3JQDA

Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor (nadp+) and inhibitor 2-amino-4-oxo-6-phenyl-4,7-dihydro-3h-pyrrolo[2,3-d]pyrimidine-5-carbonitrile (dx7)
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
267
structure length
248
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQSNLSIVNLCDAMVDQPMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-based design of pteridine reductase inhibitors targeting african sleeping sickness and the leishmaniases.
pubmed doi rcsb
source organism Trypanosoma brucei
molecule tags Oxidoreductase
molecule keywords Pteridine reductase 1
total genus 95
structure length 248
sequence length 267
chains with identical sequence B, C, D
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2009-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3jqdA00
2R00C 3U0BA 2YV2A 1JDJA 1B3RA 5F5LA 1ZXLA 4I9UA 1IZ9A 1GEEA 4YQZA 1VL0A 3C85A 5GZ3A 1XQ1A 5BSFA 2PV7A 3UOGA 3TWOA 2QRLA 1EK6A 4FSHA 2EIHA 1NHGA 3LF2A 3RC2A 3NDJA 4PCVA 1GTMA 1WVGA 1J6UA 4B4OA 4J4BA 2XPCA 3KRTA 4OYRA 1FDSA 4RVSA 3WGOA 3WIEA 1HDGO 3QP9A 4K26A 2R2GA 5G0TA 5IDQA 2WTBA 1W4ZA 4CM4A 1Y8QB 4I8XA 4E12A 4II2A 1KY4A 2NNLD 4NQZA 1QXSA 3ZWBA 2ZCUA 3GGOA 2E37A 3R3JA 1C1XB 1YOVB 3WJ7A 3VZRA 1BW9B 3IC5A 1EZ4A 2Y1OA 2X0IA 1EQUA 4WECA 2EV9A 2VRBA 5DOZA 3UHAA 3WFJA 3I23A 4BNVA 2UV8A 1PZGA 1U4OA 3CINA 5JLAA 4XGNA 3PWKA 5DF1A 3AY6A 4YT8A 3C7CB 3P7MA 2J5QA 1B2LA 3L6DA 4NG5A 4Z3KA 1NP3A 2BFAA 1PEDA 4A2CA 3JQ8B 1NFFA 2OP0A 1B15A 5B12A 3JQ9C 1GL3A 1ZMOA 2VHWA 2VYVD 3GVPA 3D4OA 4WCFC 4B8WA 1E3SA 3Q0EA 1AUPA 2R6JA 4AJOA 3E03A 3GQVA 2QZ9A 3VOSA 3QSGA 1BGVA 4UVIA 2EJVA 2V6MA 4GX2A 4JX8A 3ZW9A 4FDAA 2AQIA 1ZJZA 1IYZA 1IHYA 2CMDA 2C7GA 2PZLA 3CIFA 4CL8A 4DGSA 1HYEA 3JTMA 3D5QA 4RVGA 4DMMA 2YHUA 3FR8A 1JVBA 3AFMA 2PZKA 2QRKA 4XYEA 1ZMTA 4CMKA 1PJ2A 1ZZEA 3NJ4A 5LCXA 1UDAA 1MB4A 3ONEA 4Z0TA 1CWUA 2B37A 4QECA 3QWBA 1DIBA 3L4BA 1H6CA 3RBXA 4W99A 1HDRA 3BHIA 4KP7A 1ENYA 4JBGA 3HQ4O 4JROA 4TZKA 3VH4A 4NZ9A 1OC4A 3V1UA 1UAYA 1XEAA 3IOYA 1P33A 4BO3A 2P4QA 1H94A 2JL1A 2H63A 1MA0A 2QRJA 4BNUA 2EP7A 1XELA 4GVLA 3ZWNA 4PG4A 4A03A 2JAPA 4ROSA 1WPQA 1A9YA 1HDZA 3A06A 4W7IA 4H15A 4WNIA 1K6XA 3WBFA 1T1SA 3ZU4A 1A7AA 2VWQA 1ADBA 4GKVA 3VVCA 3WXBA 3WYEA 3UICA 4JP2A 2NVWA 3AU9A 3H3FA 3AOGA 5FEUA 3SBOA 2Y0CA 4CM8B 4YXFA 1WZIA 4DQXA 3R1IA 1NAHA 4GPD1 4LSWA 3UKOA 1YB1A 3ZH2A 1KVSA 4CMEC 2EP5A 4JNKA 4RDHA 1CQJA 2AA3A 2CVQA 4BO8A 4RF4A 1KEUA 2OBNA 3DB2A 3NV9A 1ULUA 2OOSA 3SC4A 2YQ4A 1YONA 5LDHA 1PTJA 2GLXA 3B20A 3D0OA 3W6ZA 3MJEA 4WOJA 2QYTA 2GN4A 1T4DA 4EI2A 1XLTA 5FWNA 3GA0A 3H5NA 4CMGA 1GZ4A 1E3WA 3GG2A 3HB4X 4MVJI 5JCXA 4CUKA 5C7IO 5L4NA 3H8VA 3KV3O 5JS6A 4KQXA 3RCBA 3FF4A 1MFZA 1NYTA 4U8GA 3O8QB 2OMEA 2XXJA 1WW8A 3DBHA 4TQGA 3DL2A 1ID1A 3CUKA 1MV8A 1KOLA 4DBVO 4J0FA 1HDXA 4D79A 1BVRA 1MC4A 2EG9A 2V7PA 3ZU2A 5DNAA 4Z9XA 4MKXA 1H6AA 1XYGA 2Y1EA 3RFVA 2E82A 3H5RA 4M86A 5C3MA 3RAJA 4NMHA 5CFZA 5LDGA 4R5HA 4MVJM 4IQ8A 4HWKA 2DKNA 3RUCA 3JQ7A 2EGHA 2E48A 1OAAA 1YKFA 2PZJA 2Q4EA 3C1AA 3HDYA 4ALKA 6LDHA 5T57A 2P9CA 4F45A 2YYYA 2GN9A 5I7EA 4IMRA 1NXQA 2VOEA 4TROA 4D41A 2Y0EA 1KVQA 1HE5A 2YHIA 2I5PO 2Y1GA 5T5QA 2EERA 2Q49A 4YRDA 3DMTC 4U5QA 4BL5A 3WICA 1XU9A 2PLAA 3D5TA 4DPMA 4XYMA 1ISFA 3DBHB 4BNTA 2PGLA 2BLLA 3WGYA 4GLOA 1C0KA 3L6EA 1ZSYA 5A3JA 4GBJA 1DFGA 1ZK1A 4E5YA 1ZJYA 1Z73A 4CM7A 5I9MA 5KVQA 4KUGA 2DPGA 4L74A 4YAKA 1DLJA 1H0KA 1PGJA 5KJEA 4BNFA 4FOSA 5AXBA 4RDIA 4OHUA 1NQOA 3LF1A 1LEHA 3DZGA 3E5RA 2B35A 1J0XO 1R12A 4AJHA 5JCJD 3GN1A 2JAHA 4TRMA 1DIHA 2Q2VA 3F9IA 5IDYA 3OJFA 1Z74A 2HUNA 5KJFA 4ITUA 2ZB3A 2VRCA 1D8AA 3P2YA 3BMOA 2AQHA 4CM8A 1WXDA 2GYYA 1KVUA 4GWGA 1ONPA 4J7XA 3ANNA 8ADHA 3JV7A 2O23A 1BSVA 3NT4A 1Q7GA 3TDKA 1D3AA 4HNGA 5JC1A 1HXHA 1OBFO 1N2SA 4YT5A 4DIFA 3E82A 1T2AA 3DAFA 1NPTO 2B36A 2ZIZA 1DHTA 1BXGB 3JD0A 1A27A 2YDYA 3E9NA 2VZ9A 3PYXA 3RC9A 3CMMA 3F5SA 4AJ1A 2HK7A 3Q11A 1UDBA 2NUAA 4LISA 3V5NA 3H2ZA 3BXXA 1K0UA 1LDGA 3GGGA 2J3JA 3ZU3A 5JSFA 4EJ6A 5K6AA 1LI4A 3HE3A 3NDIA 4MJLA 3PDUA 1ENOA 1QORA 3X2FA 5H82A 1PWXA 3ADPA 2GUGA 3MZ0A 4IINA 1TEHA 2ET6A 4NJOA 1P1IA 1Z82A 4WCDA 4LMRA 1LSOA 4IQ0A 3BIOA 4BKUA 4J6FA 1P0CA 4XB1A 2HKIA 4N18A 2VRCD 3IIEA 5DZSA 3RJ5A 3ZV5A 4EUFA 2A92A 1NPYA 1P1KA 4RZHA 4S3MA 1P1FA 1ZO8A 3PLRA 4BKPA 2UVDA 3EMKA 3QHAA 5B1YA 1YDWA 3OJOA 4WLNA 1AHIA 3WTBA 5TJHA 5IG2A 1DXYA 2WD7A 1DSSG 1LTHR 4I9NA 4ALJA 3GLQA 5HBRA 1I24A 2Y68A 1GYPA 3FNFA 5ICSA 2RCYA 3OQ1A 1PS0A 1TVEA 4TRNA 1ADCA 1EDOA 4RLSA 4EW6A 3Q9NA 4MOWA 3ZWWA 1QV7A 1BTOA 1P1JA 1LSJA 1U1IA 4GGPA 2XOXA 1JVSA 2FMUA 3ETDA 4QFCA 2W2LA 4OOEA 2GZ3A 5JYEA 1C1XA 1M2WA 1YOVA 4H16A 4KWIA 5G0WA 2B4QA 3KO8A 3ZWVA 5DCUA 4WLOA 2DBVO 1O8CA 1Q0QA 1R4NB 2VHVA 2NVUB 2PR2A 4GVXA 4B7UA 2EW2A 4TRJA 2I3AA 2IYPA 5IFLA 5AXAA 1GQ2A 4IDAA 4UEOA 1M66A 3PHHA 1DIAA 3WYBA 1BXZA 3LU1A 3FN4A 4ALIA 4CMJA 5ITWA 4BNKA 2BD0A 3DZJA 3ITDA 4L4RA 3LC1O 4OQZA 1H2BA 1Y81A 4C4OA 1V3TA 1PJ3A 2WYWA 2P5YA 1CDOA 2VYNA 1GZ3A 2B0JA 3CEAA 2ILTA 2NM0A 1MP0A 3ZW8A 1LLCA 1OC2A 4K6CA 5KVVA 5A5FA 2O3TA 3Q9UA 4PVCA 1N1GA 3ETGA 3WGTA 1O89A 4XCVA 1VJ0A 3F46A 4URFA 1QLHA 2GD1O 2DU8A 5TGDA 1JTVA 3C1TA 3PGJA 4FBGA 4DRYA 1G6KA 1BDBA 5DN9A 1VKOA 4ND4A 4FOOA 1A7KA 3PHJA 3RQSA 3OJ0A 1E77A 9LDBA 1LA2A 5GZ6A 2CDAA 1Q0LA 2ZB8A 1W0CA 3KEOA 4L4SA 4RGBA 1WLYA 2FR8A 4RF2A 4XDZA 2EHDA 4R51A 2FRDA 4D43A 1T26A 2PKRA 2J6IA 2GSDA 4XB2A 4FC7A 5CPFA 4CMIA 2F00A 2C29D 3KLMX 4U7WA 1N1EA 3LDHA 4UUOA 1S6YA 4OL9A 3QW2A 2W4QA 5GZ1A 5JY6A 3KETA 1BDMA 2Q1UA 4XKJA 2XXBA 3WWYA 1RYDA 4J90A 2P4HX 3PI7A 3BAZA 4XQCA 1ISIA 1ZK4A 1BWSA 2BFOA 4J1QA 3SJ7A 2Y1FA 4B4VA 2Z1MA 3PDJA 1GD1O 4LVCA 3ZNPA 3LVFO 3ABIA 3PYLA 4PLWA 3QQPA 3PP8A 4CQLB 3PJEA 1Y1PA 2NWQA 1CEQA 2ZQYA 4XJTA 1JLLA 1DFHA 5TT0A 1SPXA 5L40A 5CPBA 1F06A 1Z6ZA 2D0IA 2BMAA 1UAGA 1MC5A 2X23A 3AUAA 1E7RA 5ES3A 3RUHA 4EDFA 1PQPA 3G1TA 1Q2XA 4YJHB 4E5MA 1MLDA 3AOEA 3ENNA 3GHHA 4OH1A 4YJHA 4J9UE 5G2OA 1KETA 2O3UA 4IM7A 1YL6A 4IDCA 3GN2A 5COAA 1E3IA 3KUXA 4R1TA 4K1LA 4Y67A 1F0YA 4I5FA 4NBUA 4X54A 4OIMA 2Y66A 3G17A 1XIVA 2FZWA 4B4UA 1X7DA 1SNYA 4FQ8A 3B6ZA 4R54A 5GMOA 3OM9A 3TJRA 3W8FA 4ZHSA 4CUZA 3CPSA 3OIDA 2VQ3A 1SBYA 4LMPA 1L1FA 4PG8A 2X0NA 3SLKA 1R0KA 1LU9A 2IXAA 4I1IA 1EMDA 3HJAA 2C2YA 1U5CA 4R16A 1PS9A 3GAFA 1ZIDA 5F1OA 2JFFA 4D3SA 4CMIB 4Y98A 2D8AA 3W1VA 4Z9YA 5JDIA 4BS9A 4UEJA 2LDBA 5IDWA 1WDLA 1SZJG 2X6TA 1BMDA 3N74A 5EIOA 3HG7A 3MOGA 1QKIA 1Q7CA 1E3LA 1Q0HA 1LDBA 2FSVA 3D64A 4CV0A 4W9NA 4FJ2A 2TMDA 5F5NA 1LQTA 4E4YA 4EYEA 1SC6A 2FPGA 1F8FA 1WMAA 3S1LA 2C5AA 1B8PA 4EUHA 5B37A 5CHEA 4QX6A 4J7UA 5U9CA 1VKNA 4U6QA 5I9NA 1G0NA 1GQQA 1R4NA 2NVUA 4R9SA 4Y6RA 1P1RA 4XQ9A 2X9VA 1U3TA 3I9JA 1JKFA 4W7HA 4L9RA 1KC3A 9LDTA 1XU7A 1VC2A 4MP8A 3VZPA 3WYCA 1DDOA 2H6EA 3D1LA 2VNSA 1LX6A 1UJMA 1Y9EA 4RV9A 1R4MB 3WNVA 1RM4A 1T2DA 3GY0A 1I32A 1XHLA 4YAEA 2ZK7A 4CMBA 2UAGA 4PLHA 4ONEA 4NIMA 1DAPA 4WLFA 2DTEA 4RVHA 4B8ZA 3ANMA 1QYDA 1QV6A 5K0ZA 4HBGA 3OFSA 3HUDA 2X9NA 3IMFA 1DRWA 2D5CA 4OQYA 4ZD6A 5MGBA 1VE9A 1X0VA 5AXCA 2OORA 4BNHA 4NFHA 2V6BA 3DZFA 4GQAA 4OAQA 4O5OA 3HWRA 5TT1A 4YRAA 4AJJA 4BHTA 4PIVA 3WQQA 3JD3A 1UZMA 1EDZA 4DLBA 3GG9A 3ZV6A 3EVTA 1NFRA 5BQFA 1B14A 4AVYA 4YT4A 3FSRA 4GGOA 3SX2A 1EVJA 2HRBA 3O26A 3TF5A 2UYYA 3AI2A 1GUFA 2GDZA 3DC2A 1X7HA 2VHXA 4WKGA 4BO1A 4BMNA 2PTGA 3AJRA 4O1MA 3HDQA 1R0LA 2AQKA 1LXCA 3JQFA 4PZEA 4YVFA 3GVCA 5DBIA 4DC0A 5G4KA 5KIAA 1R0SA 4Y6SA 3JYOA 3EGOA 3VDQA 3ASVA 1XG5A 5L3ZA 4CMAA 3RUAA 4EGFA 1E1MA 1JQBA 2VCYA 3I9NA 4FCCA 2HMTA 4A0SA 4OJNA 3VDRA 1E7SA 4R01A 2IZ1A 5A06A 3BMOB 4E31A 3HB5X 2JJYA 1QR6A 3QVSA 3RC1A 3DZHA 4A10A 1FMCA 3AY7A 2LDXA 2VT2A 2RHCA 1MG0A 1Y5RA 4R41A 4B3IA 4FGSA 4YDRA 1GYQA 4XX0A 5U4QA 4PG6A 4Z9FA 4QXMA 1MX3A 3ZZNA 4JBIA 2TMGA 4YJGA 3GDFA 3I5MA 1YJQA 1O5IA 3L77A 5EQFA 4J43A 4MVJG 2Q50A 3AI1A 1U5AA 2Q2WA 1M75A 2EKQA 4NU6A 3PJDA 2NSDA 3TSCA 1CETA 2D3TA 3QWFA 3W4KA 5A04A 1ORRA 4AJNA 3EDMA 1LSSA 4IZIA 4BB5A 2O3SA 2Q1WA 5JO0A 1ZH8A 5EERA 3CSDA 1HE3A 3PPIA 2AEMA 3I9LA 1VL8A 2VNAA 2VWGA 4WASA 4ZQGA 5AVOA 1TB4A 4AJEA 5TIIA 3G0OA 2VUTA 3GDGA 1U4SA 1UP6A 4QT0A 4J4TA 2O50A 3BMCA 4Q3EA 3OH8A 2I65A 5ADHA 4J49A 1K5HA 2CNBA 3MWDB 3FNHA 2GPTA 1KVTA 2HLPA 4GX5A 3JQ7B 2OL4A 4J2OA 2ZYGA 1E6UA 2C20A 1JKIA 4HFNA 4IPTA 3PZRA 2B83A 4WE3A 3ZHXA 4EBFA 1HZJA 2I67A 1EUCA 1U2DA 4NDNE 4N54A 3UCXA 3KVOA 5KJCA 4XR9A 2XF8A 1AXEA 2ZB4A 2DLDA 4YYZA 3OA0A 4J0EA 5U1PA 3WBBA 2PGJA 3KSDO 1P3DA 3S2IA 1PGPA 3RKRA 3UN1A 2YHIB 2V65A 1L7EA 3LT2A 4D0SA 3S2EA 2A9FA 2Y0DA 4Z0PA 4PG5A 2OGUA 2HMSA 4MVJE 3NUGA 3KYDA 1P44A 4OGWA 4YRBA 3H3JA 1PU2A 1LC3A 3T7EA 3PHGA 3QVXA 4L4XA 2FHSA 4WUVA 1PZFA 2JCVA 3GT0A 1PL6A 3DOCA 5COBA 4CR8A 3ROKA 1HYHA 2RHRA 3COSA 1E7MA 3BMQB 4FFRA 3ZNOA 3IDSA 3GK3A 1DFIA 3U4HA 1GAEO 4PG7A 4M89A 2A4KA 1JA9A 2EF1A 2Q1TA 2DBZA 3AY3A 3U62A 5TS3A 3RBVA 4PGFA 1GPJA 2FN7A 3D3WB 4FFMA 4IDGA 4I5EA 4CM6A 4FFPA 1LJ8A 3U4DA 3IKTA 3JQ9A 4ZRMA 4NJMA 4GWKA 3ADOA 4NJMB 4ZU3A 5BSHA 1XDWA 4PLZA 4A7PA 4NBRA 3HNPA 1WZEA 1GQYA 4HFRA 2YFHA 1YL5A 4CQMD 4QQRA 3I3OA 5AXDA 1PGQA 4QO7A 4LRSB 3QWHA 1E6EA 4CM5A 1ZXBA 2BFPA 3GUYA 3STHA 3ZN2A 4YAJA 3UVEA 2PK3A 5T64A 1PJLA 3OJEA 3ICCA 4OXKA 4BV9A 3M2TA 1I0ZA 3OEYA 3NX4A 1Y9AA 4L75A 1LRJA 3E48A 4XDYA 4K6FA 3GMSA 3JQGB 1QMGA 1U8FO 2PY6A 3FCOA 3GUCA 1TT7A 1WDKA 3GDOA 1ISGA 2A35A 4OKIA 3T4EA 3ZNNA 3GVXA 1VLLA 4O59O 3TOXA 2GASA 1PJ4A 4NBVA 3ST7A 2Q99A 3DHNA 4NFYA 5A9SA 3P5SA 3JD1A 3PJGA 5TRTA 1PR3A 4NFSA 1V6AA 1NR7A 4RF3A 3ETEA 4DLAA 2RAFA 1ZFNA 3UFXA 2R00A 2DTXA 3NAQA 1MXHA 2HSDA 4EUEA 4CQMA 1SO8A 2X5KO 1I3LA 2EKPA 3I9MA 2ZQZA 4ZQHA 1B7GO 4YB8A 1IL0A 3RD5A 1A72A 2P9GA 4BUCA 1YDEA 3WGZA 5IAAA 3PWSA 1H9AA 4IDDA 3E1KA 2BHLA 3U3XA 4IJWA 3BMCB 3ANLA 1U7TA 2NV6A 3QV1A 1T2EA 3HHPA 1X15A 4A73A 3OA2A 3CE6A 2YV1A 4WEOA 4FPXA 1B8UA 3F4BA 1PQWA 1WMBA 3PEFA 4R5MA 5AYVA 4PLYA 3WLFA 2D2IA 5ENVA 2ZTMA 4CR6A 5BR7A 4A26A 4J1TA 1Y8QA 5KKAA 4J3FA 4MKRA 1HE2A 1RWBA 1C0PA 3K96A 3GEMA 2GRAA 4E5NA 1ZCJA 2X5OA 4E2ZA 3QWIA 1PJCA 1GYRA 1RM0A 3E5MA 1GADO 1GV1A 3MCVA 3O38A 1F14A 2J3KA 3LT0A 1GEGA 3JD4A 4B4WA 2AMFA 3I6QA 2DUUA 2YQ5A 4GH5A 3U4IA 3H9JA 3DFZA 1KVRA 2ZCVA 4KZPA 4MIOA 5EL0A 3IJPA 2EXXA 2X7HA 3RJ9A 3LYLA 1GUZA 5KTKA 5DDIP 3KYCB 3TZHA 2G5CA 4ZQBA 1E5QA 3QVTA 1C0LA 5JAIA 4BKRA 1U3UA 6ADHA 2JFGA 3ZWPA 5A9RA 4YCAA 3MJSA 3IS3A 5JW6A 5CEEA 4RVUA 5A02A 4C7KA 5TC4A 1ISMA 2AE1A 4Z6KA 1DEHA 3F47A 5A3VA 3DZBA 2VOJA 3BHMA 2DT5A 4ALNA 4XZ3A 3L4SO 1YO6A 1QSGA 3TZCA 2CSUA 4R9RA 3VAZA 3FNGA 4LRTB 1EVIA 2BGKA 5KCZA 1AE1A 1T2CA 1E7WA 3I9OA 4TVOA 2Q3EA 4NBTA 3UUWA 1JWBB 3ZWCA 2PKQP 4NI5A 4W9NC 5JCJA 1DC4A 3VH2A 1CQIA 1U8XX 2BGMA 2BKAA 3INRA 3OBBA 4R4JA 3FTNA 4YWJA 4BKOA 4HFJA 2FR1A 1H5QA 3R0IA 2OO5A 5CAEA 3IL2A 3X2EA 1OFGA 5KOIA 1D4FA 4AJPA 4HP8A 1FJHA 3I4CA 5JDIC 4WLVA 4XD2A 3I1JA 2O7SA 4BB6A 1TA4A 3ZWAA 1NASA 3FD8A 2DM6A 4FFLA 2J5RA 3WSVA 1PIWA 2OXIA 1MGOA 5JBIA 3MJ4A 3WJAA 2E49A 3HN7A 4E2XA 1C0IA 4MDHA 1IY8A 1PR9A 3NT5A 4MKZA 5JY1A 3H9QA 4IY1A 2CDCA 1FXSA 3MJVA 2FY8A 4BNMA 1B0AA 5L7YA 1H6DA 5JXWA 5KWEA 4FGWA 2HJRA 4J9VA 1B3BA 1X1EA 1DC6A 4ND5A 2WEKA 5IZCA 3S2GA 5L4SA 3OICA 4HADA 3AM3A 4CL3A 5DBFA 3G1UA 3RWBA 1KEWA 1LUAA 5L7WA 3K31A 4D45A 3E6AA 3UAGA 3WB9A 4BNLA 1SOWA 4FN4A 5C37A 4LN1A 2PZMA 2HQ1A 4CQMB 3K92A 5CDYA 4E5KA 3M6IA 4BNNA 4CLRA 1NQAO 3WQRA 3PQEA 1MUUA 1RM5A 1KEVA 5F21A 3GAZA 5GY7A 1VL6A 3H2SA 4XGKA 2CD9A 4I5DA 4MP3A 1W8DA 3FI9A 4TKLA 3OIFA 4XEHA 3ZGYA 2J8ZA 1R6DA 3L0DA 5BSGA 4Y8VA 3QY9A 5C5IA 2AG5A 4RORA 1I30A 1YQXA 4XGIA 1GV0A 4RZIA 3WGGA 4LW8A 5A5EA 4ID9A 4KDEA 1AGNA 4GSKA 4YAIA 3RC7A 4K9DA 5C7LO 3IQDB 2G17A 2O3JA 2W98A 2DC1A 4A27A 4JIGA 1YE3A 2GGSA 1NX6A 2W2LD 2P2SA 1T24A 5BSEA 1K3TA 1KIFA 5IF3A 4E2WA 4TMFA 3GZNB 5JDCC 4G65A 1SOVA 3TOZA 3PTZA 1Y8RB 2AG8A 1V3UA 5I7VA 5L95A 4JK3A 1QRRA 3GNSA 2AEJA 4UVEA 1D1TA 3RFXA 2VUUA 4BVAA 3DBRB 3W6UA 3GVHA 4IQGA 1E3WB 5T8KA 3PZBA 5CG2A 3V8BA 4DTIA 2BFMA 1WNTA 2VUSA 3O03A 1NVTA 1YBMA 4TSKA 2DUWA 1LLUA 1M67A 3W8DA 3GF4A 3FRJA 1YH3A 3ZWXA 3RROA 1V0JA 4BGIA 4II3A 5FYDA 1QLJA 3E8XA 3DONA 4YT2A 5I9LA 5KVCA 3QVOA 2YW9A 4XYLA 5JFOA 3JQ6A 1BG6A 1HT0A 2AE2A 5IZCC 3D4NA 2C82A 4PZCA 3GR6A 4RPHA 1X14A 4AL4A 3CZRA 4LGVA 2D1YA 3PIDA 2Y67A 4YJFA 5F1KA 4UUPA 4ZICA 2QX7A 1ADGA 2JCYA 3H9UA 3WGIA 2NU9A 3WTCA 3ENKA 1D7OA 1ZSNA 3WQSB 1NWHA 1I5RA 3ROQA 2WM3A 4P22A 5JAQA 3HDJA 1MFPA 2C54A 1PX0A 1GZ6A 5TSDA 1HTBA 4ND1A 3L07A 2IEBA 3GFBA 2OBYA 3HZZA 3JD2A 3EZLA 3NTOA 2A94A 3ROMA 4RLHA 3QJ5A 3ZHZA 3DBVO 2CUKA 1O6ZA 3B1KA 1PQUA 1FDUA 5AQ1A 3K30A 4ZVVA 4WLEA 4GX0A 4F46A 5JNLA 2G76A 3SEFA 1NNUA 4TRRA 1SB8A 5CP8A 4MVJH 4CLOA 1OOEA 4FS3A 2OFPA 1EVZA 3LT4A 4C7JA 3KB6A 3JQAA 3RUDA 4GLLA 1O9BA 3MJCA 1Q7BA 5F3RA 1IUKA 1EFKA 1LDNA 4XIYA 5KJ6A 1B16A 4GMFA 4OMUA 1I8TA 3JYQA 4IXWA 4CLHA 1T1RA 4N5MA 1KBZA 3F6YA 2VHZA 2UUOA 3PQDA 4E2YA 2WJPA 4DQVA 2GERA 1YQDA 4DXHA 3WMXA 5JPIA 3JQ8A 2IEDA 3LC2O 1U3WA 3PLNA 3Q6IA 4Q9NA 3W4IA 1JAYA 1ZK0A 1UH5A 4N5LA 1S7CA 2JFHA 2RBEA 4CLDA 3DWFA 1DO8A 4LVUA 4JBHA 4AJLA 3AWDA 3GGPA 4WJZA 3GEDA 1LDEA 4U0KA 1AHHA 3PQFA 1UZLA 2C59A 4W82A 3H9GA 4RO0A 2QYSA 2WD7B 4FR5A 3VZQA 1J4AA 3WGHA 2QG4A 2RH8A 1ZKMA 1YXMA 2ZJ1A 1JAXA 1IOLA 1G1AA 1FF9A 3ZV3A 4DWVA 2JKVA 4RF5A 4CM4B 1PZHA 2BGLA 3U49A 4JJGA 1EVYA 3GC6A 1V9LA 4IJVA 1XWFA 4YJGB 3ZWYA 2PD6A 2VTEA 4JXKA 3UCFA 1UP4A 1ZW1A 2W8ZA 2G1UA 1NM5A 4JN6B 3WFIA 2QQ5A 1TLTA 2YUTA 4PLGA 3ROPA 3FPCA 3H9EO 1EE2A 4CM3A 2PNFA 4UEKA 3KOUA 5IJZA 4D3DA 4IXTA 4GMGA 4BGVA 4E5PA 3RUEA 4ALLA 5H83A 3FPLA 5I7FA 2DFDA 2O2YA 5JO9A 2FWMX 1YBVA 3AUTA 1K2WA 1NHWA 2GR9A 3K9QO 3PRJA 3KBOA 2WSBA 3ONDA 2Q4BA 3WGQA 3LK7A 1DC3A 1YVEI 3D4PA 5G4KB 4ZA2A 1H93A 2NQ8A 3I4FA 4E3ZA 4ZJUA 1DC5A 4RPLA 3RUIA 3WWZA 4EZBA 4UREA 1KYQA 5L7TA 4Q3NA 1J49A 4MP6A 4R1NA 3TZKA 1HSOA 4XRRA 4G81A 3BTVA 3ZI0A 1HZZA 2QIOA 1A5ZA 1UXJA 3H6KA 4FJ0A 5JMPA 4EJ0A 2NTNA 1R37A 2AEFA 2C2XA 5ITVA 2OP1A 4JP3A 4DYDA 4F6LA 1K6JA 5COQA 4ZRNA 1GCUA 1QYVA 3C3XA 3OF2A 1OZAA 2FZEA 5JYDA 2ZTUA 3GRKA 5FI3A 1DIRA 1QG6A 3PWZA 3UH1A 2F1KA 2H1SA 3KSUA 4GX1A 4EITA 3FBTA 1TT5B 1UZNA 4NK5A 2H5LA 5TLSA 4QTZA 3GRPA 2C07A 4IUYA 2BELA 2BI7A 3AK4A 2VTDA 3EK2A 1PL8A 1XR3A 2HCTA 2UUPA 2Y05A 4JCOA 1VPDA 1E3JA 1Y8RA 3A1NA 2JHFA 4B7XA 4CMEA 2EW8A 3GZNA 1CF2O 1V3VA 1QYWA 1EUDA 1NVMB 2AW5A 5JAZA 4HX5A 4MIYA 4MINA 1SAYA 3FNEA 2NACA 1CJCA 4BNWA 4HUJA 5EINA 5DP2A 3FWZA 2YFQA 2HMWA 3DQPA 3ASUA 2ZKLA 3AU8A 1UDCA 1IPFA 3UXYA 1IHXA 3KLPX 2X22A 3CMCO 3N58A 1DOHA 1P9LA 5BNTA 3O9ZA 2C0CA 3QVWA 1XQ6A 1N9GA 4Q3CA 3WDSA 2X86A 4B7CA 3RUFA 5TNXA 3G3EA 2NU6A 1LQUA 2G82A 3MWEB 2EGGA 4L0QA 5HA5A 5J23A 3DFUA 2CVOA 1WDMA 4MO2A 5KNLA 1RKXA 3PFFA 4N7RA 4WOKA 3TRIA 3TZ6A 2QZZA 1PSDA 3TNLA 5ENDA 3OP4A 3HSKA 3LT1A 1L7DA 4MIEA 2JD0A 1DJQA 2IRWA 3K2BA 1IE3A 1PGNA 3ZV4A 4G5HA 3WS7A 7ADHA 4RVDA 4EEZA 2ZTLA 4L8VA 2DAPA 4YPOA 5L45A 3HDHA 4RVFA 1C1DB 1EFLA 2PGDA 3VPSA 4CLEA 3OQ6A 5DCYA 2B4RO 4XRGA 1NQ5A 1F8GA 1WAMA 1I3MA 1JKJA 4DIBA 1CYDA 3E9QA 3V1YA 1ONOA 3N7UA 3H4VA 2GZ1A 4IDEA 1PGOA 3JQAD 1R15A 4DUPA 4L76A 3SJUA 1H6BA 3E18A 2BRUA 3P2OA 4INAA 1SEVA 3MOIA 3ORFA 1JW9B 3V2UA 1HEUA 4K28A 5C7OO 4KTVE 2CZCA 3QIVA 4YR9A 1T25A 4AJKA 4P4GA 2WE8A 4OM8A 1ISJA 1LDYA 2HMUA 2X5JO 5IN5A 4IBOA 2PKQO 4D0RA 1DLIA 1EE9A 2WDZA 1TI7A 4MPDA 4IJUA 2IYOA 3IP3A 4RQUA 3IUSA 2WWRA 2DBQA 4B3HA 3OEWA 3VKUA 2E6UX 1CERA 1DHRA 1UXIA 4ILKA 3RFTA 2HK8A 3G79A 2HK9A 1ZEMA 3NGLA 2E4AA 4Y6PA 3GPDG 4KUHA 4BNXA 4HV4A 4AICA 4BIIA 1GR0A 4JGBA 1ZBQA 5L4LA 4WGGA 2DVMA 4CJXA 4DL9A 3BTSA 3EAGA 3H7AA 4QFDA 5CDUA 1YL7A 3EZYA 4P8RA 1QP8A 4DVJA 1UR5A 3EW7A 4M1QA 2CY0A 1X7GA 1QYCA 3MEQA 1P45A 1K89A 3NRCA 1UXKA 3KYCA 3AOEC 4NU5A 1JWAB 2IODA 2WYVA 2HDHA 4TZTA 3DZKA 2Q1SA 5A05A 4IZHA 1RYEA 4YJDA 5ER6A 4IS2A 1N8KA 4PN3A 1UXHA 4KWHA 1SMKA 2VWPA 3T4XA 1C14A 3I6IA 4E32A 1NTOA 1M6WA 3Q1LA 1UP7A 5EPOA 4D7AA 1WWKA 1ULSA 4XYBA 3C24A 4IDFA 3CXRA 4ZQEA 4UAGA 2I76A 3NYWA 1E1KA 5DOVA 3CZMA 5ICMA 1XSEA 3PFWO 2JCXA 1H9BA 4L73A 1E7QA 3LLVA 3C7AA 3DDNA 4S1VA 1YGYA 2H9IA 3KHUA 4J91A 3JQFC 3D3EA 3L9WA 5A4DA 1KY5A 3ZHYA 4NHEA 2D4AA 1ML3A 3AUUA 3A4VA 3PHLA 3DBLB 4YA6A 1WP4A 5EESA 3KZVA 5H81A 4PLTA 3DMYA 4BNYA 5T67A 4RPJA 3PVZA 5JE8A 1HETA 3EY4A 3SLGA 3K73O 3AFNA 3WX0A 1I2ZA 1KERA 4JJIA 2BF7A 1EEHA 2P68A 1D1SA 2X8LA 4CM9D 7MDHA 4RJTA 2X58A 4DQUA 1NWCA 5B4UA 4FFOA 3DO5A 4UUMA 3ZCXA 3AUSA 2VZ0A 1UXGA 1RJWA 4XYGA 3PJFA 4KTTE 3SC6A 3ZHBA 3IJRA 2POQX 1ZEJA 4E0BA 1E1LA 3V1TC 4Q3AA 1V8BA 3DMTA 3I52A 3ULKA 5ILOA 5EMHA 2Z1NA 3RIHA 3JYPA 4KDFA 3B70A 1FDWA 1B26A 3NJ8A 3CKYA 5A1TA 1E92A 3DHYA 1E3EA 4JLWA 3FTPA 1FK8A 4J4HA 1A71A 5A9SB 3DHEA 1FDTA 3NTQA 3TFQA 5ILGA 4UVGA 3NEPX 1KS9A 5G0VA 2CVZA 5I8WA 1FDVA 3LC7O 4PLPA 3KM0A 2GCGA 1NFQA 1PJTA 2ZYAA 2Q2QA 1E5LA 3H5AA 4BNGA 2VYND 4BNJA 2HAEA 2NU7A 4CLXA 3B1FA 4CM9A 4DA9A 5EQDA 2FPPA 3SXPA 3EUWA 4TVBA 1AXGA 1KEPA 2DFVA 3BTOA 2ZTVA 5K9ZA 1C3VA 2EWMA 3IAHA 5I8ZA 1J5PA 4D42A 4HKTA 1BXGA 4YAGA 5CDTA 4RCVA 3DXFA 4XQEA 4D44A 3EVNA 3S2FA 5JMWA 3AW9A 1PJBA 4JQCA 4YQYA 2BH9A 2EKLA 5B4TA 2G0TA 3VC7A 4PFJA 2O3QA 1U3VA 3ZWMA 5TQVA 1SEPA 3DZIA 2BI8A 1VJ1A 2FR0A 4YACA 1G0OA 3AI3A 2YJZA 1ZNQO 1LSUA 1C1DA 4WLUA 5F1PA 4HFMA 4NNJA 3FR7A 3KTDA 3QE3A 4RL6A 1U28A 5L51A 1YQGA 3B1JA 3BMQA 4IDBA 3BZUA 2SCUA 2NU8A 2JD2A 4BGUA 1DRVA 4WEQA 3IKVA 4IMPA 4J1NA 5LC1A 2GNAA 3AM4A 1HL3A 3VVBA 1PJSA 1LRKA 1P31A 1N7HA 4XIJA 4AFNA 1BHSA 4MVJA 1E7YA 4H3VA 5IZ4A 3KYDB 1T4BA 1UUFA 4LK3A 2NVBA 3P19A 4CUJA 3RSHA 2CFCA 2XAAA 4R1SA 3F1KA 2PWZA 2D5AA 2X0RA 1YJ8A 1X13A 1LLDA 4AJ2A 2PD3A 3EHEA 4RPGA 5A03A 1P74A 5FI5A 4M87A 5HS6A 3C1OA 1OI7A 3MTJA 3TL3A 4BOYA 2O48X 3U4CA 2W90A 3O8QA 4GSLA 2D59A 3GEGA 2X0JA 3GZ4A 2FP4A 2VWHA 3V2GA 4R68A 1HKUA 3RI3A 3UF0A 2AQ8A 4LCEA 3JYLA 2AHRA 1HDCA 5DBGA 2B5VA 1I2CA 3JQGA 5HTOA 5DULA 5KKCA 3VTZA 5DT9A 4MVJF 5TF4A 2O2SA 1W6UA 3GHYA 4Z3DA 1YRLA 5L9AA 3K8ZA 5T8KC 4Q3BA 1PJQA 3L6OO 4KUEA 3S8MA 4OO3A 1Z45A 3BA1A 3GMDA 1JU9A 2Z5LA 3PIIA 4KOAA 4O63O 1K6IA 4DLLA 4BQPA 4BMVA 3ONFA 3MJTA 4HXYA 4Q3DA 4ND2A 1NAIA 5KJ1A 4EJMA 1DIGA 1I3NA 3M1AA 4R1UA 3JQBC 2NADA 4OSPA 3JQCA 3NDRA 1KC1A 1P77A 5HS4A 4G2NA 3R6DA 1TT5A 3I9KA 5CEFA 3HADA 3D3WA 1ZSVA 1XCBA 3JQDA 3OECA 4IIVA 4LSMA 3OMLA 3TPCA 1I10A 4BGEA 4CMCA 4WCFA 1Y7TA 3RASA 1VM6A 1XA0A 4BO2A 2WYUA 4YTEA 1O94A 3W8EA 4IS3A 5EN4A 3DOJA 1LDMA 2P5UA 3RKUA 1E6WA 3OIGA 4AG3A 3NKLA 3AM5A 2HU2A 3I83A 5JC8A 3F5QA 4E30A 5JAMA 3WSWA 4OKNA 3SVTA 1GCOA 2Y1CA 1VI2A 2O4CA 2HO5A 2HRZA 4ZN6A 1GY8A 3JSAA 3TN7A 4CMHA 3QRWA 3GVIA 3VTFA 3LSYA 3RVDA 1VSVA 4M49A 2Y1DA 3PK0A 1R16A 5ER9A 1B8VA 1XKQA 2X9GA 3ON5A 4DREA 2O7QA 3LLSA 4FC6A 4PZDA 4PVDA 3VHRA 3Q2KA 4UVDA 3W4JA 1HDOA 5IXYA 5THKA 4NK4A 1RM3A 2WD8A 5B4VA 1LBEA 5CG1A 4ESOA 1LLQA 2NQTA 4IGFA 1I01A 4M8SA 1PZEA 2J5KA 1DPGA 3WG9A 5HM8A 4GKBA 2VT3A 1NPDA 4I5GA 5DP1A 1N7GA 2V6FA 4DC1A 3OETA 4M55A 4P4NA 4F6CA 3INGA 2GO1A 1CIVA 1SB9A 3WLEA 1ZK3A 1VSUA 4R3WA 1F17A 1R66A 2GN6A 2FSSA 2J3IA 3JQEA 5IXSA 4CR7A 1LNQA 2YY7A 4P4LA 3WR5A 1TXGA 2CDBA 3GH3A 1NVGA 4DYVA 3OSUA 1XGKA 5K6AC 1LC0A 3M1LA 4PLCA 4BNZA 4CV2A 2C7VA 4FJ1A 1EBFA 2CF6A 4J7CA 4ZQFA 1YBAA 3TL2A 4BV8A 4DIOA 3PGXA 3DBLA 2EJWA 3ITKA 4ZGWA 2B4TO 5G0UA 2GF2A 1JN0A 2YV3A 3F3SA 5IN4A 3OJLA 2ZYDA 2I6TA 4GI2A 3EC7A 1W73A 4U6SA 2Q45A 5DCWA 3UGKA 2I3GA 1I36A 4XR4A 2DTDA 2EEZA 3TZQA 1P0FA 4PLVA 1R4MA 4NBWA 3WIDA 4WK6A 4CLOB 1BVUA 1GPDG 5FFFA 3VZSA 1M6HA 1O0SA 5THQA 4UULA 3E9MA 5L53A 4BMSA 3GFGA 1DAOA 4LCJA 4GL4A 2P91A 3U9LA 1BW9A 3HFSA 1ZUD1 4FFNA 1A4UA 2Q46A 5G0SA 5BNIA 2W2KA 4J2HA 4RPKA 3QWAA 5T6BA 1ZVMA 5TX7A 4R69A 4QO8A 4BO7A 4OSOA 3A28A 1ENZA 1Q1NA 4NR0A 1N92A 1E0DA 1PWZA 4J16A 1EBUA 5HWSA 1QYXA 2IZZA 3NGXA 3JQAB 1EK5A 3T7CA 5AOVA 4BO4A 2HMVA 3F4LA 1HWYA 3ZWOA 4R3NA 3GOHA 2DPHA 2NTJA 2UDPA 4HY3A 1E1NA 4XA8A 5TJ9A 3VPHA 3DTTA 5MDHA 3EYWA 1M76A 4YJFB 3NT2A 4D46A 4DMLA 1IPEA 4XJSA 5FF9A 1HRDA 1X0XA 1HYGA 1PS8A 1RPNA 1Z7EA 2B69A 3C7DB 4BO9A 2PFGA 4F3YA 4YBZA 4TKMA 2VZ8A 3DEYX 3F1LA 3BTUA 4E21A 4W6ZA 2DQ4A 1I2BA 1SCUA 2NLOA 3GNQA 4PRLA 1I3KA 1T2FA 3OHSX 4FD3A 4TWRA 3TQHA 1HLPA 2JHGA 2VYVA 4WCFB 4IJKA 4NPCA 1VJTA 4MVJD 1HSZA 2DBRA 2J3HA 4WNCA 3WOHA 3H65A 5CEJA 3LZ6A 2OHXA 2GN8A 2P9EA 2WE7A 3FHLA 2PA3A 4XQGA 4A5OA 1YWGO 3DTYA 1IZ0A 1DB3A 4Z0HO 1ARZA 2OUIA 4WPGA 3D7LA 1OMOA 2RH4A 4PLFA 4XWYA 4QUKA 2IZ0A 2I99A 2WMDA 2FPIA 4MVJP 3JCZA 3GPIA 4KMSA 3M2PA 3UW3A 3FBGA 3IP1A 1BXKA 4BO6A 2IE0A 3OQBA 4E33A 1VRWA 4ND3A 4P38A 2NTVA 4HNHA 1YB5A 2ZB7A 2AXQA 2FOIA 2B5WA 1EQ2A 3GNTA 4O0LA 3A9WA 1NBOA 2IXBA 2C5EA 2PD4A 4I08A 3DBRA 1PL7A 3QA9A 1DBVO 4FB5A 3BMNA 3CTMA 4OXYA 1NQTA 3ZU5A 1A9ZA 5EJ2A 1IB6A 3ZNQA 3IUPA 3JYNA 4CM1A 1MXFA 1A4IA 4IIUA 4DBZA 2IDZA 4N5NA 3U5TA 4BO5A 3TFOA 1BRMA 1N9GB 1HE4A 2HJSA 3V2HA 4AJIA 4CPDA 4I9HA 5IDXA 4QEDA 3PHIA 5I7SA 1ISHA 1U7HA 3KEQA 5BT9A 3RU9A 1YB4A 2Y99A 1H2HA 1Z7BA 5A9TA 3HN2A 3ICPA 3R3SA 4BKQA 5CDGA 3ZDFA 4D3FA 3VPFA 3G49A 4J1SA 4GAEA 3VH1A 3K2EA 2Y93A 4DPKA 1NR1A 4FW8A 4DPLA 5BNFA 4BNIA 1I33A 2I9PA 2JD1A 2ZATA 3L4BC 2Z95A 1X1TA 4CV1A 2GZ2A 1HDYA 3DOOA 1U2GA 3K5PA 3WNQA 3JQBA 3RBZA 4B3JA 4CLRB 3UCEA 3VKVA 3A14A 2X4GA 3QLJA 2PH5A 1ADFA 3FWNA 3BMNB 4RQTA 1O95A 3RU7A 3Q2IA 2YZ7A 8LDHA 2O4UX 4BO0A 1GFSA 5KVSA 3DAPA 1AN9A 2VHYA 1N5DA 1P1HA 2ZJ0A 4UVHA 1HLDA 3WMWA 2O3RA 5G4LA 3S55A 4CQLA 3VH3A 3BYZA 4YEDA 2I66A 5JDCA 1DJNA 2X1HA 4E13A 3LQFA 4PRKA 1HF3A 1ENPA 4FIZA 4JJFA 4W4TA 2OZPA 4E6PA 1U9JA 4H7PA 4OXNA 1GU7A 1EUZA 4O6VA 3CH6A 3KXDA 4EEXA 4QSMA 3DR3A 5HRUA 2PH3A 3PXXA 3PYMA 5CDSA 3L9XA 1F12A 4AJ4A 1CRWG 3C8MA 1GUYA 4M54A 4B79A 3NTRA 4U0JA 3DAGA 3INTA 3KYBA 3O4RA 4IGEA 1V35A 1YS4A 2YDXA 3BHJA 2VN8A 2CF5A 1MG5A 1ONNA 2V6GA 1GDHA 2QHXA 4CV3A 3Q3CA 4CODB 4ALMA 1ZK2A 1IULA 4UUNA 4OOFA 4Q39A 4Y9DA 1DRUA 3VPXA 3KSZO 1Y6JA 3MTGA 4KQWA 4BQRA 1LRLA 2RIRA 1Y5MA 1Z75A 2QW8A 4NH4A 3VPGA 3HFGA 3K6JA 2W2KB 3U09A
chains in the Genus database with same CATH superfamily
5BPFA 2LVBA 4GRDA 2R8YA 3BDVA 2JFBA 3K1ZA 5IBRA 4FMDF 3U0BA 2X3YA 3CY6A 3L1HA 3UHPA 4EHKA 5JZOA 4P1ZA 3M33A 1KEEB 2QN7A 4B44A 2CCGA 1VL0A 3C85A 4F2HA 5HUHA 2B1GA 3TWOA 3PPVA 3R6TA 1EK6A 4PC1A 4EI8A 2EIHA 1NHGA 3EVZA 3RC2A 2VEOA 4E11A 3Q0IA 1DBIA 1N9ZA 5JPCA 4KRFA 4UBNA 1D6SA 3PNSA 1LPPA 2VDMB 3O1JC 1F8XA 2Q3FA 2QMEA 2WVJA 3CEHA 3AJ8A 4MTLA 1PSZA 2HRQA 4KE6A 3U4MA 1WZCA 4NU8X 3CT6A 3HPQA 1YQ9A 4K26A 2R1UA 1U8AA 5IDQA 4KI7A 1G8PA 4Z2AA 4EX7A 1P75A 2GKSA 2XMQA 3RW9A 4E12A 2NNLD 3HJHA 3M3PA 4O02B 2VRWA 3DCIA 3G2JA 2JGEA 4QAQA 3R8CA 3V2IA 4BB0A 1KFCB 4UNNA 2ZBGA 5DM1A 1IXZA 3VZRA 4G1MB 1OWMA 1FJXA 3KOYA 1EZ4A 3OUZA 1QP0A 2O8DA 1OGJA 2Q62A 4LZLA 3PDCA 1EQUA 4L0DA 3UENA 2JLAA 2QG9A 3UJ7A 4ATNA 3WFJA 3I23A 1SH7A 2PT9A 4JSRA 8MHTA 2AN4A 1ESDA 5JLAA 3CINA 3MSXA 1Z4LA 3N0VA 4U39A 2HQOA 3M9XA 5LVAA 3H8WA 1JG2A 3FTQA 2J5QA 4KR3A 1Y34E 1CUGA 4EKEA 3GP8A 4A2CA 2QL6A 2J7PA 4BLTA 2OP0A 2V6JA 3RVQA 1XKTA 1GL3A 4I4IA 2ERYA 4NENB 1JUDA 2RG1A 2BY4A 4W5TA 1IN8A 1SKYB 4R8LA 2XOKD 2ISCA 4ZAWA 3TIFA 4YRSA 1HE8B 2DEUA 3E03A 6Q21A 4LCBA 2I8AA 2VJAA 2SICE 4GOND 4J29A 1VYHA 2PMDA 1P2UA 1LY1A 3CLTD 3ZW9A 4FDAA 3FPHA 2CMDA 4FI3F 4IJ6A 3VVMA 3U7EB 2PZLA 3CIFA 5AJHA 1R0WA 4DMMA 1SUFA 3D5QA 2YHUA 2Z57A 1JVBA 3T3DA 3IAEA 4EABA 3QMMA 2E7ZA 4EVQA 3LPMA 4XE5A 1PJ2A 1ZZEA 2JAUA 3V55A 4C2TA 1JL3A 1MB4A 2QM3A 1NP6A 4BRSA 4P36A 2G8LA 4XUCA 3ONEA 1CWUA 3MVEA 3A9RA 4QECA 5IT0A 3L4BA 1H6CA 1FNDA 1HNNA 3NHFA 4IX1A 1XJWA 3RBXA 5H3HA 4W99A 3BHIA 4ZCPA 1U99A 4PYMA 1T6ZA 3D43A 1Q16A 1EP2B 5F9FA 4MAFA 1W29A 4JROA 1O4WA 2VDUE 2R3SA 1GJRA 1CEXA 1DJOA 3O1IC 4K9OA 1NZJA 1I9GA 2JZNA 3A7DA 3E7FA 4LRUA 5K3BA 4TWAA 4N5DA 2QB5A 5FTMA 3QBDA 1P33A 4PHHA 4ZXFA 1CYEA 1UJNA 4P92A 1DI0A 2C7BA 4IOJA 1BIFA 1BWPA 3MLBA 4G1BA 1TVMA 1MA0A 3R20A 1XELA 4GVLA 1SA0B 1ZC4A 1XZKA 1TK2A 2F2TA 1V43A 4A0RA 3CNOA 3CZ4A 1A9YA 1M6NA 3P27A 4QUGA 2WKSA 1WDTA 2M98A 2BGUA 3PCTA 1QTIA 4E7PA 1QZ3A 2GTHA 5ALPA 5SV2A 1P0IA 5F7XA 3SYTA 3HJTA 3UICA 4DSOA 5FOVA 3AOGA 2W42A 4CM8B 2FW8A 5E2BA 3C3PA 4YXFA 4TV9F 5EJGA 2HLNA 3U80A 3F90A 3BC1A 4X3CA 2YFKA 2O52A 3UKOA 2EVWX 1PBNA 3FJOA 2Q5LA 2CXQA 4YWHA 1KVSA 3ZH2A 3ZJVA 3K8QA 3Q10A 2VCHA 2YX1A 3LGSA 1MABA 3AILA 1CQJA 2AA3A 2CVQA 3EWIA 4RF4A 4KVAA 3TQRA 3E8MA 5H8WA 1MO6A 2A7XA 1V4BA 2OOSA 3NV9A 4KIFA 4DW8A 1AF7A 2OCIA 1YONA 2PGAA 1OBVA 1PTJA 4TLAA 4QJ5A 4G07A 1YTUA 3G9XA 4WOJA 5KNBA 4MARA 1NJGA 4D4GA 1T4DA 5AM0A 4EI2A 2JKYA 2PVCA 2AOVA 3ZHVA 4ZTUB 1DX6A 2OESA 3D8UA 5JCXA 2JASA 4J3JA 5A0FA 2YV5A 1V1RA 4RHEA 1T5TA 2MIIA 3RCBA 3MD9A 3WO0A 1MFZA 2OMKA 1LLFA 1NATA 2BFNA 2GX6A 2OMEA 2VUHB 3VPCA 4BZQA 4TQGA 1M0WA 4RD6A 3NWEA 3B7GA 2XWPA 4X24A 3BWBA 3FDXA 5CM2Z 3ZK8A 4WESA 4J0FA 1OFIA 5C8YA 4CI0B 3FTEA 4YCSA 1MC4A 3TIIA 1W36B 2UZ0A 3TOCA 4POAA 3EF0A 1ISPA 1HZZC 2V7QD 3HEBA 3AUXA 4MKXA 3W3ZB 4MW5A 1MF7A 5JHGB 4G9EA 3O8OB 1XYGA 3HBMA 2FUG1 4F5WA 5C3MA 3RAJA 3K1JA 5CFZA 2HU8A 4Y1RA 2AOTA 2H8GA 1I4WA 3EB9A 4HWKA 1P5FA 4KYIB 4UU1A 3RUCA 1N5OX 1K8YB 2EX4A 2F17A 2ZR9A 1UF9A 4OCZA 4OJMX 5AM3A 3BK7A 1OAAA 1YKFA 2PZJA 2HNAA 3C1AA 2AB0A 1LPBB 5T57A 2MT9A 2XLBA 1SG9A 1W9HA 2G5TA 2RHGB 3HUEA 3G5UA 1I4EB 3O7MA 4N5HX 3IV9A 3LFUA 2GN9A 3VR5H 1T0JB 1X42A 2LW7A 2CDRA 1D2MA 2WYHA 3WLJA 1XI2A 5B6JA 2Y1GA 4AI6A 4UFOA 4B34A 3AJEA 4XSVA 5KVAA 5DNYB 4OQPA 2XXAB 4CIVA 1IZ8A 5E4JA 1S3IA 2J3DA 3C8ZA 5AOBA 1TK9A 2IWHA 3VPDA 4NMMA 3DBHB 2ID8A 4XYMA 4TTPA 2PGLA 2E3JA 4BNTA 3ZIAD 2P5TB 1C0KA 1FFEA 1QTQA 5GJVC 3VR0A 2WMNB 1C7JA 1EUCB 1ZK1A 3IPXA 3M3HA 3CCCA 4CM7A 5I9MA 4MHSA 4NENA 4KN9S 2IV2X 4AM8A 1QG2A 4NICA 3U7JA 4IJ5A 3ASYA 5U4XA 3ONVA 4DSZA 1T3SA 2NMVA 1PGJA 4KYTA 2X0EA 4FOSA 2R8ZA 3GWGA 5K05A 1ZGCA 5HP4A 1AQUA 3V4FA 5J43A 2WD9A 4ZEMA 1WCIA 4PYLA 3GN1A 1TNDA 1JVNA 1R8JA 2BAGA 3HJCA 3MB8A 4N49A 1WU7A 1V7PC 2Q2VA 3O6VA 3QBJA 1E61A 2PRYA 2VUIB 4TSFD 1Z74A 4C05A 1BCSA 2OHOA 2P62A 4ITUA 4Q24A 3P2YA 1YTLA 3DCYA 1ECJA 1NVDA 1R0XA 3HCDA 1WXDA 2GYYA 1KVUA 2NO4A 4GWGA 4PHCA 4DUGD 3ORSA 5IU6A 5LNK1 3RYCB 3X1KA 3JV7A 13PKA 1OI3A 1BSVA 1E4VA 2DQSA 3NT4A 4KMRA 1D3AA 4HNGA 2OQVA 3QMPA 4YT5A 2JARA 2XUGA 3E82A 4N6OA 2BKXA 4P4UA 4DIFA 5C32A 3CC8A 4BAZA 2ZIZA 4BUZA 1BXGB 5CURA 1M1YE 1A27A 4Q4CA 2VZ9A 3PYXA 4ZV9A 3CMMA 4AJ1A 1XL0A 3ESRA 4H17A 3GBPA 3PC4A 1V8ZA 4ZT3A 1UDBA 2QNIA 1DWUA 3O0TA 4LISA 4X61A 5CVTA 1KTIA 2PO7A 3H2ZA 3MTEA 2BC9A 3P5BA 3BXXA 1QFZA 4KV7A 4RXUA 5JSFA 3L7IA 5K6AA 4MPTA 3B85A 4MJLA 2AUMA 3PDUA 3X2FA 1PWXA 3MZ0A 1P4GA 1TEHA 3UQZA 4JLUA 4NJOA 1P1IA 1U0GA 5EGNA 3OE7A 6GPBA 2I78A 2IY8A 1DJPA 3CB4A 1HG1A 1Z2DA 3GBVA 4V0ME 1PKXA 4BKUA 5AW6A 1XRLA 2DQYA 2CHGA 2RGEA 1JQEA 4UBOA 1VQ1A 3O75A 2QN9A 3IIEA 3R7AA 1PUJA 3G89A 3ZV5A 4QJBA 2A92A 1T3TA 2BHSA 2O2IA 2VTVA 3VRHA 5C9ZA 4N47A 1ANKA 1OKKA 2E1PA 4NSNA 3AO0B 4RH1A 4AMGA 2CEAA 3ND6A 4XM1A 3PVSA 3W34A 4YMGA 1C80A 1NXWA 3R9IA 3AEYA 3V32A 3C3DA 4BIMA 2RC5A 1Q1QA 4YAUA 5IG2A 2QE7D 3NC1C 4I9NA 5EHGA 3WWOA 2WF8A 4I99A 5B58T 2EIXA 4W1PA 1EFHA 2P67A 1ZL0A 5DM0A 2RCYA 3G7NA 3M89A 4G97A 4NG4A 3V34A 3M1YA 1GKIA 4XSGA 4AU1A 4BLRA 1SBZA 2HWYA 1EDOA 1Y9JA 4RLSA 3D7SA 1V8DA 1QV7A 4MUKA 4YLEA 3C6XA 1E64A 4OFBA 1UK8A 1U1IA 3V8NA 2XB6A 1XL1A 4IIXA 2V9PA 1JVSA 4QFCA 3B2NA 3PL5A 5P8WA 1NJSA 1R88A 1SKAA 2AJ8A 3TBFA 3GLGB 2IBSA 5CB6A 5G0WA 1NQVA 4KWIA 2IF0A 1KJ9A 2G7ZA 4KE7A 4P7GA 5DCUA 3ZWVA 4CCYB 5HKBA 1XZDA 2ZUVA 1O8CA 1Q0QA 2CJFA 1ZWKA 2VHVA 2W83A 2X19A 3H75A 4GVXA 3TQFA 3VNBA 4NMWA 2Q3DA 3EDRA 1XCGB 3K0EA 2IYPA 3HYLA 4YI5A 4A6DA 5B64A 1JILA 3N6VA 5J2UA 2RD2A 2WNIA 2QR3A 3DVAB 2WV7A 1M66A 3PHHA 2BM0A 4IDAA 3ICVA 2ZIGA 1DIAA 3WYBA 4DC9A 4L08A 4HB2A 3N3AC 5AM1A 2CXHA 4BLWA 4CMJA 3F8TA 5ITWA 4IYJA 4J07A 5IF9A 3PNMA 5JQGB 3BWVA 4FKBA 4OB6A 4S24A 1A8IA 5B2ZA 1CDOA 1E2EA 2VJYA 4ZI2A 2ILTA 2JI9A 1MP0A 1J39A 2E4WA 2O2HA 1LS1A 2QUAA 5GPBA 2PLNA 1OH8A 5JJIA 1EA5A 4O2AF 4OK3A 4K6CA 4B6EA 3M6AA 3RV4A 4HLQB 3BWDD 4ZOLB 5KVVA 4IOKA 1VIAA 3SYLA 2CHVA 3L0YA 4QXQA 2YQZA 5MHTA 3OFNA 4DLRA 1N1GA 3QSYA 1GRQA 1UKAA 1KH2A 4HNVA 4XVCA 3S4YA 3L0ZA 3V8PA 1QLHA 2DU8A 4FINA 4OHFA 1Z38A 3C1TA 3PDIA 2EQAA 2ONZA 4H7IA 4HT3B 1G6KA 3WKBA 4Z4QA 1VKOA 1ZA1A 3FBWA 3IUJA 4ND4A 1DX4A 1DZ3A 3N5KA 4Q9AA 2DRIA 1DE0A 1E77A 4CT0A 2X0FA 5H0IA 2I1LA 3CLUC 1P4AA 5AVKA 2NU9B 4C01A 4L4SA 3DEZA 3JQPA 4URVR 1L4HA 3QI7A 1RWXA 2O2EA 2PUAA 1DAEA 4UMEA 1H4VB 1T26A 1G38A 1YR2A 4XB2A 5CPFA 1WIWA 1JQ5A 2C29D 2NGRA 3RF6A 4P0QB 1Y9DA 3LDHA 4MWTA 3EODA 4OQFA 4OL9A 5FTNA 2J07A 3KUKA 4KQ9A 4ZKDA 5JY6A 5D3QA 4HTFB 4OHMA 3QYAA 3EZFA 1CT9A 1HRKA 3O2JA 1U9IA 2AJTA 2B6HA 3EOAI 3N59A 2PT7A 4WNAB 1MA3A 2V5AA 3LLUA 4F38A 5MF6A 2DETA 2C2ZA 1SOUA 1BWSA 1XRMA 2Y1FA 2PWPA 2A1UB 5K0BA 4BVEA 4LVCA 2HXSA 3LVFO 3VR6A 1F4VA 3FRIA 4B43A 4D9JA 3UJ9A 1GGVA 3LUJA 4IV8A 5GVRA 3RRNA 4CQLB 1UPBA 5A3QA 1PDWA 1Y1PA 2NWQA 3OCZA 4RULA 3NR2A 2KB0A 1ZVVA 3VNUA 1BA2A 3IIKA 1F06A 5CK5A 5IWCA 4XWKA 2BMAA 2FEOA 3DUFB 3EH1A 2WJJA 1U0OC 4FDTA 1S2DA 5C80A 1MC5A 3C6BA 4EDFA 4Q6WA 4JEMA 5AFSA 2PANA 3SC2B 4LZAA 4M6WA 3NOXA 4EPYA 2PSJA 4RAOA 5B3JC 2O3UA 5HMMA 1YL6A 4E08A 1Z5UA 4IDCA 3GN2A 821PA 4W5WA 5ESWA 5EYPB 2GK6A 3KUXA 4GDMA 4R1TA 1GTZA 1UPTA 4Y67A 3S3TA 1V11B 2B61A 4ZIRA 5J47A 4OIMA 1TJPB 3AH8A 4R7ZA 2VQSA 2IHUA 3CGWA 3B6ZA 4PXYA 2A1UA 2QTVB 4IO1A 3TJRA 3W8FA 3HGTA 3KQSA 5JAOA 3OIDA 1F51E 2W43A 4ZXPA 2FW9A 2Q9UA 1ZNZA 1QAMA 4TX1A 5GGYA 2HIAA 3PRHA 1JIKA 2W6MA 3QEOA 4Z51A 3SLKA 1R0KA 1TQ8A 1LU9A 4KNVA 2HJGA 2ZE8A 4I1IA 1F8YA 1ATIA 2H4YA 2C2YA 5AVZA 5KMGB 1PS9A 1TZCA 2JFFA 3A70A 3VR6D 1RABA 2OC9A 5JDIA 3T1OA 4YGYA 1P5JA 4JGIA 4OP1A 1GGNA 1J33A 1XMXA 2C42A 1GCIA 1RXSA 3WMRA 1JG4A 3HG7A 3LWBA 4LF6B 4CTMA 1QKIA 1QGUB 2P77A 3VR5D 1LDBA 3R6WA 2FSVA 1T34A 5E1BA 3ZJ5A 1RRMA 2TMDA 3B7WA 1E6MA 5BQ3A 1BVYF 7MHTA 2K7FA 1GRVA 4IMIB 1F8FA 1WMAA 2G5GX 2NXEA 3GXBA 2FW7A 2C5AA 2Q7XA 2XQJA 2GYUA 3DYBA 2GZMA 3HCBA 3KYIB 4N9WA 1WUJS 4REQA 1DRKA 1ZJJA 1VKNA 4J7UA 2OXEA 4I2VA 4N6GA 1CX9B 1HTTA 2KQUA 4BQOA 4F91B 5I9NA 1QIIA 4MR8B 3SPXA 3ZZUA 3RVMA 1XC7A 3W7BA 3DZCA 5DSZA 4RKFA 1R6BX 2B78A 2P41A 5AW4A 1WA5A 4G25A 3MTIA 4OPMA 2VDNB 4ZOLF 4UZEA 2HPZA 3OFKA 1KORA 3K70D 3TMKA 2CVHA 4MP8A 3T3EA 3A1CA 3VZPA 4TYNA 3D1LA 3PUIA 3VKGA 1XXHB 3BK2A 4M9RA 2VNSA 1CY2A 1GKUB 4PPNA 1LW7A 3VO1A 1WW3A 3JWHA 3T1TA 3FMFA 2Y1KA 1K7CA 4O08A 5LA6F 3WNVA 1AF4A 5CD1A 2G04A 2WPDD 3T9EA 1CW2B 2ZT7A 4D4KA 1T2DA 2ZJAA 1I32A 4YAEA 3VPGA 3WL6A 4CMBA 1Z4IA 3QELA 1XZCA 2SNIE 4H6XA 1TYCA 1KRHA 1Z83A 1V8PA 4KXUA 3BH7A 3G5TA 3ND5A 2VQEB 3CUYA 4YROA 5AKKA 3UK6A 1QYDA 3KSBC 2ODBA 5BMVA 2R4TA 1V5WA 2LKCA 3TMYA 3OFSA 3HUDA 1NG9A 3E81A 3BEDA 2IIVA 2D5CA 4NESA 4INPA 5C81A 4TTRA 5MGBA 3ZLTA 1WKBA 2C4MA 2EL9A 4F4DA 1E0KA 2OORA 2YZ2A 3Q9LA 2CXSA 4W1SA 3REOA 4BNHA 1UANA 4KQMA 5JOQA 4WXRA 1VBMA 3CEMA 4O5OA 1K3UB 3HWRA 4O4HA 4EYGA 1YS9A 2ZIFA 5HZGA 4AJJA 3OWOA 4PIVA 1Y33E 4EFLA 3KZOA 3GG9A 2H1OA 2EATA 5FBKA 3EVTA 4D82A 2W6IA 2ZITA 3H1TA 3R3ZA 1YAJA 4QU5A 4JT4A 4AVYA 1WOMA 4YT4A 4GGOA 4WL0A 3SX2A 1EVJA 4UM5A 2UYYA 5FNVB 1B0UA 5EIXA 3A3OA 3OLVA 5EJMA 4OB7A 5DVZA 4WKGA 2GDJA 2JA1A 1P9OA 3NQ41 1EB8A 2PTGA 3HI4A 4MW1A 3LMKA 4TS9A 3AJRA 3CE9A 4LJYA 5ELLA 4OK6A 1LXCA 5BRAA 4LYGA 1CNFA 4UHKA 3AV0B 2B4AA 5TEVA 5IM5A 2Z83A 3GRCA 4E09A 1IRXA 3VDQA 4EJFA 1H9CA 3ASVA 4AUMA 2VDOB 3EIFA 3RUAA 4FCCA 3RAGA 4LHEA 3LFTA 2WVGA 4Y6LA 5FPSA 2IYFA 3R9KA 3VDRA 2V58A 1IAVA 2DH5A 3QYJA 3B9RA 2OLJA 4D4MA 2WWFA 3BXOA 1XQWA 2J7KA 3RS9A 1I6MA 1QR6A 4RY8A 4WKNA 2WIBA 1RHUA 1N6LA 4Y18A 3RC1A 4ENVA 4LBVA 1YUMA 2ZRLA 2VT2A 5F1YA 1NT2A 3WQBA 1MG0A 1A9OA 4DLZA 4OGGA 4B3IA 3DDWA 4JLPA 4FGSA 1GA1A 1R50A 3HBLA 1JHVA 4L1KA 4B6JA 2XT6A 4YDRA 1GKLA 1JHYA 4QQ8A 1KI7A 3HVHA 4Z9FA 1QGOA 1ZI9A 4NYMQ 4YFYA 3R8XA 1JB9A 1Y48E 3OWXA 1Y1QA 2J3EA 5IJ9A 1VGVA 1MX3A 2HCRA 3KXLA 1OH6A 2JKZA 2D3WA 2J4CA 4NYJQ 1B6SA 4YJGA 4CEHB 3MTAA 3RBAA 1CY4A 1O5IA 2YMLA 3L77A 4A92A 4MQBA 1BDJA 1U5AA 1A9RA 2Q2WA 5LZ4A 1BROA 1M75A 4BE4A 2GCOB 4YUYA 4D9IA 2VPIA 1HLGA 1XZHA 3EG5A 3V4OA 1TF5A 3AT1A 2NSDA 3PJDA 1RQLA 2D3TA 1F5NA 2GJ8A 1QGAA 2BJWA 2SBTA 4MO9A 3OQJA 3W4KA 1G17A 3H84A 4BB5A 1U2TA 2Q1WA 3AR8A 3DV2A 4R0VA 4LYDA 2COEA 2QPTA 3CSDA 3WGLA 3N0RA 3I9LA 4XVHA 2VNAA 4AJEA 5EUCA 1Y7LA 4G3XA 4HOYA 3GDGA 1G55A 1X2BA 3P9QA 3WRVA 1RXIA 2QNRA 1UPCA 4RACA 5ADHA 2I65A 3AB8A 4J49A 1SC9A 3C3WA 1K5HA 2JI8A 4YECA 5E3JA 4RTRA 2VAWA 3DPIA 3GIWA 3PEUA 4MKFA 3FNHA 5K3DA 1YZFA 2HLPA 4GX5A 4J2OA 4UJ5A 2ZWMA 2ZYGA 3UA3A 1JKIA 5D3KA 4JVNA 3CA8A 2B83A 2GD0A 2PJDA 3FUWA 3PZRA 5FWXB 5HQTA 3ZKWA 1EUCA 1Q95A 5DSTA 2FP4B 3UCXA 2ONCA 3WLKX 4PS1A 3LPCA 1L5OA 4E22A 2QTLA 3K94A 1P5RA 4ZZ3A 1X1SA 1JJVA 2DLDA 1P18A 2GBIA 1XZAA 2QJOA 3K0CA 3VO9A 2PGJA 1K08A 1IUPA 2N9UA 3ADDA 4D4HA 2Y6UA 3D8SA 1SVIA 2V65A 2MWMA 3ETJA 4XEUA 3OPYB 3OT5A 3BB3A 4Z0PA 5LZ2A 4TM7A 3THWA 1HT1E 1YB7A 4M0UA 1JTEA 3QPDA 2CNLA 1THGA 2ZUDA 4MVJE 1LH0A 1JQ3A 1P44A 2GHQA 2WUGA 2XDQA 2YRWA 1NMYA 3DF9A 2D13A 3FYDA 1GO2A 3ELWA 4G56A 4GXRA 5I9BA 3T7EA 3IP7A 3BXGA 1RHRA 3H11B 1J2JA 2FHSA 4GP9A 1Y63A 2AOUA 2JCVA 3GT0A 4H3SA 2AHOA 5B7GA 3PQ7A 1EJ2A 4OXRA 1M5UA 3RREA 3RRXA 3T1VA 2XYRA 2OSVA 4TMVA 4EG7A 4W8HA 1E7MA 3WYGA 5CUQA 4QXAA 3ZNOA 4IHJB 4K46A 1GFWA 3W2GA 5CW2A 5EUQB 1GAEO 3JALA 4M89A 3DDOA 2W6QA 4PGMA 4RHXA 2AZXA 2DBZA 1WBBA 1HBJA 2JGRA 2VQ6A 4V0KA 5TS3A 3LTEA 4YIKA 2ZCJA 1ZW6A 2FN7A 4FFMA 4P86A 1YS7A 4I5EA 5EYPA 2YV4A 1ZOIA 1LJ8A 2ZT5A 3PFCA 5JCZA 3IKTA 3JQ9A 4ZRMA 2PSHA 4NJMA 4NJMB 1Z5ZA 2ZS9A 3P9PA 3BUSA 5KNDH 1LBHA 2R96A 3KJQA 1PD0A 3REFA 5I7UA 3C5CA 4M9SA 3TLCA 3I3OA 1E5TA 2AK3A 4QU8A 1I6KA 3QWHA 5DK6A 2G4CA 3W5BA 4CNBA 3K20A 3UVEA 3W0LB 3QA3E 1RZVA 1L7XA 4Y2HA 1BJKA 1KMHA 4B9EA 4OXKA 3ZD8A 1XU4A 5E4TA 3U6BA 2B20A 4WNYA 1KY2A 3DNMA 4MJ3A 3UEOA 4ER7A 4QULA 5BPHA 2HHCA 1Y4DE 1ORTA 3ZXYA 4XDYA 1W34A 4ENPA 2V1UA 3WADA 1P2FA 1VCOA 1U8FO 4R71A 1QIJA 1W59A 2ZJOA 1PTKA 1KRXA 4JYZA 3GDOA 4AKTA 2ATCA 2G3YA 1V5IA 4B75A 2IW1A 2HU5A 3ZNNA 1BOFA 2W6PA 2AVDA 3GJSA 4U7DA 1IAQA 4O59O 5EZSA 3TOXA 2FEKA 1B6GA 5AHRA 3KUUA 3K0FB 2WTXA 1K5PA 4GOKA 5ITSA 3UMSA 3SKYA 4G1EB 3IP6A 5TRTA 1PR3A 2WU1A 4JVMA 5TE9A 3OLXA 3UJCA 2Z3ZA 4RF3A 2BHRA 1YZGA 2GESA 4LDNA 5FP0A 5K0LA 1GT91 4DSAA 2RAFA 2HIMA 3UFXA 2C2HA 2DTXA 1A4XA 3WK4A 1Q50A 1XAHA 4EUEA 4X44A 2ODQA 4G01B 5G3YA 4CGZA 5AHKA 5FWXA 3L8CA 1KFKB 4X8HA 4YB8A 3RIGA 2O8BB 1RI2A 4WA7A 1I80A 4EP1A 3RD5A 1WXWA 3NH9A 7ABPA 4FZVA 1YZQA 2ZRDA 1KXJA 5TEWA 1CEYA 1H9AA 3CVJA 3LQ1A 3PTLA 3E1KA 3QNWA 2KPOA 2WU0A 4AAYA 1W5AA 2BHLA 2P4EA 1MKYA 1O4VA 5SY4A 2FLKA 3ANLA 1U7TA 2NV6A 1U0HC 3QV1A 1FP2A 3CVOA 3JZMA 3MBOA 5J2UF 2H4JA 4WSOA 2W6ID 3RIEA 5BN4B 1Z6GA 3D4IA 3OA2A 4YREA 4G9BA 4A73A 1ND5A 1DKLA 1E3DA 3A6DA 1R4ZA 1B8UA 1KO8A 3WP1B 1PQWA 2WNSA 4LWZA 1N6PA 4C0LA 1KR5A 5IJWA 3U5ZB 2ZTMA 4NEHB 3SF8B 1TJ3A 1M1ZA 2XUZA 1MQAA 1TM2A 2GCOA 1P4JA 4DEVA 5IM4F 5KKAA 2BR3A 1HE2A 1YVDA 2GF0A 5KX5A 2JS7A 2NP7A 1R5BA 4E5NA 2X5OA 5A62A 2ZKIA 3NVDA 2ZJFA 1OF1A 4OJYA 1JDVA 1RM0A 3HYSA 5JSQA 1YS2X 4K3UA 2ATIA 3H19A 3ZU6A 1GV1A 3MCVA 3O38A 3BXEA 4ES6A 3ZDDA 3DKPA 2I7TA 3ESXA 3I6QA 3MS7A 3ZBPA 1EHCA 3U4IA 1IWPB 1W5EA 2V5VA 3WDKA 2PYZA 5LQUA 1I7LA 3U3ZA 3G6KA 3H4TA 4L78A 3ZCRA 4WZAA 4QTXA 1HURA 3BZBA 4MIOA 4US1R 4ASUA 3ORRA 1EU1A 1SCDA 3RJ9A 5KWVA 3BD8A 3B2QA 2VHUA 4Y0NA 2PWBA 3WK5A 2ZRBA 3O73A 2RHHA 3WLIA 2RGRA 1HOTA 1OFHA 1E5QA 2HD4A 4GP6A 4MV3A 3LRXA 3SM3A 3N28A 4M7WA 1SKYE 2BEJA 3KJIA 4D8TA 1TDJA 2JFGA 1SELA 2DHDA 3IELA 3K71B 4K87A 4ZREA 3WK8A 4C4YA 4DBLE 1M34B 2OK7A 3P2KA 3LKVA 3OU2A 4PWZA 5CEEA 3WLHA 1C3OB 4MITA 4RVUA 1J09A 1ISMA 1ZGBA 2OT3B 3UJHA 3UKJA 1L7NA 4LOKA 4ARUA 5IAOA 1DEHA 3CRRA 5A3VA 2CLDX 2H51A 2ZDHA 2VOJA 3BHMA 3RSZA 1R5NA 3GJ8A 5LNK6 3C74A 2C2KA 2P35A 3Q9SA 3H17A 2R8OA 3GJ3A 2XBLA 1Z6TA 3P0FA 1BMQA 4LRTB 5E2IA 2ZU0C 4HLDA 2O1XA 2WINI 1XZJA 1Z47A 3MT9A 2E6KA 3UH0A 3MERA 1JFLA 4HB0A 2QIPA 3DKKA 1LZKA 1Z13A 3AJ9A 1S2MA 1WV1A 3EY9A 4QDUA 3T4UA 1JWBB 1NURA 2PKQP 2Z8YA 5IFKA 2VDJA 4QTYA 4DJ5X 5JNWA 1CQIA 3VJRA 4BKOA 1XOIA 3VXKA 5JAHA 4WZAB 4ZVLA 1P80A 1YGPA 3Q85A 3DD1A 1H5QA 3JZDA 3R0IA 4PEVA 1AN0A 1C7RA 1LVUA 2BEVB 5CAEA 3DV0A 6REQA 5F98A 5KYYA 2FFJA 2WA1A 1V2GA 4A36A 4AJPA 5JZ9A 3RTCA 1FJHA 1ESMA 3IUYA 1CUWA 1M8JA 3OX1A 4UNRA 3ZWAA 1MT3A 4LWQA 3TRHA 2Z9CA 4RH3A 3QF7A 1OBOA 3ELUA 1R4AA 4C5AA 5BYAA 2HZBA 4KOEC 5JBIA 3MJ4A 2E49A 3HN7A 4E2XA 4IHJF 3L7JA 3NT5A 2M9MA 3CCFA 4FGJA 2WU3A 3I72A 3SJCA 2YXEA 4A82A 1TIKA 3SS9X 2CD7A 4LRWA 4YJKA 7YASA 2C03A 3IUEA 2PKCA 5LYJF 2FY8A 2JF0A 5BV0A 1B0AA 3JRNA 3BWEA 1BFUA 1KAMA 2OV1A 1CIPA 2XCLA 4DWOA 2HJRA 4HPJB 2ZEJA 4HWPA 3E9CA 4KQCA 4CN8A 5ITZA 1NW8A 4M0DA 4ZAYA 2XA9A 4KO8A 4ND5A 4IP0A 3T3PB 1WCV1 2XNCA 2WM8A 2AC2A 3GT4A 2H5EA 1BKDR 1OU4A 1CG6A 2A5GA 2ON6A 1ZUWA 3CM0A 3GP5A 3LBAA 4HADA 5HVNA 2C97A 1KEWA 1IOVA 1LUAA 3H16A 1ZH4A 2YINC 3LS2A 4O4LF 4DIMA 2E0IA 2XWJI 5YASA 3AF4A 1DJLA 4Y2XA 2PZMA 3ILVA 2HQ1A 4CQMB 1KFEB 1QO7A 2G7MC 3K92A 4ND7A 3RWMB 1T5LA 3TKYA 1MH1A 2I7DA 4Q7EA 4QVGA 4AB1A 2F8TA 3A2KA 4KX5A 3UJAA 3DAOA 5ECGC 4EDHA 2Q6IA 3CSSA 1XNHA 1VL6A 2NU6B 2PGOA 3LA8A 5BYBA 2QRZA 3EJ6A 3FI9A 4L9AA 4DG5A 2FPUA 1GUBA 2YBEA 5CVVA 4MPRA 4OUDB 2G8NA 3EMBA 1JEJA 2YN4A 3GI1A 4PGGA 1H2YA 3ZGLA 4DLWA 2B8WA 2AG5A 4RORA 1I30A 1KJWA 2BZGA 4WXYB 1GV0A 2H2FA 2JJ2D 4OU4A 3ZBUA 5H7XA 4B7ZA 3KL4A 5AW1A 1QE3A 2ABWA 3U7QA 1AGNA 1IM8A 2F90A 3RVSA 2F6RA 1IZ7A 4K9DA 4BXOA 1UDXA 5D3MB 2VAXA 4A27A 1BJRE 1UDWA 1NJ2A 3E0XA 1DJMA 2CUZA 5CIYA 3O90A 3M1IA 1QHXA 4PNZA 4LTNA 1YE3A 3BQMB 2GGSA 1P17A 1GQRA 1T24A 3E9YA 1K3TA 3KHTA 4O2AA 3LXMA 3HGMA 4QKQA 4OATA 2YW2A 4AKHA 4E4TA 5HW0A 4Q12A 3O82A 4G65A 1SOVA 2IS4A 1UIRA 1E58A 2AG8A 1ZU4A 3HVUA 4Y9TA 1ZNWA 1V3UA 3IVCA 4LV6A 5EJ8A 1AURA 3BX1A 1QRRA 5EP1A 2XB2A 1JNXX 3HN6A 3O74A 1KEKA 1P5HA 2CB0A 2XZPA 4P83A 3ZQUA 1FU8A 3HSYA 5IK2A 2AC4A 3A7EA 1KJNA 5MFZA 1HFKA 2BFMA 1FFGA 1KI2A 4ZP1A 4AN0A 2EX1A 1Q3TA 2H4XA 1W2WB 3H5LA 3IA7A 4UAVA 1PUIA 4TYPA 1O97D 3BCHA 3RH0A 5FYDA 1QLJA 3E8XA 1FNMA 3A26A 3DONA 3CNEA 1L5NA 2YWFA 4I4LA 5J58A 1FYDA 1SFRA 2LCQA 4IHJA 4QL3A 4LXIA 3WZMA 2HJ9A 4NVRA 4ZEOA 3D6FA 4E51A 2C82A 2IQIA 4UOQA 4MI6A 2WF7A 2XNDA 4LGVA 3QNMA 3KQUA 5ICCA 4JI6B 1JDUA 1F9AA 3BT7A 4UUPA 4L6AA 1NXOA 3QUQA 3QU4A 3H9UA 3NC0C 2I71A 4RMNA 2QV0A 1SVUA 1VYTA 2JLCA 4G4SO 1DQPA 2Z2XA 3G2MA 3KOZA 4MWZA 2P75A 3WQSB 1RWWA 1NN1A 1N5KA 3T5TA 4HYQA 4P22A 2KE5A 4TN1A 3HDJA 2UYOA 3K0AA 1KEZA 1MFPA 4JWKA 4KDRA 4NU0A 4A0HA 4BWFB 3MRVA 1Q14A 2EQ5A 3OLWA 1HTBA 5LMCA 5A5VA 1RRCA 1FFXA 2UXCB 3D8HA 5ECYA 1R0BA 3GFBA 3P52A 2IIPA 2JJ1D 1A8HA 3EZLA 3FLEA 4JT8A 1YASA 4Q02A 4RWZA 2A94A 3F6CA 1TVKA 2IP1A 1TKAA 4EFMA 5JPDA 1YAHA 3OO0A 3NALA 4M0EA 3WDLA 1NOIA 3HVKA 5AQ1A 3EFHA 4Q4AB 3VJMA 5BWOA 2XDQB 1LTKA 4GX0A 2QX6A 4IKOA 5BSWA 1NNUA 1U7DA 2HXYA 1MTOA 2XQKA 1POWA 4FDMA 4EJSC 4INZA 4CLOA 1OOEA 1ETHA 1QLWA 4FS3A 1JFFB 5HOQA 3KB6A 4MV4A 3JQAA 1K92A 1CEEA 4DXDA 1IBCA 2FN3A 2A9PA 2ZXEA 3X1XA 1O9BA 1UBJS 2X2OA 3MJCA 3N2EA 3HO6A 1LBTA 4HLUC 2C98A 2XH8A 2JI7A 1Z16A 4DDUA 1LJUA 4GMFA 4L27A 5AJTA 1TTQB 2JZOA 2OHJA 1Y3DE 2CHQA 2F48A 3EDCA 2BBOA 3ET5A 2F3UA 3GCZA 1UM8A 3JYQA 1QR2A 3AEXA 3QF4B 4M0KA 4BFXA 5LU8A 4URHA 3SNHA 1NUQA 1WSWA 4MEJA 3CLSD 3F6YA 3GGJA 2OFFA 3ZKWB 2UUOA 3PQDA 3F0TA 1DAMA 2AYXA 3PLNA 2IEDA 5KHAA 1U3WA 2GAFA 2FEWB 2RK4A 1PR6A 1BEZA 1RE1A 1S7CA 2HLDD 3W6OA 2Q2NA 2HO4A 1OWOA 4JJ8A 1DO8A 1SUPA 1IG0A 2ZTSA 4LVUA 3BWXA 4JBHA 1P9WA 2BFDA 2PJUA 1CK4A 2PCLA 4U7PB 1DPFA 4WHMA 2JFQA 1JDBC 1FMTA 2AEEA 3PXUA 3QLUA 1M7HA 4L8FA 2XADA 5EP2A 4DMKA 4C0SA 1RYZA 1EFAA 4W82A 2ODWA 3H1GA 2QTAA 3L40A 5ALXA 3RVBA 4RO0A 4YQFA 2ZRKA 3GRZA 3HDVA 1C5KA 1IEXA 1Z0SA 2IYNA 2Z08A 2WD7B 3L6UA 5FULA 3GMIA 5T41A 5JWHA 3VZQA 1Q22A 4JMPA 2QG4A 1XALA 4LECA 1E2BA 4EKNB 5FUQA 1YXMA 4Y2GA 3HCOA 1Y6ZA 2ZJ1A 1L4GA 3FVTA 1FF9A 2N1MA 4N82A 2JKVA 1MIOA 1JFVA 4D98A 3J81k 2FK8A 1W87A 3GJYA 2IP2A 3KQMA 4LHZA 2R7AA 1P1BA 1Z06A 2EJBA 4BBAA 1G8MA 4HGPA 4YJGB 1JAZA 1V3QE 2PD6A 2Z58A 1BDHA 1YBHA 1T36B 3ZZ1A 4EO7A 1UP4A 2W8ZA 2G1UA 3L3BA 4PM4A 3EQ9A 3E2MA 2YUTA 4MLZA 5KS2A 4PLGA 3H4MA 2CFSA 5AQEA 3ROPA 4OP2A 1X8JA 3PUJA 1EE2A 4BMXA 2D1FA 1U2ZA 3I5AA 4P4SA 4IXTA 1LW6E 4EYKA 4PANA 4C87A 1QH8A 3TGLA 1QH8B 4OHZA 1K3FA 1KBQA 4F8JA 2B25A 2V9CA 5IEJA 1H4QA 4ARIA 4DTCA 1F2VA 3NHRA 4F96A 3R0XA 1E2UA 1K2WA 1OIVA 3PHBE 5DNVA 1EFCA 4KLCA 5C53B 3WGQA 4YV0A 1CUDA 1P7CA 3LK7A 4OQ4A 1T4CB 3L46A 4N4AA 3OY7A 4NRDA 4RJ2A 1FSPA 2OWDA 2H1CA 2NQ8A 3I4FA 4R05A 4A16A 1JDBB 1YU6A 2AMJA 2O6LA 2FZGA 4FHFA 3FYCA 1VPEA 3F6PA 3L4EA 3N2GA 4ZAXA 4MDFA 4PTZA 1N75A 1NKSA 2VC2B 5E3IA 5B1DA 2GM4A 4HTAA 3FWKA 3AL3A 2XTJA 4MP6A 3W8NA 2FZ4A 1JIUA 2I4TA 1V9CA 3ZTTA 2H31A 4BQFA 4G81A 5CCEA 4KH1A 3FIJA 1R6XA 1I4TD 3ED1A 3LCVB 2ETXA 2GA9A 3SQMA 1LVGA 2ZZNA 1QPGA 1FCJA 5J4LA 4N40A 4FMPA 2YHAA 3UFBA 5ITVA 2YWEA 5C4IA 5JJCA 1GCUA 1FVOA 2PUVA 3C3XA 3OF2A 2PYDA 5JTTA 1C3JA 1H3FA 5E9QA 1Z88A 4JS0A 2HYIC 3IEXA 3DL7A 4N8SA 4FR2A 1W6RA 3GRKA 5EP3A 1DBRA 1H05A 1QG6A 3T6KA 5AVQA 4LQCA 3ML1A 3UH1A 4ENSA 4TT8A 4ARSA 2RC6A 4UXIA 4PNEA 1V95A 4WGFA 3LA6A 3O94A 5TPWB 4NK5A 1RYNA 2WOOA 3BIJA 1T8TA 2H5LA 3GFOA 2PZBA 5EE3A 4D8WA 2BCGY 3DMFA 1N5JA 3ZDXB 2ORYA 2BI7A 3L8HA 1G3QA 1UMBB 3PG5A 5AKXA 1XR3A 2R48A 1N5RA 4YLYA 1RBZA 3EXFB 3OUTA 2WIJA 3I76A 2FLWA 1N5MA 2VDWA 1VPLA 4AZ0A 3ZD6A 3CVUA 4RMGA 4FMCB 2ETVA 4NZYA 1XTSA 1E3JA 1EXWA 1Y8RA 2CB9A 2DG2A 2QORA 3B1ZA 3EN0A 5HFAA 3V33A 1M72A 2EW8A 4B3MB 1CVIA 1Y89A 5H80A 3UK7A