3ASVA 3KRTA 3GDOA 3AOEA 2HDHA 1LLUA 4IXWA 5DT9A 3U4CA 4W6ZA 2B4RO 5IDWA 3VH1A 4BGIA 4AJ4A 1V3UA 4RF3A 2YV3A 1OMOA 3OIGA 1IL0A 4FC6A 4Y9DA 3GG2A 2X4GA 4IDBA 8LDHA 5JMWA 2J5RA 1LC0A 1V9LA 2EF1A 3L9WA 4Q3AA 4CMBA 3D0OA 1X0XA 2Y68A 1ZMOA 2D59A 1LQTA 4NQZA 4OKIA 3F5SA 4GL4A 1SZJG 1E5LA 1A72A 2GYYA 1VE9A 4Z0TA 1BHSA 3DBVO 4N5MA 3C1TA 1JA9A 2WEKA 2Y99A 4BO2A 5BSGA 2VN8A 5ILGA 3WICA 2I3GA 2B0JA 2B37A 4XX0A 3NTRA 1GR0A 2A4KA 2PZJA 3JD2A 3JQDA 4LVCA 4C4OA 3K5PA 4E5PA 5K9ZA 2XXBA 3BHJA 1YL6A 1UZMA 2E6UX 1UP7A 1X14A 1N2SA 3C85A 3F4LA 3IJPA 1PQPA 3RROA 3LK7A 4CLDA 1KEPA 4D3SA 4IDFA 4RJTA 1MA0A 3LT1A 4ND5A 3LC7O 2BLLA 2Y05A 4M89A 2UVDA 1BXGA 5DCYA 3A14A 2BELA 2HK7A 3GHYA 2AA3A 3ITKA 4LN1A 4MVJM 4IMRA 4KUEA 4A27A 4RF5A 4PG6A 3NAQA 4CLXA 2DC1A 4TKLA 4W7HA 4XQ9A 2D5AA 1U4OA 1X7HA 3O03A 4P22A 1N1GA 2DFVA 3F46A 1Q1NA 1JAXA 4R01A 4D46A 1GYRA 4II2A 1K6IA 3BHMA 3PHGA 2WDZA 3D3EA 5G4KA 5TX7A 2CVOA 2HMUA 3PYXA 1ZZEA 4E30A 1IOLA 1NP3A 1TB4A 1T2CA 2NM0A 3AFNA 5CDGA 5MGBA 1VJ1A 4WASA 4TRJA 4KDEA 5CEJA 3PJGA 4MPDA 1YL5A 4RVUA 3SJ7A 4AJHA 3V2GA 1GDHA 1U2GA 4D43A 3PWZA 3WFJA 1T1RA 4J91A 3PDJA 5EJ2A 2J8ZA 3TZHA 1PJCA 2AEMA 4K9DA 3OJ0A 3GH3A 3HN7A 4WCFA 2PH5A 1NHWA 1M2WA 2W2LD 3S1LA 2I66A 3UGKA 4CMEA 3MOIA 1E7QA 2GZ2A 3BMOA 3VZSA 3BMCA 5ITVA 3C7AA 2Y1GA 3EY4A 1N9GA 4L4RA 4BL5A 1YQDA 3UKOA 1EVYA 2GNAA 3K2EA 4A0SA 1C0PA 3DMTC 3TZQA 1E0DA 1KERA 4RPGA 4WLOA 5DOVA 3DXFA 4R4JA 1E7YA 1B8UA 1FDWA 2PV7A 3M2TA 1ENOA 1SPXA 4I08A 3RD5A 1O0SA 3ZWOA 3JQFA 3NGLA 2NQTA 3DZKA 4XGNA 5A9TA 5TIIA 2C7GA 1LJ8A 5T64A 1LSSA 1LEHA 4CQMD 5KJCA 3D5TA 1BXGB 1NASA 3F1KA 3PHIA 4RQUA 1C1DA 1ZK2A 3A9WA 3FNFA 4NHEA 1S7CA 3WDSA 5A03A 4CM1A 1H9AA 5TJ9A 1GV0A 2O2YA 2RH8A 1NPDA 1YL7A 1E7WA 4J2OA 4YAJA 3UXYA 2PZKA 4KTTE 3RUCA 4MVJA 2VWGA 2XXJA 1C0IA 3DHYA 4E2YA 4BNXA 1E6EA 2BGLA 3GN1A 4OXNA 3WQSB 1WP4A 3GRPA 5A3VA 2F1KA 4RPKA 1LSUA 5K6AC 2GN6A 2DUUA 3NRCA 1OC2A 4ALIA 5G4KB 1P1KA 1P44A 4RDHA 4CM9D 6LDHA 1ZFNA 2RIRA 1EUZA 4NI5A 5ENVA 1PIWA 1ORRA 3DBLA 5JDIA 2BFOA 4RZHA 3K9QO 4KUGA 4AICA 5L4LA 4E2XA 1H2BA 4OSOA 2VCYA 4ZQHA 1CQIA 1HZJA 1YJQA 3NDIA 4K1LA 4IQ0A 4MKRA 4PLYA 3RBVA 3RBXA 5IDYA 4TRNA 1B2LA 3KB6A 3FI9A 3CTMA 4YXFA 1H5QA 3KXDA 3KSZO 3WMXA 5B1YA 3EYWA 3DZIA 4IXTA 2OOSA 3L77A 1F14A 3EZYA 1K89A 4WCFB 4D7AA 3JQ6A 3P5SA 3Q1LA 4RORA 1H0KA 2NACA 3BMOB 3T4XA 4UUMA 1EBUA 3BMCB 4OH1A 1Y5MA 4WECA 1N9GB 1U1IA 3V1YA 2IYOA 4RVFA 2Y1OA 2G5CA 3GAZA 1XQ1A 4XIYA 2TMGA 3D4PA 4JJIA 4O59O 1IPEA 3F9IA 3GVCA 3LT4A 2EJWA 4UUPA 2OGUA 1DSSG 2P68A 3G79A 4L4XA 3ZW8A 3VH3A 3KBOA 1ZBQA 3WTBA 4Y8VA 4LISA 4TSKA 4NBRA 4IIUA 4N5NA 1QYXA 1HEUA 4E33A 3E9MA 4BS9A 4I9UA 3ZNOA 1J49A 4PLVA 4Q39A 2GZ3A 4LSWA 4BKPA 4CR7A 1GEEA 3JQGA 2R6JA 1ID1A 4LW8A 4R9RA 1PSDA 3GMSA 3S8MA 3VPGA 3W6ZA 4FOOA 4Z3DA 4WNIA 4BO1A 3ZHBA 3OEWA 1XA0A 1O6ZA 2X9GA 2YDXA 2HRZA 5I7FA 3AWDA 4D41A 5MDHA 3RFTA 3I9JA 3OEYA 5JCXA 2Y0DA 5LDGA 4B8ZA 1ONPA 2DLDA 2Y66A 1HDYA 1R12A 3GG9A 4AG3A 3DBLB 1H6CA 4CR8A 5IJZA 3BTUA 3D64A 5GMOA 4IJVA 3GY0A 2HJRA 1SMKA 3JD0A 3GZNA 5DP1A 5U4QA 1PQWA 3DFZA 4JBGA 4JX8A 3ADOA 1A9ZA 4FGWA 1HYHA 1IY8A 1VI2A 1ZEMA 3P19A 3R3SA 3V2HA 4B7XA 1GZ4A 2BRUA 4BVAA 3VKUA 4F6LA 4YRAA 2PKQO 1YO6A 2QRLA 3JQBA 2PTGA 4Y6PA 1RPNA 1QXSA 5EPOA 3RC2A 2NVUA 3COSA 4BB6A 2W90A 5KVQA 4N5LA 4OIMA 4A73A 1YE3A 4J7UA 5TC4A 1HDZA 1HF3A 4YAIA 4W9NA 3BXXA 1HE2A 2P91A 4IZIA 4O63O 1BVUA 3L0DA 5ILOA 2ZKLA 1QV7A 5JYEA 1ONNA 5HBRA 5F21A 3A28A 1M75A 2DU8A 3ZWYA 3RFXA 5JBIA 4AJJA 4R54A 2O48X 2VYND 4IDEA 3RC9A 1X7GA 4DIBA 1KS9A 1HKUA 1ZK0A 2V7PA 1JLLA 3GNQA 2I9PA 4RQTA 2E82A 4M87A 4BKOA 1GPJA 1NVGA 4ZN6A 3UN1A 2FR8A 1PQUA 3KYCA 4OGWA 4D44A 3DMTA 4JP2A 2Q2QA 4A10A 4ZJUA 5JDCA 1O8CA 4BOYA 3JQGB 5JCJA 4MO2A 2PKQP 2AE2A 2EJVA 3K8ZA 1HXHA 1DFIA 5IN4A 1H94A 3WGYA 2HMWA 2CMDA 3WB9A 4IUYA 1UDAA 5TS3A 4ALLA 4GX0A 5L53A 1NXQA 2FN7A 3LDHA 4HUJA 3AW9A 3QWAA 3S2IA 4P4LA 1ZSYA 4LMRA 4HKTA 3VPFA 3AOGA 3DTTA 2J6IA 2NNLD 5CP8A 3UUWA 2GR9A 5A06A 4BNNA 2QG4A 2YHIA 3GZNB 4ZRMA 3TZKA 3EAGA 1JAYA 3BMNA 1E3IA 3N58A 1PU2A 2X0JA 3B6ZA 3DOOA 3VOSA 4DLBA 4FB5A 1PEDA 2VWQA 3DHEA 3F4BA 4IQ8A 2CNBA 4TWRA 1LSJA 2QZZA 2Y67A 3GRKA 2Y1FA 4ONEA 4XYLA 3QV1A 2NVUB 3Q2KA 4U0JA 1M66A 4YB8A 5F1KA 3RU9A 1P77A 2QQ5A 4IDDA 4WLVA 1R6DA 3C24A 4QT0A 1HE5A 5IF3A 2VRCD 1H6BA 3HDQA 3C7DB 3DOJA 4LGVA 4CV0A 2BFPA 1NVMB 3BTSA 1DC4A 1LDMA 1VJ0A 4YDRA 3EZLA 3PTZA 3ZGYA 5CDUA 2B4TO 3RAJA 2CY0A 3SXPA 3ZNQA 2FZEA 1ULSA 3HDYA 1AHIA 2IYPA 2NTVA 1UP4A 3KYCB 1O95A 4H7PA 3TOXA 4GPD1 3O38A 4EEXA 2PA3A 3PZRA 1Y1PA 2EGHA 3ANMA 3ETEA 1AN9A 2C20A 4D42A 2ET6A 2A9FA 1WPQA 1K0UA 1IZ0A 1MB4A 1NR7A 1V0JA 1YS4A 2JD0A 3GAFA 3H2SA 2PD3A 5GY7A 1XHLA 2ZTVA 3D1LA 1ZK4A 2HRBA 3PK0A 4YCAA 3W8FA 5JAMA 4Y98A 3I4CA 1BTOA 1R4NA 3DWFA 3LF2A 3PQFA 4JJFA 4O5OA 1VPDA 4KWIA 2H6EA 3ROPA 1ISFA 4J4BA 1QYDA 2EGGA 3SVTA 2YHIB 2C5EA 4Y6RA 4BMVA 3BMNB 3ZHXA 1C3VA 1YWGO 4ND2A 2CFCA 3DONA 5TQVA 2WSBA 3CH6A 2O23A 2VNSA 3ZU3A 4NU5A 3IP3A 1QLJA 2CDAA 2NTJA 3ADPA 3B20A 4CMHA 4E12A 1E1MA 3ON5A 1G0OA 1KVUA 3AY6A 3JQEA 5DCUA 3BMQA 3TJRA 3WWZA 4XYBA 4GVLA 2J5KA 3E03A 4XIJA 2W2LA 5IN5A 1NQOA 4CQLA 4M54A 3KV3O 2P4QA 3P7MA 5T8KC 1NQ5A 4AJIA 5IXSA 2O7SA 4FS3A 5DBGA 2BHLA 4WE3A 2NSDA 4KQWA 1YB4A 5DN9A 5FEUA 3IS3A 4XEHA 1I0ZA 1FK8A 1I3MA 2GUGA 4MDHA 2GDZA 4C7KA 4R1SA 5A04A 4N7RA 3JD4A 1N8KA 5HS4A 3FNGA 5KVCA 3OH8A 2GN4A 4ZQFA 1IHXA 1ZEJA 3IIEA 4KDFA 5I9LA 3DEYX 4M1QA 1I5RA 4AJPA 4DPMA 4I1IA 4IJKA 4MP8A 4BO4A 2BH9A 3H5RA 1ZIDA 1EFKA 2EW8A 3GEMA 4AJKA 1JKIA 4ND1A 4AJ2A 3AUSA 3OA2A 1P45A 1KEUA 5JMPA 1YQGA 1JKJA 3QSGA 4A26A 3ASUA 4E2WA 3WBBA 2R00A 4J9VA 3ZWNA 3TN7A 5I9NA 3TL2A 4DLLA 4XCVA 3KYDA 1DRUA 4R41A 2FSSA 3AM4A 4TQGA 4YT2A 5IDXA 4EJ6A 1Q7GA 3H4VA 5L9AA 3PHJA 2X6TA 1GYQA 1P33A 1R4NB 1LLCA 2FHSA 3LYLA 3ZN2A 4E13A 4ALKA 4TRRA 3DZHA 4G5HA 4TROA 4AJLA 4DA9A 1N92A 4EZBA 3L4BC 3FNHA 2HSDA 3JQ9C 2OP1A 4R1UA 1QG6A 4MIYA 1ZSNA 2XAAA 4DWVA 3RUHA 1NQTA 4RVGA 3WIEA 3WSWA 3QWHA 3ZNNA 4B4UA 5HM8A 1NFRA 3KETA 4NNJA 3I9LA 4J90A 3GLQA 3BMQB 1EK5A 3VAZA 3FHLA 3MOGA 4QQRA 4UUNA 4CQLB 1SOWA 1HWYA 2CSUA 5TJHA 4YAGA 5IG2A 1PJLA 4NJOA 4B4OA 4INAA 4Z0HO 2FR0A 3PZBA 1TVEA 2DKNA 2JHFA 4PLPA 4YJGA 4R3NA 4BNVA 5C7OO 1AE1A 4DPKA 2PNFA 1XU7A 4U6SA 4O1MA 3VPSA 5L7TA 3RWBA 1LRKA 1XSEA 3GK3A 3OF2A 4AJ1A 5THQA 2FRDA 2W2KB 3DAFA 2GERA 3PEFA 3L6DA 5B4TA 3K30A 2AHRA 4J1TA 3QVSA 5KJ1A 4YPOA 3I9KA 2VWPA 4IZHA 3ZV6A 3C1OA 1MXFA 4UREA 3HDHA 3STHA 2HMTA 1GTMA 3AU8A 4GKBA 3VVCA 1K6XA 1PL7A 4KUHA 5GZ6A 1D8AA 1GADO 1KC3A 4IINA 1LDBA 4U5QA 1XYGA 3KYDB 1ENYA 4DGSA 1PZFA 4ROSA 3I6QA 3DZBA 5JC8A 2OHXA 5G0TA 1ADBA 1T1SA 3ZHYA 3BZUA 1C1XA 3DQPA 4J43A 4YRBA 2C2YA 3BTOA 4Z0PA 4KMSA 1F12A 4YJFA 1IE3A 1KEVA 2RHCA 2B69A 3JSAA 1T4BA 2B36A 2ILTA 5JPIA 4WEOA 3MJ4A 1T24A 1Y8RA 3NT5A 4CM8A 1ZK3A 2X86A 1YB1A 5F1OA 1U8FO 4RZIA 4URFA 1MFZA 3Q11A 2OZPA 4XKJA 3X2FA 1Y9AA 2HQ1A 5JAQA 3RUFA 2VZ9A 4YACA 5EL0A 1KETA 2NADA 3FNEA 2NU8A 2OUIA 3CINA 2H9IA 3NDJA 3OETA 5TT1A 1KEWA 4GVXA 3RUAA 3ZV3A 2JFFA 2Q46A 4YJGB 4UAGA 4W99A 2AG8A 1TLTA 1I36A 5C5IA 3UW3A 1E92A 3KM0A 4PLFA 1CRWG 2DBQA 2EEZA 1ZNQO 3CIFA 3K73O 4IBOA 4HXYA 3RVDA 1OI7A 2O3SA 3FR7A 4CV3A 1WLYA 2ZCVA 2VYNA 3EVNA 4YT8A 5AXCA 2JD1A 4IM7A 3WLEA 3B1FA 4LCJA 3RC1A 1V35A 3QE3A 4WNCA 5U9CA 5JO0A 3W4KA 1U3VA 3EW7A 4RF4A 2W98A 3WGOA 2YZ7A 1U7HA 2FSVA 1A9YA 2IRWA 4ND4A 3QWFA 5GZ3A 1ISIA 1GFSA 3H65A 2VOJA 3BTVA 3PJEA 4FSHA 2GF2A 3GT0A 3PI7A 1Z75A 4NFYA 2EHDA 1PGOA 2BFMA 2FPPA 1TXGA 1PGPA 3R3JA 3JYQA 4NDNE 1IYZA 1EDOA 3H9EO 1GU7A 2OBYA 4QUKA 5F1PA 1ADGA 1C1XB 5L95A 3IP1A 2ZTUA 1XELA 2W4QA 4YJFB 1P1FA 3FF4A 3FWNA 1BMDA 4IQGA 2OFPA 3E8XA 5THKA 3WS7A 1X7DA 3HJAA 1I01A 1Y8RB 4U7WA 1E5QA 3U3XA 4CM8B 4KP7A 5CG1A 5H82A 4DIFA 1EE9A 4BNHA 5FFFA 1HRDA 3E82A 2Q1TA 5JYDA 3K2BA 4P4GA 2FOIA 2O3UA 3I5MA 1RWBA 1VSUA 3KLMX 4GWKA 4IIVA 1XR3A 3CE6A 3SC6A 1ISHA 2E4AA 1DIHA 1XLTA 3UVEA 4DQVA 2GLXA 2JFHA 1Y6JA 1E3WA 4DTIA 5H83A 1ONOA 4S1VA 2IODA 2DBRA 2RCYA 3U5TA 4W82A 2NU6A 1A4IA 1PZHA 1B7GO 1KY4A 4J6FA 4PGFA 4CM3A 5B4UA 3PQDA 4CV2A 3KSUA 1U2DA 1FDTA 3DAPA 3ENNA 3WLFA 1HDRA 1J0XO 3S2FA 4BNIA 1AXEA 3ONEA 3ROMA 1HE4A 1VRWA 2YYYA 4R16A 4IGEA 1T4DA 3DO5A 3G1UA 5JO9A 2CF5A 3AFMA 1VC2A 3TRIA 1A71A 4MVJG 1L7DA 4JBHA 3DDNA 2D1YA 4I9HA 1HSOA 3ITDA 2NTNA 1XIVA 2X5KO 3JYOA 4J1NA 4PLZA 2HO5A 2Q1SA 3IUSA 4R69A 4RLSA 3UICA 1O94A 1A7AA 1HDXA 1O5IA 1NQAO 2NVWA 2VUUA 2DVMA 2JFGA 1C0LA 5A05A 4ZVVA 1ZJZA 1CWUA 2H63A 3V8BA 2ZYAA 4OXKA 1TI7A 1AUPA 5T57A 1Z6ZA 5KKAA 2CUKA 3EVTA 1XKQA 3HSKA 2PKRA 3G17A 3ZWMA 3DR3A 2ZQZA 5I8WA 1M6WA 4AJOA 3N74A 5I7VA 1WXDA 4QX6A 3PLNA 1I24A 1LQUA 1ZO8A 1WNTA 2IXAA 1QSGA 4J1QA 3KVOA 3OA0A 4YJDA 5ENDA 4PG4A 4DXHA 4WKGA 1ML3A 4CL3A 3G0OA 4CUJA 1G6KA 2DAPA 4YTEA 5CEFA 1FXSA 4UVGA 3ICCA 2PGLA 2UUOA 3OQBA 3NX4A 9LDTA 3QLJA 4JQCA 4FPXA 1R0LA 2ZB4A 4WOJA 3RUIA 4R68A 1BSVA 2GCGA 2EXXA 4E21A 1H9BA 1FMCA 3IQDB 4YRDA 2BGMA 1E3WB 1BW9A 3ZNPA 3L6EA 1JN0A 1P1HA 3GDGA 1T2FA 3WYEA 3FTPA 2ZQYA 1JWBB 3ZHZA 4EJ0A 5F5NA 2GN8A 4KZPA 4ZQEA 1DIRA 4HNGA 1JVSA 2UYYA 1QLHA 3FD8A 4KQXA 3ANNA 3GC6A 4RDIA 1RM3A 3FSRA 2YV1A 3OQ6A 4UVIA 4DYDA 5DULA 1PJSA 3AUUA 4B3IA 3NDRA 2D5CA 4UEOA 2AQKA 1DJQA 5ITWA 1FDSA 1T25A 2VNAA 3OJLA 2VTDA 4FJ2A 4FD3A 1VKOA 1MLDA 1X15A 1I3NA 1YDEA 4WLFA 4EI2A 4ZGWA 1EBFA 1LLDA 2ZB7A 3NJ4A 1YXMA 1Y81A 1G0NA 1FDVA 4NBWA 3GPDG 4F46A 5JY6A 5EQFA 2PZMA 3AI2A 4CL8A 2Q1UA 2A92A 4YT4A 3DZFA 1Y7TA 3JV7A 2O4CA 1HT0A 2WYVA 1Q7BA 3DC2A 3QWBA 3FRJA 2GD1O 3PJDA 5G0VA 4OXYA 4AFNA 3QVXA 3PHHA 4L0QA 5L3ZA 4CR6A 5HRUA 2X9VA 4I5DA 1JW9B 3N7UA 2NU9A 1R0KA 4BUCA 2IZ1A 4YAEA 5AVOA 2YUTA 1ZUD1 4EJMA 1ARZA 3FBGA 3JQ7A 4HY3A 3PLRA 4WJZA 1P1RA 2NV6A 4LVUA 1GV1A 4XDYA 4YR9A 4DRYA 1LDGA 3WGTA 1NWHA 4MIEA 1Z73A 4IJUA 4B3JA 5KVSA 3ROKA 3OP4A 5BSFA 3QP9A 2D0IA 4LSMA 5JFOA 1F17A 3ORFA 3U49A 1U7TA 2PY6A 1YBVA 4DMMA 4FFOA 5EIOA 3GQVA 1MG0A 2W8ZA 1P3DA 7ADHA 3IMFA 3SJUA 3ZI0A 1NPTO 1BW9B 3H6KA 4JP3A 1MC4A 1GD1O 2FR1A 2O50A 1HZZA 2YQ4A 3FR8A 2QYSA 1PZGA 3H2ZA 5KWEA 3P2OA 1NFQA 1KOLA 2Y0CA 2DQ4A 3S2GA 2BI8A 2VUSA 3GFGA 1D1SA 2QZ9A 5IZCC 2GPTA 4ZHSA 3PWSA 4EW6A 1UXHA 3TFQA 1ZSVA 1ZKMA 1R4MA 5DP2A 3KHUA 3NJ8A 1K3TA 5IAAA 3PFWO 2YFHA 1P0FA 1GQYA 5JC1A 5EQDA 1E77A 4NK4A 4RVDA 1KBZA 2VHXA 2GO1A 4GH5A 2B5WA 4BO3A 4L9RA 2Y1DA 4TMFA 2EIHA 3ANLA 3QVOA 4GSLA 1OFGA 1RM4A 4BO6A 3OHSX 4KTVE 1EQUA 1IUKA 5I9MA 2HKIA 2XF8A 3LSYA 3CZMA 3FPCA 5HWSA 5JXWA 3LT0A 2X5OA 1SOVA 2WTBA 3HZZA 4OYRA 1UP6A 1EDZA 2C7VA 2JAPA 4O6VA 3WJ7A 4O0LA 3ZW9A 1I2CA 3DBHA 1EE2A 4EUEA 3JD3A 1P1JA 5A9SA 5AXDA 4GX2A 2FZWA 3EGOA 3VH4A 3ZWAA 1V3TA 1QORA 1HL3A 1DBVO 1DAOA 3JQ7B 5TT0A 2EKLA 1XEAA 1C0KA 1QR6A 3E5RA 2P9GA 3AM3A 3EMKA 4ZQGA 5A5FA 3U0BA 1V8BA 3HADA 2VYVD 2EW2A 2JCVA 2JKVA 1BWSA 2CD9A 3R6DA 4YA6A 3W8DA 2X7HA 2P2SA 3W6UA 1M67A 3S55A 2J3IA 4HFJA 1DB3A 2HK9A 4FFLA 1VJTA 2BF7A 4WLUA 3SBOA 4G65A 4DQUA 4GX1A 3ONDA 4EITA 1MUUA 2VWHA 4CMIA 4W4TA 5K0ZA 1R0SA 1M6HA 2C59A 5FI3A 5BSEA 3WX0A 5K6AA 4P4NA 1VL6A 1JTVA 3UCXA 5DDIP 1IPFA 3RU7A 3WGGA 4AJNA 4DIOA 2OMEA 1R4MB 1B3BA 1MGOA 5IZ4A 8ADHA 1YKFA 4TKMA 4B3HA 4L76A 1X0VA 2HAEA 2JL1A 3F6YA 2NWQA 2I5PO 4J7XA 2G1UA 1L7EA 4D0SA 1UZNA 1P9LA 5J23A 4BNWA 3F47A 5FI5A 5ADHA 3OIDA 2Q3EA 4PFJA 5IFLA 3TQHA 1SO8A 4RO0A 1OAAA 2Q2VA 4ITUA 2HU2A 4C7JA 1XDWA 5EESA 4EYEA 1SB8A 2X9NA 4OL9A 4OQYA 3H5AA 7MDHA 4R1TA 1E3EA 4E2ZA 3WGHA 1B16A 4Q3EA 1GEGA 2DTXA 2XPCA 4MOWA 4EGFA 3QA9A 1KVQA 1ZJYA 3C3XA 5F5LA 3DBHB 4GMFA 5A9SB 1BXZA 1SC6A 2FMUA 3KOUA 3MTGA 1W6UA 4RV9A 2DFDA 3A06A 1B15A 3OM9A 4FFMA 1KIFA 3KZVA 5ER6A 4MVJE 3RIHA 2PH3A 3E1KA 2D3TA 2VHYA 3K92A 2NU7A 3HB5X 4Z9YA 3H9QA 3UHAA 2OL4A 4CV1A 3PYLA 4B79A 1PJ3A 1DFHA 3MCVA 1PJ2A 4IDAA 1YOVA 3INTA 4N54A 5ICMA 3SX2A 4CMGA 3DMYA 1AGNA 3OICA 1SCUA 3JYLA 1VM6A 1LRLA 2Z95A 3QHAA 3FBTA 1MG5A 3B1JA 4RPJA 3U4HA 4CMIB 2E37A 3H9JA 1GY8A 2Q1WA 3OIFA 1OBFO 1Z45A 2YJZA 3AUAA 4DUPA 1Z7EA 5DOZA 1PJQA 4ID9A 3Q2IA 3MJCA 3KO8A 3TOZA 4DBVO 2WMDA 2CDCA 4WLNA 1EZ4A 1DJNA 3UCFA 2PWZA 3HN2A 4FW8A 4BNFA 4YQYA 4CJXA 2NUAA 3TL3A 3PQEA 4DYVA 1V6AA 4MJLA 1EFLA 1J4AA 4B7CA 2AMFA 4CLEA 2V6GA 1WZEA 5KJ6A 2GSDA 2J3KA 3H3JA 3ZU5A 4J4HA 4NR0A 4TVOA 3V1UA 4HV4A 3UF0A 4GQAA 1LDEA 4DC0A 2RAFA 5IZCA 3AK4A 3WNVA 3RJ5A 2W2KA 2QRJA 4BO9A 2HMSA 3ZV5A 3IL2A 3I9NA 1WVGA 4BKQA 1ENZA 5ER9A 4K6FA 1W8DA 1N5DA 3LF1A 4CQMA 4OQZA 3ZWBA 1F06A 1UXGA 2GZ1A 4I9NA 2ZYDA 3E9QA 4RCVA 1YRLA 3MJEA 4D3FA 1N7HA 1D4FA 3CEAA 1CDOA 2Z1NA 4YJHA 3INGA 4G2NA 4JLWA 4NZ9A 2O3TA 2B35A 1K2WA 2G76A 2H5LA 4QFCA 1I2BA 4RVSA 3IKTA 1MV8A 2XOXA 2J3HA 4NPCA 2O3RA 1H6DA 2P5UA 3D3WA 4ALNA 4CM9A 1YOVB 1D1TA 4U6QA 1E1NA 3EK2A 4FC7A 5CEEA 2ZCUA 5KOIA 3M1AA 4OJNA 4PCVA 2V65A 5BQFA 3T7EA 3TFOA 3Q3CA 4HBGA 5H81A 3RC7A 2H1SA 3WMWA 2BD0A 4PVDA 2BFAA 5L7WA 4N18A 1IB6A 1DC5A 2JHGA 3KTDA 4XB1A 5TGDA 2A94A 2PGDA 3AI1A 4UVEA 1TEHA 3RUDA 3SC4A 2QW8A 4E5KA 3OFSA 1R16A 3NTOA 4TZKA 2YY7A 1A27A 3DOCA 4B4VA 3P2YA 4RGBA 4M8SA 1Q0HA 3H9GA 4FFNA 4DC1A 4L8VA 3GOHA 4R3WA 4GSKA 4ALMA 3ULKA 4H3VA 4IDGA 1LI4A 3NEPX 4MVJF 4IGFA 4HFNA 5BNIA 1NFFA 4I5EA 4XJSA 3AY7A 1MXHA 4HWKA 5KCZA 4WCFC 1BGVA 3GF4A 4CQMB 4CMEC 3CMMA 2TMDA 4EUFA 3GGPA 5B12A 1ADFA 1NVTA 3I23A 3U4IA 4HX5A 4BNYA 4GGOA 4L4SA 1X1TA 4CM6A 1O9BA 3K96A 4RLHA 4YJHB 4FJ0A 1DLIA 4UULA 3ETGA 4FR5A 5KIAA 4EEZA 1DHRA 2O4UX 1Z82A 1ISJA 1F8FA 1R66A 2VT2A 1UAGA 3KLPX
chains in the Genus database with same CATH superfamily
3O3MB 2YZNA 4KO4S 4KFTA 4EFDA 3P4UA 3MJVA 4ZCQA 4IH4A 1WPGA 4QBKA 2I3BA 3D3WB 1NBOA 2X0RA 2X8WA 1AQLA 3GJ7A 4D9JA 6REQA 4JI2B 3RIXA 1A95A 1D0VA 1I7NA 3WRXA 5L7YA 1DI0A 3FYCA 4GICA 4HGZA 2H1LA 2OHOA 4IX1A 5H8WA 4GP9A 3R9XB 2A9JA 2ZZNA 5AW0A 5AW6A 2ZBEA 4KQ6A 1N6KA 4NYJQ 2HNKA 2G25A 3PXDA 3ESAA 1OFTA 1PKEA 2WD9A 5IK2A 5H7XA 1QHXA 3DL2A 1XMIA 1EWRA 2HQSA 1QP0A 3DV2A 3HL0A 1U0TA 3GLVA 2DF8A 4OKNA 4INJA 4QBFA 3W77A 1W2WB 4O3FA 1I2ZA 3GQBA 4WFKA 4B75A 4YCLA 2W0SA 3EXG1 3RI3A 3WTCA 4F06A 4UOQA 2XUOA 1DINA 2VDVE 4II3A 2A1IA 1JZSA 1VLMA 2ESRA 4TXMA 4MVJP 3NYWA 3O0TA 1U98A 1N2CA 1R9JA 3AERB 4HDSB 1G3UA 2IXDA 3PNVA 4LXXA 1Z7WA 4MQFA 1GG8A 2Y9MB 1IJKA 4OQFA 4XYEA 5JCJD 2GBCA 2QDKA 1KFEB 2N1BA 2JD2A 4D9CA 2JLRA 1OFUA 1RJ9B 2PSDA 1Y6GA 3V4VB 3QRWA 4H77A 2VQFB 5K5EA 1XCLA 1ZC4A 2DM6A 3HA7A 3PIIA 3CT4A 4WFJA 1JR2A 3P2MA 3QHQA 1YBMA 3W4IA 3U1VA 5I3CA 3AEXA 3QA3E 3V1NA 4ZT7A 1SURA 4FYWA 5FB3A 1QHGA 1YI8A 4LE1A 3EGXB 2D4AA 4FQ8A 3JYNA 1F1JA 1V5FA 2HRCA 2JGEA 2J3DA 4WMLA 1SUIA 5TE9A 3BE6A 2W2OA 1RI1A 3GLFA 5GVRA 4ED9A 3TWOA 3V2IA 1FYFA 3UENA 3CG0A 4CPDA 2BJHA 5CNJA 2YZKA 5L51A 3GN2A 4B4WA 5TGZA 1TX4B 4C4RA 5F7ZA 3TVTA 3FPLA 2WIBA 2CKDA 2QV7A 4WK2B 1J9GA 2E49A 2ONJA 1KQ3A 1R7RA 2OPHA 4AN4A 4PN3A 4IOMA 4NS1A 4TUYA 3FWHA 1SEPA 1NAIA 4MV6A 3QBEA 2WUVA 1ZPDA 4MGZR 3E6AA 1Z6QA 2QN7A 2Y4NA 3LIIA 3P9SA 2Y93A 2QR3A 3FMPB 1CK4A 3KJZA 3PF9A 4UVHA 1G20E 5ES3A 4I1RA 2AG1A 3CR7A 3GPIA 1SVNA 3P9KA 1OGIA 2ZI5A 4FYYA 1QC5B 1H8EA 1MW9X 4MLZA 1NTRA 1GLGA 2J67A 2ZJAA 3VQTA 4W5NA 1KDVA 4BO7A 2PU5A 2F00A 3NVKI 4ZQBA 2O5CA 4NH0A 3LUAA 5A4DA 4XDHA 4PYJA 2DZDA 3SYTA 4F2DA 4IW3B 1XVUA 3FPAA 4IPTA 3E22B 1ORTA 1DKPA 3IQXA 1Y63A 2HR1A 4O4IF 1V3VA 4F5YA 3WIUA 4NBTA 1IHPA 3R5TA 4MUBA 1P8JA 5IH3A 2CGEA 3RKUA 3TNYA 4C0AC 1JR3E 5IANA 1YACA 3KUDA 5G0UA 3FCCA 3LHIA 5IPFA 4MB0A 1P7YA 2C07A 3LLCA 1XTVA 2AC7A 3A1SA 3VDQA 3FKSA 3AVWA 1AB5A 1Z0IA 3DXXA 4IO1A 5E6SA 5EJMA 1DUVG 5JFGA 4IMJB 1G21B 5KYXB 3K0AA 3Q7QA 4TLCA 4F5DA 5DX1A 2PKWA 4MUNA 1UBJS 1D5CA 3B13B 3P8ZA 4GQBA 1XU9A 3V33A 4K5QA 1Z33A 4PLGA 2FP4B 1Z47A 1YJ8A 4HZUB 2BRUC 4BN0A 2R8OA 2HU5A 2J7KA 5CDSA 1LJLA 1PWZA 2PMKA 1H2XA 5CX1B 5J3JA 3NHRA 4RVOA 2D8MA 4PINA 2ZI7A 2ZRLA 4WCDA 4TXHA 3B70A 2RARA 4B1FA 4FQ7A 4YMSA 2R7KA 2VPPA 3L6CA 4LXYA 4CTJA 2RBEA 4XD7A 2J5QA 2X5JO 2YXPX 4M86A 5CW2A 1R8JA 1TAUA 3LPMA 5HP4A 1KP3A 1QTQA 3VKGA 2IPLA 2NVBA 2VT6A 4ERNA 4PCAA 1XQ6A 2VHZA 3B60A 1M54A 3PBKA 3Q9LA 3D8SA 3LC1O 2HPVA 4HBZA 3EC2A 4CG3A 5B4VA 4IIHA 4LJ4A 2PV0A 1V9SA 1AHHA 1EVIA 3RTBA 3ELBA 5IP5A 2PS1A 3M6WA 4AUEA 4ZRDA 5EP3A 3UWSA 1L5OA 1HI9A 4YWHA 4F5WA 2PGIA 3IPCA 4IIFA 5JIBA 5H4HA 1LVUA 2W6ID 2Y0PA 3VDRA 2O8DB 2CBGA 3F6RA 5DW0A 4LCEA 3O8OA 4IDPA 1D6SA 2JI6A 4L74A 4WUVA 2IZZA 3L4SO 2A30A 3HB4X 2WV9A 4WL0A 5AJTA 4OA8A 3RRBA 3TJMA 4MRMA 4UUBA 3VMMA 5F3WB 1KI7A 3OCVA 1HYEA 2GT1A 1W47A 5AJHA 4QRHA 2V6FA 1U8YA 4Q5IA 3ZGNA 2HNBA 3GEBA 3LQ1A 5EERA 3SZMA 3R0ZA 3VYRB 1UXKA 2HC9A 3R7AA 2KJQA 5JADA 1YIDA 3FCUB 3ZGLA 2AZMA 3BJEA 2NNWB 13PKA 4MS4A 4WXYB 5K2MA 3FJOA 4MQLA 5J1TB 3UWPA 1K6JA 1MABA 1T5IA 5C8ZA 4TV8A 4XGQA 5MN5A 4OX9B 2QJWA 4MQEA 5TLSA 5FJJA 1UJMA 1ZXXA 4EB8A 2EBUA 2QN2A 1CYDA 3D5QA 3G0GA 2NT3A 1Q1BA 2O3QA 1KKLA 1E9DA 1PT8A 2ADFA 2RB4A 3GT7A 2QHXA 3PC6A 3QOFA 1ESZA 1BEZA 3COVA 2C5SA 1Q3KA 4ZOLB 3RQIA 1N5LA 3MGKA 4KQJA 5AK5A 2J7PD 1MGPA 1I0LA 2C58A 4YJKA 4G26A 4JVNA 1C5KA 1AV7A 1ZUIA 1WWKA 3WFIA 3L0ZA 4B40A 5KTKA 3PQ4A 4CT5A 2YHAA 5JXGA 4V1CA 1DKOA 2YR0A 4HMPA 1BQ4A 5JZSA 3WGIA 2J07A 4FVTA 4F38A 4OHMA 4XM0A 3ZTTA 1GA6A 1G3IA 1XGKA 2RH5A 3C6XA 2HIAA 4ZU6X 4ZD6A 2IT1A 1UH5A 1YGYA 3STUA 5KJFA 5C5DA 2QQGA 2RKOA 1OIWA 4O1IA 4G4SO 1Q1ZA 3BCHA 3GMDA 1SQ5A 4B6JA 3TPCA 5B7NA 5JAOA 2CSXA 2JEZA 3T4PA 3LV8A 2AMJA 4Q9AA 4OEHA 4ZARA 1L0BA 1PRYA 2H1RA 3HUUA 2D0PB 4MQ6A 3JTMA 5DT2A 1JIQA 3A2NA 5BORA 5LWQA 2OECA 3OQMA 3VR3A 4K28A 4CNQA 3DAOA 2VEDA 4CEIB 1WMFA 3DZGA 4HJRA 3J81k 2AN5A 2F1JA 1HORA 3HJBA 1TM5E 1YHYA 4Q48A 1ZDMA 2VXOA 2E4XA 2WKSA 4Q3CA 3I6ZA 2JBHA 1W85A 3R5FA 2J45A 4H7FA 5FKJA 5ALNA 4ZA2A 2M2IA 3HO8A 1KFBB 3LHSA 3QBDA 3ETJA 2QIOA 2XRYA 3KJIA 3FZYA 3WRYC 4MR9B 1ZYUA 3G8CA 2H06A 5AVSA 3VR4H 3LU1A 5L3RA 4EJSA 2WK1A 3F67A 5C31A 5FH9A 2CLCX 4KG7A 1LVHA 3AM5A 1AD2A 3FMGA 3HB7A 3CX3A 3IEKA 1T1JA 1WDMA 2I7DA 1UK7A 4V39A 4UEJA 2RMKA 4W7IA 3DGFC 4AKSA 3L9XA 1TQHA 3BXFA 3EEIA 4RPHA 5KAPA 2P27A 5JD6A 5BV8A 3BRWD 4EPXA 3AZPA 2WD7B 2OVFA 3GVHA 1W4ZA 3KZMA 4WNYA 4B5LA 4S2EA 1HETA 5E2IA 3FMFA 1J06A 1TIKA 1XZNA 3EIXA 4HRAA 3L7YA 2V3CC 4RMJA 4GPZA 4M98A 1C1DB 4YAUA 3T1YB 2V5UA 4EDFA 2VC2B 1KO5A 3ENZA 4GGPA 2I6GA 2VRBA 5HQJA 4CODB 1A9XA 4Z99A 1P2UA 2IS4A 2YJTD 3GJZA 2PZ8A 4DCOA 4BP8A 3NKLA 2F3TA 1ZG3A 3OECA 4D3YA 1U1DA 6ABPA 1GCOA 2D1SA 2CK3D 3AILA 1JU3A 3QXCA 4D57A 3H3FA 2R25B 1UMDB 4NCIA 4X7MA 5DBIA 4RGVA 2PD6A 4QOHA 4XA8A 1A04A 2HA3A 5LQSA 1JEYB 2Y2UA 1P60A 2YX1A 3QPUA 5ITSA 1KI4A 1X7WB 3LVFO 2XUKA 2O2SA 4G5SA 1JDBC 3KAJA 2IEDA 4JBXA 3QENA 1TU4A 4NMWA 4BBJA 2W6JA 4ND7A 2AK2A 1DRVA 1VL5A 1SZDA 2XDWA 1N0UA 2V5VA 4KI7A 3SQNA 3BJRA 3ZIAD 1E7RA 1GL3A 3AVXA 1YZUA 2QZ4A 2V6BA 3ADDA 4ZHQA 2CZGA 1CIVA 5H16A 2QX4A 1Z6YA 2XIJA 3L7CA 2XTJA 1GCIA 2R2AA 3B3AA 2YWGA 3EW9A 4G1UC 4LMPA 5E7QA 3ETDA 3PR2B 4YRNA 1FQWA 1DP4A 2W6OA 3KWFA 4JS0A 3FXAA 3VZQA 1L8LA 1IK4A 3HHPA 1CJUC 1NNUA 1Y7HA 3M4YA 4LYJA 4CKBA 1KVRA 3K05A 1MTOA 3SFTA 3KYBA 1S3IA 4O29A 3MWLA 4B6RA 2O8FB 1P74A 1OXTA 4OO3A 3L7LA 2WR8A 4EECA 1UPUA 1VIYA 5E3HA 4QUHA 2FI1A 5GTDA 4IDOA 4LXIA 1NKTA 3H99A 4GD3Q 4M0DA 3TVDA 3PVSA 2WJHA 4O3MA 4P3OA 2PHZA 3G3EA 3CZRA 5KHAA 5CPFA 1KVSA 3LL7A 2Q2OA 4E94A 1FSZA 1J23A 3GA7A 3NUGA 2WSSD 3QU4A 1M1XB 4FGKA 1VMKA 5TNXA 3TIVA 1SEVA 4LRTB 1Z3CA 4NIMA 1DRWA 3UMVA 1ZM9A 4WN3A 2UUBB 3NM5A 3VO2A 1Z5NA 4YWJA 2FSUA 1L1RA 4YJ3B 4F1KA 1J5PA 1WV0A 2XCUA 1MFPA 4PONA 4HT3B 3BIXA 4BNJA 3D5EA 3LCCA 4EAQA 3LVBA 5KAMA 2G7ZA 2PUHA 1AXGA 1HYQA 1LV7A 3F3SA 1JQAA 3BWVA 3DJFA 3LKZA 3ZTWA 1NKSA 3U56A 1I4DD 3QVTA 1N25A 2O5RA 3PCTA 4L51A 4LNUB 3II6X 3WKAA 3ZCXA 2EFGA 4NEGA 2XB9A 1OH5A 1A2QA 3E9EA 4J4TA 4RKYA 1J2JA 4ZU3A 1RU3A 3KS9A 3WLMA 5IHPA 5FV7A 5BWMA 3AHEA 2HF9A 3TM4A 5A02A 3KSDO 1IN8A 2X8LA 3H2BA 3D4OA 5TQ0A 3PB3A 4E32A 5JSZA 3AJRA 3C6QA 3KVVA 3PEWA 3K1AB 4NU6A 1DLJA 2VBCA 1YC2A 2VP0A 3Q3JB 2G72A 2HRRA 1PJAA 5I5EA 5FHRA 3GROA 1P9NA 1AXRA 3GMTA 5KYNA 5JTUA 3HJCA 1FRVA 3KQWA 3H7IA 4F5ZA 3VVBA 5JCPA 3WK7A 1FTSA 4KI0A 3I9V1 5JZ9A 2D8AA 3U9LA 1TVKB 1V7CA 1E6CA 3EJWA 3I83A 1KI8A 5DK4A 1DZIA 5B1DA 1XEXB 5IF9A 2WUEA 3EDMA 4X1IB 1WM1A 1PLJA 1VLQA 1EUCB 5D1HA 5HKBA 1NHGA 3KHKA 2C0CA 2FRDC 1WXHA 5IXYA 3HFSA 3TR5A 4ETNA 2AFVA 2FV8A 3C1UA 1CVLA 1R3DA 3IOYA 3TK1A 4U6NA 4RZ3A 1Y8ZA 5GOTA 3LLVA 5DWQA 3WC4A 1O54A 3HBFA 2FGJA 2ZYGA 3WYBA 5L45A 3RVMA 1T1GA 4RSMA 2ZB2A 3PDUA 1AKYA 4WBNB 4JMPA 5L3SA 4I5FA 5HJ5A 2BGKA 4NE7A 1YB2A 1PUIA 2X3UA 1SC4A 4ND3A 1A5ZA 4Q18A 1DIAA 3CR8A 4IJWA 4KN8A 2GMWA 4DJ5X 5HGXA 5ANRB 3LKBA 1R0WA 2O1XA 3PHLA 3KOWA 1V5EA 1X1CA 3BDIA 3MELA 4OAOA 2QVYX 1J2EA 4Z9FA 3FFTA 1DKLA 1F8GA 4NABA 1S6YA 2VQSA 4O8ZA 1VLLA 1EMDA 3NORA 5F3DA 2GLUA 1KAOA 1QYVA 2AC2A 4ENRA 1IY0A 4ESOA 1Y9EA 3Q98A 4DDWA 2EWMA 3NGXA 4QATA 3WRVA 5EI5A 5IVHA 4HQLA 3A05A 3T7RA 2P9BA 3PIDA 1MAHA 1OLUB 3ZYZA 1FTYA 1TM7E 1YZ3A 2R87A 4WK6A 3RFVA 1A2OA 4WOBA 2UXDB 2EERA 2HOQA 1Y3HA 2WOJA 3H97A 1IQPA 3HR4A 2EP8A 3NHKA 3GLKA 1QG2A 1SCQA 2J3QA 4RLQA 4WZAE 1KYIA 3HCAA 5E6UA 2FG5A 3OY2A 3WMEA 4KR3A 1PV2A 1QZ3A 1P4SA 1QX3A 2Q99A 2AJTA 2XT6A 1YQXA 2ZEJA 4HNHA 1KJNA 4NV3A 4BB9A 3TF5A 1WABA 5JE8A 1D7OA 3HBMA 3CUEF 3MWEB 2BEUB 4I2VA 4TUYF 2DHCA 1CF9A 3DKKA 1FPMA 1TVCA 4NFSA 4QXOA 4D9BA 5AVUA 5K8JB 1X86B 1NGSA 1SRQA 4DLZA 4IS3A 2XWQA 4V0QA 4CQJA 3ZWQA 3S6JA 2IEAA 2WJ4A 3RE1A 3G0BA 4BDTA 1E2MA 1NI3A 1Z62A 2FPIB 2W6MA 2WM8A 3LDGA 4O4HF 2CL7X 3K9CA 2RGUA 1GA4A 1USWA 3AVOA 4WZZA 4POAA 2ZIXB 3CVJA 4E70A 2ZE8A 5LC1A 3GCXA 4C30A 3EVCA 4JBWA 4HN9A 5E8JA 1FNCA 2DHQA 1NI5A 2NTYC 3CE9A 3WQQA 2VHWA 3R0IA 5I6DA 3OCYA 2I1VB 1E20A 4NH4A 3HB1A 2WG0A 1ZW6A 2QRVA 2ZIFA 4BE9A 1EU1A 4IAOA 4LX0A 4CM4A 2QT9A 1YBAA 3EC7A 4GLLA 3JQCA 5AI0A 5TF4A 5JWOA 3WIOA 3T99A 3MJRA 2ZYVX 1F3LA 1ZI8A 1U0RA 4HLNA 1RMYA 1XXHE 1ATIA 3NPAA 1M0EA 5BN3B 3GJ6A 2WHPB 2AOVA 2I99A 3MBKA 4DFDA 2B83A 3HKEB 2YV2A 1VE6A 2PPVA 1BH6A 2VLBA 2ZIWB 1DX9A 1HYBA 1G8KA 1X77A 3PGVA 4DA0A 4C76A 5JTTA 3ZCSA 4NRDA 4HLCA 4AP9A 4CW7A 5B3LA 3U62A 2FQQA 4JHLA 4AMZA 1IPHA 1DKMA 1XC7A 2X8JB 4DLAA 1UDBA 3D6NB 3ZCRA 1QGZA 3V2UA 1BCRB 5DNUA 5FUMA 3EBLA 1JUDA 2DPMA 1PR3A 1SVIA 2QE7A 5DYIA 3WZMA 1QJ4A 4P54A 1KI6B 4DB4A 1ISMA 4MKZA 3TDNA 4US1R 3TL6A 1N6OA 3WV4A 3ZHUA 1DUSA 2FWPA 2VPYA 1E2BA 1C3XA 2QTAA 3B2NA 4Z54A 3ZGVA 4LYGA 2X23A 2K87A 2WZQA 3G5LA 2PRYA 5CCDA 1ZNYA 4RM2A 1WB6A 1DKUA 4L8FA 1JHUA 2QR5A 4YBRA 1KI1A 2IUSA 4LJ5A 5HTOA 1ODJA 1NZJA 1OGYA 1YV9A 4TM7A 5CPBA 4DV1B 1II8A 1A50B 1X9IA 2EGUA 2PSEA 4F86A 5LKRA 1RWVA 2QD3A 1Z7YA 1UWLA 3RF7A 3ORHA 3TOVA 3KLBA 3T4EA 5BVGA 4EH1A 1Y8QB 1KYQA 1V2HE 2CXRA 2D74A 1XK6A 2XD9A 3AEUA 1S9DA 1M34B 1NAHA 2WT9A 4C2BA 4BP9A 4TMVA 1E89A 1MV5A 2B0CA 1JIXA 2RHGB 3CRW1 1U4NA 3H87A 3LMKA 1TK9A 4FYIA 4NMHA 2C61A 4R9SA 4Z2AA 1JDJA 4UTVA 2BMVA 2AOTB 1NVFA 5JAZA 3HWRA 2YIJA 1XRQA 3UAYA 4EQZA 3PGA1 1LK7A 4NICA 3BQMB 3E3AA 3K6JA 3L07A 3OESA 3E48A 2O59A 4MVJI 4M7WA 2Z2YA 4HAUA 1QM5A 5EJIA 3K09C 1NYTA 4UW9A 1G6HA 2N1MA 4ERXA 2IFTA 3DLHA 4JLDA 2DBVO 1IHOA 1X9GA 1U2DC 1I1OA 2ZWPA 3I9OA 3ZGXA 1FMFA 4ZDKA 1US8B 1WRBA 1Y5NA 2G82A 4FZVA 3W5JA 3EZ6A 3SZRA 1ACMA 3OZTA 4TV8F 2QX6A 4Q9NA 3CZAA 5ALEA 2XKAA 5BUQA 4QRDA 4K3VA 1JSZA 3I5YA 5FWYA 5BPFA 3FRHA 2YASA 5JY1A 4MMYB 2JS7A 4GLOA 1GDTA 2XDAA 4N40A 1TECE 1GGKA 4Y6QA 4EA6A 2IDZA 3BPSA 1AB6A 1NR1A 2BMDA 3RVQA 2R86A 2BP7B 2CUZA 3K0HA 4AMYA 4B8YA 4DJEC 2HWWA 3BRQA 3NBFA 4DB2A 3EZGA 2YDYA 4PBSA 1AH2A 2JW5A 1DC6A 4GDMA 4FE4A 1EDDA 2VF4X 1LDYA 1JEQB 3BRSA 2JVKA 5BOSB 4MVYA 5KVVA 1AMOA 5LIPA 2ZRJA 5E0OA 3TNDA 3WWYA 1WSBA 3C5CA 4M9RA 2YYSA 2JHCA 4LDRA 4ME6A 2EQ5A 4UMEA 4Z3KA 2DULA 2X1LA 4BDSA 3OTOB 1E2FA 3IMKA 4C7MA 1TK3A 4GX5A 1GG5A 1BGXT 1RP1A 1U81A 3FPKA 1U3TA 3P9XA 3V4FA 3EFOB 1NLYA 3WLPA 5D3ZA 1R50A 4M2LA 3MJTA 1AHPA 4EYGA 2OGWA 5DM60 3AYXB 2WFZA 1K7CA 3L6BA 4KFSA 1CF2O 5DRYA 1KTIA 3PD7A 1H2WA 2PT9A 1NBEA 3SFVA 4OAQA 1AK2A 2CHQA 4FDMA 2I6TA 4RDXA 1RZRA 2CC2A 1W94A 1FSGA 3EUWA 1QDLB 3EXIB 3KR9A 4NJEB 3WJ1A 2GZHA 2O6LA 3MTDA 1MRSA 3MF4A 4NXNB 5FTNA 1Q0SA 2COKA 3Q3IA 2NO1A 1E2HA 2XCQA 2IYFA 3IOCA 1W1WA 1KPIA 1T3SA 2WU4A 2JFWA 1GYPA 5KYXA 2LVBA 1LTHR 1HLDA 1G2QA 2C98A 3O8QB 4E5MA 5AUOB 1TT5B 3VOTA 3KKEA 3VNVA 5JH7A 1K98A 3G7SA 1Z4KA 1LLUA 1QFMA 5U4XA 5K7SA 1T6XA 2CMFA 4U9UA 4RETA 1NUPA 2B4RO 2QNIA 3LFUA 4G67A 4HZGA 5FNZA 3VH1A 3VR5H 3VV3A 5LXTA 4CGZA 2Q29A 1V3UA 1UBKS 2C4MA 3LYAA 2QG9A 3OIGA 1IL0A 2Z9BA 5ALFA 5BSRA 1UEXC 2ZUSA 3GG2A 1RYBA 1WKCA 2A5YB 1L5SA 2X4GA 2J5RA 3L8GA 4IDBA 4MJXA 4Z5XA 1LC0A 1U8ZA 2VDOB 4GM0A 4K6KA 3P26A 2RG7A 1ZS9A 4FHZA 5HF5A 4CMBA 4H9GA 3D0OA 3D6TB 2B30A 1JQKA 3IEMA 2WM9B 3AGPA 3JW8A 1ZGAA 2PXXA 3C74A 4U7FA 2A0XA 2H2HA 5CVJA 4C43A 5KS2A 4LE2A 1FBTA 4ARAA 1A72A 2GYYA 2MYUA 2X77A 4M1OA 1BQ3A 4LXHA 1SHJA 5G41A 4Z0TA 4B3XA 4XWKA 4PPYA 3DXZA 1Z3IX 1LNZA 2P9JA 4FBLA 1Z35A 1PHPA 3ACBA 3LCRA 4FHCA 4Q7EA 1NDQA 3Q7EA 2AJCA 1GCAA 3WICA 4H1UA 5FO1A 2B0JA 4XX0A 3NTRA 1GR0A 3A4MA 4Z4IA 1HQYE 3NANA 2OKCA 1HNXB 4LOJA 1PFVA 2OC4A 2AG6A 4FFBB 4C4OA 5JNVA 3RSGA 3T12A 4E5PA 5A4JA 1MEEA 4RJKA 2N46A 3L7DA 4PTYA 1UP7A 1Z5VA 2VAPA 1X14A 1N2SA 3IJPA 1EGQA 1V4BA 2D1FA 3B1VA 4RH1A 3ZDYB 2ZWMA 4FCTA 3RROA 5ADUS 5AW2A 4D3SA 4ZHQF 1RQNA 1MA0A 1Z4QA 3LT1A 3WGNA 4ND5A 3X0DA 2VTVA 4NCNA 2BLLA 4MV9A 1MQ9A 2DUNA 5HFAA 1O6CA 1PUXA 3BXPA 3U44A 1IVYA 5EWMB 3NBAA 1Z0SA 4ZT4A 1FFXB 3ROFA 1G7SA 3A14A 4D97A 3I37X 3GLHB 2F4VB 4ZEWA 3H11B 4BV2A 4D4JA 3AF2A 1T6NA 3LP8A 1JAZA 4KUEA 4Z7JA 4RF5A 2CV1A 3TW6A 3NAQA 4DYHA 4DV6B 3AR7A 1LI7A 3F6BX 3O03A 3DUFB 1CCWA 1L4LA 1R5BA 1V1MA 2HA4A 4AULA 1QF6A 2YJGA 4JV5B 1EHCA 1QFYA 4EI8A 1AQJA 1Q1NA 1JAXA 3FF1A 4KNYA 1OWLA 4II2A 1K6IA 3EYAA 3W2HA 4Z1OA 3OC0A 3OU6A 4FOTA 3RHZA 3D3EA 2CHFA 5G4KA 2F48A 3PR1A 4NXMB 4GMHA 4MHTA 3U6KA 3U4AA 1G8FA 2XUAA 3H8WA 1BU8A 2NPOA 3WI7A 3HXKA 1MX5A 1H65A 1OTHA 3ZR4B 1IOLA 5CDGA 4JI6B 1T2CA 2DY1A 3WIVA 1O0CA 1VJ1A 5HMMA 3P9RA 4LV5B 4WASA 3FPSA 1KRXA 4KDEA 2AS0A 3PJGA 4AJHA 4DZZA 3SJ7A 4K9PA 3WMGA 1GDHA 4EABA 3CVOA 3GRFA 3IUJA 3CR3C 2P2NA 4UM8B 3TTYA 4QYSA 3UK6A 5A3QA 2QUJA 2J8ZA 3ICVA 4MWEA 5JXIA 4LHYA 4ARZA 4PIMA 3GI1A 1JMKC 3TXXA 4Q00A 3RGWS 2YJ4A 2ZYRA 1KHTA 1ESMA 3UG7A 5DIFA 1E94E 2J0EA 4MRPA 3VZSA 2MINA 3UT5B 1DELA 3PNQA 3BMCA 2I55A 2Y1GA 1IFXA 1N9GA 3EY4A 3ELYA 3FSJX 3JWHA 2QVLA 4M9UA 3UWMA 1C9NA 1LVGA 2OHVA 4KV9A 1MMFB 2ZRKA 1YA6A 4RKEA 1P19A 2C4UA 5EE9A 2A0UA 2GEVA 3VR1A 5JHGB 2YHBA 3ADCA 4R2KA 4DNFA 8GPBA 2PV7A 2LWIA 2OXRA 3M2TA 2JFUA 1ENOA 3HP1A 2FZ5A 4R8LA 5G3YA 4X64B 3H2HA 3RD5A 2JLUA 3WLSA 2WJGA 1T9ZA 5JQGA 3ZWOA 1L9KA 1LNSA 1T5HX 2PWPA 3DZKA 1UFQA 2R1ZA 2YNMA 4HNAB 3WB2A 5KTMA 4WXRA 2C94A 3IP5A 3JWEA 4WAUA 1LSSA 1LEHA 2PUTA 4EF5A 2D5BA 1BXGB 1E79D 1NASA 1ST3A 4GOKA 4HB4A 1KGSA 4M8LA 3BOSA 1C1DA 5DBOA 5KOHB 3L1HA 1YQUA 1QB8A 5A03A 3NIDB 1R6AA 1V6SA 2OC9A 3IEXA 3LFTA 4Q3KA 4B9AA 4CM1A 4EY7A 2O2YA 1OIXA 2ATIA 2XYHA 3A6EA 3MIIA 1E7WA 3S7TA 3UXYA 4Y2SA 2YV5A 5T3UA 2X41A 4G0PA 2V96A 3OT1B 2OV1A 4HEQA 2VWGA 2XXJA 1C0IA 1BKYA 4JB8A 5AI5A 1E6EA 2BGLA 1WJGA 3GN1A 4I4LA 3PDIA 4TTRA 1NVWQ 3FAZA 2F1KA 1J8VA 5J4HA 1YDGA 3E0QA 2GN6A 5K6AC 3DVLA 5KX5B 3ZZTA 3NRCA 3QSYA 2Y9PB 3O1LA 4ALIA 4OQLA 4RDHA 5FTWA 5EAIA 1Y7PA 1PJRA 2VPQA 2J6CA 1AKEA 4V3BA 5F4BA 1ZLXA 3COZA 4X7BA 5ENVA 3W2TA 3S81A 2ADOA 2C0QA 2RK3A 3NLLA 1E1CB 2AXPA 5H1YA 3CNOA 4MMXB 1T8YA 1T34A 4Q9IA 3DEIA 2WWIA 4P4TA 5IYZA 4Z4FA 4L4YA 1JHOA 5J2TA 3D1JA 5L4LA 4UHKA 4YR7A 1I3CA 4D4HA 2Z9CA 4GOJA 5FNVB 3NBQA 3I01M 3T1NA 1NQUA 4S12A 4WFIA 3RBVA 3OOEA 3THYA 1JI0A 1YVDA 3BC1A 1L5YA 1WCXA 3CTMA 3DKPA 3EQ8A 3G5UA 3KB6A 3KXDA 3ZIDA 4R8RA 2RHWA 4F4FA 3WMXA 3K70C 3UKJA 5A3RA 1JA1A 1RP7A 2OOSA 4RQAA 1V7ZA 4AECA 4S1PA 4WCFB 1EFCA 1EVKA 4D7AA 1DJPA 3ZJUA 2FZVA 1OH8A 1XF1A 4RORA 1N6RA 3PDCA 2NACA 4DG5A 4UUMA 5D7NA 4WECA 4UAUA 1D2RA 1NBIA 5JG7A 1X2EA 1SXJA 3ZOZA 5A4MS 1NLUA 4OHZA 5LP1A 3AC0A 2H8KA 4Y6GB 2TMGA 3EUEA 1MZPA 2I71A 2H3EA 1W6RA 4HOYA 4MWSA 3DDHA 1TJNA 1M83A 3ACCA 4K9SA 1J8MF 3RNLA 4YT8A 4BQEA 4NTZA 4KXMA 1ZJ5A 4L4XA 2IX3A 2QM0A 5EMKA 3VH3A 2F55A 3T3OA 4H6VA 2RJNA 4Z8YA 2ZQ5A 3IBYA 4Y8VA 1MH9A 4LISA 4G4SP 4MUAA 5DHPA 1PZXA 2Q3CA 1THTA 1IUOA 3I5XA 3DSRA 4QU5A 4BS9A 5KTOA 5SV2A 4I9UA 4HDAA 4DBLE 4PLVA 2JGDA 4Z49A 4LSWA 3LXUX 1A3CA 3A9VA 4CR7A 3QEBZ 1GEEA 1L9XA 1YB6A 2IGTA 1JX6A 3EHDA 2A6PA 3OSZA 4ZXPA 4Q47A 5BR8B 2R6JA 2QTFA 3QLUA 1QJCA 1RLUA 1NBME 3GMSA 3IUQA 5CHYA 4FOOA 5BV0A 2A9VA 4P7BA 3MQFA 4WK4B 3P2JA 3ZHBA 3OEWA 2X9GA 1O6ZA 4YIHA 2XHEA 5MDHA 3RFTA 2NYVA 3MG9A 3AL0C 5J2UB 2Y0DA 3DKRA 3F7TA 4OP2A 4X20A 3UJ8A 1H42A 2Q5IA 1OZFA 2LGJA 4B8ZA 1RLIA 2WPDD 4ZTZB 1V16A 2Y66A 3SVZA 3Q6MA 4AG3A 4DLTA 3M5DA 3HV0A 2JIPA 2YS7A 4BMDA 4D9MA 3LS2A 1YKGA 2HJRA 3JD0A 3JVIA 4QBHA 5BN4B 3TLBA 2QW1A 2VH1A 4JBGA 1VMAA 5KCZA 4YRZA 4FE3A 1SBNE 3FSGD 4YONB 1BS2A 1A9ZA 2PRSA 1FOEB 2ZXFA 4FKMA 4H4DA 3P19A 3V2HA 1SG0A 2ZGVA 4B7XA 3VKUA 2ZRCA 2IYRA 2HADA 1O5OA 1TYZA 2PKQO 3PC7A 4TZ0A 5JI2E 4OUDB 2BKUA 3N0VA 3PICA 3O1HB 1L5WA 2NVUA 5AM2A 1P81A 5LYJB 5EG5A 2GWRA 5LOVF 4YRFA 5I48A 4J0IA 1KKMA 3N2GB 1QZUA 4A73A 2QTVA 4J7UA 4LJYA 1MJHA 4TQ9A 3UAOA 4NKRA 3I2JA 1F0KA 3DCIA 4OG2A 4W9NA 3QMVA 1NJ8A 2AFIB 5EKXA 2B99A 3BXXA 3QKUA 1E2NA 5ILOA 2Q2NA 2G9VA 2X2FA 5KDLA 4O0MA 1SC1A 1RJFA 2IHVA 2XF2A 3ZH9B 5JBIA 3EARA 5DM4A 3OFND 2MSDB 2WU0A 3AVYA 1U7PA 4IDEA 4A4DA 2XE6A 1P2SA 1Y8CA 2BHNA 3RIGA 3EXG2 3JWIA 2V7PA 721PA 3QEAZ 2YWFA 1J33A 1JLLA 4C2UA 4BMPB 4TSFA 1NVGA 2NZVG 3Q7SA 4K6MA 4OGWA 3ZLJA 1OT3A 1W59A 3DMTA 4JP2A 3LPCA 5GM1A 4A10A 5JDCA 3ZY2A 1O8CA 4HTFB 2IYYA 4R6XA 3ZKWB 4BOYA 5EHQA 4R2IA 3GLRA 3QFSA 4P53A 4B47A 3WIBA 1QS0A 1CTQA 2EJVA 5G1PA 4MK4A 1HXHA 1H94A 3E9YA 3SFZA 3RW9A 2AVDA 2QN1A 3RTAA 2HMWA 3SS7X 1WE2A 1VMIA 4YAOA 4IUYA 4G0VA 1BMTA 2OAEA 2XTNA 5BQOA 2RI0A 3VUFA 4B3GA 5L53A 5LMUB 3AW9A 4RY9A 3MYRA 2YS6A 4P4LA 2OFOA 5B2EA 2X4LA 5CBPB 3BWXA 1NVKA 2H54A 3AOGA 3DKVA 1GG9A 3DTTA 5CP8A 3UM9A 2WTAA 1U8UA 2QG4A 3VI3B 2NSLA 3BD7A 3VOSA 2X0JA 2RKBA 3P1JA 5JXJA 4FB5A 4RVNA 4ZZIA 1AK1A 1PEDA 5JJKA 1K5DA 1IN1A 3T8YA 4DEXA 3KU1A 4G2TA 4WH0A 1N5KA 1OASA 4B4DA 1X2BA 3BE5A 4LA4A 3DWGA 2P41A 2YWDA 4E6EA 5ADVA 4EI7A 1W0JA 3HZRA 1ZGJA 1G3RA 1GGJA 1JFTA 4J29A 3QV1A 4IILA 3Q2KA 1VCNA 1F9AA 4I4IA 1UKEA 4MHSA 2ZXUA 5KTYA 1GFIA 2TMKA 2IUTA 2QQ5A 4IDDA 2XUGA 1ESEA 2CFIA 3EIUA 4J1TC 3FKSD 1OVGA 1XZBA 2F9LA 2RGNA 2ZSAA 4DJAA 2CXXA 1Z4IA 3OQIB 3O84A 1HUQA 5CIQA 1RWKA 1FTQA 1H6BA 3HDQA 3IAUA 4MRSA 3RR2A 5SZJA 4BEWA 2ZT6A 4M9SA 2P77A 4N7MA 2BFPA 3SR0A 2XLBA 1XQWA 4M1TA 4OQDA 3ORYA 1FFWA 3K0CA 1K9VF 4J0HA 1SHZA 4KWEA 4UZSA 4Y2GA 4YDRA 4UBIA 3OMXA 3SJBA 2RHLA 3DUWA 1R0XA 3ML1A 4PFKA 3ZHSA 1OKKA 4DR7B 1OLSB 1XZJA 3ZNQA 3N0XA 2WY2D 3DE7X 1G4HA 1ULSA 3LX5A 5CITA 1AHIA 1Z12A 1M1ZA 3IBSA 4ZOAA 1KPGA 3B1XA 4M7RA 4QGFA 4DRXB 4ER6A 1TW3A 1QFSA 1GGNA 1L7QA 1Y4DE 5LXTF 4XD7D 2FDRA 3ZEAA 1U0SY 3KYCB 3LUBA 2UZ3A 1QF9A 2ZBDA 3A1EA 3TOXA 1PZMA 2V7TA 2OFXA 2PA3A 1XRSB 1T9KA 3ANMA 3ETEA 3RFUA 1AN9A 3BFPA 4D42A 4X3CA 1RYZA 4HNQA 2Y27A 2A9FA 1WPQA 1IZ0A 1MB4A 4JI1B 3GAFA 3W2GA 2IY9A 3G7NA 4C6TB 2VDPB 2Y6UA 1DEAA 3D1LA 4HGRA 4PFQA 5AVXA 3PK0A 2HRBA 4CBVA 1PZNA 2XGMA 5DWDA 1JFSA 4LSGA 1R4NA 3DWFA 4KQEA 1BRTA 1MRNA 2H6EA 2W6PA 3ROPA 1LBQA 1GPNA 2XUPA 4MW2A 1ZQ9A 3G6KA 4TMWA 3NIGB 1GNVA 3LAWA 3BMNB 3FH0A 1C3VA 1YWGO 2EQAA 2WG2A 3LP6A 4ND2A 4C7VA 1EFPB 1N36B 2O57A 4B85A 1MIOB 1QNFA 2WSBA 2HK6A 2VPTA 3NASA 3SCZA 3VAYA 1T4CB 1CDDA 3RYFA 1H22A 2J41A 2JBWA 3P9ZA 4FNOA 4K05A 4NU5A 5C52B 4MCJA 2XUIA 1TIPA 1ZOSA 2NUBA 1KNQA 1ZOPA 4HX2A 4XVHA 5IAOA 2Y8EA 3B85A 3BMQA 4MR8B 3WWZA 4XYBA 3WE7A 3P71T 1U31A 1K3FA 2XZPA 4YXWA 4XIJA 4MJ7A 1F38A 4CKZA 1NQOA 3WYDA 2IW3A 2JANA 4M54A 2ZI4A 5EP4A 5EUQB 3OT4A 3EFHA 4L6IA 4CKEA 1J0AA 2O7SA 2I33A 5E3IA 3IQZA 1A9OA 1WBBA 1P4GA 2GM4A 1KJ9A 5KWJA 2MYPA 3IS3A 4NE9A 2ATEA 1JNYA 2GTHA 1NU6A 1QOZA 3FGZA 1JRLA 1FU7A 4HQNA 4XEHA 3ZY6A 2GUGA 4DOMA 1CUUA 3KQPA 2AG0A 2GM5A 2ZANA 9ABPA 4D56A 3FNGA 4PV7A 3OH8A 2Z56A 2GN4A 5FEMA 3VU8A 4R31A 2W11A 1N1DA 5CLLA 5K3CA 4ZQFA 1J8FA 3ZK9A 4ESEA 3AF3A 2FUKA 1PEAA 3BXEA 2QMHA 3GGJA 4RL4A 5H9VA 3D8TA 3QEKA 3PSAA 1K88A 3B51X 3MILA 1EPUA 4UHHA 3SF0A 4AJPA 1Y3FE 4DPMA 4IJKA 4MP8A 4TLDA 2DG2A 3GEMA 1A8UA 1EP2B 2JKYA 4DIDA 3LY8A 3U61B 3AUSA 2F9MA 1KEUA 2QY9A 4C9BA 2ZAGA 1E9EA 3NVAA 4HH0A 5ALWA 4P58A 3L40A 4I8IA 2IC5A 3ASUA 3AI7A 5CB6A 4FE7A 3HU2A 1R64A 2B3DA 3TN7A 2F1HA 4FTWA 4HEA6 4KYTA 1M7GA 3VFDA 3H0KA 3EXEB 5I9NA 4BNDB 5A0FA 3KYDA 1G5FA 3EEFA 3HCWA 5B3JC 4IEFB 2QQFA 5IDXA 4HH1A 4JA0A 4RMGA 3KJXA 3VPAA 4DLYA 3W6NA 3WWDA 2X6TA 2Z0MA 2ZETA 1OAOA 3IV7A 2YOHA 3T5MA 1GYQA 4RD4A 2OV3A 1ZRHA 3LCUA 3ZN2A 4BFYA 4DT1B 4J03A 4P4UA 4E13A 3KZ1E 3DZHA 4G5HA 5K51A 4OH7A 4JI0B 4EZBA 5JWRA 1G1MA 2YY5A 3TXAA 4R1UA 2HA0A 3EXFA 3UHOA 1XE3A 4MIYA 3RTGA 1X7YA 3ZE6A 4CN8A 4YV1A 2XVZA 2WP0A 3WP1B 3RSCA 1N0HA 3DTVD 4PAWA 1SBCA 4D9NA 1NF2A 2P3OA 3RUHA 2BKEA 3UUEA 3ZCQA 2ZUCA 3WSWA 3QWHA 4B83A 1GTJ1 5M34A 3CF0A 2JGFA 4GPIB 1M2VA 3HYRA 5JD3A 3N2EA 1QRAA 1VBMA 4C01A 1X7ZA 4EYKA