3JQMA

Binding of 5'-gtp to molybdenum cofactor biosynthesis protein moac from thermus theromophilus hb8
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
147
structure length
147
Chain Sequence
GRPRMVDVTEKPETFRTATAEAFVELTEEALSALEKGGVGKGDPLVVAQLAGILAAKKTADLIPLCHPLPLTGVEVRVELLKAEKRVRIEATVKTKAETGVEMEAMTACAVAALTVYDMLKAASKGLVISQVRLLHKAGGKSGEWRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of apo and GTP-bound molybdenum cofactor biosynthesis protein MoaC from Thermus thermophilus HB8
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Biosynthetic protein
molecule keywords Molybdenum cofactor biosynthesis protein C
total genus 36
structure length 147
sequence length 147
chains with identical sequence B, C, D, E, F, G, H, I
ec nomenclature
pdb deposition date 2009-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01967 MoaC MoaC family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.640 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Molybdopterin cofactor biosynthesis C (MoaC) domain 3jqmA00
1EKSA 4PYAA 4FDFA 2IIHA 3JQMA 2EKNA 3JQJA 4PYDA 1EKRA 2IDEA 2OHDA 3JQKA 2EEYA
chains in the Genus database with same CATH superfamily
3LOUA 1F0XA 3KOAA 2I5JB 2OEMA 3KLHA 5HO4A 2CJBA 3J7YU 5LMNF 3HHLD 1E6VA 1WC0A 1SJQA 3Q86A 2GCFA 3QGGA 1RE1B 1E6YA 3HD2A 1LWCB 4QIVA 2AKWB 2DNZA 1UFLA 4NLXA 3FC9A 4DOZA 1FKAF 3CULA 1W26A 4DXLA 3NL0A 2B7CB 1Q86T 1KP6A 4X2BA 3CW2C 4USKA 2RHSB 1U1KA 2IMOA 3HHEA 2ZD1B 4OYOA 1DRZA 3RRGA 3NNHA 3QT7A 4DV4J 1HD1A 4KC5A 4C8MA 3M8QB 2NPFA 4C8ZA 4KJIA 5JVGQ 4ECZA 4URQU 2K7KA 3GSIA 4B3TF 1T9UA 5JJBA 4OLPA 1F5AA 2CNLB 3ISND 2FGOA 1VBYA 3EVMA 5I3UB 3MECB 4JI1F 3DLEA 4FF4A 2AEFA 1JK9B 2A6OA 2HHTA 3PFEA 3AQPA 2DGUA 1QTMA 2OSQA 5GMDA 5EN1A 4Y0FA 4MAKA 2QL9B 2XHWA 2XYHB 2MQNA 4KGKA 3MM8A 3VZHA 2MQ8A 4AL6A 4EBEA 2MQQA 5CD4H 3LP0A 1NK0A 3GIJA 2CIMA 2DGXA 5DO2A 1JXVA 5J2MB 2GFFA 2MKKA 2RUGA 1RBOB 2B7BB 2EFQA 4Y2AA 3GV7B 4JYAF 4KKOB 4FYWB 5DLGA 2EPIA 3H5XA 2G0CA 2WW4A 3OVSA 1IR0A 3KKFA 4OYBA 4QIGA 1AUSL 1S1UA 5K8OA 4ELUA 1UL3A 1K0VA 4M5IA 2L9WA 4FKYA 2WVBA 1GFWB 4L75A 1JNZB 5G0RB 2ZM6F 1KBRA 1R89A 1RTZA 1RWXB 1RGVA 4FXWA 4MKBA 4OI2A 3KLEB 2ABYA 1P6TA 2XZDB 3VGSA 1HNIB 1L3KA 2A18A 1O51A 3DMJA 4BBYA 5JMNA 3KJVB 3Q24A 3PV8A 4BWJA 4OYPA 3ZFVA 4J9MA 3GJSB 2J0WA 3LWMA 1XK8A 3J80Y 1JJHA 3HSGA 2WONB 1BQMB 2OKQA 4IKAA 3PO5A 1DQAA 4MMOA 4JI2J 3OR2B 1BY9A 4IFVB 4EYHB 3JTPA 3KHGA 4NCGB 5IV3A 1U4BA 1TFYA 1PJ5A 2C2ZB 4ZLPA 4IO1A 2ZOMA 3W2WA 2VHGA 3ILLA 3T6BA 3ZZZA 5KG2A 3MAQA 1V3ZA 5HLFA 3C14B 4CYUA 3PX4A 1TL1A 2HZAA 2HGNA 2V4JA 3AODA 1U6FA 2VV5A 4DV3J 4DSLA 4K2JA 4DR6J 1FKOB 4G1QA 4O3SA 3CJ3A 5JVHQ 4OHXA 1UJ4A 5DZ6A 4ID5A 2LLZA 3NS6A 1RTHB 2YX4A 3UN5A 4M5LA 1FRIA 1J2VA 4LRCA 5EX3A 2QLXA 5F3TA 5IS2A 4GKKJ 1CVJA 5F3ZA 1U1LA 1VBXA 2NZCA 1FX4A 4HACB 2Q6BA 4HI1A 2XYGB 1UFWA 1NZAA 4O3RA 1QD1A 2C3PA 2E1PA 3R5BA 4X62F 3QJLA 2R7VA 4HVZA 3T19A 3BH6B 1UZDA 2CQHA 2LEBA 2D3OR 1JJ2R 4F2SA 4X4PA 3PKYA 2XY6A 4GKJF 1WC6A 3M05A 5CYMA 1S59A 3B6BA 4PG7A 4WXWA 1YJNS 1FRMA 1S1VB 2MLXA 3FQLA 7FD1A 1XR7A 4IG0A 4F50A 1P1TA 3G86A 1WACA 4C8YA 1IM4A 4DR7J 2CG4A 3LQVA 3ADAC 3BN7A 3CCTA 3DKDA 2KDOA 3GJTB 3HSDA 4PEOA 4PWWA 5ADZA 4CIOA 3GILA 3VR1A 2WBRA 3QT6A 3TX8A 2KU7A 3VGTA 2ATCB 1I5OB 1Q53A 4DUYF 3UNGC 3H2VE 1HFEL 2HWIA 2DHAA 3K5PA 2DXEA 3PDNA 4J5OA 3Q8RB 3HJVA 1RT2B 4XPEA 2QA4S 2GJ2A 4USTA 1R8PA 3MMBB 3V4IA 1M5VC 4H54A 3C15B 1SC4B 5A2QY 2V2VA 3AT1B 4DQIA 2CWKA 3H2UB 2LDIA 2IDLA 3SSQA 5AJ3J 3IG1A 2H5IB 2ZH8A 2JDJA 1XMQJ 4ILMA 5A8RB 3N28A 2XZTB 1IR2A 2VDHA 1FWKA 2UZAA 1C0TA 4WP8A 2B9XA 2HURA 2RQMA 5KFLA 4X4TA 4JV1A 3ISNC 4ZIWA 4C8KA 3V81A 3G8QA 1YHQS 1IKWB 2QGFB 3EXYA 4AXIA 2FHJA 1RHUB 2XGQA 5GADI 3D2WA 3GU0A 4WBFA 3RZAA 2R8IA 1FRLA 3M8WA 3GFYA 2CAJA 3QO9A 2XMAA 4OZLA 5KT4A 2ZHAA 2KZZA 4EYIB 1VK3A 4CM0A 4MTPA 2J8AA 8RUCA 2UUBJ 1U6ZA 2RE1A 1DLOA 1HLWA 1S9EB 2P6SA 3R27A 2PSZA 1H2TZ 3HVAA 3QQCD 4DUYJ 4JI4F 1UWBA 2DNRA 1UW4A 3G82B 3M32A 4UUXA 5AE2A 1JLEA 1LFPA 1RK8A 3K5NA 1Y3JA 2OIHA 1CJTA 4UQTA 4BLGA 1TP7A 4EO6A 1DZ5A 1R0AB 2NZ4A 1AB8A 4RW9A 1C1BB 1RACB 2YX7A 3QGHA 2ZUGA 4KH0B 4NMLA 3QZ7A 3D1QA 2YWKA 2B6AA 5HJXA 3LWLA 5AT1B 2MKYA 2MHNA 3BO4A 3PW4A 3TAQA 2W2MP 3JQKA 2FJVA 2YPYA 4P7TA 3GE9A 4TY8B 2DPJA 4PXEA 1HA1A 4YB5A 1I94J 3O8WA 1R8AA 3QRRA 1Q7YT 1N5TA 1JKHA 2ZZTA 3POTB 2DKOB 3RRKA 1AROP 3PW7A 4O44A 1Y11A 2GHWA 4NXNF 4OZ3A 1OY9A 3R7NB 1JNRB 4DL0C 3TX0A 3KNGA 3M8YA 5IV4A 4FP9A 5CHCB 1SH2A 4RW8A 2A10A 4LFAJ 1JLQB 1TVRB 5IQ6A 1UA0A 3NS5A 2R3VA 4RUBA 4TYBA 2IBKA 2ZE2B 2F5GA 5ETQA 3OVAA 2OPRB 1TU0B 4E2FB 2G9OA 2ACYA 2E5IA 3I82A 5B09A 1SKRA 2B4VA 1NB2A 3H20A 1WOOA 5ETSA 3M4XA 1XNRJ 3IC1A 2V9WA 5L39A 5LXYA 3OLBA 1I3OB 2FIUA 2RSQA 4LF8J 2FLOA 1T9TA 4DR3J 4X4UA 2QYGA 1CJUB 1UPMB 4Z7YA 3TUPA 1LWXA 3D68A 3S1TA 5KG5A 1RADB 5KFRA 3ITHB 1YITS 1KWMA 2BM1A 3W65A 1NU4A 4N77A 2JC0A 3WIUA 4YQWA 3KLHB 3BGLA 1Q5VA 5THWA 3OFEA 2O5DA 1S9GB 2AEMA 1LWCA 1Y0HA 4RW7A 2EFGA 1XMOJ 3DLKB 2RH3A 2CQPA 3BQ0A 2R2RA 4NX9A 3W60A 3UW1A 3V4MA 5L1LA 1T95A 3RUBL 2QFJA 4FXDA 1VLOA 1XMBA 4G65A 3FEYB 1HQEB 2BUNA 1HNZF 4PZVA 2EXUA 2MJNA 3GCWP 4QR2A 2J6TA 2VJUA 3PG9A 1YX2A 2NSCA 2AMCB 2W4CA 2KFZA 3GIIA 3MCSA 2ZBPA 5ETPA 1PC4A 2LQBA 5C42B 4FS2A 4NRUA 4QPXA 1VQ9S 1RKIA 1S0VA 1S6PB 2CJYB 2Y1LB 2VH7A 3TWZA 4ZVUB 3PACA 2BQUA 2D69A 4IOCQ 2AV5A 3H5SA 2ILZA 3BR9A 3KWMA 5AXMA 1LQ9A 3P45B 2KB2A 2QG9B 4K7QA 4DR4J 3KK1B 1G1XA 1FEEA 5A8WB 5DDPC 4LSNA 4RZRA 4TU7A 1H74A 3BPDA 4WIQA 4WE1A 2AX0A 2O67A 4FNHA 2O1PA 1MROB 3RBEA 4P9SA 4LF7J 5KFZA 2W8LA 3RBZA 1UPPA 1JLGA 5GAHI 4ZCMA 2ZEJA 2AYEA 3WC2A 3OR1B 3I0RB 2FVSA 1X8DA 4CLWA 3HVTA 2C2OB 2DO4A 2QL7B 4CLSA 4RU2A 3TR5A 1HNZJ 3OTBA 4URSA 1VC6A 1VRTA 5KFQA 1RBLA 2B9YA 1WF2A 1Q81T 5D15A 1QSLA 4DX5A 2VZ9A 2BANB 4DF4A 3MPYA 1Q95G 4ZPWR 3K57A 5HK4A 5HP1B 1NJIT 1Z4UA 4U8VA 3OTOF 1IKXA 2MZSA 4CT8A 5HJYA 1NPPA 4PWDA 2RIJA 1HMVB 4CH0S 2J5AA 1PGZA 1W7WA 4K50A 1N8RT 2IBOA 4AL5A 1WI6A 4HDGA 2D41A 2ZH4A 2CPFA 5D3GB 2JEJA 1TL3A 2MLYA 5AJ3F 1R7IA 1X4HA 1HQ2A 2KRRA 2ASLA 2R7OA 3MAHA 1FKOA 4G1QB 2V2ZA 4W4MA 3F73A 1ZZFA 2GA7A 2WRMA 2Z2LA 1BGXT 4NZ6A 4OI4A 4BHQA 3IM9A 4F4XA 4AL7A 1R3NA 3FBBA 1NRKA 1MMLA 4CWBA 2YKAA 1I6JA 2G2YA 5J1EB 4JI8J 3MM5A 2JFKA 4PQUB 2IRUA 1KSPA 1JXLA 1PAEX 1VQMS 3PR4A 4HACA 3PKMA 4ATNA 1KFDA 2IPOB 2XM3A 1RB0A 4A48A 1HNWJ 2QV6A 1CQNA 3BKFA 1RCXB 1CS4B 1VRUB 3R7BB 4ZCKA 4WP3A 1RWPB 3HM9A 4N76A 3BSCA 1APSA 1VHIA 3TQ1A 3UCGA 3JQJA 4DL4A 3BSOA 5D0EA 3HHLB 1AXQA 5C7PA 4KGZB 1S1VA 4O0IA 2E5LF 1RT7A 3IBCB 1NJYA 3IGVA 3NP5A 4FXVA 1K8AT 1SV5B 2EG1A 3GV8B 1NK4A 2ZBIA 3CXCR 1IBKF 4N56A 3OXGA 4R5PA 4CLUA 3LAKA 4LBPA 5B0DA 1R0BG 1TKZB 1X31C 1J5OA 3L95X 3TA0A 1TELA 1IVZA 1QAXA 2PMHA 3QPIA 4UOGA 4HHJA 4KSEB 4M5DB 5IFMA 3VAHA 1N56A 2CWXA 5IWAF 4MKYA 1VJQA 1SIWB 3QIDA 4DPYA 5KFFA 3EVOA 1ZTTA 5DGBA 4ECWA 3MCNA 4JI5J 1UVMA 3F0NA 1HWIA 2B0GA 1Q79A 1RTJB 5I4MA 5EWEA 2WSCC 4EBDA 1IBKJ 3Q83A 2BRLA 2QTWA 1O5JA 5B0GA 2L41A 1NZ8A 2DIUA 1ELOA 4FNIA 1TL7B 2C2MB 2J6SA 1VHFA 2B4PA 3HHNB 1TK0A 1R43A 5DM7Q 1GK8A 2JLGA 2CJAA 4KHMA 2YKOA 3IS9A 3NRBA 2ZJRQ 3ETOA 3CCRS 3W5ZA 4B3SJ 1TKDA 1FFWB 2HYIB 1CJVA 1SXLA 5LJ3Y 3GFXA 2NUUG 1HR0F 4TQSA 2DNLA 2HAIA 4X4VA 3W2VB 1AZSA 1C4CA 1WC5A 4IR9A 2DR9A 3Q2SC 4CTAA 1LWEB 3V5RA 3EX7B 3PYDA 2Z58B 4Z7CA 5F8LA 2I1RA 1CC7A 4QYZJ 4K4ZA 2XO7A 3HHDA 1M0SA 5A76A 5FLXY 4R0EA 3D4JA 4I6YA 4Q43A 2RQ4A 3T9ZA 5A6PA 1RT5A 2ALZA 2OEKA 1VC5A 1PILA 2DGSA 2V63A 4LF4F 4LFBF 3J81j 1JJCB 4DBQA 3DDKA 3NGDA 2D3O1 1HQUA 2DITA 2V8GA 3UPFA 1M90T 1UWBB 1DAXA 1HBMA 2WHOA 4F25A 3VAMA 1JLEB 3V6KA 5HBMA 2DH7A 4J9SA 4DFKA 3PW0A 1T11A 3ZC4A 1VI7A 2QSFA 4D3GA 2V6AA 4NLOA 3KLGA 2PMWA 2E44A 2LYVA 3DLGB 3PRVA 4TVAB 3CC4S 1V3RA 2CZVC 2ZC4A 3EZOA 1X0PA 3GG1A 3P8BB 2VFSA 1EQMA 6AT1B 3SYZA 1B7YB 4DLEA 2YQ1A 1RYSA 2FY1A 3Q8PB 4HHHA 3PJXA 4KTQA 4GVBB 4ZVRB 1TKTA 4D3HA 3G6ES 5KFNA 1HNVB 3DOKB 4ZVGA 5CYJA 1N48A 1YBAA 1Q8IA 1HPZB 4F8RA 3J7A1 1RTDA 3BEGB 3M8PB 2GJFA 1EETB 4LJMA 1UEVA 4OYZA 1VQ5S 4M95A 1ACMB 1WHXA 4PABA 5DDQC 2F9JA 2E7XA 2KKHA 1U7LA 3LGNA 2VU5A 3CCWA 1NSAA 1D8ZA 2HBQB 4DV2J 4OX8A 1C4AA 2W8KA 1X5SA 3CO9A 3AFGA 2F9DA 3FJ2A 4EWTA 2GVDA 5LJ5Y 2OPPB 2PC6A 2POKA 3QNWB 4KAIA 5GAEI 4OHWA 4J37A 1JLAA 3OJUA 3RBDA 1IBMJ 3M2VA 4P7VA 1LKZA 1NJXA 2C2NA 1KOHA 2HEKA 2L9DA 1I1GA 2QX0A 3ET6A 3R5CA 4ZN3A 4DV1F 1P27B 3MFIA 1D0EA 2E9ZA 4FYDA 1Y5IB 2YKNB 1WHWA 3A3OB 1WI8A 3F44A 4N7TA 4DZ6A 2XZWA 2UXDJ 2R7UA 2V34A 1VBZA 4B3MF 2GW8A 3MM6B 4C4WA 1U1OA 3MAAB 4DLGA 2UVWA 3OSNA 4ECTA 4UY8T 4E0DA 2AGPA 3G6XA 1VFJA 2J7WA 1GXLA 2V68A 1RT1B 2GQ2A 2IAJA 3R5DA 1U1RA 3JSYA 4YFUA 1EP4A 4JI3F 2L3MA 3MEEA 3T5KA 3MMAA 3WC0A 3TUIC 3T6JA 5J2PA 2QLFB 2HNYB 1NDLA 3NGKA 4B02A 3U27A 1WD6A 1T05A 2IM0A 3R2DJ 2ZBCA 3CD0A 2GQQA 3L4BC 2MKHA 1N0UA 4RW6B 2QMXA 1RAHB 4OI3A 5F0UA 5C5JA 1S7HA 4RBVA 1T03A 2E9RX 5L1JA 1DY3A 2MQMA 4ECSA 1WEZA 3T5LA 1Y00A 1K44A 2OD6A 3FRZA 4AXJA 1VK8A 1CULB 2DD8S 4LF6J 5D8HB 2GZOA 2W4PA 1CJKA 4RX6A 4J9QA 3TZYA 2A2DA 5CH7B 1S49A 1IM6A 1WSRA 2FJBB 4RL1A 2NLWA 2BJ8A 2DR7A 4NASA 3PVXA 2E9TA 2RUSA 4WXOA 3OL6A 1HBNA 1ZS6A 1S6PA 1RDRA 2BJ9A 1D09B 3ISZA 2BV3A 4DV5F 3HHLC 5JXSA 1JLBA 3C6TB 4IH6A 2YNFA 1MG7A 1LK7A 1UFKA 1UJ6A 2PEHA 3KG1A 2EEYA 4ZP9A 4C3KA 4ELTA 4NZ7A 9RUBA 3BO3A 2V9KA 2OO4A 3WQPA 2NXEA 5FIIA 4ZCIA 5KFYA 4RUAA 2C3OA 2CZ9A 2HFZA 4WE1B 4BDPA 3UD4P 5FJ4A 2LU2A 3KJFB 2CJQA 2OPSB 3ZXWA 2ZH5A 2D7SA 2V5HG 5D4LA 1PYTA 1K0TA 2MZRA 3HPOA 2R4FA 3K8VA 3C66A 5F8MA 2UVRA 5E0OA 3I0RA 2F8HA 3B78A 4BCAA 1RT3B 2ROPA 3FEZA 3N6NA 3QLHB 4PCQA 5IT9U 3DHXA 1OQ3A 1VRTB 4OYAA 1FXDA 4PXDA 5CYQA 5GAHU 1VCTA 4DR2J 1N6QA 4PXBA 2W9AA 3H8YA 1QM9A 1SQEA 3AD9C 1M5SA 4WFBQ 1NSQA 4TQRA 4F0MA 2ZITA 4LR9A 2OEJA 2XMMA 4YEAA 3PXGa 1L3UA 4DR7F 2B43A 1YQHA 1P1LA 1BXNA 2PDAA 2MKCA 4L3NA 4FPIA 3DM2B 5L9XA 3FFIB 3GYNA 2DEIA 5C2GA 1TL3B 3CJ5A 3KUEA 3MTJA 1TUGB 2FGCA 3X3UA 1LW2B 4KIAA 1N54B 1HIYA 1RT4A 3AHPA 1W2IA 3M8QA 4YOEA 1RUSA 3MM9B 4YUDA 1MLAA 3THTA 3KK2A 4UOHA 4M5NA 1WDDA 1U24A 4KGMA 4IO9Q 1AYEA 4H4KA 4DN9A 4C3LA 3PX6A 1URNA 3DLEB 3JXOA 1PYOB 1HL6A 1EAYC 3P3DA 3I87A 4KHPJ 4NYPA 1R8CA 2MLZA 2DRAA 3BGRB 4HTJA 2I6WA 3SDEA 4ETZA 1OSDA 5A8KB 1N4LA 2FC8A 4IQXA 1SKWA 4XDCA 3EZ5A 5BYSA 3R3TA 1FO1A 2U1AA 4I7FB 4NA1A 1GMUA 1NMEB 3I5BA 4NEYA 1TV6B 4A8WA 5CQGA 2ZOGA 4ZVQB 2DH9A 4PYAA 3WX8A 3NGSA 4UUWA 5DDOC 1IKVB 2XLKA 2IC3A 5H9EK 2GAHC 4O3QA 1FK9A 3LTOA 4BC9A 5C24B 5ITHA 4LF6F 1C0UB 3W7BA 3R5JB 4EMDA 1U45A 2HMIB 2ILYA 1LOUA 2CPEA 4MKVA 4B9UA 2M0GB 1N5VA 1FE0A 3FKBA 4CLPA 3NNCA 2YH0A 2N7YA 1RA6A 4N47A 3US5A 3KLIB 4OHVA 2H4WB 3OT9A 1FNXH 2CQGA 3NY0A 2FVPA 3HCXA 3LP2B 3LP1A 1HNIA 5D4NA 3Q2TC 2HS4A 5KG3A 1SC6A 3CNQP 2W9BB 2RKIA 3GIKA 4QBUA 1FWLA 2DNGA 4LRBA 4UTGA 1TUVA 4USIA 5C2CA 3VAIA 2UU9F 3CJSA 1E6VB 1DQ8A 3GSDA 1SPBP 1P9YA 1UZHA 2CVEA 3IR7B 4LRAA 4MFBB 4WPAA 5BR8F 3BGUA 4OJ3A 3IS9B 3N0VA 2FYXA 3EJMA 3SZ2A 1YJUA 4LSLB 4K4VA 2DHXA 2YTCA 1ZH5A 2P9CA 3GTYX 2RF2A 1UW9A 4KPCA 1CC8A 4Y6IA 3CD7A 4RO0A 2OI2A 2OUGA 2VKZG 3O6QA 3FEXB 2CQDA 1OIAA 3QYYA 4J9VA 2J9CA 4CTAB 3K58A 2VIHA 1YRXA 4NLGA 4YR0A 1RHMB 2HNZB 3OD2A 3PYGA 4OYXA 1GH8A 3T1AA 1KTVA 2DGTA 1URRA 5KFUA 5I42B 1F5CA 2IRXA 1N34F 4I6AA 5K14A 2JOQA 3RU0A 4JI6F 3MOZA 2QA4G 1WC1A 4KQZA 2HVDA 5KFDA 4C48A 2VQFJ 2W24A 2DGOA 5C25B 4K4TA 2JZ5A 3KDOA 5L38A 1PAUB 2DNPA 3C19A 3I31A 2ZM6J 3CB4A 3PTWA 1XN9A 4IDKA 2XCAA 5J2MA 4OZ0A 3MI7X 4FKXA 5CYMB 4CNZA 4DV0F 1SC3B 4CDIA 1WG5A 1FF2A 1EJ7L 1GT8A 1PIEA 2ACMA 2WSEC 3FZ2A 2DNOA 3JSBA 3G4SS 5L1KA 2GS8A 1XNRF 2BABA 4JV5F 2MQOA 1EX8A 2KVIA 1SI9A 3B8HA 4CO5A 4PG5A 2MKIA 4I64A 1Q16B 2XMWA 4ED6A 2CJKA 3MOJB 1QY7A 4HTIA 4WF9Q 3FMBA 3PM9A 2MHEA 2XULA 2AT1B 3AH6A 3BYPA 5B0CA 5CD4A 3MR3A 2JFDA 1REGX 5SUHA 1RT6A 3J7Z5 3TRGA 4KR0B 3VQTA 1D9DA 4XK8C 3AXMA 2HSEB 3M8PA 1BD6A 3KUHA 1C1CA 3NAIA 1Y4ZB 4TNOA 3V2UC 1QAJA 5D0RA 4OZ5A 5IT0A 3OL9A 2MKJA 2J7KA 1OWXA 1TMJA 1U0SA 3T41A 2RU9A 3UNYA 3MMBA 3ZTSA 4B08A 1DFDA 3MF5A 1XERA 4PG4A 4K8RA 2APOA 1NCLA 4Q5VA 1LW0A 2H5EA 2KL8A 2VG5B 3KDNA 4U9RA 2R8JA 3OVBA 2HBYB 1SUQA 2WOMA 4X65J 2XB2D 2FJDB 3ZZRA 2CQCA 2QRRA 2B3TB 4CO3A 2OTLS 5IT9Y 1HBOB 1UEKA 4I56A 3GZ7A 3IAS9 1XR6A 2V4JB 4OZ1A 5LMUF 1C0TB 1R27B 3DLJA 3FVYA 4L3KA 3DI6B 1T9WA 4X62J 1NEEA 4X4QA 5HL7Q 1N36F 2XSJB 3SXLA 1NXIA 2RMLA 2KG1A 2VJVA 4JI7F 3K0JA 1NSKL 2NXNA 3SBMA 3MAAA 1S97A 4AQYF 2OFGX 2JC1A 2ZHOA 4YS2A 4IYQA 3KJNB 3K5MA 4F4ZA 1RT1A 2IAJB 3MM7A 3NAHA 2DR6A 5ETOA 1J5EJ 3NS7B 4EU0A 3ZZ0A 3GQCA 4J9KA 2CUYA 4NLWA 3A3PB 1XR5A 3H0PA 3FZBA 3Q8VA 3W62A 4EO8A 2VQEJ 4WFNQ 4YR3A 2DGQA 1X7VA 2DNKA 1UMJA 4LIRA 2JLEA 2HNYA 8ATCB 3J7ZT 1DURA 3MHYA 4M1KA 4B9MA 4LFCJ 3GPAA 3OPKA 2QLJB 1U0HA 1CJTB 3EICA 5F41A 4HKQA 3QIPA 4AD6A 1SJRA 2ZHBA 3UVJA 4RW4B 1FHTA 4NLRA 2EC2A 1ZAWA 2B8QA 2GGPB 2WB4A 2VFUA 3HVWA 2OELA 1UA1A 1UWAA 2LMIA 3B4MA 3DDNA 1XWLA 2D3ZA 3DOMA 4DDFA 3RRHA 2AGOA 2Y0SD 4WU2A 3RAMA 4ZMMA 4H4KC 1EB0A 4QIFA 5I3PA 3Q8SB 2FJWA 2ZVSA 4GO7X 1FDBA 3MPDA 2IJFA 1FRJA 1GMVA 3FMWA 4J7CA 3J81U 2BJ3A 4MK9A 4K59A 3RAQA 3NMAA 2HZVA 2F65A 3L9ZA 5E2QA 1JXEA 2V50A 1D9AA 3QAUA 2HHUA 3DXBA 2M70A 1WOSA 3MMJA 5A2QU 1OO0B 1RHKB 3ILJA 1N52B 3CDWA 4TU9A 2MY8A 2P9EA 4OFZA 3J7YI 2YWGA 4I2PA 2I0XA 3FBFA 2J7UA 7FDRA 5KFBA 4ES2A 4IH7A 4I68A 1HI0P 4WTOB 4DUZJ 1WTFA 2NR0A 3MWBA 3WDOA 2Y8WA 2Y9HA 3CCUS 1KLNA 4GKJJ 2MZJA 3ZZUA 3VAGA 5DQIA 3A4TA 3R6LB 5EHHA 3T1HJ 3GIRA 1Z1ZA 2OPQA 2EFVA 4CO4A 4F0KA 4J9RA 1N6QB 1KN6A 4TYAA 1ROFA 2EKNA 5M2UA 5F9NA 2MGZA 3LGMA 1J27A 1QE1A 2JEGA 2J9DA 3G96A 1HI8A 4OX9F 2IRYA 2KT5A 4NRTA 3H7HB 4ANDA 3GJQB 1SH0A 2AQ4A 2NSBA 1ITPA 3VTIA 4RW7B 1JLCA 1GAOA 1VS3A 3SSSA 2XY5A 4DQPA 5IQQA 4CLZA 4B3OA 4C11B 4F02A 3I96A 3KJQB 5DQHA 2XMTA 2XY7A 1QSYA 2BE7D 2DGWA 4WFXA 4MJKA 4CLFA 5AE3A 3I0SA 3MM9A 1HQEA 2OAUA 1GX5A 4KFBA 4RW9B 4EUVA 2M9KA 1B0TA 3I6PA 2GJIA 3AJ1A 2WCXA 4USHA 3P4UB 3FUYA 5ETRA 1KQGB 2UV8A 5B0BA 1K47A 1FJGF 1XQIA 2LFVA 4PUOB 3LPYA 4JI2F 3KLFB 1ZOTA 3DXSX 3IWLA 3KXDA 4O23A 3UI3A 4Y3CA 4QWBA 3BGRA 3POTA 2R7WA 4WZQA 4DL5A 4G3IA 4C8LA 1TFWA 5LMUJ 1LK5A 4NE9C 4X84A 3Q8QB 3CJRA 3D54A 2L08A 2ZH7A 4J9LA 4PPDA 3TANA 3NOCA 7AT1B 4OQJA 5KT3A 4DR3F 3FGVA 3L3CA 1ZA2B 3K5LA 3BZQA 1I51B 3CWJA 2XS2A 1WC4A 1FD2A 2CYYA 1H2UX 2OPRA 3RR7A 4LMZA 2BJEA 1Q82T 5J1NA 2VPYB 3MR6A 4HT5A 4DSJA 2W01A 4ZLNA 4QIWD 5GVQA 1RAFB 1JLGB 1AUDA 4UZBA 1AA1B 1FVSA 1JLFA 2HQGA 3BM7A 3LP1B 3OR1A 1CJUA 3HVTB 3ZO7A 4DR1J 3EPIA 1Z2LA 1ZTWA 4M5KA 3KUGA 4C0BA 1QSSA 2J8SA 1P8GA 2QIFA 1IWGA 3O1LA 2EFOA 4HHUA 2AJ2A 4PPZA 2JVOA 3Q89A 3T5HA 4PYDA 2A6MA 4U67Q 2CDQA 2ZH3A 3RB3A 2HNDB 1FI4A 2OTJS 5H9FJ 2XMVA 1Y7PA 3LUYA 2PI4A 5F8NA 3HX9A 5L46A 2KM8C 3O5TB 1XC9A 1KTQA 2MJUA 4DFMA 1X9MA 2RRNA 3UE2A 2VQEF 1UVLA 3O44A 1NKBA 4B9NA 5LSRA 4LSLA 4GKKF 1X4BA 1ZA1B 3CJ2A 2BEFA 3DDIA 3CSKA 3P96A 4JP8A 5JUMA 1EARA 3RG6A 3M6UA 1NHKL 2CQIA 1YWXA 4NPOA 1TKXA 3HT0A 4ID8A 2YH1A 4USVA 1JQGA 1S1TA 4YB1P 4M94A 1TUWA 5LL6d 4JI7J 3E01A 2LVWA 4DFPA 5KT2A 3BSNA 4A8KA 1KC8T 2M2BA 3E3XA 3IP0A 4JV0A 2VC1A 5HVHA 2QMWA 3DLBA 3BH7B 2XO6A 3MEDB 1XJWB 4PG8A 3BS9A 5C25A 3MD1A 4M5MA 4HL9A 3DOLB 4FVCA 3TNVA 1NSPA 1GNKA 2CKWA 2HRTA 5HQ8A 3VAFA 1YJWS 1XMQF 1WG1A 2EBEA 2GHVC 4IDKB 4KV8A 3DC2A 4LVNP 3HJFA 3X1LB 4OMFG 4DL3A 1REVA 2NREA 2LA4A 4YDXA 3FCVA 1NPKA 4CLLA 1H38A 4DV3F 1VQNS 3HI9A 3M6WA 4DV1J 2WVFA 2XSFA 4CO0A 5EDWA 1PO6A 1DBDA 5LT5A 1MROA 1H98A 3TA1A 5IT4A 3M8RA 4QWCA 3TQEA 2ZH9A 1S99A 2HLUA 1P9QC 2IVMA 4DG1B 1M5PC 1FJGJ 1BC6A 1RT6B 5T14A 1QUVA 1VBKA 4OI1A 3K59A 2GV1A 2HS0A 1XEZA 1MSWD 3GFZA 3DRRB 1HBUA 3EDQB 4LR8A 4BC7A 4DCJB 1FE4A 3V6DB 2OP5A 4JI5F 1H7WA 2DISA 1A6LA 3CGIA 5ETKA 4F2RA 2ZKUA 1SJ1A 4W92B 4L74A 2KM8B 2E1AA 1LW0B 1YLXA 2VG5A 2AWZA 3OXFA 3CMES 4OYWA 4DU7A 3CD6S 2KYZA 4OJ1A 1TAQA 2YWEA 3PJ9A 1X4EA 2VQFF 1RHRB 1Q5YA 3W63A 3MZIA 3DI6A 3ZTQA 3T5JA 3PEHA 4K5SA 5M2RA 1S57A 4IFYB 1I94F 5J2NA 2XSJA 3CJ0A 4MIWA 4TXSA 2GC8A 5EX0A 3PY8A 1IR1A 1ULRA 2QFIA 2RRBA 3NMRA 2UXBJ 5IWAJ 1H0HB 1ZPWX 3HP6A 4U95A 3MM5B 2YKQA 3GWCA 4PQUA 1HI1A 1S6OA 2V2KA 2P6TA 3KK3B 1RT5B 2G4BA 5DRKA 1RLDA 3B54A 1B3TA 2GVZB 2AEJA 4ZPAA 1SJ3P 1KLMA 1CS4A 1RQ0A 2W1BA 4JI1J 1IKYA 4BWMA 3UDEA 5KFSA 4DQRA 4O4RA 4JI8F 2HHSA 3PHEA 2FHKA 1RAGB 1HBMB 2AX1A 2DNMA 1X5PA 2EK6A 1NDKA 2K3IA 2MPUA 4ES1A 4JB8B 3M2RA 3LP0B 2HHPA 3FQKA 5KG7A 4Y2KA 4MIAA 3IRXB 4NLQA 1R0CB 4Y2MA 2YQ3A 2DPIA 4DR1F 1RT7B 1RCOB 1HW9A 1T02A 4AYBD 4CT9A 4ECRA 2EG2A 4CP5A 5DQGA 2XTJP 1U8SA 2HHVA 2UVVA 4ITSA 2KXHA 2MYFA 4F3MA 3CDEA 3ETMA 3T1HF 4C97A 1VQ4S 2R8KA 1IBCB 1OQ6A 3KLEA 3OQ2A 3CCQS 3PYEA 1PSDA 1F1BB 2HWTA 2B5JA 3JTOA 5EUHA 4ZVTB 2IA6A 3KJVA 3WZ0A 4IG3A 2Q1LA 3JSMB 2WK4A 3E8OA 1FRHA 3DU5A 3NCRA 5A0YA 3WX4A 1SH3A 4QW8A 4ANCA 3NGUA 3D66A 1X4DA 2W25A 4USJC 4HT7A 3NGTA 3U1LA 1PCAA 2DXDA 3AXKA 2MKSA 2Z30B 2J0QD 4ED4A 3DNCA 4I2PB 2Q3PA 3CDAA 4C2MA 4LBIA 4O3OA 4XAKA 2MY7A 4QYZK 1NAQA 2RT3A 1JLAB 1KQFB 3IO1A 3H5UA 2UU9J 4TLRA 1NPRA 1M5HA 5KFCA 3OW2R 5HN0A 2Q66A 3QRPA 3W2VA 4UT4A 1TZ0A 1UJ5A 1ZPVA 1S6UA 1B0VA 3BGFA 2WTFA 4B9SA 2W9CB 4NA2A 1FA0A 4ED7A 2QE5A 3JTNA 4ID5B 4O3NA 4KB7A 1JX4A 5I3QA 2VOOA 1RTHA 3DGPA 3M30B 4DR5J 2ZOFA 3CD5A 4XTTA 4LF9F 1NDPA 4DL6A 2CQ3A 1XBWA 3W9HA 3ZZTA 1QE1B 2ZDPA 1VQ7S 2Z57B 3VVUA 2XG8A 4K4WA 4F4WA 4Y28C 2E1CA 4OZJA 1MMDA 4UZCA 2OMOA 2DK2A 3NBPA 1NKCA 2LXIA 1JLCB 3TJ9A 3W3SA 1FKPA 4B3OB 1H3DA 2W7AA 2CA9A 1DARA 2IA0A 4DU8A 2WVCA 1M1HA 2R2TA 1RI7A 3TAMA 3DLGA 3RR8A 5DDRC 4YP3A 3I0SB 3OBIA 5LMNJ 2ZFHA 1YTYA 3RYLA 2WZ1A 4IRDA 3G9CA 1LWFA 3BGOP 3BPSP 1H72C 3LAMA 4IG0B 5DGAA 5LOQA 4IOAQ 5AXKA 2JJ4D 3BQ2A 5KOXA 4KGXB 1IJEB 3IBWA 2JVRA 1X4CA 1TKTB 4QWEA 3CO0P 1HNVA 2YX1A 3MGJA 3B4DA 4E98A 4ZS6A 2XMUA 4URGA 1UETA 4OJHA 4HH0A 4DS4A 4IUFA 4Q8EA 3OLAA 3D0GE 1RTDB 2ZH2A 1X4GA 2H9ZA 1EETA 1Q4RA 1V9OA 2YBVA 1RTIA 2K2PA 3AB2B 2CPHA 3MDFA 2IVFB 2LEAA 1F6TA 2HQIA 2J9EA 3GR0A 3PNIA 3UN3A 1MW7A 3VVTA 2FLNA 2X3GA 1VQKS 5F8JA 1N5YB 4RBTA 5FLXU 2AJ1A 1R8HA 3IN5A 3CIZA 4Z37A 3C15A 4WTYA 4FBTA 4RNMA 3Q22A 3CJ4A 5L8RC 2XNRA 1M5OC 3QJJA 4ZPDA 2QMUB 2Z2YB 2DO0A 2RQKA 3IG1B 2FLPA 2CNOB 1ZM9A 3R2CJ 1S5ZA 4A47A 4ZJOA 2F4FA 3SV3A 3D1HA 4DEZA 2BE9B 2E5HA 3DFEA 3G8TA 5CCLA 1SL0A 4EFAC 2X1FA 5E3QA 1FNOA 2PEBA 1LEOA 3GLJA 4JI3J 4NLVA 3R9LA 3ICLA 3HO1A 3MR2A 3HZEA 3PRDA 4I0WA 4NLYA 5D4PA 5MLCV 1D1UA 2I5JA 5G4DA 1N0VC 2QLBB 1H73A 1IN0A 4WCEQ 3QATA 6FDRA 4ILRA 4M5GA 2CRLA 1EP4B 1Q7LB 3LO3A 3UFCX 4QIEA 2A1BA 2W2OP 3KMQA 3MMAB 1IXKA 3DM2A 2BACA 1MWYA 1TMMA 2ZD1A 3D6MB 4AQYJ 3G82A 1MU2B 3M32B 2Z0GA 5KFJA 4V19X 4EGLA 5MAOA 3JSRA 4P73A 1M5KC 2ALYB 1U26A 2Q79A 1RT4B 3OTCA 1VDHA 2ADCA 2VF3A 2IY5B 3H59A 1KVJA 2IHR1 1T03B 2P8IA 1TKXB 1UTAA 2LQ8A 3VV2B 1WEXA 4FBUA 2VBZA 1MMNA 3PHTA 4OHYA 1D3WA 2B6AB 3LA0A 5I3UA 4WJBA 1OPIA 1S6QA 2AW0A 2M7SA 4Q45A 5B7WA 4JBCA 1KRPA 3OFFA 5BR8J 2HVZA 3CDBA 2X3DA 1OY6A 1WUUA 5E3CA 4I4BA 2ASJA 4LVOP 2RQCA 4NLDA 3MEDA 3C3LA 4L72B 4WFZA 5KFWA 3BSAA 3EDRB 2CG8A 2KT3A 1T3NA 2HFOA 2WBMA 2YQ0A 2FJEB 1JIHA 3QWPA 1VISA 3QZ8A 1QAIA 4W90B 4WKRA 3HSZA 4DV0J 2QL5B 1N32J 3M9OB 1YJRA 2JH3A 1O0PA 1VQSA 4U96A 5K8MA 4G1IA 1JLQA 1TVRA 5GMKa 4Q0BA 1DQ9A 4LSZB 2HBZB 5KFKA 1FJ7A 1XMOF 1F9FA 4P72A 1SQGA 2PD1A 1RWWB 1MNEA 3BF4A 2DJWA 1EHWA 2HIYA 3HSJA 3I4HX 3R7SB 4ES3A 1X4FA 1ZM3A 2EVZA 4DG1A 2HMIA 3RBXA 3FCHA 3HFZB 4J9UE 3ILOA 2H65B 2C1EB 3LP2A 3ZNUA 4OHZA 2AYGA 3CC7S 2N7CA 1G2EA 2DHGA 2W9BA 2DNHA 2FC9A 3R97A 4F7VA 3V6DA 2RS8A 3ITHA 2WONA 5H1SV 3QGPA 1T94A 3OR2A 4IFVA 2B9EA 2BZ2A 2EW9A 2MQPA 3MUVP 3PW5A 2CPJA 1F2HA 3M6VA 3EYZA 4NCAA 4B17A 3MPVA 2AF6A 2E5LJ 3TZXA 3CIMA 5KT6A 2VA2A 3FFIA 4GVLA 4YDDB 2W7OA 3W8PA 2KT2A 4DHVA 3R1HA 6FD1A 1L3TA 3IWNC 5M2PA 1PJ6A 2DBBA 1FXRA 2D1CA 3HDSA 3OSPA 2V0NA 1X5OA 2EC0A 2KRBA 1WKLA 1YJTA 3D6HB 3DYAB 1B99A 1SL1A 3JQMA 1FCAA 4ECQA 5ETMA 4NXMF 2CNNB 3QWUA 4YHHJ 1EQ0A 4JV5J 4TU8A 2AYBA 1HHQA 2HNZA 2C3UA 1F2GA 2K3KA 4OIXA 2PFDA 4H4OB 4Y2IA 5LM7E 3AOAA 5FDLA 5IM0A 4LF2A 4F3OA 4K0KJ 2HQFA 2KFYA 2UUWA 3T9NA 3EGNA 2D9PA 2GVZA 3R5GA 2KTQA 1KLMB 2E1RA 4ZHRB 2XHCA 1BLUA 1G4CA 2E7VA 4CO2A 4DV7J 4NLTA 2BDPA 3I5AA 3ZNJ1 4DQSA 1SVDA 2YNGB 2IJNA 2HK2A 2XMKA 2Z4PA 5CZXA 5KFGA 2PA3A 4J9PA 1DTTA 1B4SA 3ONQA 2B51A 3AJDA 4F67A 3I9V9 2JNJA 3G6YA 2VODA 4QZVB 4O0NA 1YRUA 4TKTA 2AJQA 5RUBA 4ECYA 3S01A 1ZETA 1WNEA 2VONA 2VPZB 3FSIA 2I8EA 2F4VJ 3SQOP 4ENOA 2Y1RI 1FWPA 2BRKA 3OTDA 3TARA 3DRSA 2BA9A 3ILIA 4G1PA 2DGVA 5GAEU 3ZZYA 2ZBRA 3AJ2A 4XO0A 2FUG9 4OZ2A 5HAOA 4RPFA 4DL7A 3TYTA 2XBPA 3CC2S 1U25A 2VBXA 4OX7A 1H6KX 5KFVA 4ELVA 5B0EA 4DX8H 5CCMA 1C1CB 4RNHA 3CVKA 4X4SA 1S1XB 2ZUAA 4R8UA 3V4IB 1IBLF 5K20B 2PE8A 1PBUA 5K5MA 1HWUA 4MFBA 4DX6A 3G71S 2FVRA 1IQTA 1OPZA 3I56S 4UF4A 3RB4A 2E5JA 5T7LA 2B56A 4ZPTR 4ZJLA 4AFFA 2DHHA 3CEDA 5AXNA 2F40A 4K4UA 1HBOA 3QBCA 3VGVA 3ELHA 4I6WA 2Y1JA 1TR0A 2BKNA 1KQKA 1KS2A 3PJWA 2RF2B 2VD3A 2V8VA 2X7IA 4A8OA 3P5BP 3VWSA 3M1VA 3CCLS 3CDUA 2ZZNA 2AIRB 3A13A 3F56A 2XQCA 1WHYA 1VRQC 3QO9B 4F26A 4J9OA 1TK8A 4OYIA 3QJPA 3O2IA 3SEOA 1X4AA 1YZ7A 1N32F 2AJ4A 4Y65A 1X5TA 1BE4A 2J0XA 1MWQA 4ILLA 3G2XA 1FERA 2B4OA 3WBZA 5KT7A 2MDAA 4Q7AA 2PA8D 4YB6A 1A0OB 1RHQB 1VRUA 3TZZA 3BREA 4DZDA 1N33F 2FTRA 2NXUA 4CO1A 4ZIVA 3KTQA 2HRUA 3NCQA 3G87A 3MEKA 3NWRA 1FVQA 3N5BA 3GONA 2IJRA 2KI2A 3U7JA 5AE1A 4X65F 3VALA 2DNQA 2OJ3A 1WHVA 4CCHA 2FHJD 1R0AA 5DS7A 1C1BA 3KHRA 3FBEA 1YBUA 2V2QA 3UVJB 5GAGI 4RW4A 5A6WA 2KJVA 3EZUA 2KO1A 1N33J 2P9GA 2CADA 1S0OA 3NEKA 3NOGA 5D77A 2JEFA 2CQ4A 4JOUA 4B9TA 1R8BA 2HAFA 1NH7A 2RVJA 2D9OA 4CLYA 4YN3B 4C98A 1TQLA 2MMYA 2RRAA 5KG1A 4ERDA 2PO4A 3FSXA 4LF7F 2BE2A 1HYSA 2F63A 4O44B 2CJ9A 1DTQA 1YSJA 3A8EA 5HMXA 1OSCA 2QC3A 2HVIA 1S12A 4DV5J 1YRTA 1BQNA 2B8PA 3K2YA 4USUA 3VF0B 4DSKA 2SXLA 1TL7A 3TI0A 3CJKA 2DVIA 3BJYA 1C2PA 4QCLA 2HRYA 2MZTA 4USMA 2AZ1A 2VG6A 1SUQB 2R8HA 1S76D 1VQYA 1WF1A 4Y00A 3HT3A 1Q78A 2M3DA 4UW2A 1T7PA 4JI0J 3MCOA 1CJVB 1AFIA 1QUPA 1PG5B 2YNHB 4DCOB 5DETA 2AGQA 1XNQJ 3MUMP 4C3MA 2ZNZA 4CM2A 4ZPBA 1RISA 1FRXA 1PJ7A 1NK9A 2XWXA 3AD8C 5HMWA 2XNQA 2OPQB 2XEXA 1SL2A 4I1TA 3MUTP 1Q8LA 2H5JB 3KHHA 2AU0A 2C28A 1S1WB 4RUCA 3EMTA 3SFUA 4H4MA 3U1MA 4LQ3A 5IC4B 1UAWA 1B70B 2K8GA 3GYXB 2G0IA 3MMCA 3H42A 4GO5X 5K9FA 2ZVIA 4E8UA 3HVRA 2PT0A 3GB0A 1HQUB 1BUXA 2CQ0A 1GTEA 2I9SA 2CXEA 3FNNA 3HKWA 3CJQA 4NA3A 4WYLA 3JYTB 2G2OA 2LP4A 4DR4F 1MU2A 1AFJA 4N8OA 4NYZA 3I5CA 1U2FA 2K7JA 2L9NA 3TO8A 4NEZA 2OLWA 2CQBA 4NMXA 1G7CB 3KLGB 2C22A 1NK5A 4NYOA 3TVKA 1RXOB 3I4PA 1GXUA 2DTJA 5HMZA 1VQ8S 2J6UA 3C16A 1WWHA 1Y3KA 2HQDA 1JB0C 2VG7B 1S6QB 3M6XA 2FHOB 4RWXA 4LQ9A 4XDDA 4AT1B 4ED8A 4P2FA 1A7GE 2DXFA 2C3MA 2MEWA 2RJZA 4WYWA 2G2ZA 4RBUA 3PZPA 3MD3A 3BDPA 3LANA 4KGVB 4PUOA 2BKPA 4MYTA 3FSYA 3E51A 4U7UD 5K8NA 3EPGA 1VOMA 4A8YA 2ZH1A 3BBCA 1YI2S 3LH2S 3CE8A 2WAQD 3W66A 4DJBA 4ED0A 2HK3A 4KY3A 1MN7A 2MSTA 4KPYA 4U6PA 4YY3J 2O01C 1KONA 1SKUB 3M2UA 4C6AA 3NCPA 1FDNA 4YB7A 3DRPA 5LXRA 1GTHA 2C2RA 4Q0BB 3VCDA 2A0FB 1SKSA 1KNZA 3CMAS 3VGUA 5HMYA 1VQPS 2ADBA 1X9SA 1GQEA 2EK1A 3FCWA 3G8SA 1ZBTA 3OFGA 1NH8A 4A8FA 2DCUB 2R9LA 5LSOA 4DQQA 1S77D 3RW6A 2VB6A 5E5NA 3ET6B 4DS5A 3S8SA 2OD4A 3DU6A 5J2QB 1FX2A 2BW7A 2WW8A 3P5TL 2HZCA 3NG8A 1V5IB 4G6VB 4RNOA 1ZAVA 2I38A 2BANA 3ZTOA 3I9ZA 3ENQA 4I2QB 3HZGA 2IIHA 5F9LA 4N5SA 1VC0A 2HVHA 4LRFA 2J9DE 1HR0J 4O4GB 4PWUA 2UUCF 3AD7C 1YKWA 4ZPCA 3TW0A 2EFPA 2HG4A 4ED5A 2QT7A 2YPZA 4ICLB 1VMBA 3Q8UA 1ZZNA 2ERRA 1GEHA 1K1SA 2EWHA 3W64A 1W25A 1UKUA 1BWVA 2Q6CA 3TA2A 1NBEB 2E1MC 4J9NA 2GIFA 4TN2A 3OL8A 1YDLA 2VBWA 5KG0A 5J2PB 1T05B 4FF3A 4LUBA 5K8PA 2BVZA 1PKUA 2GO8A 2NUHA 1XTZA 3PRBA 1UVIA 1RP5A 1T9VA 4KFBB 4EI2A 2R2SA 4P75A 1CBKA 5E3PA 4EK2A 1S1TB 2NXJA 3C6UA 2EI5A 5J1EA 2KYXA 1CULA 3HD1A 1UVKA 2IYIA 2UXDF 3QSIA 4HI2A 5IM0B 3LW5C 5HROB 3OTOJ 4KRWA 2Y3YA 3KLFA 3GP9A 4ZA1A 3H98A 1RKJA 4WZMA 3IM8A 2AYMA 3Q0AA 2BXJA 5EWFA 2HFNA 1FFGB 2VA3A 1RAEB 1HBNB 1VIOA 4KE5A 5FD1A 2QLWA 3MM8B 2VASA 2B9WA 2QO3A 4NLSA 2YNFB 4A8MP 1A9NB 2VDIA 2FZKB 1AW0A 2E29A 3A12A 3D3BJ 3TVZA 1YJ9S 4LF4J 3HK2A 2NS1B 3F41A 3Q8YA 4Q44A 3CCVS 4K5RA 4OI0A 2UXBF 5DG9A 4R5PB 1V6HA 2JLFA 2CDRB 1RLCL 4ZKAA 2LXFA 1S1UB 3BR8A 4DSFA 1J5OB 2RDDA 1U1MA 1KFSA 4GC6A 5U47A 4KHRA 4LF9J 4WIIA 5D0GA 5ETLA 4P2MA 1LXJA 2QA1A 3AAWB 3LGHA 1N5QA 2JRSA 2BJDA 2ZDOA 1U8WA 2Z2ZA 4HEA9 3DRRA 3EGVA 2GIRA 3BQ1A 1VQLS 1FTCA 3L7OA 1NO8A 4RKUC 1Z2ZA 3OJSA 4NXMJ 4X4NA 3CMQA 1KDNA 1Y9OA 3TVYA 3N5FA 2MB0B 2CPDA 3H40A 1VYAA 3W61A 2HNDA 1TAUA 2LECA 1LNQA 1H7XA 3UQSA 1S9FA 2DIVA 3WHIA 4DV6J 5T7LB 4YMEA 3IAM9 3UN2A 3W2WB 1HWJA 1T9XA 3JS9A 1Y5NB 3L7UA 4LIWA 5HVFA 3AQOA 1TL1B 1U09A 1RJJA 2FVQA 4QQBA 3ZTRA 1FRKA 2W4DA 2UXCF 4GRSA 5J2NB 1D9FA 1RA7A 2CZ4A 2R42A 1S79A 5HQLA 4M63A 2N82B 2YKPA 4AE5A 3HMJG 2DNNA 2LKZA 1S10A 3A8IA 1QTNB 1M1KT 3IBFB 3NGRA 3NXZA 3P49B 2KZMA 3UR0A 1L3VA 2YNIA 1O8BA 2ZBQA 4N8NA 3RGIA 2W7PA 3UD3P 1QVGR 4I67A 2CFXA 1U6BA 1X60A 2LQ9A 2FLLA 2QZ8A 1IKYB 3D1OA 3IGNA 5B0AA 4F4AA 5A8KA 4B3SF 2H51B 1S7IA 2F3JA 2UUTA 5KG6A 3FDSA 4NLUA 1LV5A 2D74B 3AA8A 3M2RB 3D3CJ 4C8NA 5CXTA 4BS2A 3LPEA 2Q43A 4DPTA 9ATCB 3AB4B 3HFVA 4ED1A 2IC3B 4LRDA 1IBLJ 1BWEA 4YHHF 2BYCA 2C3YA 1CSJA 3W5XA 4X4OA 3HLUA 2ROEA 1C0UA 2F8EX 1G6BA 3M8ZA 3NKYA 4DF8A 1R31A 2BMBA 4PXCA 1IQZA 4Y34A 5E3AA 5G0RA 4ZN1A 3OV7A 1B64A 2CPZA 3DOKA 4A4JA 3GG0A 2GMHA 1VIXA 4DV4F 1JWWA 3DRXA 1PYSB 2DY1A 2VL1A 1NHUA 2QA2A 4PKDB 4C0HA 5KAKA 3QSYB 3AA9A 5D78A 3S6EA 2BE2B 4IG3B 4FYYB 3D5MA 1ZAXA 4R0JA 3JSMA 2Y8YA 1DTQB 1RT2A 1KEKA 3TOQA 1VQOS 1BQMA 3CCSS 1BMQB 4B9LA 4HLBA 2GMJA 3CTRA 3K5OA 2H48B 3LALA 5GADU 1WJ9A 1CG2A 5KFOA 3SFGA 4A8SA 5D0HA 2W2PP 5ETNA 2GVDB 4CH1A 2N3LA 3BN4A 2BOAA 3EXCX 1EKSA 1NLKL 2HGMA 4CYUB 3BO2A 1F9EB 3M2VB 2R7XA 1V3SA 1KD1T 2BBEA 2K1RB 4HYKA 4ZDNA 2VKRA 2YKNA 2IFXA 2GNKA 4IFYA 3W5YA 4DUTA 2RNEA 2A2CA 4LF1A 3JAMU 2KH9A 4CLTA 2JWNA 3MM6A 2J0SD 2H54B 4LT6A 2BX6A 3SCLE 1J5EF 2DR5A 1WOPA 3EE3A 1WC3A 2ZWPA 4QU7A 5I42A 1WKJA 2CNKB 5GMEA 3OXLA 3IMQJ 1DLOB 1S9EA 1TL5A 3J7AN 4RUHA 4DWIA 2GAGC 2HFVA 2N4CA 3AY0A 4NZ0A 2HFUA 5D6GA 2QEXS 3MEEB 1N34J 4MK8A 5BXIA 3JYTA 2C2DA 3KMSA 3VZIA 5HQMA 2G0JA 1ZM2A 2N4DA 3UO0A 8AT1B 3IRXA 3IXQA 3UR3C 4DX7A 5KOWA 4NI2B 2UUAJ 4RW6A 5BJRA 3ENVA 2AJ0A 4RNNA 3V6HA 4UY85 3THPA 4NLPA 3W9JA 3K8WA 4KHPF 1LWFB 3BKUA 1OYEA 2V4RA 2CPYA 2RD5C 2NPIA 4ZK7M 3C16B 5LSLA 2V69A 1IWAA 2FQQB 1U48A 4N41A 3TJ8A 4FF2A 4WP9A 1H2VZ 4DI6A 4UQGA 2M8HA 3SCKE 1O6XA 2LU1A 4USWA 1SC1B 3O3LA 4UOFA 2YVSA 3R6GB 4HH1A 4L73A 2KJWA 2QYCA 3MEGB 2OHDA 3H4BA 3W1YC 4B9VA 3KLVA 3VQSA 1LXNA 2GX8A 5A0YB 2R2UA 2V4QA 3C2PA 4P10A 4OYMA 2YY3A 3MR7A 2UV8G 4ZVHA 4LREA 4RW8B 5KFEA 2FHMA 3W9IA 2CPIA 3DLLQ 4K4SA 3GMGA 1YG0A 4NCBA 2ZE2A 2Z2MA 2C42A 4L76A 2WOMB 5E41A 4HDHA 4TLQA 5A8RA 2VFRA 2KXFA 4IRKA 2HHWA 4Q2MA 2DRDA 3I55S 3LF0A 2KN4A 3UDVA 4XIUA 2YKMA 4XPCA 3N6LA 3UDCA 2XI2A 4JUZA 4U7CA 3V81B 1LFWA 3DHWC 1IKWA 1V5VA 2JX2A 4ZVEA 4ZVPB 2W9CA 4K4YA 5J2QA 4QWAA 4MIBA 3U02A 4WFYA 1NK7A 3N9UC 4K0KF 1X9WA 3DGPB 2AZ3A 3M30A 1ICEB 5D4OA 1FDAA 1T3OA 2RB7A 1FNMA 4QYRA 5SZTA 2MSSA 1WG4A 4JI4J 3BDEA 2MZQA 3MM7B 3ZZPA 3GJRB 4O4GA 3ZTPA 3ULHA 4ER8A 2OSRA 4P52A 1S9GA 2KVQE 3D0IE 1Q8KA 3NBPB 1FT8A 1FJEB 3H2LA 3IR5B 1RWOB 3QAEA 4RLEA 4U7UK 1G3OA 3DLKA 3KG4A 1FKPB 3J81Y 5DM6Q 4DV2F 2W2NP 3M7VA 2EFNA 1S4EA 4MKAA 3HXMA 5KFHA 2Z8QA 2ZJPQ 5HANA 1U0HB 4ANEA 2M5YA 3QIPB 2CJXB 1OY8A 5KFAA 3KK2B 4PR6A 4ALZA 4P74A 3RB6A 3DCAA 4WK1A 3T3FA 2GGPA 5B08A 4V19J 3R1LA 4OV1A 4OV6A 3THVA 4TY8A 3DOMB 2LCWA 1KVKA 2VPWB 2FVCA 4P2XA 4F04B 1KQSR 4NOHA 4R25A 5HROA 1SJFA 4EZ9A 2VUGA 2LXUA 1U2CA 4FDFA 3M8SA 2ZZMA 4X66J 1YJVA 3IR6B 4K4XA 4C0OC 1NJZA 1NJWA 1EKRA 3HHKA 3TJAA 5CZVA 2WB1D 3DN9A 4ETXA 1WORA 4RNFA 1UP1A 4DSIA 2VFVA 3EM1A 3EWGA 4LR7A 4LF5J 2BW2A 4I7FA 4CQ1A 1KVIA 4MYUA 1TV6A 5L9NA 3UDLA 3PEJA 1WKKA 1QAYA 4M8LA 1N5YA 1HWLA 1HNXF 2J76E 1XNQF 1IKVA 1FESA 2H3EB 4YY3F 1NDCA 3M9MB 5A8WA 2VBYA 1F5BA 2PGCA 2H1YA 2DHSA 5T41A 3V6JA 2XLJA 1UVNA 4DMZA 3CPWR 5H9EJ 3N4WA 3RAXA 1CPZA 4EBCA 3PW2A 1MN9A 4M5JA 4MT1A 4DPUA 2O3DA 3QFHA 2GO9A 4U8YA 4ZITA 3OUYA 2M88A 3CCJS 1OMSA 2YWWA 1KOOA 2AHOB 2BJ7A 2DEJA 2GIQA 3BB5A 3R5AA 3D6TB 4B3MJ 4TY9A 4IH5A 2OH2A 2RKIB 4KH1B 1CEZA 5F8HA 2R7QA 1WEYA 2AJFE 3IFEA 1IBMF 1WELA 4DPWA 4Q2LA 5HP1A 3IRWP 2WVDA 2DT9A 3PR5B 4DR6F 3AOBA 1NNDA 1U1QA 3SCJE 4PWDB 2IVYA 3NWGA 2HGLA 1L5UA 1UEUA 2OMLA 3PIPQ 3SIPB 1FDDA 3TZWA 4CRJA 4NWBA 1FXLA 3BKTA 3PYFA 4ED3A 4F4KA 4FZVA 3P6YC 1KHWA 3RJMB 1GMWD 1OS5A 3GYGA 3MPWA 2NYHA 1S0NA 4OI6A 4I69A 4B3TJ 2HQCA 3A3NB 4B3RJ 2GQCA 3SQGB 1Q0NA 3DYAA 4L6V3 1VR6A 4F4YA 3BV8A 3JAMY 2HHHJ 3BYRA 2XWYA 1GMWA 4F0HA 2DB1A 4H4OA 5KFMA 5K14B 2XGPA 1K73T 1TTHB 4FYXB 2YNIB 5C42A 3SI8A 2P5VA 1F3FA 1RBAA 1F3VA 1PC5A 1S0MA 4LF8F 1L3SA 3RB0A 4QR0A 2JEIA 1UCNA 1AT1B 1EZZB 4A46A 1HNXJ 2EBGA 1RWVB 1SJ4P 4ZP7A 2JL9A 4C9DA 4JYAJ 2RAQA 2BJ1A 2HVEA 2YNGA 5HATA 3AOCA 3SMZA 2ZJQQ 3K17A 2ZNYA 3HHLA 2HHHF 2RDIA 3KK1A 4EEYA 1S48A 4PG6A 4X4RA 2UVUA 1RWUA 3E2EA 1CLFA 4DSEA 4DFJA 4LFAF 2K06A 4LSNB 5IXUA 3ENAA 2O66A 3D0HE 3HULA 2HWHA 4OZNA 4LFBJ 2IDEA 2M4MA 1TKZA 1R6VA 3QFWA 4DPXA 3KYLA 2COLA 5F8GA 5HSPA 2QSWA 1BQXA 4MK7A 3GR1A 3DRSB 4V1Ak 3VAKA 1DJ0A 3UCZP 4C8OA 4QU6A 3H4DA 1ZYQA 2FZCB 3N79A 2KHCA 1JLFB 2HQ3A 2AP6A 5E3RA 3CT9A 1R6YA 5IOLA 4ZPVR 4ZCLA 1WF0A 4CNYA 2PN6A 2PMZD 3JB9k 1K1QA 1RTJA 1SIZA 3U1NA 4R8UB 2C2EA 1NUEA 4DCPB 3PIOQ 4DV7F 1QLNA 1IKXB 4J90A 4DUZF 4Q8FA 1HMVA 4F36A 2VC0A 4IR1A 1E6YB 1TK5A 1RHJB 4P6QA 1B7FA 2N3OA 1BHNA 3J80U 2OGUA 2FD2A 4ZP8A 1RYRA 2Z56B 2M52A 4IOBA 5D3GA 4DPOA 4K2XA 3UWTA 2PFFB 2V94A 4QPTA 4UOCA 4HR2A 2VPXB 2K1RA 4M5HA 1GX6A 4A8XA 1AZSB 4FN5A 3MR5A 1NHVA 3OHBA 3CF5Q 1D8YA 3M1VB 1YZ6A 1U02A 2DYAA 2R7TA 1T9YA 1FTRA 4ZOSA 1RU2A 1Y10A 4A8QA 1RWKB 3MURP 3FRYA 3A8JA 3MECA 5L1IA 1QVFR 5FDLB 4ZVFA 1HNWF 3CJ8A 5EGYA 3GFHA 1SB6A 1WSVA 2LQJA 1RZMA 3FBCA 4DV6F 3VAJA 3DRYA 4WKYA 3UCUP 2ATLA 4ZHRA 2XYPB 3MPUB 2BM0A 4ECUA 3QT8A 3K89A 3DOLA 3IA0A 4OLOA 1KKHA 3BBBA 4PAAA 4W98A 3TUJC 5CA5A 5HBMB 5KFPA 1OJ4A 2UXCJ 4NI2A 3N6MA 1REVB 1DTTB 2A3JA 2E5GA 4DN0A 4KKOA 1SV5A 1VLYA 3CCZA 5HI7A 1N36J 2DRBA 2UUBF 4QWDA 1FEHA 3EVWA 2OFHX 3N01A 1XIQA 5E33A 3QGIA 5ETVA 3K7RA 4GVBA 2E7WA 1YIJS 1RAIB 4M5DA 3CCES 5BYQA 2GMLA 2YWFA 2C2KB 4IQMA 2BQRA 3WIVA 3MCMA 4FYVB 1NM2A 4IRCA 2ASYA 1RABB 2X51A 3BBFA 3SSRA 2HFSA 5CABA 4RWWA 3DMJB 1U1NA 3MEGA 3KHLA 1VJWA 3QMQA 2BQ3A 4OX9J 1HYSB 2FB0A 2M8DB 1S1XA 4PQAA 5F8IA 2CQ1A 3OHAA 1ZM4A 3VHQA 2X1AA 1T0TV 4LFCF 3I32A 2W2QP 1FD8A 1HHTP 1VGYA 1HKAA 2HS3A 1JJ4A 4S0MA 1RWMB 2LQ5A 3CJKB 3Q23A 1T8EA 4NCGA 2BOPA 2LDYA 1OYDA 4F3QA 3H5YA 2HW3A 4FVMA 2VG6B 4GC7A 3TEGA 4QR1A 4X64J 2G13A 2OPPA 2QJ3A 2YWHA 1FFSB 2VICA 5HLFB 1NB7A 2V67A 3C14A 5IC6B 2VFTA 3PFOA 1DHMA 2YKMB 2YNHA 5KFIA 1Q1KA 1HARA 2CQ2A 4DR5F 4P2SA 4ECXA 2G1DA 1LWEA 1HW8A 2V8PA 2BKOA 5B0FA 3M9NB 4ZLJA 5IZHA 4NL5A 3EGWB 4KBIA 1WDTA 2IYGA 2HIQA 2CVIA 2MGZB 3A8KA 4ZVSB 3KK3A 3D9BA 1KR4A 4P71A 4H4MB 5KG4A 5DG8A 2DR8A 3MMCB 3IWXA 3G6VA 3HKZD 1X0FA 4OL8A 3H90A 5DLFA 2LEPA 1M1GA 2HPUA 4Z2XA 4DL2A 1KHVA 2IMWP 4PRFA 4CI0B 5H9FK 4C11A 2QN6B 5KFTA 2XS5A 3GIMA 2RDJA 4Y2CA 4ZVOB 1SCJB 4KYZA 1TL4A 2FDNA 2MXYA 3OL7A 1W2BR 3T1YJ 2KHDA 1RAJA 2NYIA 4CZCA 5KT5A 2V8DA 4WK3A 3MXHP 2X1BA 4ZLLA 2DCLA 2U2FA 2VG7A 2CPXA 1CJKB 1YK9A 1HD0A 3B82A 4ED2A 4CH7A 1F9HA 1IUJA 5GAGU 2UUCJ 1HPZA 3A1YG 4KO0B 1S72S 2B5JB 2ZC3A 4FF1A 4CLKA 2FZGB 4OJGA 2XC9A 4MH8A 5KFXA 3SV4A 3T1YF 1JLBB 1VQ6S 4KT0C 5HVGA 3UD5A 2X1GA 1N5SA 3SCIE 1BQNB 2HBRB 1U2RA 2R7RA 3FK4A 4QW9A 2ZKTA 3TP2A 2R8GA 3DRPB 3D7SB 3NLCA 4ECVA 3TEHB 2UP1A 2HLTA 1FJCA 1UVJA 2R7SA 4WFAQ 3D67A 1EIYB 2D3UA 3DGVA 1NK6A 2GHPA 2MTLA 5EWGA 2DH8A 3L7PA 5ETTA 3D6FB 5AXLA 3OUYB 1N88A 1RAAB 2DY9A 2IM2A 1Y5LB 3MFHA 2KXNB 3NNAA 2B4UA 2G1HA 3QLHA 4JV2A 4NXNJ 2KG0A 4WU3A 3RTVA 5CYQB 2F8MA 2YXLA 2EKYA 1CQMA 2RILA 2PIIA 4I2QA 2XLIA 1S1WA 4ZP6A 2VOPA 2PI5A 1RAOA 5F0WA 3EUNA 4YR2A 4WWSA 3KNAA 4EZ6A 1SBRA 1RU1A 2FJXA 3DLHA 3PO4A 4ICLA 4X64F 3L09A 2Y1IA 3QRQA 4C7QA 1QDUB 5E7OB 5DZ7A 2H4YB 4ZJQA 1YBTA 2MZ1A 2KFNA 3OTEA 5BYRA 2JSXA 2FPHX 2F4VF 3KG0A 1LW2A 3QT5A 1Q8BA 2LA6A 2L48A 2XCPA 4J91A 2ZH6A 1JMTA 1U47A 4LF5F 3OFHA 3TAMB 1U1PA 1YJ7A 2V8HA 2FY8A 2E66A 3GCXP 3D28A 3SQGA 2RS2A 3S7RA 2XI3A 4GMKA 2BR0A 1GXTA 2XS7A 1NKEA 3C8YA 1K9MT 4FPRA 3EGZA 1YGYA 2FJAB 3C6UB 3E01B 2WSFC 3KFWX 3PX0A 2HHQA 1RSCA 4JI0F 4O3PA 3ZZOA 2UUAF 1YVFA 4LBHA 2ZWOA 2HHXA 1SQFA 2JHEA 1JKHB 1MWZA 3TAPA 3CJTA 3MTKA 3CCMS 3SDEB 3W8GA 5J1PA 3HF5A 3GV5B 2HKEA 1RTIB 2F7VA 3C6TA 4KO0A 4X66F 1QJHA 1WTBA 4KV8B 2P2CB 5CAAA 3M2UB 1B0PA 2ROGA 1U49A 2RU3A 1RWNB 1FK9B 3R8YA 3H25A 1NK8A 1S4FA 5C24A 2AD9A 2ASDA 3HFKA 2NXCA 3ENWA 2I2YA 4RJVA 2OPSA 1IJFB 4OX6A 5DG7A 2MQLA 2XMJA 2Y0BB 2F1FA 5DJBA 5KTQA 4JI6J 2NQPA 4FS1A 1PBAA 3KLIA 2IM3A 1F60B 1RT3A 2DNYA 4QJVA 2RHQB 4QOTA 3CUNA 3C46A 4RR5A 2NCKL 1HWKA 2IM1A 3TUZC 4AUKA 4DR2F 1HBUB 4RU9A 4B3RF 3PCOB 2WVEA 3RW7A 1HHSA
chains in the Genus database with same CATH topology
1EKSA 4PYAA 4FDFA 2IIHA 3JQMA 2EKNA 3JQJA 4PYDA 1EKRA 2IDEA 2OHDA 3JQKA 2EEYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EKS A;  4PYA A;  4FDF A;  2IIH A;  3JQM A;  2EKN A;  3JQJ A;  4PYD A;  1EKR A;  2IDE A;  2OHD A;  3JQK A;  2EEY A; 
#chains in the Genus database with same CATH topology
 3LOU A;  1F0X A;  3KOA A;  2I5J B;  2OEM A;  3KLH A;  5HO4 A;  2CJB A;  3J7Y U;  5LMN F;  3HHL D;  1E6V A;  1WC0 A;  1SJQ A;  3Q86 A;  2GCF A;  3QGG A;  1RE1 B;  1E6Y A;  3HD2 A;  1LWC B;  4QIV A;  2AKW B;  2DNZ A;  1UFL A;  4NLX A;  3FC9 A;  4DOZ A;  1FKA F;  3CUL A;  1W26 A;  4DXL A;  3NL0 A;  2B7C B;  1Q86 T;  1KP6 A;  4X2B A;  3CW2 C;  4USK A;  2RHS B;  1U1K A;  2IMO A;  3HHE A;  2ZD1 B;  4OYO A;  1DRZ A;  3RRG A;  3NNH A;  3QT7 A;  4DV4 J;  1HD1 A;  4KC5 A;  4C8M A;  3M8Q B;  2NPF A;  4C8Z A;  4KJI A;  5JVG Q;  4ECZ A;  4URQ U;  2K7K A;  3GSI A;  4B3T F;  1T9U A;  5JJB A;  4OLP A;  1F5A A;  2CNL B;  3ISN D;  2FGO A;  1VBY A;  3EVM A;  5I3U B;  3MEC B;  4JI1 F;  3DLE A;  4FF4 A;  2AEF A;  1JK9 B;  2A6O A;  2HHT A;  3PFE A;  3AQP A;  2DGU A;  1QTM A;  2OSQ A;  5GMD A;  5EN1 A;  4Y0F A;  4MAK A;  2QL9 B;  2XHW A;  2XYH B;  2MQN A;  4KGK A;  3MM8 A;  3VZH A;  2MQ8 A;  4AL6 A;  4EBE A;  2MQQ A;  5CD4 H;  3LP0 A;  1NK0 A;  3GIJ A;  2CIM A;  2DGX A;  5DO2 A;  1JXV A;  5J2M B;  2GFF A;  2MKK A;  2RUG A;  1RBO B;  2B7B B;  2EFQ A;  4Y2A A;  3GV7 B;  4JYA F;  4KKO B;  4FYW B;  5DLG A;  2EPI A;  3H5X A;  2G0C A;  2WW4 A;  3OVS A;  1IR0 A;  3KKF A;  4OYB A;  4QIG A;  1AUS L;  1S1U A;  5K8O A;  4ELU A;  1UL3 A;  1K0V A;  4M5I A;  2L9W A;  4FKY A;  2WVB A;  1GFW B;  4L75 A;  1JNZ B;  5G0R B;  2ZM6 F;  1KBR A;  1R89 A;  1RTZ A;  1RWX B;  1RGV A;  4FXW A;  4MKB A;  4OI2 A;  3KLE B;  2ABY A;  1P6T A;  2XZD B;  3VGS A;  1HNI B;  1L3K A;  2A18 A;  1O51 A;  3DMJ A;  4BBY A;  5JMN A;  3KJV B;  3Q24 A;  3PV8 A;  4BWJ A;  4OYP A;  3ZFV A;  4J9M A;  3GJS B;  2J0W A;  3LWM A;  1XK8 A;  3J80 Y;  1JJH A;  3HSG A;  2WON B;  1BQM B;  2OKQ A;  4IKA A;  3PO5 A;  1DQA A;  4MMO A;  4JI2 J;  3OR2 B;  1BY9 A;  4IFV B;  4EYH B;  3JTP A;  3KHG A;  4NCG B;  5IV3 A;  1U4B A;  1TFY A;  1PJ5 A;  2C2Z B;  4ZLP A;  4IO1 A;  2ZOM A;  3W2W A;  2VHG A;  3ILL A;  3T6B A;  3ZZZ A;  5KG2 A;  3MAQ A;  1V3Z A;  5HLF A;  3C14 B;  4CYU A;  3PX4 A;  1TL1 A;  2HZA A;  2HGN A;  2V4J A;  3AOD A;  1U6F A;  2VV5 A;  4DV3 J;  4DSL A;  4K2J A;  4DR6 J;  1FKO B;  4G1Q A;  4O3S A;  3CJ3 A;  5JVH Q;  4OHX A;  1UJ4 A;  5DZ6 A;  4ID5 A;  2LLZ A;  3NS6 A;  1RTH B;  2YX4 A;  3UN5 A;  4M5L A;  1FRI A;  1J2V A;  4LRC A;  5EX3 A;  2QLX A;  5F3T A;  5IS2 A;  4GKK J;  1CVJ A;  5F3Z A;  1U1L A;  1VBX A;  2NZC A;  1FX4 A;  4HAC B;  2Q6B A;  4HI1 A;  2XYG B;  1UFW A;  1NZA A;  4O3R A;  1QD1 A;  2C3P A;  2E1P A;  3R5B A;  4X62 F;  3QJL A;  2R7V A;  4HVZ A;  3T19 A;  3BH6 B;  1UZD A;  2CQH A;  2LEB A;  2D3O R;  1JJ2 R;  4F2S A;  4X4P A;  3PKY A;  2XY6 A;  4GKJ F;  1WC6 A;  3M05 A;  5CYM A;  1S59 A;  3B6B A;  4PG7 A;  4WXW A;  1YJN S;  1FRM A;  1S1V B;  2MLX A;  3FQL A;  7FD1 A;  1XR7 A;  4IG0 A;  4F50 A;  1P1T A;  3G86 A;  1WAC A;  4C8Y A;  1IM4 A;  4DR7 J;  2CG4 A;  3LQV A;  3ADA C;  3BN7 A;  3CCT A;  3DKD A;  2KDO A;  3GJT B;  3HSD A;  4PEO A;  4PWW A;  5ADZ A;  4CIO A;  3GIL A;  3VR1 A;  2WBR A;  3QT6 A;  3TX8 A;  2KU7 A;  3VGT A;  2ATC B;  1I5O B;  1Q53 A;  4DUY F;  3UNG C;  3H2V E;  1HFE L;  2HWI A;  2DHA A;  3K5P A;  2DXE A;  3PDN A;  4J5O A;  3Q8R B;  3HJV A;  1RT2 B;  4XPE A;  2QA4 S;  2GJ2 A;  4UST A;  1R8P A;  3MMB B;  3V4I A;  1M5V C;  4H54 A;  3C15 B;  1SC4 B;  5A2Q Y;  2V2V A;  3AT1 B;  4DQI A;  2CWK A;  3H2U B;  2LDI A;  2IDL A;  3SSQ A;  5AJ3 J;  3IG1 A;  2H5I B;  2ZH8 A;  2JDJ A;  1XMQ J;  4ILM A;  5A8R B;  3N28 A;  2XZT B;  1IR2 A;  2VDH A;  1FWK A;  2UZA A;  1C0T A;  4WP8 A;  2B9X A;  2HUR A;  2RQM A;  5KFL A;  4X4T A;  4JV1 A;  3ISN C;  4ZIW A;  4C8K A;  3V81 A;  3G8Q A;  1YHQ S;  1IKW B;  2QGF B;  3EXY A;  4AXI A;  2FHJ A;  1RHU B;  2XGQ A;  5GAD I;  3D2W A;  3GU0 A;  4WBF A;  3RZA A;  2R8I A;  1FRL A;  3M8W A;  3GFY A;  2CAJ A;  3QO9 A;  2XMA A;  4OZL A;  5KT4 A;  2ZHA A;  2KZZ A;  4EYI B;  1VK3 A;  4CM0 A;  4MTP A;  2J8A A;  8RUC A;  2UUB J;  1U6Z A;  2RE1 A;  1DLO A;  1HLW A;  1S9E B;  2P6S A;  3R27 A;  2PSZ A;  1H2T Z;  3HVA A;  3QQC D;  4DUY J;  4JI4 F;  1UWB A;  2DNR A;  1UW4 A;  3G82 B;  3M32 A;  4UUX A;  5AE2 A;  1JLE A;  1LFP A;  1RK8 A;  3K5N A;  1Y3J A;  2OIH A;  1CJT A;  4UQT A;  4BLG A;  1TP7 A;  4EO6 A;  1DZ5 A;  1R0A B;  2NZ4 A;  1AB8 A;  4RW9 A;  1C1B B;  1RAC B;  2YX7 A;  3QGH A;  2ZUG A;  4KH0 B;  4NML A;  3QZ7 A;  3D1Q A;  2YWK A;  2B6A A;  5HJX A;  3LWL A;  5AT1 B;  2MKY A;  2MHN A;  3BO4 A;  3PW4 A;  3TAQ A;  2W2M P;  3JQK A;  2FJV A;  2YPY A;  4P7T A;  3GE9 A;  4TY8 B;  2DPJ A;  4PXE A;  1HA1 A;  4YB5 A;  1I94 J;  3O8W A;  1R8A A;  3QRR A;  1Q7Y T;  1N5T A;  1JKH A;  2ZZT A;  3POT B;  2DKO B;  3RRK A;  1ARO P;  3PW7 A;  4O44 A;  1Y11 A;  2GHW A;  4NXN F;  4OZ3 A;  1OY9 A;  3R7N B;  1JNR B;  4DL0 C;  3TX0 A;  3KNG A;  3M8Y A;  5IV4 A;  4FP9 A;  5CHC B;  1SH2 A;  4RW8 A;  2A10 A;  4LFA J;  1JLQ B;  1TVR B;  5IQ6 A;  1UA0 A;  3NS5 A;  2R3V A;  4RUB A;  4TYB A;  2IBK A;  2ZE2 B;  2F5G A;  5ETQ A;  3OVA A;  2OPR B;  1TU0 B;  4E2F B;  2G9O A;  2ACY A;  2E5I A;  3I82 A;  5B09 A;  1SKR A;  2B4V A;  1NB2 A;  3H20 A;  1WOO A;  5ETS A;  3M4X A;  1XNR J;  3IC1 A;  2V9W A;  5L39 A;  5LXY A;  3OLB A;  1I3O B;  2FIU A;  2RSQ A;  4LF8 J;  2FLO A;  1T9T A;  4DR3 J;  4X4U A;  2QYG A;  1CJU B;  1UPM B;  4Z7Y A;  3TUP A;  1LWX A;  3D68 A;  3S1T A;  5KG5 A;  1RAD B;  5KFR A;  3ITH B;  1YIT S;  1KWM A;  2BM1 A;  3W65 A;  1NU4 A;  4N77 A;  2JC0 A;  3WIU A;  4YQW A;  3KLH B;  3BGL A;  1Q5V A;  5THW A;  3OFE A;  2O5D A;  1S9G B;  2AEM A;  1LWC A;  1Y0H A;  4RW7 A;  2EFG A;  1XMO J;  3DLK B;  2RH3 A;  2CQP A;  3BQ0 A;  2R2R A;  4NX9 A;  3W60 A;  3UW1 A;  3V4M A;  5L1L A;  1T95 A;  3RUB L;  2QFJ A;  4FXD A;  1VLO A;  1XMB A;  4G65 A;  3FEY B;  1HQE B;  2BUN A;  1HNZ F;  4PZV A;  2EXU A;  2MJN A;  3GCW P;  4QR2 A;  2J6T A;  2VJU A;  3PG9 A;  1YX2 A;  2NSC A;  2AMC B;  2W4C A;  2KFZ A;  3GII A;  3MCS A;  2ZBP A;  5ETP A;  1PC4 A;  2LQB A;  5C42 B;  4FS2 A;  4NRU A;  4QPX A;  1VQ9 S;  1RKI A;  1S0V A;  1S6P B;  2CJY B;  2Y1L B;  2VH7 A;  3TWZ A;  4ZVU B;  3PAC A;  2BQU A;  2D69 A;  4IOC Q;  2AV5 A;  3H5S A;  2ILZ A;  3BR9 A;  3KWM A;  5AXM A;  1LQ9 A;  3P45 B;  2KB2 A;  2QG9 B;  4K7Q A;  4DR4 J;  3KK1 B;  1G1X A;  1FEE A;  5A8W B;  5DDP C;  4LSN A;  4RZR A;  4TU7 A;  1H74 A;  3BPD A;  4WIQ A;  4WE1 A;  2AX0 A;  2O67 A;  4FNH A;  2O1P A;  1MRO B;  3RBE A;  4P9S A;  4LF7 J;  5KFZ A;  2W8L A;  3RBZ A;  1UPP A;  1JLG A;  5GAH I;  4ZCM A;  2ZEJ A;  2AYE A;  3WC2 A;  3OR1 B;  3I0R B;  2FVS A;  1X8D A;  4CLW A;  3HVT A;  2C2O B;  2DO4 A;  2QL7 B;  4CLS A;  4RU2 A;  3TR5 A;  1HNZ J;  3OTB A;  4URS A;  1VC6 A;  1VRT A;  5KFQ A;  1RBL A;  2B9Y A;  1WF2 A;  1Q81 T;  5D15 A;  1QSL A;  4DX5 A;  2VZ9 A;  2BAN B;  4DF4 A;  3MPY A;  1Q95 G;  4ZPW R;  3K57 A;  5HK4 A;  5HP1 B;  1NJI T;  1Z4U A;  4U8V A;  3OTO F;  1IKX A;  2MZS A;  4CT8 A;  5HJY A;  1NPP A;  4PWD A;  2RIJ A;  1HMV B;  4CH0 S;  2J5A A;  1PGZ A;  1W7W A;  4K50 A;  1N8R T;  2IBO A;  4AL5 A;  1WI6 A;  4HDG A;  2D41 A;  2ZH4 A;  2CPF A;  5D3G B;  2JEJ A;  1TL3 A;  2MLY A;  5AJ3 F;  1R7I A;  1X4H A;  1HQ2 A;  2KRR A;  2ASL A;  2R7O A;  3MAH A;  1FKO A;  4G1Q B;  2V2Z A;  4W4M A;  3F73 A;  1ZZF A;  2GA7 A;  2WRM A;  2Z2L A;  1BGX T;  4NZ6 A;  4OI4 A;  4BHQ A;  3IM9 A;  4F4X A;  4AL7 A;  1R3N A;  3FBB A;  1NRK A;  1MML A;  4CWB A;  2YKA A;  1I6J A;  2G2Y A;  5J1E B;  4JI8 J;  3MM5 A;  2JFK A;  4PQU B;  2IRU A;  1KSP A;  1JXL A;  1PAE X;  1VQM S;  3PR4 A;  4HAC A;  3PKM A;  4ATN A;  1KFD A;  2IPO B;  2XM3 A;  1RB0 A;  4A48 A;  1HNW J;  2QV6 A;  1CQN A;  3BKF A;  1RCX B;  1CS4 B;  1VRU B;  3R7B B;  4ZCK A;  4WP3 A;  1RWP B;  3HM9 A;  4N76 A;  3BSC A;  1APS A;  1VHI A;  3TQ1 A;  3UCG A;  3JQJ A;  4DL4 A;  3BSO A;  5D0E A;  3HHL B;  1AXQ A;  5C7P A;  4KGZ B;  1S1V A;  4O0I A;  2E5L F;  1RT7 A;  3IBC B;  1NJY A;  3IGV A;  3NP5 A;  4FXV A;  1K8A T;  1SV5 B;  2EG1 A;  3GV8 B;  1NK4 A;  2ZBI A;  3CXC R;  1IBK F;  4N56 A;  3OXG A;  4R5P A;  4CLU A;  3LAK A;  4LBP A;  5B0D A;  1R0B G;  1TKZ B;  1X31 C;  1J5O A;  3L95 X;  3TA0 A;  1TEL A;  1IVZ A;  1QAX A;  2PMH A;  3QPI A;  4UOG A;  4HHJ A;  4KSE B;  4M5D B;  5IFM A;  3VAH A;  1N56 A;  2CWX A;  5IWA F;  4MKY A;  1VJQ A;  1SIW B;  3QID A;  4DPY A;  5KFF A;  3EVO A;  1ZTT A;  5DGB A;  4ECW A;  3MCN A;  4JI5 J;  1UVM A;  3F0N A;  1HWI A;  2B0G A;  1Q79 A;  1RTJ B;  5I4M A;  5EWE A;  2WSC C;  4EBD A;  1IBK J;  3Q83 A;  2BRL A;  2QTW A;  1O5J A;  5B0G A;  2L41 A;  1NZ8 A;  2DIU A;  1ELO A;  4FNI A;  1TL7 B;  2C2M B;  2J6S A;  1VHF A;  2B4P A;  3HHN B;  1TK0 A;  1R43 A;  5DM7 Q;  1GK8 A;  2JLG A;  2CJA A;  4KHM A;  2YKO A;  3IS9 A;  3NRB A;  2ZJR Q;  3ETO A;  3CCR S;  3W5Z A;  4B3S J;  1TKD A;  1FFW B;  2HYI B;  1CJV A;  1SXL A;  5LJ3 Y;  3GFX A;  2NUU G;  1HR0 F;  4TQS A;  2DNL A;  2HAI A;  4X4V A;  3W2V B;  1AZS A;  1C4C A;  1WC5 A;  4IR9 A;  2DR9 A;  3Q2S C;  4CTA A;  1LWE B;  3V5R A;  3EX7 B;  3PYD A;  2Z58 B;  4Z7C A;  5F8L A;  2I1R A;  1CC7 A;  4QYZ J;  4K4Z A;  2XO7 A;  3HHD A;  1M0S A;  5A76 A;  5FLX Y;  4R0E A;  3D4J A;  4I6Y A;  4Q43 A;  2RQ4 A;  3T9Z A;  5A6P A;  1RT5 A;  2ALZ A;  2OEK A;  1VC5 A;  1PIL A;  2DGS A;  2V63 A;  4LF4 F;  4LFB F;  3J81 j;  1JJC B;  4DBQ A;  3DDK A;  3NGD A;  2D3O 1;  1HQU A;  2DIT A;  2V8G A;  3UPF A;  1M90 T;  1UWB B;  1DAX A;  1HBM A;  2WHO A;  4F25 A;  3VAM A;  1JLE B;  3V6K A;  5HBM A;  2DH7 A;  4J9S A;  4DFK A;  3PW0 A;  1T11 A;  3ZC4 A;  1VI7 A;  2QSF A;  4D3G A;  2V6A A;  4NLO A;  3KLG A;  2PMW A;  2E44 A;  2LYV A;  3DLG B;  3PRV A;  4TVA B;  3CC4 S;  1V3R A;  2CZV C;  2ZC4 A;  3EZO A;  1X0P A;  3GG1 A;  3P8B B;  2VFS A;  1EQM A;  6AT1 B;  3SYZ A;  1B7Y B;  4DLE A;  2YQ1 A;  1RYS A;  2FY1 A;  3Q8P B;  4HHH A;  3PJX A;  4KTQ A;  4GVB B;  4ZVR B;  1TKT A;  4D3H A;  3G6E S;  5KFN A;  1HNV B;  3DOK B;  4ZVG A;  5CYJ A;  1N48 A;  1YBA A;  1Q8I A;  1HPZ B;  4F8R A;  3J7A 1;  1RTD A;  3BEG B;  3M8P B;  2GJF A;  1EET B;  4LJM A;  1UEV A;  4OYZ A;  1VQ5 S;  4M95 A;  1ACM B;  1WHX A;  4PAB A;  5DDQ C;  2F9J A;  2E7X A;  2KKH A;  1U7L A;  3LGN A;  2VU5 A;  3CCW A;  1NSA A;  1D8Z A;  2HBQ B;  4DV2 J;  4OX8 A;  1C4A A;  2W8K A;  1X5S A;  3CO9 A;  3AFG A;  2F9D A;  3FJ2 A;  4EWT A;  2GVD A;  5LJ5 Y;  2OPP B;  2PC6 A;  2POK A;  3QNW B;  4KAI A;  5GAE I;  4OHW A;  4J37 A;  1JLA A;  3OJU A;  3RBD A;  1IBM J;  3M2V A;  4P7V A;  1LKZ A;  1NJX A;  2C2N A;  1KOH A;  2HEK A;  2L9D A;  1I1G A;  2QX0 A;  3ET6 A;  3R5C A;  4ZN3 A;  4DV1 F;  1P27 B;  3MFI A;  1D0E A;  2E9Z A;  4FYD A;  1Y5I B;  2YKN B;  1WHW A;  3A3O B;  1WI8 A;  3F44 A;  4N7T A;  4DZ6 A;  2XZW A;  2UXD J;  2R7U A;  2V34 A;  1VBZ A;  4B3M F;  2GW8 A;  3MM6 B;  4C4W A;  1U1O A;  3MAA B;  4DLG A;  2UVW A;  3OSN A;  4ECT A;  4UY8 T;  4E0D A;  2AGP A;  3G6X A;  1VFJ A;  2J7W A;  1GXL A;  2V68 A;  1RT1 B;  2GQ2 A;  2IAJ A;  3R5D A;  1U1R A;  3JSY A;  4YFU A;  1EP4 A;  4JI3 F;  2L3M A;  3MEE A;  3T5K A;  3MMA A;  3WC0 A;  3TUI C;  3T6J A;  5J2P A;  2QLF B;  2HNY B;  1NDL A;  3NGK A;  4B02 A;  3U27 A;  1WD6 A;  1T05 A;  2IM0 A;  3R2D J;  2ZBC A;  3CD0 A;  2GQQ A;  3L4B C;  2MKH A;  1N0U A;  4RW6 B;  2QMX A;  1RAH B;  4OI3 A;  5F0U A;  5C5J A;  1S7H A;  4RBV A;  1T03 A;  2E9R X;  5L1J A;  1DY3 A;  2MQM A;  4ECS A;  1WEZ A;  3T5L A;  1Y00 A;  1K44 A;  2OD6 A;  3FRZ A;  4AXJ A;  1VK8 A;  1CUL B;  2DD8 S;  4LF6 J;  5D8H B;  2GZO A;  2W4P A;  1CJK A;  4RX6 A;  4J9Q A;  3TZY A;  2A2D A;  5CH7 B;  1S49 A;  1IM6 A;  1WSR A;  2FJB B;  4RL1 A;  2NLW A;  2BJ8 A;  2DR7 A;  4NAS A;  3PVX A;  2E9T A;  2RUS A;  4WXO A;  3OL6 A;  1HBN A;  1ZS6 A;  1S6P A;  1RDR A;  2BJ9 A;  1D09 B;  3ISZ A;  2BV3 A;  4DV5 F;  3HHL C;  5JXS A;  1JLB A;  3C6T B;  4IH6 A;  2YNF A;  1MG7 A;  1LK7 A;  1UFK A;  1UJ6 A;  2PEH A;  3KG1 A;  2EEY A;  4ZP9 A;  4C3K A;  4ELT A;  4NZ7 A;  9RUB A;  3BO3 A;  2V9K A;  2OO4 A;  3WQP A;  2NXE A;  5FII A;  4ZCI A;  5KFY A;  4RUA A;  2C3O A;  2CZ9 A;  2HFZ A;  4WE1 B;  4BDP A;  3UD4 P;  5FJ4 A;  2LU2 A;  3KJF B;  2CJQ A;  2OPS B;  3ZXW A;  2ZH5 A;  2D7S A;  2V5H G;  5D4L A;  1PYT A;  1K0T A;  2MZR A;  3HPO A;  2R4F A;  3K8V A;  3C66 A;  5F8M A;  2UVR A;  5E0O A;  3I0R A;  2F8H A;  3B78 A;  4BCA A;  1RT3 B;  2ROP A;  3FEZ A;  3N6N A;  3QLH B;  4PCQ A;  5IT9 U;  3DHX A;  1OQ3 A;  1VRT B;  4OYA A;  1FXD A;  4PXD A;  5CYQ A;  5GAH U;  1VCT A;  4DR2 J;  1N6Q A;  4PXB A;  2W9A A;  3H8Y A;  1QM9 A;  1SQE A;  3AD9 C;  1M5S A;  4WFB Q;  1NSQ A;  4TQR A;  4F0M A;  2ZIT A;  4LR9 A;  2OEJ A;  2XMM A;  4YEA A;  3PXG a;  1L3U A;  4DR7 F;  2B43 A;  1YQH A;  1P1L A;  1BXN A;  2PDA A;  2MKC A;  4L3N A;  4FPI A;  3DM2 B;  5L9X A;  3FFI B;  3GYN A;  2DEI A;  5C2G A;  1TL3 B;  3CJ5 A;  3KUE A;  3MTJ A;  1TUG B;  2FGC A;  3X3U A;  1LW2 B;  4KIA A;  1N54 B;  1HIY A;  1RT4 A;  3AHP A;  1W2I A;  3M8Q A;  4YOE A;  1RUS A;  3MM9 B;  4YUD A;  1MLA A;  3THT A;  3KK2 A;  4UOH A;  4M5N A;  1WDD A;  1U24 A;  4KGM A;  4IO9 Q;  1AYE A;  4H4K A;  4DN9 A;  4C3L A;  3PX6 A;  1URN A;  3DLE B;  3JXO A;  1PYO B;  1HL6 A;  1EAY C;  3P3D A;  3I87 A;  4KHP J;  4NYP A;  1R8C A;  2MLZ A;  2DRA A;  3BGR B;  4HTJ A;  2I6W A;  3SDE A;  4ETZ A;  1OSD A;  5A8K B;  1N4L A;  2FC8 A;  4IQX A;  1SKW A;  4XDC A;  3EZ5 A;  5BYS A;  3R3T A;  1FO1 A;  2U1A A;  4I7F B;  4NA1 A;  1GMU A;  1NME B;  3I5B A;  4NEY A;  1TV6 B;  4A8W A;  5CQG A;  2ZOG A;  4ZVQ B;  2DH9 A;  4PYA A;  3WX8 A;  3NGS A;  4UUW A;  5DDO C;  1IKV B;  2XLK A;  2IC3 A;  5H9E K;  2GAH C;  4O3Q A;  1FK9 A;  3LTO A;  4BC9 A;  5C24 B;  5ITH A;  4LF6 F;  1C0U B;  3W7B A;  3R5J B;  4EMD A;  1U45 A;  2HMI B;  2ILY A;  1LOU A;  2CPE A;  4MKV A;  4B9U A;  2M0G B;  1N5V A;  1FE0 A;  3FKB A;  4CLP A;  3NNC A;  2YH0 A;  2N7Y A;  1RA6 A;  4N47 A;  3US5 A;  3KLI B;  4OHV A;  2H4W B;  3OT9 A;  1FNX H;  2CQG A;  3NY0 A;  2FVP A;  3HCX A;  3LP2 B;  3LP1 A;  1HNI A;  5D4N A;  3Q2T C;  2HS4 A;  5KG3 A;  1SC6 A;  3CNQ P;  2W9B B;  2RKI A;  3GIK A;  4QBU A;  1FWL A;  2DNG A;  4LRB A;  4UTG A;  1TUV A;  4USI A;  5C2C A;  3VAI A;  2UU9 F;  3CJS A;  1E6V B;  1DQ8 A;  3GSD A;  1SPB P;  1P9Y A;  1UZH A;  2CVE A;  3IR7 B;  4LRA A;  4MFB B;  4WPA A;  5BR8 F;  3BGU A;  4OJ3 A;  3IS9 B;  3N0V A;  2FYX A;  3EJM A;  3SZ2 A;  1YJU A;  4LSL B;  4K4V A;  2DHX A;  2YTC A;  1ZH5 A;  2P9C A;  3GTY X;  2RF2 A;  1UW9 A;  4KPC A;  1CC8 A;  4Y6I A;  3CD7 A;  4RO0 A;  2OI2 A;  2OUG A;  2VKZ G;  3O6Q A;  3FEX B;  2CQD A;  1OIA A;  3QYY A;  4J9V A;  2J9C A;  4CTA B;  3K58 A;  2VIH A;  1YRX A;  4NLG A;  4YR0 A;  1RHM B;  2HNZ B;  3OD2 A;  3PYG A;  4OYX A;  1GH8 A;  3T1A A;  1KTV A;  2DGT A;  1URR A;  5KFU A;  5I42 B;  1F5C A;  2IRX A;  1N34 F;  4I6A A;  5K14 A;  2JOQ A;  3RU0 A;  4JI6 F;  3MOZ A;  2QA4 G;  1WC1 A;  4KQZ A;  2HVD A;  5KFD A;  4C48 A;  2VQF J;  2W24 A;  2DGO A;  5C25 B;  4K4T A;  2JZ5 A;  3KDO A;  5L38 A;  1PAU B;  2DNP A;  3C19 A;  3I31 A;  2ZM6 J;  3CB4 A;  3PTW A;  1XN9 A;  4IDK A;  2XCA A;  5J2M A;  4OZ0 A;  3MI7 X;  4FKX A;  5CYM B;  4CNZ A;  4DV0 F;  1SC3 B;  4CDI A;  1WG5 A;  1FF2 A;  1EJ7 L;  1GT8 A;  1PIE A;  2ACM A;  2WSE C;  3FZ2 A;  2DNO A;  3JSB A;  3G4S S;  5L1K A;  2GS8 A;  1XNR F;  2BAB A;  4JV5 F;  2MQO A;  1EX8 A;  2KVI A;  1SI9 A;  3B8H A;  4CO5 A;  4PG5 A;  2MKI A;  4I64 A;  1Q16 B;  2XMW A;  4ED6 A;  2CJK A;  3MOJ B;  1QY7 A;  4HTI A;  4WF9 Q;  3FMB A;  3PM9 A;  2MHE A;  2XUL A;  2AT1 B;  3AH6 A;  3BYP A;  5B0C A;  5CD4 A;  3MR3 A;  2JFD A;  1REG X;  5SUH A;  1RT6 A;  3J7Z 5;  3TRG A;  4KR0 B;  3VQT A;  1D9D A;  4XK8 C;  3AXM A;  2HSE B;  3M8P A;  1BD6 A;  3KUH A;  1C1C A;  3NAI A;  1Y4Z B;  4TNO A;  3V2U C;  1QAJ A;  5D0R A;  4OZ5 A;  5IT0 A;  3OL9 A;  2MKJ A;  2J7K A;  1OWX A;  1TMJ A;  1U0S A;  3T41 A;  2RU9 A;  3UNY A;  3MMB A;  3ZTS A;  4B08 A;  1DFD A;  3MF5 A;  1XER A;  4PG4 A;  4K8R A;  2APO A;  1NCL A;  4Q5V A;  1LW0 A;  2H5E A;  2KL8 A;  2VG5 B;  3KDN A;  4U9R A;  2R8J A;  3OVB A;  2HBY B;  1SUQ A;  2WOM A;  4X65 J;  2XB2 D;  2FJD B;  3ZZR A;  2CQC A;  2QRR A;  2B3T B;  4CO3 A;  2OTL S;  5IT9 Y;  1HBO B;  1UEK A;  4I56 A;  3GZ7 A;  3IAS 9;  1XR6 A;  2V4J B;  4OZ1 A;  5LMU F;  1C0T B;  1R27 B;  3DLJ A;  3FVY A;  4L3K A;  3DI6 B;  1T9W A;  4X62 J;  1NEE A;  4X4Q A;  5HL7 Q;  1N36 F;  2XSJ B;  3SXL A;  1NXI A;  2RML A;  2KG1 A;  2VJV A;  4JI7 F;  3K0J A;  1NSK L;  2NXN A;  3SBM A;  3MAA A;  1S97 A;  4AQY F;  2OFG X;  2JC1 A;  2ZHO A;  4YS2 A;  4IYQ A;  3KJN B;  3K5M A;  4F4Z A;  1RT1 A;  2IAJ B;  3MM7 A;  3NAH A;  2DR6 A;  5ETO A;  1J5E J;  3NS7 B;  4EU0 A;  3ZZ0 A;  3GQC A;  4J9K A;  2CUY A;  4NLW A;  3A3P B;  1XR5 A;  3H0P A;  3FZB A;  3Q8V A;  3W62 A;  4EO8 A;  2VQE J;  4WFN Q;  4YR3 A;  2DGQ A;  1X7V A;  2DNK A;  1UMJ A;  4LIR A;  2JLE A;  2HNY A;  8ATC B;  3J7Z T;  1DUR A;  3MHY A;  4M1K A;  4B9M A;  4LFC J;  3GPA A;  3OPK A;  2QLJ B;  1U0H A;  1CJT B;  3EIC A;  5F41 A;  4HKQ A;  3QIP A;  4AD6 A;  1SJR A;  2ZHB A;  3UVJ A;  4RW4 B;  1FHT A;  4NLR A;  2EC2 A;  1ZAW A;  2B8Q A;  2GGP B;  2WB4 A;  2VFU A;  3HVW A;  2OEL A;  1UA1 A;  1UWA A;  2LMI A;  3B4M A;  3DDN A;  1XWL A;  2D3Z A;  3DOM A;  4DDF A;  3RRH A;  2AGO A;  2Y0S D;  4WU2 A;  3RAM A;  4ZMM A;  4H4K C;  1EB0 A;  4QIF A;  5I3P A;  3Q8S B;  2FJW A;  2ZVS A;  4GO7 X;  1FDB A;  3MPD A;  2IJF A;  1FRJ A;  1GMV A;  3FMW A;  4J7C A;  3J81 U;  2BJ3 A;  4MK9 A;  4K59 A;  3RAQ A;  3NMA A;  2HZV A;  2F65 A;  3L9Z A;  5E2Q A;  1JXE A;  2V50 A;  1D9A A;  3QAU A;  2HHU A;  3DXB A;  2M70 A;  1WOS A;  3MMJ A;  5A2Q U;  1OO0 B;  1RHK B;  3ILJ A;  1N52 B;  3CDW A;  4TU9 A;  2MY8 A;  2P9E A;  4OFZ A;  3J7Y I;  2YWG A;  4I2P A;  2I0X A;  3FBF A;  2J7U A;  7FDR A;  5KFB A;  4ES2 A;  4IH7 A;  4I68 A;  1HI0 P;  4WTO B;  4DUZ J;  1WTF A;  2NR0 A;  3MWB A;  3WDO A;  2Y8W A;  2Y9H A;  3CCU S;  1KLN A;  4GKJ J;  2MZJ A;  3ZZU A;  3VAG A;  5DQI A;  3A4T A;  3R6L B;  5EHH A;  3T1H J;  3GIR A;  1Z1Z A;  2OPQ A;  2EFV A;  4CO4 A;  4F0K A;  4J9R A;  1N6Q B;  1KN6 A;  4TYA A;  1ROF A;  2EKN A;  5M2U A;  5F9N A;  2MGZ A;  3LGM A;  1J27 A;  1QE1 A;  2JEG A;  2J9D A;  3G96 A;  1HI8 A;  4OX9 F;  2IRY A;  2KT5 A;  4NRT A;  3H7H B;  4AND A;  3GJQ B;  1SH0 A;  2AQ4 A;  2NSB A;  1ITP A;  3VTI A;  4RW7 B;  1JLC A;  1GAO A;  1VS3 A;  3SSS A;  2XY5 A;  4DQP A;  5IQQ A;  4CLZ A;  4B3O A;  4C11 B;  4F02 A;  3I96 A;  3KJQ B;  5DQH A;  2XMT A;  2XY7 A;  1QSY A;  2BE7 D;  2DGW A;  4WFX A;  4MJK A;  4CLF A;  5AE3 A;  3I0S A;  3MM9 A;  1HQE A;  2OAU A;  1GX5 A;  4KFB A;  4RW9 B;  4EUV A;  2M9K A;  1B0T A;  3I6P A;  2GJI A;  3AJ1 A;  2WCX A;  4USH A;  3P4U B;  3FUY A;  5ETR A;  1KQG B;  2UV8 A;  5B0B A;  1K47 A;  1FJG F;  1XQI A;  2LFV A;  4PUO B;  3LPY A;  4JI2 F;  3KLF B;  1ZOT A;  3DXS X;  3IWL A;  3KXD A;  4O23 A;  3UI3 A;  4Y3C A;  4QWB A;  3BGR A;  3POT A;  2R7W A;  4WZQ A;  4DL5 A;  4G3I A;  4C8L A;  1TFW A;  5LMU J;  1LK5 A;  4NE9 C;  4X84 A;  3Q8Q B;  3CJR A;  3D54 A;  2L08 A;  2ZH7 A;  4J9L A;  4PPD A;  3TAN A;  3NOC A;  7AT1 B;  4OQJ A;  5KT3 A;  4DR3 F;  3FGV A;  3L3C A;  1ZA2 B;  3K5L A;  3BZQ A;  1I51 B;  3CWJ A;  2XS2 A;  1WC4 A;  1FD2 A;  2CYY A;  1H2U X;  2OPR A;  3RR7 A;  4LMZ A;  2BJE A;  1Q82 T;  5J1N A;  2VPY B;  3MR6 A;  4HT5 A;  4DSJ A;  2W01 A;  4ZLN A;  4QIW D;  5GVQ A;  1RAF B;  1JLG B;  1AUD A;  4UZB A;  1AA1 B;  1FVS A;  1JLF A;  2HQG A;  3BM7 A;  3LP1 B;  3OR1 A;  1CJU A;  3HVT B;  3ZO7 A;  4DR1 J;  3EPI A;  1Z2L A;  1ZTW A;  4M5K A;  3KUG A;  4C0B A;  1QSS A;  2J8S A;  1P8G A;  2QIF A;  1IWG A;  3O1L A;  2EFO A;  4HHU A;  2AJ2 A;  4PPZ A;  2JVO A;  3Q89 A;  3T5H A;  4PYD A;  2A6M A;  4U67 Q;  2CDQ A;  2ZH3 A;  3RB3 A;  2HND B;  1FI4 A;  2OTJ S;  5H9F J;  2XMV A;  1Y7P A;  3LUY A;  2PI4 A;  5F8N A;  3HX9 A;  5L46 A;  2KM8 C;  3O5T B;  1XC9 A;  1KTQ A;  2MJU A;  4DFM A;  1X9M A;  2RRN A;  3UE2 A;  2VQE F;  1UVL A;  3O44 A;  1NKB A;  4B9N A;  5LSR A;  4LSL A;  4GKK F;  1X4B A;  1ZA1 B;  3CJ2 A;  2BEF A;  3DDI A;  3CSK A;  3P96 A;  4JP8 A;  5JUM A;  1EAR A;  3RG6 A;  3M6U A;  1NHK L;  2CQI A;  1YWX A;  4NPO A;  1TKX A;  3HT0 A;  4ID8 A;  2YH1 A;  4USV A;  1JQG A;  1S1T A;  4YB1 P;  4M94 A;  1TUW A;  5LL6 d;  4JI7 J;  3E01 A;  2LVW A;  4DFP A;  5KT2 A;  3BSN A;  4A8K A;  1KC8 T;  2M2B A;  3E3X A;  3IP0 A;  4JV0 A;  2VC1 A;  5HVH A;  2QMW A;  3DLB A;  3BH7 B;  2XO6 A;  3MED B;  1XJW B;  4PG8 A;  3BS9 A;  5C25 A;  3MD1 A;  4M5M A;  4HL9 A;  3DOL B;  4FVC A;  3TNV A;  1NSP A;  1GNK A;  2CKW A;  2HRT A;  5HQ8 A;  3VAF A;  1YJW S;  1XMQ F;  1WG1 A;  2EBE A;  2GHV C;  4IDK B;  4KV8 A;  3DC2 A;  4LVN P;  3HJF A;  3X1L B;  4OMF G;  4DL3 A;  1REV A;  2NRE A;  2LA4 A;  4YDX A;  3FCV A;  1NPK A;  4CLL A;  1H38 A;  4DV3 F;  1VQN S;  3HI9 A;  3M6W A;  4DV1 J;  2WVF A;  2XSF A;  4CO0 A;  5EDW A;  1PO6 A;  1DBD A;  5LT5 A;  1MRO A;  1H98 A;  3TA1 A;  5IT4 A;  3M8R A;  4QWC A;  3TQE A;  2ZH9 A;  1S99 A;  2HLU A;  1P9Q C;  2IVM A;  4DG1 B;  1M5P C;  1FJG J;  1BC6 A;  1RT6 B;  5T14 A;  1QUV A;  1VBK A;  4OI1 A;  3K59 A;  2GV1 A;  2HS0 A;  1XEZ A;  1MSW D;  3GFZ A;  3DRR B;  1HBU A;  3EDQ B;  4LR8 A;  4BC7 A;  4DCJ B;  1FE4 A;  3V6D B;  2OP5 A;  4JI5 F;  1H7W A;  2DIS A;  1A6L A;  3CGI A;  5ETK A;  4F2R A;  2ZKU A;  1SJ1 A;  4W92 B;  4L74 A;  2KM8 B;  2E1A A;  1LW0 B;  1YLX A;  2VG5 A;  2AWZ A;  3OXF A;  3CME S;  4OYW A;  4DU7 A;  3CD6 S;  2KYZ A;  4OJ1 A;  1TAQ A;  2YWE A;  3PJ9 A;  1X4E A;  2VQF F;  1RHR B;  1Q5Y A;  3W63 A;  3MZI A;  3DI6 A;  3ZTQ A;  3T5J A;  3PEH A;  4K5S A;  5M2R A;  1S57 A;  4IFY B;  1I94 F;  5J2N A;  2XSJ A;  3CJ0 A;  4MIW A;  4TXS A;  2GC8 A;  5EX0 A;  3PY8 A;  1IR1 A;  1ULR A;  2QFI A;  2RRB A;  3NMR A;  2UXB J;  5IWA J;  1H0H B;  1ZPW X;  3HP6 A;  4U95 A;  3MM5 B;  2YKQ A;  3GWC A;  4PQU A;  1HI1 A;  1S6O A;  2V2K A;  2P6T A;  3KK3 B;  1RT5 B;  2G4B A;  5DRK A;  1RLD A;  3B54 A;  1B3T A;  2GVZ B;  2AEJ A;  4ZPA A;  1SJ3 P;  1KLM A;  1CS4 A;  1RQ0 A;  2W1B A;  4JI1 J;  1IKY A;  4BWM A;  3UDE A;  5KFS A;  4DQR A;  4O4R A;  4JI8 F;  2HHS A;  3PHE A;  2FHK A;  1RAG B;  1HBM B;  2AX1 A;  2DNM A;  1X5P A;  2EK6 A;  1NDK A;  2K3I A;  2MPU A;  4ES1 A;  4JB8 B;  3M2R A;  3LP0 B;  2HHP A;  3FQK A;  5KG7 A;  4Y2K A;  4MIA A;  3IRX B;  4NLQ A;  1R0C B;  4Y2M A;  2YQ3 A;  2DPI A;  4DR1 F;  1RT7 B;  1RCO B;  1HW9 A;  1T02 A;  4AYB D;  4CT9 A;  4ECR A;  2EG2 A;  4CP5 A;  5DQG A;  2XTJ P;  1U8S A;  2HHV A;  2UVV A;  4ITS A;  2KXH A;  2MYF A;  4F3M A;  3CDE A;  3ETM A;  3T1H F;  4C97 A;  1VQ4 S;  2R8K A;  1IBC B;  1OQ6 A;  3KLE A;  3OQ2 A;  3CCQ S;  3PYE A;  1PSD A;  1F1B B;  2HWT A;  2B5J A;  3JTO A;  5EUH A;  4ZVT B;  2IA6 A;  3KJV A;  3WZ0 A;  4IG3 A;  2Q1L A;  3JSM B;  2WK4 A;  3E8O A;  1FRH A;  3DU5 A;  3NCR A;  5A0Y A;  3WX4 A;  1SH3 A;  4QW8 A;  4ANC A;  3NGU A;  3D66 A;  1X4D A;  2W25 A;  4USJ C;  4HT7 A;  3NGT A;  3U1L A;  1PCA A;  2DXD A;  3AXK A;  2MKS A;  2Z30 B;  2J0Q D;  4ED4 A;  3DNC A;  4I2P B;  2Q3P A;  3CDA A;  4C2M A;  4LBI A;  4O3O A;  4XAK A;  2MY7 A;  4QYZ K;  1NAQ A;  2RT3 A;  1JLA B;  1KQF B;  3IO1 A;  3H5U A;  2UU9 J;  4TLR A;  1NPR A;  1M5H A;  5KFC A;  3OW2 R;  5HN0 A;  2Q66 A;  3QRP A;  3W2V A;  4UT4 A;  1TZ0 A;  1UJ5 A;  1ZPV A;  1S6U A;  1B0V A;  3BGF A;  2WTF A;  4B9S A;  2W9C B;  4NA2 A;  1FA0 A;  4ED7 A;  2QE5 A;  3JTN A;  4ID5 B;  4O3N A;  4KB7 A;  1JX4 A;  5I3Q A;  2VOO A;  1RTH A;  3DGP A;  3M30 B;  4DR5 J;  2ZOF A;  3CD5 A;  4XTT A;  4LF9 F;  1NDP A;  4DL6 A;  2CQ3 A;  1XBW A;  3W9H A;  3ZZT A;  1QE1 B;  2ZDP A;  1VQ7 S;  2Z57 B;  3VVU A;  2XG8 A;  4K4W A;  4F4W A;  4Y28 C;  2E1C A;  4OZJ A;  1MMD A;  4UZC A;  2OMO A;  2DK2 A;  3NBP A;  1NKC A;  2LXI A;  1JLC B;  3TJ9 A;  3W3S A;  1FKP A;  4B3O B;  1H3D A;  2W7A A;  2CA9 A;  1DAR A;  2IA0 A;  4DU8 A;  2WVC A;  1M1H A;  2R2T A;  1RI7 A;  3TAM A;  3DLG A;  3RR8 A;  5DDR C;  4YP3 A;  3I0S B;  3OBI A;  5LMN J;  2ZFH A;  1YTY A;  3RYL A;  2WZ1 A;  4IRD A;  3G9C A;  1LWF A;  3BGO P;  3BPS P;  1H72 C;  3LAM A;  4IG0 B;  5DGA A;  5LOQ A;  4IOA Q;  5AXK A;  2JJ4 D;  3BQ2 A;  5KOX A;  4KGX B;  1IJE B;  3IBW A;  2JVR A;  1X4C A;  1TKT B;  4QWE A;  3CO0 P;  1HNV A;  2YX1 A;  3MGJ A;  3B4D A;  4E98 A;  4ZS6 A;  2XMU A;  4URG A;  1UET A;  4OJH A;  4HH0 A;  4DS4 A;  4IUF A;  4Q8E A;  3OLA A;  3D0G E;  1RTD B;  2ZH2 A;  1X4G A;  2H9Z A;  1EET A;  1Q4R A;  1V9O A;  2YBV A;  1RTI A;  2K2P A;  3AB2 B;  2CPH A;  3MDF A;  2IVF B;  2LEA A;  1F6T A;  2HQI A;  2J9E A;  3GR0 A;  3PNI A;  3UN3 A;  1MW7 A;  3VVT A;  2FLN A;  2X3G A;  1VQK S;  5F8J A;  1N5Y B;  4RBT A;  5FLX U;  2AJ1 A;  1R8H A;  3IN5 A;  3CIZ A;  4Z37 A;  3C15 A;  4WTY A;  4FBT A;  4RNM A;  3Q22 A;  3CJ4 A;  5L8R C;  2XNR A;  1M5O C;  3QJJ A;  4ZPD A;  2QMU B;  2Z2Y B;  2DO0 A;  2RQK A;  3IG1 B;  2FLP A;  2CNO B;  1ZM9 A;  3R2C J;  1S5Z A;  4A47 A;  4ZJO A;  2F4F A;  3SV3 A;  3D1H A;  4DEZ A;  2BE9 B;  2E5H A;  3DFE A;  3G8T A;  5CCL A;  1SL0 A;  4EFA C;  2X1F A;  5E3Q A;  1FNO A;  2PEB A;  1LEO A;  3GLJ A;  4JI3 J;  4NLV A;  3R9L A;  3ICL A;  3HO1 A;  3MR2 A;  3HZE A;  3PRD A;  4I0W A;  4NLY A;  5D4P A;  5MLC V;  1D1U A;  2I5J A;  5G4D A;  1N0V C;  2QLB B;  1H73 A;  1IN0 A;  4WCE Q;  3QAT A;  6FDR A;  4ILR A;  4M5G A;  2CRL A;  1EP4 B;  1Q7L B;  3LO3 A;  3UFC X;  4QIE A;  2A1B A;  2W2O P;  3KMQ A;  3MMA B;  1IXK A;  3DM2 A;  2BAC A;  1MWY A;  1TMM A;  2ZD1 A;  3D6M B;  4AQY J;  3G82 A;  1MU2 B;  3M32 B;  2Z0G A;  5KFJ A;  4V19 X;  4EGL A;  5MAO A;  3JSR A;  4P73 A;  1M5K C;  2ALY B;  1U26 A;  2Q79 A;  1RT4 B;  3OTC A;  1VDH A;  2ADC A;  2VF3 A;  2IY5 B;  3H59 A;  1KVJ A;  2IHR 1;  1T03 B;  2P8I A;  1TKX B;  1UTA A;  2LQ8 A;  3VV2 B;  1WEX A;  4FBU A;  2VBZ A;  1MMN A;  3PHT A;  4OHY A;  1D3W A;  2B6A B;  3LA0 A;  5I3U A;  4WJB A;  1OPI A;  1S6Q A;  2AW0 A;  2M7S A;  4Q45 A;  5B7W A;  4JBC A;  1KRP A;  3OFF A;  5BR8 J;  2HVZ A;  3CDB A;  2X3D A;  1OY6 A;  1WUU A;  5E3C A;  4I4B A;  2ASJ A;  4LVO P;  2RQC A;  4NLD A;  3MED A;  3C3L A;  4L72 B;  4WFZ A;  5KFW A;  3BSA A;  3EDR B;  2CG8 A;  2KT3 A;  1T3N A;  2HFO A;  2WBM A;  2YQ0 A;  2FJE B;  1JIH A;  3QWP A;  1VIS A;  3QZ8 A;  1QAI A;  4W90 B;  4WKR A;  3HSZ A;  4DV0 J;  2QL5 B;  1N32 J;  3M9O B;  1YJR A;  2JH3 A;  1O0P A;  1VQS A;  4U96 A;  5K8M A;  4G1I A;  1JLQ A;  1TVR A;  5GMK a;  4Q0B A;  1DQ9 A;  4LSZ B;  2HBZ B;  5KFK A;  1FJ7 A;  1XMO F;  1F9F A;  4P72 A;  1SQG A;  2PD1 A;  1RWW B;  1MNE A;  3BF4 A;  2DJW A;  1EHW A;  2HIY A;  3HSJ A;  3I4H X;  3R7S B;  4ES3 A;  1X4F A;  1ZM3 A;  2EVZ A;  4DG1 A;  2HMI A;  3RBX A;  3FCH A;  3HFZ B;  4J9U E;  3ILO A;  2H65 B;  2C1E B;  3LP2 A;  3ZNU A;  4OHZ A;  2AYG A;  3CC7 S;  2N7C A;  1G2E A;  2DHG A;  2W9B A;  2DNH A;  2FC9 A;  3R97 A;  4F7V A;  3V6D A;  2RS8 A;  3ITH A;  2WON A;  5H1S V;  3QGP A;  1T94 A;  3OR2 A;  4IFV A;  2B9E A;  2BZ2 A;  2EW9 A;  2MQP A;  3MUV P;  3PW5 A;  2CPJ A;  1F2H A;  3M6V A;  3EYZ A;  4NCA A;  4B17 A;  3MPV A;  2AF6 A;  2E5L J;  3TZX A;  3CIM A;  5KT6 A;  2VA2 A;  3FFI A;  4GVL A;  4YDD B;  2W7O A;  3W8P A;  2KT2 A;  4DHV A;  3R1H A;  6FD1 A;  1L3T A;  3IWN C;  5M2P A;  1PJ6 A;  2DBB A;  1FXR A;  2D1C A;  3HDS A;  3OSP A;  2V0N A;  1X5O A;  2EC0 A;  2KRB A;  1WKL A;  1YJT A;  3D6H B;  3DYA B;  1B99 A;  1SL1 A;  3JQM A;  1FCA A;  4ECQ A;  5ETM A;  4NXM F;  2CNN B;  3QWU A;  4YHH J;  1EQ0 A;  4JV5 J;  4TU8 A;  2AYB A;  1HHQ A;  2HNZ A;  2C3U A;  1F2G A;  2K3K A;  4OIX A;  2PFD A;  4H4O B;  4Y2I A;  5LM7 E;  3AOA A;  5FDL A;  5IM0 A;  4LF2 A;  4F3O A;  4K0K J;  2HQF A;  2KFY A;  2UUW A;  3T9N A;  3EGN A;  2D9P A;  2GVZ A;  3R5G A;  2KTQ A;  1KLM B;  2E1R A;  4ZHR B;  2XHC A;  1BLU A;  1G4C A;  2E7V A;  4CO2 A;  4DV7 J;  4NLT A;  2BDP A;  3I5A A;  3ZNJ 1;  4DQS A;  1SVD A;  2YNG B;  2IJN A;  2HK2 A;  2XMK A;  2Z4P A;  5CZX A;  5KFG A;  2PA3 A;  4J9P A;  1DTT A;  1B4S A;  3ONQ A;  2B51 A;  3AJD A;  4F67 A;  3I9V 9;  2JNJ A;  3G6Y A;  2VOD A;  4QZV B;  4O0N A;  1YRU A;  4TKT A;  2AJQ A;  5RUB A;  4ECY A;  3S01 A;  1ZET A;  1WNE A;  2VON A;  2VPZ B;  3FSI A;  2I8E A;  2F4V J;  3SQO P;  4ENO A;  2Y1R I;  1FWP A;  2BRK A;  3OTD A;  3TAR A;  3DRS A;  2BA9 A;  3ILI A;  4G1P A;  2DGV A;  5GAE U;  3ZZY A;  2ZBR A;  3AJ2 A;  4XO0 A;  2FUG 9;  4OZ2 A;  5HAO A;  4RPF A;  4DL7 A;  3TYT A;  2XBP A;  3CC2 S;  1U25 A;  2VBX A;  4OX7 A;  1H6K X;  5KFV A;  4ELV A;  5B0E A;  4DX8 H;  5CCM A;  1C1C B;  4RNH A;  3CVK A;  4X4S A;  1S1X B;  2ZUA A;  4R8U A;  3V4I B;  1IBL F;  5K20 B;  2PE8 A;  1PBU A;  5K5M A;  1HWU A;  4MFB A;  4DX6 A;  3G71 S;  2FVR A;  1IQT A;  1OPZ A;  3I56 S;  4UF4 A;  3RB4 A;  2E5J A;  5T7L A;  2B56 A;  4ZPT R;  4ZJL A;  4AFF A;  2DHH A;  3CED A;  5AXN A;  2F40 A;  4K4U A;  1HBO A;  3QBC A;  3VGV A;  3ELH A;  4I6W A;  2Y1J A;  1TR0 A;  2BKN A;  1KQK A;  1KS2 A;  3PJW A;  2RF2 B;  2VD3 A;  2V8V A;  2X7I A;  4A8O A;  3P5B P;  3VWS A;  3M1V A;  3CCL S;  3CDU A;  2ZZN A;  2AIR B;  3A13 A;  3F56 A;  2XQC A;  1WHY A;  1VRQ C;  3QO9 B;  4F26 A;  4J9O A;  1TK8 A;  4OYI A;  3QJP A;  3O2I A;  3SEO A;  1X4A A;  1YZ7 A;  1N32 F;  2AJ4 A;  4Y65 A;  1X5T A;  1BE4 A;  2J0X A;  1MWQ A;  4ILL A;  3G2X A;  1FER A;  2B4O A;  3WBZ A;  5KT7 A;  2MDA A;  4Q7A A;  2PA8 D;  4YB6 A;  1A0O B;  1RHQ B;  1VRU A;  3TZZ A;  3BRE A;  4DZD A;  1N33 F;  2FTR A;  2NXU A;  4CO1 A;  4ZIV A;  3KTQ A;  2HRU A;  3NCQ A;  3G87 A;  3MEK A;  3NWR A;  1FVQ A;  3N5B A;  3GON A;  2IJR A;  2KI2 A;  3U7J A;  5AE1 A;  4X65 F;  3VAL A;  2DNQ A;  2OJ3 A;  1WHV A;  4CCH A;  2FHJ D;  1R0A A;  5DS7 A;  1C1B A;  3KHR A;  3FBE A;  1YBU A;  2V2Q A;  3UVJ B;  5GAG I;  4RW4 A;  5A6W A;  2KJV A;  3EZU A;  2KO1 A;  1N33 J;  2P9G A;  2CAD A;  1S0O A;  3NEK A;  3NOG A;  5D77 A;  2JEF A;  2CQ4 A;  4JOU A;  4B9T A;  1R8B A;  2HAF A;  1NH7 A;  2RVJ A;  2D9O A;  4CLY A;  4YN3 B;  4C98 A;  1TQL A;  2MMY A;  2RRA A;  5KG1 A;  4ERD A;  2PO4 A;  3FSX A;  4LF7 F;  2BE2 A;  1HYS A;  2F63 A;  4O44 B;  2CJ9 A;  1DTQ A;  1YSJ A;  3A8E A;  5HMX A;  1OSC A;  2QC3 A;  2HVI A;  1S12 A;  4DV5 J;  1YRT A;  1BQN A;  2B8P A;  3K2Y A;  4USU A;  3VF0 B;  4DSK A;  2SXL A;  1TL7 A;  3TI0 A;  3CJK A;  2DVI A;  3BJY A;  1C2P A;  4QCL A;  2HRY A;  2MZT A;  4USM A;  2AZ1 A;  2VG6 A;  1SUQ B;  2R8H A;  1S76 D;  1VQY A;  1WF1 A;  4Y00 A;  3HT3 A;  1Q78 A;  2M3D A;  4UW2 A;  1T7P A;  4JI0 J;  3MCO A;  1CJV B;  1AFI A;  1QUP A;  1PG5 B;  2YNH B;  4DCO B;  5DET A;  2AGQ A;  1XNQ J;  3MUM P;  4C3M A;  2ZNZ A;  4CM2 A;  4ZPB A;  1RIS A;  1FRX A;  1PJ7 A;  1NK9 A;  2XWX A;  3AD8 C;  5HMW A;  2XNQ A;  2OPQ B;  2XEX A;  1SL2 A;  4I1T A;  3MUT P;  1Q8L A;  2H5J B;  3KHH A;  2AU0 A;  2C28 A;  1S1W B;  4RUC A;  3EMT A;  3SFU A;  4H4M A;  3U1M A;  4LQ3 A;  5IC4 B;  1UAW A;  1B70 B;  2K8G A;  3GYX B;  2G0I A;  3MMC A;  3H42 A;  4GO5 X;  5K9F A;  2ZVI A;  4E8U A;  3HVR A;  2PT0 A;  3GB0 A;  1HQU B;  1BUX A;  2CQ0 A;  1GTE A;  2I9S A;  2CXE A;  3FNN A;  3HKW A;  3CJQ A;  4NA3 A;  4WYL A;  3JYT B;  2G2O A;  2LP4 A;  4DR4 F;  1MU2 A;  1AFJ A;  4N8O A;  4NYZ A;  3I5C A;  1U2F A;  2K7J A;  2L9N A;  3TO8 A;  4NEZ A;  2OLW A;  2CQB A;  4NMX A;  1G7C B;  3KLG B;  2C22 A;  1NK5 A;  4NYO A;  3TVK A;  1RXO B;  3I4P A;  1GXU A;  2DTJ A;  5HMZ A;  1VQ8 S;  2J6U A;  3C16 A;  1WWH A;  1Y3K A;  2HQD A;  1JB0 C;  2VG7 B;  1S6Q B;  3M6X A;  2FHO B;  4RWX A;  4LQ9 A;  4XDD A;  4AT1 B;  4ED8 A;  4P2F A;  1A7G E;  2DXF A;  2C3M A;  2MEW A;  2RJZ A;  4WYW A;  2G2Z A;  4RBU A;  3PZP A;  3MD3 A;  3BDP A;  3LAN A;  4KGV B;  4PUO A;  2BKP A;  4MYT A;  3FSY A;  3E51 A;  4U7U D;  5K8N A;  3EPG A;  1VOM A;  4A8Y A;  2ZH1 A;  3BBC A;  1YI2 S;  3LH2 S;  3CE8 A;  2WAQ D;  3W66 A;  4DJB A;  4ED0 A;  2HK3 A;  4KY3 A;  1MN7 A;  2MST A;  4KPY A;  4U6P A;  4YY3 J;  2O01 C;  1KON A;  1SKU B;  3M2U A;  4C6A A;  3NCP A;  1FDN A;  4YB7 A;  3DRP A;  5LXR A;  1GTH A;  2C2R A;  4Q0B B;  3VCD A;  2A0F B;  1SKS A;  1KNZ A;  3CMA S;  3VGU A;  5HMY A;  1VQP S;  2ADB A;  1X9S A;  1GQE A;  2EK1 A;  3FCW A;  3G8S A;  1ZBT A;  3OFG A;  1NH8 A;  4A8F A;  2DCU B;  2R9L A;  5LSO A;  4DQQ A;  1S77 D;  3RW6 A;  2VB6 A;  5E5N A;  3ET6 B;  4DS5 A;  3S8S A;  2OD4 A;  3DU6 A;  5J2Q B;  1FX2 A;  2BW7 A;  2WW8 A;  3P5T L;  2HZC A;  3NG8 A;  1V5I B;  4G6V B;  4RNO A;  1ZAV A;  2I38 A;  2BAN A;  3ZTO A;  3I9Z A;  3ENQ A;  4I2Q B;  3HZG A;  2IIH A;  5F9L A;  4N5S A;  1VC0 A;  2HVH A;  4LRF A;  2J9D E;  1HR0 J;  4O4G B;  4PWU A;  2UUC F;  3AD7 C;  1YKW A;  4ZPC A;  3TW0 A;  2EFP A;  2HG4 A;  4ED5 A;  2QT7 A;  2YPZ A;  4ICL B;  1VMB A;  3Q8U A;  1ZZN A;  2ERR A;  1GEH A;  1K1S A;  2EWH A;  3W64 A;  1W25 A;  1UKU A;  1BWV A;  2Q6C A;  3TA2 A;  1NBE B;  2E1M C;  4J9N A;  2GIF A;  4TN2 A;  3OL8 A;  1YDL A;  2VBW A;  5KG0 A;  5J2P B;  1T05 B;  4FF3 A;  4LUB A;  5K8P A;  2BVZ A;  1PKU A;  2GO8 A;  2NUH A;  1XTZ A;  3PRB A;  1UVI A;  1RP5 A;  1T9V A;  4KFB B;  4EI2 A;  2R2S A;  4P75 A;  1CBK A;  5E3P A;  4EK2 A;  1S1T B;  2NXJ A;  3C6U A;  2EI5 A;  5J1E A;  2KYX A;  1CUL A;  3HD1 A;  1UVK A;  2IYI A;  2UXD F;  3QSI A;  4HI2 A;  5IM0 B;  3LW5 C;  5HRO B;  3OTO J;  4KRW A;  2Y3Y A;  3KLF A;  3GP9 A;  4ZA1 A;  3H98 A;  1RKJ A;  4WZM A;  3IM8 A;  2AYM A;  3Q0A A;  2BXJ A;  5EWF A;  2HFN A;  1FFG B;  2VA3 A;  1RAE B;  1HBN B;  1VIO A;  4KE5 A;  5FD1 A;  2QLW A;  3MM8 B;  2VAS A;  2B9W A;  2QO3 A;  4NLS A;  2YNF B;  4A8M P;  1A9N B;  2VDI A;  2FZK B;  1AW0 A;  2E29 A;  3A12 A;  3D3B J;  3TVZ A;  1YJ9 S;  4LF4 J;  3HK2 A;  2NS1 B;  3F41 A;  3Q8Y A;  4Q44 A;  3CCV S;  4K5R A;  4OI0 A;  2UXB F;  5DG9 A;  4R5P B;  1V6H A;  2JLF A;  2CDR B;  1RLC L;  4ZKA A;  2LXF A;  1S1U B;  3BR8 A;  4DSF A;  1J5O B;  2RDD A;  1U1M A;  1KFS A;  4GC6 A;  5U47 A;  4KHR A;  4LF9 J;  4WII A;  5D0G A;  5ETL A;  4P2M A;  1LXJ A;  2QA1 A;  3AAW B;  3LGH A;  1N5Q A;  2JRS A;  2BJD A;  2ZDO A;  1U8W A;  2Z2Z A;  4HEA 9;  3DRR A;  3EGV A;  2GIR A;  3BQ1 A;  1VQL S;  1FTC A;  3L7O A;  1NO8 A;  4RKU C;  1Z2Z A;  3OJS A;  4NXM J;  4X4N A;  3CMQ A;  1KDN A;  1Y9O A;  3TVY A;  3N5F A;  2MB0 B;  2CPD A;  3H40 A;  1VYA A;  3W61 A;  2HND A;  1TAU A;  2LEC A;  1LNQ A;  1H7X A;  3UQS A;  1S9F A;  2DIV A;  3WHI A;  4DV6 J;  5T7L B;  4YME A;  3IAM 9;  3UN2 A;  3W2W B;  1HWJ A;  1T9X A;  3JS9 A;  1Y5N B;  3L7U A;  4LIW A;  5HVF A;  3AQO A;  1TL1 B;  1U09 A;  1RJJ A;  2FVQ A;  4QQB A;  3ZTR A;  1FRK A;  2W4D A;  2UXC F;  4GRS A;  5J2N B;  1D9F A;  1RA7 A;  2CZ4 A;  2R42 A;  1S79 A;  5HQL A;  4M63 A;  2N82 B;  2YKP A;  4AE5 A;  3HMJ G;  2DNN A;  2LKZ A;  1S10 A;  3A8I A;  1QTN B;  1M1K T;  3IBF B;  3NGR A;  3NXZ A;  3P49 B;  2KZM A;  3UR0 A;  1L3V A;  2YNI A;  1O8B A;  2ZBQ A;  4N8N A;  3RGI A;  2W7P A;  3UD3 P;  1QVG R;  4I67 A;  2CFX A;  1U6B A;  1X60 A;  2LQ9 A;  2FLL A;  2QZ8 A;  1IKY B;  3D1O A;  3IGN A;  5B0A A;  4F4A A;  5A8K A;  4B3S F;  2H51 B;  1S7I A;  2F3J A;  2UUT A;  5KG6 A;  3FDS A;  4NLU A;  1LV5 A;  2D74 B;  3AA8 A;  3M2R B;  3D3C J;  4C8N A;  5CXT A;  4BS2 A;  3LPE A;  2Q43 A;  4DPT A;  9ATC B;  3AB4 B;  3HFV A;  4ED1 A;  2IC3 B;  4LRD A;  1IBL J;  1BWE A;  4YHH F;  2BYC A;  2C3Y A;  1CSJ A;  3W5X A;  4X4O A;  3HLU A;  2ROE A;  1C0U A;  2F8E X;  1G6B A;  3M8Z A;  3NKY A;  4DF8 A;  1R31 A;  2BMB A;  4PXC A;  1IQZ A;  4Y34 A;  5E3A A;  5G0R A;  4ZN1 A;  3OV7 A;  1B64 A;  2CPZ A;  3DOK A;  4A4J A;  3GG0 A;  2GMH A;  1VIX A;  4DV4 F;  1JWW A;  3DRX A;  1PYS B;  2DY1 A;  2VL1 A;  1NHU A;  2QA2 A;  4PKD B;  4C0H A;  5KAK A;  3QSY B;  3AA9 A;  5D78 A;  3S6E A;  2BE2 B;  4IG3 B;  4FYY B;  3D5M A;  1ZAX A;  4R0J A;  3JSM A;  2Y8Y A;  1DTQ B;  1RT2 A;  1KEK A;  3TOQ A;  1VQO S;  1BQM A;  3CCS S;  1BMQ B;  4B9L A;  4HLB A;  2GMJ A;  3CTR A;  3K5O A;  2H48 B;  3LAL A;  5GAD U;  1WJ9 A;  1CG2 A;  5KFO A;  3SFG A;  4A8S A;  5D0H A;  2W2P P;  5ETN A;  2GVD B;  4CH1 A;  2N3L A;  3BN4 A;  2BOA A;  3EXC X;  1EKS A;  1NLK L;  2HGM A;  4CYU B;  3BO2 A;  1F9E B;  3M2V B;  2R7X A;  1V3S A;  1KD1 T;  2BBE A;  2K1R B;  4HYK A;  4ZDN A;  2VKR A;  2YKN A;  2IFX A;  2GNK A;  4IFY A;  3W5Y A;  4DUT A;  2RNE A;  2A2C A;  4LF1 A;  3JAM U;  2KH9 A;  4CLT A;  2JWN A;  3MM6 A;  2J0S D;  2H54 B;  4LT6 A;  2BX6 A;  3SCL E;  1J5E F;  2DR5 A;  1WOP A;  3EE3 A;  1WC3 A;  2ZWP A;  4QU7 A;  5I42 A;  1WKJ A;  2CNK B;  5GME A;  3OXL A;  3IMQ J;  1DLO B;  1S9E A;  1TL5 A;  3J7A N;  4RUH A;  4DWI A;  2GAG C;  2HFV A;  2N4C A;  3AY0 A;  4NZ0 A;  2HFU A;  5D6G A;  2QEX S;  3MEE B;  1N34 J;  4MK8 A;  5BXI A;  3JYT A;  2C2D A;  3KMS A;  3VZI A;  5HQM A;  2G0J A;  1ZM2 A;  2N4D A;  3UO0 A;  8AT1 B;  3IRX A;  3IXQ A;  3UR3 C;  4DX7 A;  5KOW A;  4NI2 B;  2UUA J;  4RW6 A;  5BJR A;  3ENV A;  2AJ0 A;  4RNN A;  3V6H A;  4UY8 5;  3THP A;  4NLP A;  3W9J A;  3K8W A;  4KHP F;  1LWF B;  3BKU A;  1OYE A;  2V4R A;  2CPY A;  2RD5 C;  2NPI A;  4ZK7 M;  3C16 B;  5LSL A;  2V69 A;  1IWA A;  2FQQ B;  1U48 A;  4N41 A;  3TJ8 A;  4FF2 A;  4WP9 A;  1H2V Z;  4DI6 A;  4UQG A;  2M8H A;  3SCK E;  1O6X A;  2LU1 A;  4USW A;  1SC1 B;  3O3L A;  4UOF A;  2YVS A;  3R6G B;  4HH1 A;  4L73 A;  2KJW A;  2QYC A;  3MEG B;  2OHD A;  3H4B A;  3W1Y C;  4B9V A;  3KLV A;  3VQS A;  1LXN A;  2GX8 A;  5A0Y B;  2R2U A;  2V4Q A;  3C2P A;  4P10 A;  4OYM A;  2YY3 A;  3MR7 A;  2UV8 G;  4ZVH A;  4LRE A;  4RW8 B;  5KFE A;  2FHM A;  3W9I A;  2CPI A;  3DLL Q;  4K4S A;  3GMG A;  1YG0 A;  4NCB A;  2ZE2 A;  2Z2M A;  2C42 A;  4L76 A;  2WOM B;  5E41 A;  4HDH A;  4TLQ A;  5A8R A;  2VFR A;  2KXF A;  4IRK A;  2HHW A;  4Q2M A;  2DRD A;  3I55 S;  3LF0 A;  2KN4 A;  3UDV A;  4XIU A;  2YKM A;  4XPC A;  3N6L A;  3UDC A;  2XI2 A;  4JUZ A;  4U7C A;  3V81 B;  1LFW A;  3DHW C;  1IKW A;  1V5V A;  2JX2 A;  4ZVE A;  4ZVP B;  2W9C A;  4K4Y A;  5J2Q A;  4QWA A;  4MIB A;  3U02 A;  4WFY A;  1NK7 A;  3N9U C;  4K0K F;  1X9W A;  3DGP B;  2AZ3 A;  3M30 A;  1ICE B;  5D4O A;  1FDA A;  1T3O A;  2RB7 A;  1FNM A;  4QYR A;  5SZT A;  2MSS A;  1WG4 A;  4JI4 J;  3BDE A;  2MZQ A;  3MM7 B;  3ZZP A;  3GJR B;  4O4G A;  3ZTP A;  3ULH A;  4ER8 A;  2OSR A;  4P52 A;  1S9G A;  2KVQ E;  3D0I E;  1Q8K A;  3NBP B;  1FT8 A;  1FJE B;  3H2L A;  3IR5 B;  1RWO B;  3QAE A;  4RLE A;  4U7U K;  1G3O A;  3DLK A;  3KG4 A;  1FKP B;  3J81 Y;  5DM6 Q;  4DV2 F;  2W2N P;  3M7V A;  2EFN A;  1S4E A;  4MKA A;  3HXM A;  5KFH A;  2Z8Q A;  2ZJP Q;  5HAN A;  1U0H B;  4ANE A;  2M5Y A;  3QIP B;  2CJX B;  1OY8 A;  5KFA A;  3KK2 B;  4PR6 A;  4ALZ A;  4P74 A;  3RB6 A;  3DCA A;  4WK1 A;  3T3F A;  2GGP A;  5B08 A;  4V19 J;  3R1L A;  4OV1 A;  4OV6 A;  3THV A;  4TY8 A;  3DOM B;  2LCW A;  1KVK A;  2VPW B;  2FVC A;  4P2X A;  4F04 B;  1KQS R;  4NOH A;  4R25 A;  5HRO A;  1SJF A;  4EZ9 A;  2VUG A;  2LXU A;  1U2C A;  4FDF A;  3M8S A;  2ZZM A;  4X66 J;  1YJV A;  3IR6 B;  4K4X A;  4C0O C;  1NJZ A;  1NJW A;  1EKR A;  3HHK A;  3TJA A;  5CZV A;  2WB1 D;  3DN9 A;  4ETX A;  1WOR A;  4RNF A;  1UP1 A;  4DSI A;  2VFV A;  3EM1 A;  3EWG A;  4LR7 A;  4LF5 J;  2BW2 A;  4I7F A;  4CQ1 A;  1KVI A;  4MYU A;  1TV6 A;  5L9N A;  3UDL A;  3PEJ A;  1WKK A;  1QAY A;  4M8L A;  1N5Y A;  1HWL A;  1HNX F;  2J76 E;  1XNQ F;  1IKV A;  1FES A;  2H3E B;  4YY3 F;  1NDC A;  3M9M B;  5A8W A;  2VBY A;  1F5B A;  2PGC A;  2H1Y A;  2DHS A;  5T41 A;  3V6J A;  2XLJ A;  1UVN A;  4DMZ A;  3CPW R;  5H9E J;  3N4W A;  3RAX A;  1CPZ A;  4EBC A;  3PW2 A;  1MN9 A;  4M5J A;  4MT1 A;  4DPU A;  2O3D A;  3QFH A;  2GO9 A;  4U8Y A;  4ZIT A;  3OUY A;  2M88 A;  3CCJ S;  1OMS A;  2YWW A;  1KOO A;  2AHO B;  2BJ7 A;  2DEJ A;  2GIQ A;  3BB5 A;  3R5A A;  3D6T B;  4B3M J;  4TY9 A;  4IH5 A;  2OH2 A;  2RKI B;  4KH1 B;  1CEZ A;  5F8H A;  2R7Q A;  1WEY A;  2AJF E;  3IFE A;  1IBM F;  1WEL A;  4DPW A;  4Q2L A;  5HP1 A;  3IRW P;  2WVD A;  2DT9 A;  3PR5 B;  4DR6 F;  3AOB A;  1NND A;  1U1Q A;  3SCJ E;  4PWD B;  2IVY A;  3NWG A;  2HGL A;  1L5U A;  1UEU A;  2OML A;  3PIP Q;  3SIP B;  1FDD A;  3TZW A;  4CRJ A;  4NWB A;  1FXL A;  3BKT A;  3PYF A;  4ED3 A;  4F4K A;  4FZV A;  3P6Y C;  1KHW A;  3RJM B;  1GMW D;  1OS5 A;  3GYG A;  3MPW A;  2NYH A;  1S0N A;  4OI6 A;  4I69 A;  4B3T J;  2HQC A;  3A3N B;  4B3R J;  2GQC A;  3SQG B;  1Q0N A;  3DYA A;  4L6V 3;  1VR6 A;  4F4Y A;  3BV8 A;  3JAM Y;  2HHH J;  3BYR A;  2XWY A;  1GMW A;  4F0H A;  2DB1 A;  4H4O A;  5KFM A;  5K14 B;  2XGP A;  1K73 T;  1TTH B;  4FYX B;  2YNI B;  5C42 A;  3SI8 A;  2P5V A;  1F3F A;  1RBA A;  1F3V A;  1PC5 A;  1S0M A;  4LF8 F;  1L3S A;  3RB0 A;  4QR0 A;  2JEI A;  1UCN A;  1AT1 B;  1EZZ B;  4A46 A;  1HNX J;  2EBG A;  1RWV B;  1SJ4 P;  4ZP7 A;  2JL9 A;  4C9D A;  4JYA J;  2RAQ A;  2BJ1 A;  2HVE A;  2YNG A;  5HAT A;  3AOC A;  3SMZ A;  2ZJQ Q;  3K17 A;  2ZNY A;  3HHL A;  2HHH F;  2RDI A;  3KK1 A;  4EEY A;  1S48 A;  4PG6 A;  4X4R A;  2UVU A;  1RWU A;  3E2E A;  1CLF A;  4DSE A;  4DFJ A;  4LFA F;  2K06 A;  4LSN B;  5IXU A;  3ENA A;  2O66 A;  3D0H E;  3HUL A;  2HWH A;  4OZN A;  4LFB J;  2IDE A;  2M4M A;  1TKZ A;  1R6V A;  3QFW A;  4DPX A;  3KYL A;  2COL A;  5F8G A;  5HSP A;  2QSW A;  1BQX A;  4MK7 A;  3GR1 A;  3DRS B;  4V1A k;  3VAK A;  1DJ0 A;  3UCZ P;  4C8O A;  4QU6 A;  3H4D A;  1ZYQ A;  2FZC B;  3N79 A;  2KHC A;  1JLF B;  2HQ3 A;  2AP6 A;  5E3R A;  3CT9 A;  1R6Y A;  5IOL A;  4ZPV R;  4ZCL A;  1WF0 A;  4CNY A;  2PN6 A;  2PMZ D;  3JB9 k;  1K1Q A;  1RTJ A;  1SIZ A;  3U1N A;  4R8U B;  2C2E A;  1NUE A;  4DCP B;  3PIO Q;  4DV7 F;  1QLN A;  1IKX B;  4J90 A;  4DUZ F;  4Q8F A;  1HMV A;  4F36 A;  2VC0 A;  4IR1 A;  1E6Y B;  1TK5 A;  1RHJ B;  4P6Q A;  1B7F A;  2N3O A;  1BHN A;  3J80 U;  2OGU A;  2FD2 A;  4ZP8 A;  1RYR A;  2Z56 B;  2M52 A;  4IOB A;  5D3G A;  4DPO A;  4K2X A;  3UWT A;  2PFF B;  2V94 A;  4QPT A;  4UOC A;  4HR2 A;  2VPX B;  2K1R A;  4M5H A;  1GX6 A;  4A8X A;  1AZS B;  4FN5 A;  3MR5 A;  1NHV A;  3OHB A;  3CF5 Q;  1D8Y A;  3M1V B;  1YZ6 A;  1U02 A;  2DYA A;  2R7T A;  1T9Y A;  1FTR A;  4ZOS A;  1RU2 A;  1Y10 A;  4A8Q A;  1RWK B;  3MUR P;  3FRY A;  3A8J A;  3MEC A;  5L1I A;  1QVF R;  5FDL B;  4ZVF A;  1HNW F;  3CJ8 A;  5EGY A;  3GFH A;  1SB6 A;  1WSV A;  2LQJ A;  1RZM A;  3FBC A;  4DV6 F;  3VAJ A;  3DRY A;  4WKY A;  3UCU P;  2ATL A;  4ZHR A;  2XYP B;  3MPU B;  2BM0 A;  4ECU A;  3QT8 A;  3K89 A;  3DOL A;  3IA0 A;  4OLO A;  1KKH A;  3BBB A;  4PAA A;  4W98 A;  3TUJ C;  5CA5 A;  5HBM B;  5KFP A;  1OJ4 A;  2UXC J;  4NI2 A;  3N6M A;  1REV B;  1DTT B;  2A3J A;  2E5G A;  4DN0 A;  4KKO A;  1SV5 A;  1VLY A;  3CCZ A;  5HI7 A;  1N36 J;  2DRB A;  2UUB F;  4QWD A;  1FEH A;  3EVW A;  2OFH X;  3N01 A;  1XIQ A;  5E33 A;  3QGI A;  5ETV A;  3K7R A;  4GVB A;  2E7W A;  1YIJ S;  1RAI B;  4M5D A;  3CCE S;  5BYQ A;  2GML A;  2YWF A;  2C2K B;  4IQM A;  2BQR A;  3WIV A;  3MCM A;  4FYV B;  1NM2 A;  4IRC A;  2ASY A;  1RAB B;  2X51 A;  3BBF A;  3SSR A;  2HFS A;  5CAB A;  4RWW A;  3DMJ B;  1U1N A;  3MEG A;  3KHL A;  1VJW A;  3QMQ A;  2BQ3 A;  4OX9 J;  1HYS B;  2FB0 A;  2M8D B;  1S1X A;  4PQA A;  5F8I A;  2CQ1 A;  3OHA A;  1ZM4 A;  3VHQ A;  2X1A A;  1T0T V;  4LFC F;  3I32 A;  2W2Q P;  1FD8 A;  1HHT P;  1VGY A;  1HKA A;  2HS3 A;  1JJ4 A;  4S0M A;  1RWM B;  2LQ5 A;  3CJK B;  3Q23 A;  1T8E A;  4NCG A;  2BOP A;  2LDY A;  1OYD A;  4F3Q A;  3H5Y A;  2HW3 A;  4FVM A;  2VG6 B;  4GC7 A;  3TEG A;  4QR1 A;  4X64 J;  2G13 A;  2OPP A;  2QJ3 A;  2YWH A;  1FFS B;  2VIC A;  5HLF B;  1NB7 A;  2V67 A;  3C14 A;  5IC6 B;  2VFT A;  3PFO A;  1DHM A;  2YKM B;  2YNH A;  5KFI A;  1Q1K A;  1HAR A;  2CQ2 A;  4DR5 F;  4P2S A;  4ECX A;  2G1D A;  1LWE A;  1HW8 A;  2V8P A;  2BKO A;  5B0F A;  3M9N B;  4ZLJ A;  5IZH A;  4NL5 A;  3EGW B;  4KBI A;  1WDT A;  2IYG A;  2HIQ A;  2CVI A;  2MGZ B;  3A8K A;  4ZVS B;  3KK3 A;  3D9B A;  1KR4 A;  4P71 A;  4H4M B;  5KG4 A;  5DG8 A;  2DR8 A;  3MMC B;  3IWX A;  3G6V A;  3HKZ D;  1X0F A;  4OL8 A;  3H90 A;  5DLF A;  2LEP A;  1M1G A;  2HPU A;  4Z2X A;  4DL2 A;  1KHV A;  2IMW P;  4PRF A;  4CI0 B;  5H9F K;  4C11 A;  2QN6 B;  5KFT A;  2XS5 A;  3GIM A;  2RDJ A;  4Y2C A;  4ZVO B;  1SCJ B;  4KYZ A;  1TL4 A;  2FDN A;  2MXY A;  3OL7 A;  1W2B R;  3T1Y J;  2KHD A;  1RAJ A;  2NYI A;  4CZC A;  5KT5 A;  2V8D A;  4WK3 A;  3MXH P;  2X1B A;  4ZLL A;  2DCL A;  2U2F A;  2VG7 A;  2CPX A;  1CJK B;  1YK9 A;  1HD0 A;  3B82 A;  4ED2 A;  4CH7 A;  1F9H A;  1IUJ A;  5GAG U;  2UUC J;  1HPZ A;  3A1Y G;  4KO0 B;  1S72 S;  2B5J B;  2ZC3 A;  4FF1 A;  4CLK A;  2FZG B;  4OJG A;  2XC9 A;  4MH8 A;  5KFX A;  3SV4 A;  3T1Y F;  1JLB B;  1VQ6 S;  4KT0 C;  5HVG A;  3UD5 A;  2X1G A;  1N5S A;  3SCI E;  1BQN B;  2HBR B;  1U2R A;  2R7R A;  3FK4 A;  4QW9 A;  2ZKT A;  3TP2 A;  2R8G A;  3DRP B;  3D7S B;  3NLC A;  4ECV A;  3TEH B;  2UP1 A;  2HLT A;  1FJC A;  1UVJ A;  2R7S A;  4WFA Q;  3D67 A;  1EIY B;  2D3U A;  3DGV A;  1NK6 A;  2GHP A;  2MTL A;  5EWG A;  2DH8 A;  3L7P A;  5ETT A;  3D6F B;  5AXL A;  3OUY B;  1N88 A;  1RAA B;  2DY9 A;  2IM2 A;  1Y5L B;  3MFH A;  2KXN B;  3NNA A;  2B4U A;  2G1H A;  3QLH A;  4JV2 A;  4NXN J;  2KG0 A;  4WU3 A;  3RTV A;  5CYQ B;  2F8M A;  2YXL A;  2EKY A;  1CQM A;  2RIL A;  2PII A;  4I2Q A;  2XLI A;  1S1W A;  4ZP6 A;  2VOP A;  2PI5 A;  1RAO A;  5F0W A;  3EUN A;  4YR2 A;  4WWS A;  3KNA A;  4EZ6 A;  1SBR A;  1RU1 A;  2FJX A;  3DLH A;  3PO4 A;  4ICL A;  4X64 F;  3L09 A;  2Y1I A;  3QRQ A;  4C7Q A;  1QDU B;  5E7O B;  5DZ7 A;  2H4Y B;  4ZJQ A;  1YBT A;  2MZ1 A;  2KFN A;  3OTE A;  5BYR A;  2JSX A;  2FPH X;  2F4V F;  3KG0 A;  1LW2 A;  3QT5 A;  1Q8B A;  2LA6 A;  2L48 A;  2XCP A;  4J91 A;  2ZH6 A;  1JMT A;  1U47 A;  4LF5 F;  3OFH A;  3TAM B;  1U1P A;  1YJ7 A;  2V8H A;  2FY8 A;  2E66 A;  3GCX P;  3D28 A;  3SQG A;  2RS2 A;  3S7R A;  2XI3 A;  4GMK A;  2BR0 A;  1GXT A;  2XS7 A;  1NKE A;  3C8Y A;  1K9M T;  4FPR A;  3EGZ A;  1YGY A;  2FJA B;  3C6U B;  3E01 B;  2WSF C;  3KFW X;  3PX0 A;  2HHQ A;  1RSC A;  4JI0 F;  4O3P A;  3ZZO A;  2UUA F;  1YVF A;  4LBH A;  2ZWO A;  2HHX A;  1SQF A;  2JHE A;  1JKH B;  1MWZ A;  3TAP A;  3CJT A;  3MTK A;  3CCM S;  3SDE B;  3W8G A;  5J1P A;  3HF5 A;  3GV5 B;  2HKE A;  1RTI B;  2F7V A;  3C6T A;  4KO0 A;  4X66 F;  1QJH A;  1WTB A;  4KV8 B;  2P2C B;  5CAA A;  3M2U B;  1B0P A;  2ROG A;  1U49 A;  2RU3 A;  1RWN B;  1FK9 B;  3R8Y A;  3H25 A;  1NK8 A;  1S4F A;  5C24 A;  2AD9 A;  2ASD A;  3HFK A;  2NXC A;  3ENW A;  2I2Y A;  4RJV A;  2OPS A;  1IJF B;  4OX6 A;  5DG7 A;  2MQL A;  2XMJ A;  2Y0B B;  2F1F A;  5DJB A;  5KTQ A;  4JI6 J;  2NQP A;  4FS1 A;  1PBA A;  3KLI A;  2IM3 A;  1F60 B;  1RT3 A;  2DNY A;  4QJV A;  2RHQ B;  4QOT A;  3CUN A;  3C46 A;  4RR5 A;  2NCK L;  1HWK A;  2IM1 A;  3TUZ C;  4AUK A;  4DR2 F;  1HBU B;  4RU9 A;  4B3R F;  3PCO B;  2WVE A;  3RW7 A;  1HHS A; 
#chains in the Genus database with same CATH homology
 1EKS A;  4PYA A;  4FDF A;  2IIH A;  3JQM A;  2EKN A;  3JQJ A;  4PYD A;  1EKR A;  2IDE A;  2OHD A;  3JQK A;  2EEY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...