3JQMA

Binding of 5'-gtp to molybdenum cofactor biosynthesis protein moac from thermus theromophilus hb8
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
147
structure length
147
Chain Sequence
b'GRPRMVDVTEKPETFRTATAEAFVELTEEALSALEKGGVGKGDPLVVAQLAGILAAKKTADLIPLCHPLPLTGVEVRVELLKAEKRVRIEATVKTKAETGVEMEAMTACAVAALTVYDMLKAASKGLVISQVRLLHKAGGKSGEWRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Molybdenum cofactor biosynthesis protein C
publication title Structures of apo and GTP-bound molybdenum cofactor biosynthesis protein MoaC from Thermus thermophilus HB8
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Biosynthetic protein
total genus 36
structure length 147
sequence length 147
chains with identical sequence B, C, D, E, F, G, H, I
ec nomenclature
pdb deposition date 2009-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01967 MoaC MoaC family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.640 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Molybdopterin cofactor biosynthesis C (MoaC) domain 3jqmA00
1EKRA 3JQKA 1EKSA 2IIHA 2OHDA 3JQJA 4FDFA 4PYAA 4PYDA 2IDEA 2EKNA 2EEYA 3JQMA
chains in the Genus database with same CATH superfamily
2MY7A 3M30A 3US5A 2HQIA 2VG7B 1MNEA 2B9EA 4DR3J 4X62J 3P6YC 4DV2J 1URNA 1VYAA 3TVZA 3BM7A 3DM2A 2RDDA 4IQXA 3JSMB 3GQCA 3L7PA 3SFGA 1JLFA 4WXOA 3HFVA 2YWKA 3TUJC 4D3GA 3M8PB 4G65A 5KFOA 3C2PA 1F1BB 2J6UA 1JLAB 2IVYA 3HPOA 3I56S 2JH3A 3SQOP 3JQMA 4Q0BB 4NLQA 4DV1J 3JXOA 3IGVA 3D3BJ 4RNOA 5HK4A 1WTBA 4V19X 2FJBB 5C25A 2YWHA 1UVNA 5A76A 3KLVA 2B43A 3H2VE 4N41A 1KFSA 1P1TA 3MPUB 2VJVA 1I3OB 2K8GA 1FRJA 2XMMA 5F8JA 4Q8FA 1JLQA 2BM0A 1X4EA 4PG4A 4OYZA 3MMBB 3UPFA 3DU5A 4OX9F 1HR0F 4PXDA 1KDNA 4LRDA 4NI2B 4QIFA 5F8LA 3HVRA 4RUHA 3HKZD 3TARA 4C8NA 2ZBCA 2GS8A 4ER8A 3MD1A 3DI6B 5IQQA 2CVEA 3M6UA 1WOOA 2GIRA 5LL6d 3HP6A 2ZVSA 4OYBA 2W8LA 2VHGA 2EFNA 4ZVQB 4DXLA 4IQMA 4DUYJ 1TU0B 4TKTA 2UU9F 1U1RA 5CYMB 2AP6A 3WX4A 4JYAJ 3VALA 2HFVA 3FMWA 1XERA 1H6KX 3NP5A 2W8KA 3G87A 2VQEJ 2MGZB 3MM6A 4O0IA 3BH6B 4YP3A 1CG2A 4ZPWR 4NRUA 1NSPA 4DV7J 4PG5A 1FWLA 1YSJA 2ASLA 2G2YA 5GMDA 3TAQA 3GIKA 1X5OA 3CDAA 3HDSA 2IM1A 2DRDA 3S7RA 4HDGA 5A6PA 2AX0A 1NDKA 3NRBA 3B4DA 1REVB 2V8VA 3I5BA 4F04B 3IFEA 4IH6A 2EFVA 5H1SV 3H20A 3PM9A 5AJ3J 3KJNB 1H0HB 1NHKL 3R8YA 2UUTA 3HSZA 2V4RA 4PQUB 4USWA 2LDIA 3M8QB 3NXZA 1ZOTA 4E98A 2QMWA 3EWGA 3FVYA 4J7CA 4B17A 3FNNA 4KPCA 1JJHA 1Q8BA 2XBPA 2E7XA 3Q8PB 3KLEA 1KQSR 2VPXB 3NGUA 2J7WA 5A0YB 5GADI 1VFJA 3V6DB 1KKHA 5FIIA 1RT5A 3EDQB 5D4LA 3NS7B 7AT1B 3G9CA 1CJKA 2V34A 4Y2CA 4ZN1A 4JI3F 1HNZF 4KGKA 1G2EA 2GNKA 4F0MA 3GU0A 1F9FA 4O4RA 5HSPA 1QLNA 4DL0C 4JI7F 1YBUA 5CCLA 1S1XA 3ZZ0A 3EXYA 3CT9A 1RYRA 1WG1A 4J37A 1SB6A 4YEAA 3NEKA 1QAXA 1S7IA 3CDBA 1UPPA 3W3SA 3QAEA 4QOTA 2YWFA 3D9BA 3T19A 4DUZF 1FHTA 1F5AA 1SL2A 2D69A 1HWUA 4WPAA 1N48A 2UUWA 2OSRA 4BLGA 5HANA 1GTHA 2HNDA 3MEKA 3R5CA 2UUBJ 3CCJS 1UP1A 1ROFA 5FDLB 4EYIB 3SBMA 2UXDJ 3TWZA 3CEDA 5F8NA 2K7KA 4DDFA 2B5JA 4PG7A 1Q81T 4WTOB 2HQGA 2RRBA 1NSKL 2ZH4A 3OLBA 1JNZB 1U02A 3KKFA 2WBRA 4ZPDA 3KUHA 4J9PA 4DX7A 4U8YA 4EUVA 3EUNA 1CVJA 3CB4A 1XWLA 4OJ3A 1DTQB 3HSJA 3FCHA 5HBMA 2IYIA 1VGYA 5KG2A 2GQQA 5L8RC 1ITPA 1R27B 4PPZA 4URQU 1CJUB 3BN7A 2ZM6F 2XQCA 4OLPA 1FXRA 4TLQA 3RYLA 4MH8A 1S59A 3AA8A 2AU0A 3ENWA 3CDWA 3HKWA 4LF9J 2CQDA 4NRTA 3R9LA 1DTTB 1EJ7L 3V4IB 1S77D 1Q7LB 2VV5A 2LYVA 4I6YA 1RYSA 2H51B 1GEHA 2B9WA 4K4TA 4NLVA 1KQGB 4BC7A 1VQSA 3CD6S 3MM7B 2YNIA 3KJQB 1WSVA 2N3LA 4LSLA 3IRWP 2R7XA 4WP3A 1T8EA 8RUCA 1H74A 3MCMA 1VRUB 4FVMA 2R7RA 2VA2A 1LWCA 4N7TA 4IG0B 4OL8A 4RNHA 3CJTA 1U1NA 5HN0A 5CD4A 4I0WA 4EBDA 3NGDA 3CJ5A 3HHNB 1JJ2R 1D0EA 1U7LA 2B9XA 3D2WA 1U1OA 3I0RB 1LXNA 3NS5A 5CXTA 4WYWA 2C2NA 2N4CA 3HVAA 2OH2A 3GV8B 3NS6A 2UVRA 3VHQA 5DGBA 1VBZA 1RUSA 3NNAA 3SDEB 5K8OA 4LQ9A 3RRKA 5H9EJ 2XZDB 4U7UK 1SBRA 3DYAA 3CCSS 4PXBA 4I69A 4DPYA 4Q2MA 1NEEA 4O3SA 2DPIA 3OJUA 4J9RA 2E1PA 2DVIA 2UXCJ 2PGCA 5HMXA 4MKVA 2V2ZA 4JI1J 5DETA 4DPOA 5DS7A 2KJVA 4KO0B 2QFIA 4I7FA 3OR2B 2R7SA 2V63A 3KG1A 1RTDB 1VR6A 3KDOA 4ECRA 4NLPA 3K5MA 1EQ0A 2ZH3A 2IDEA 2V6AA 2WSCC 4RW7B 2ROGA 3FSXA 5FD1A 2V67A 2MDAA 4IYQA 1HQEA 1S9GA 4EYHB 1UCNA 3E01A 2GZOA 1Y5NB 4TY8B 3T5LA 3DRXA 2DO4A 1VC5A 1T02A 4CH1A 2ZWOA 5F3ZA 4ZS6A 2F4VJ 1SUQA 5ADZA 1MN9A 4WFNQ 4P10A 3NAIA 4MYTA 1WELA 3OR1B 4PEOA 4TU7A 3BGRA 4G6VB 2FJVA 3PDNA 1RTZA 3PW4A 1YGYA 3L95X 2VQFJ 4UF4A 2CG8A 2GX8A 1HQ2A 5KT5A 2NPFA 6FD1A 3D6HB 2RDJA 2AD9A 1NZAA 2OPSB 3RB6A 3X3UA 3AD9C 4YB6A 3OD2A 4I6WA 3PJXA 2FB0A 3I31A 2HHXA 1VS3A 1LOUA 4DCJB 3AQPA 2HEKA 2VPWB 1RGVA 4CLPA 4KKOB 2GVDA 5IC6B 2IJRA 4TYBA 2Y9HA 1SIZA 2HNYA 1JLGB 4JI2J 2CQ2A 3CVKA 5KT7A 3MCOA 5M2PA 1N5VA 1E6VB 4OYWA 2YH0A 4ETZA 3NGRA 4JV2A 3DLGA 4OIXA 1EP4A 3CCMS 4C8OA 2WOMA 3BBFA 3BDPA 1SL1A 2XS2A 1FE0A 3HT0A 2R7OA 4YR3A 4ELUA 3D0GE 1GK8A 1S1TA 2X3DA 3U7JA 1LFPA 5F0UA 4H54A 3W2VB 4ZCLA 3HK2A 3G86A 4I2QA 2PEBA 1RISA 5BR8F 5DM6Q 4IR9A 2NSBA 2E9ZA 5IXUA 3CE8A 3KLFB 5J2MA 2UVVA 2HS0A 2RKIB 4A8FA 5IV3A 4LF6F 1CULB 3CCRS 4FYVB 2JC1A 5HO4A 3JQJA 4AQYF 3HSGA 1MWYA 3CMES 4QWAA 3IXQA 4M5MA 3ILOA 3TI0A 5K8PA 4OFZA 1S0MA 4HYKA 4DSKA 4AYBD 1WKKA 3CXCR 1WHVA 2ZDOA 1XC9A 4OZJA 3T5HA 2FJAB 3BYPA 4DV6J 3I55S 1J5OA 2CA9A 2NUUG 3H4DA 2ZJQQ 3QT5A 3JQKA 1APSA 4XK8C 3K89A 1UEVA 2HVZA 1KHVA 2ZNYA 3LANA 1S79A 2Z0GA 1SH2A 1PYTA 2ZKTA 2YTCA 1XMQJ 3A3OB 5B09A 1ULRA 1ZM4A 4QR2A 4A8SA 3FC9A 2CDQA 2G0JA 2HMIA 4MIAA 4X64J 3WBZA 1N5QA 3AAWB 4QYZK 4IFVA 1PYSB 4ZPTR 4K0KJ 5KT2A 2YBVA 3C14B 2KFZA 5DRKA 5E5NA 3B8HA 3GR0A 1ZA2B 4ED2A 1HNVB 4RUAA 2F4FA 4WIIA 3HVTB 3W66A 5J2QB 2HVDA 2DH7A 4LIWA 2R8KA 3MUMP 1DLOB 1X4FA 3CO0P 1JXVA 2P8IA 3GJTB 3Q23A 1T05A 3FEYB 3DRSA 4YR2A 1UA0A 4PWDA 4DS5A 2NXNA 5D4OA 3PRBA 2WRMA 3AFGA 1FD2A 2QO3A 4USVA 4B3RJ 2IVMA 2C3MA 3A8KA 4ANEA 2JLFA 3D1HA 1HQUA 3G6XA 5HROA 1DURA 4YOEA 1N36F 2WSFC 2JFDA 2HSEB 1KC8T 3FCVA 4IOCQ 3BGUA 3GWCA 1TV6B 3AJDA 2DXFA 2CPEA 4G1QA 1VQMS 2XHCA 4QWCA 4NA3A 3CC7S 1RWMB 5K14A 2G9OA 1X5PA 2QG9B 1ACMB 3UDEA 1Y00A 5EWGA 2I0XA 1Y4ZB 1TK8A 3DNCA 2O66A 1NDLA 1VK8A 2A10A 4H4MB 1UVJA 5DQGA 1RT6B 1NM2A 1HBNB 1RLCL 2Z2ZA 3VQTA 1IBKJ 5C24B 3ENAA 1RWXB 1CS4A 1RDRA 3E51A 3M9OB 4ZJQA 2BW7A 1HA1A 2EI5A 2ZE2B 4DR3F 4X62F 4DV2F 3LP0B 5KFXA 5EHHA 2MKIA 2CYYA 1PGZA 3H7HB 2XMJA 3VQSA 2OJ3A 2HYIB 2DH8A 2A1BA 3C46A 2HIYA 2CPYA 4MIBA 4HH1A 2E7WA 4ZP9A 2BE7D 4OI6A 3PKYA 1XQIA 1N56A 4L3NA 5HBMB 4YDXA 1LWXA 1RAAB 4QWBA 2HQ3A 3RB0A 3VAIA 2GMLA 5L38A 3IS9A 1QD1A 2E1RA 2U2FA 3M32A 1JLEA 4P7TA 2LECA 2KXFA 2OO4A 2LLZA 4PR6A 3AOBA 4DFKA 4QWDA 1W7WA 2EBGA 4NE9C 2GGPA 4DSEA 2HHHJ 1OSDA 3GIIA 1HW8A 3IC1A 1Q86T 3P5TL 2R4FA 1TZ0A 4WF9Q 1T0TV 1IQZA 3NBPB 2UVUA 4DPUA 1R43A 2DHXA 3I4PA 5DM7Q 3JAMY 2B8PA 2V8GA 3RR8A 2ZNZA 3ADAC 2ZBIA 3RW7A 1UJ4A 1Y11A 4ZVRB 4RW8B 3BO3A 1RT2B 2VFSA 2XC9A 2F3JA 2PC6A 4JYAF 1M5KC 4I6AA 2W7OA 5LJ3Y 1U8SA 2W9BB 1J27A 3ZC4A 3CD5A 1SKUB 3K57A 2VQEF 1LNQA 1EKRA 1KHWA 4O4GB 1S49A 3P4UB 5KFNA 7FD1A 4NYPA 1L3TA 2V4JB 5T7LB 4DV7F 1IR2A 3G82B 3RAMA 1F60B 4HH0A 1N6QA 2LU2A 3K8VA 3N6NA 2ATLA 3OPKA 2XMKA 2V2VA 5JXSA 2BABA 1V5IB 3MDFA 3W64A 1LK5A 4ANCA 2BE2B 4P74A 3OXLA 1WC1A 2ACYA 1C0TB 3PVXA 2Z57B 3TUZC 4C8LA 4ES2A 2BJ7A 2Y1JA 2NPIA 3PX4A 3MMCA 5LMUJ 2KI2A 4C0BA 5C42A 2IAJB 3CCWA 1K9MT 2CQ0A 2W7AA 2ZD1B 4NEZA 4O3PA 5B0GA 3UR3C 1SJ3P 1S48A 1DQ9A 2KU7A 4J90A 3JSRA 2CPIA 2UZAA 4I4BA 1VQ9S 1M5SA 4G3IA 1WF1A 2BE9B 3KUGA 1I94J 4LT6A 3QGIA 4CQ1A 4CLYA 2XO6A 1GQEA 2J0SD 2HZCA 3MR3A 3J7AN 1C2PA 4H4OB 5A8WB 1W26A 3MECA 2RQMA 2W25A 4OHWA 3HX9A 2V4QA 2EC2A 1TKZB 2I1RA 3FQLA 3PFOA 1MWZA 2E9TA 4AXJA 4ZLLA 4ENOA 3RBXA 2HW3A 5ETRA 4DFMA 5I3UB 4FVCA 1V3ZA 5L1LA 2VBWA 1O8BA 2CAJA 1NJWA 1PCAA 5KFIA 3RU0A 3N0VA 1KNZA 1T03A 1RE1B 3K0JA 2G2ZA 3HJFA 4DEZA 4ED3A 2O5DA 2FLLA 2XS5A 2LEPA 1IUJA 2ZH2A 3P45B 3J80Y 4QR1A 4OHXA 3TA1A 1KN6A 5DO2A 2Q6CA 2VJUA 2HBQB 4IUFA 1FWPA 3GV7B 1X0PA 4PXCA 5CH7B 2UUBF 3VAGA 1FJCA 4ALZA 4ECWA 2GMJA 2EG1A 3MEEA 1SQEA 3HJVA 1U49A 3M2VA 2CJBA 1YITS 4QIVA 1DAXA 2UXDF 4CLZA 3A12A 4NLTA 1SXLA 3M2UA 3IR7B 1NDCA 1FXLA 3RBZA 3TQ1A 3MAHA 2DJWA 1QE1B 1VMBA 4OZ5A 4RU2A 1IJEB 3AT1B 1FO1A 5KFPA 2ZOMA 3ICLA 3AA9A 1S1WA 1M0SA 1KOHA 4C3MA 1VRTA 1HNXJ 6FDRA 1T9XA 2MB0B 1RHJB 4RZRA 5J2PA 4PYDA 2CQPA 1ZM9A 3Q86A 1SC3B 2EEYA 4YFUA 1UWBB 3GFHA 2M7SA 2P2CB 5E3QA 3FUYA 3MOJB 1L3SA 2RRNA 4P2FA 2IRUA 4CLSA 1RADB 5IC4B 4LF9F 3RJMB 1NPPA 1TP7A 5A8KA 3FJ2A 3GE9A 3SEOA 3GFYA 3C6UA 1NK7A 3VAHA 3D6TB 4LF8J 1HPZB 5DQHA 1CJVB 1VBKA 3JS9A 3PXGa 1C0UA 2UV8A 2GO9A 2OFGX 4URGA 2OUGA 3QT6A 3V6HA 2CKWA 2WONB 4OV6A 2V69A 2L9DA 1J5OB 3TA2A 3ZFVA 4LF1A 3BPSP 2HHTA 1EZZB 4ZCIA 2NS1B 1FRHA 4O3OA 4F8RA 2CNKB 4I2PB 5HLFB 2K06A 3ZO7A 4QPXA 1BC6A 3ZZOA 1YX2A 3QWUA 2M0GB 2W4PA 1YIJS 3SIPB 2YH1A 4GVBA 5J1NA 3BEGB 1CBKA 4FYWB 1WEXA 1R0CB 4DF8A 4OZLA 3POTA 1RT1A 3IAM9 2BQUA 9ATCB 2HG4A 4M5NA 3QFWA 2IFXA 2QZ8A 1C4AA 4ECSA 2I9SA 4ID5A 4L76A 2XB2D 4W90B 2LVWA 3PYDA 5IQ6A 1RKJA 1KVIA 4HEA9 1S9EB 4Q5VA 3ET6A 4QJVA 3HFKA 1PSDA 1VCTA 2M52A 3EVOA 2HGNA 4IOBA 1MG7A 3BKTA 1RLDA 2N3OA 4USTA 4Y00A 3WQPA 3PZPA 1A0OB 3UI3A 2UXCF 3KOAA 2J9CA 4JI1F 2PFDA 1YVFA 2KVIA 3S1TA 4A4JA 3S01A 1FVSA 1DFDA 3GSDA 2W7PA 2FD2A 3TUPA 4WK1A 4MFBB 1OQ6A 4IO9Q 4AL7A 4X4RA 3OJSA 2ZFHA 1WSRA 3KK3B 3BDEA 1MU2A 2EK6A 2B51A 2J7KA 4BWMA 2ILZA 4CTAA 1RB0A 3PHTA 3I4HX 3VVTA 3PW5A 3EGVA 2HBRB 3EXCX 2R2SA 4NLOA 4L73A 1IXKA 1HHQA 4TVAB 2YQ0A 3GP9A 5F8GA 3HCXA 1NBEB 5ETNA 2F4VF 1NRKA 2RUGA 4OMFG 3TOQA 4IFYA 3ZTPA 3W2WB 2W01A 1G1XA 2LXUA 2VUGA 2VC0A 4YDDB 1MROA 3M1VA 3X1LB 3GG1A 3NCQA 2VQFF 3JB9k 2DRBA 1I1GA 4K4SA 1U1KA 2EFPA 3NNHA 1VQ5S 3N28A 1ELOA 2Z2LA 5DQIA 4A47A 4KBIA 1RK8A 5F9NA 3C15B 2MKYA 3IS9B 2OPQA 1F2HA 2YQ1A 2F1FA 4RWXA 4ZVOB 1NUEA 4J5OA 2V2KA 3CMAS 4YY3J 2MQOA 4LJMA 2DB1A 3TZYA 5EDWA 5BXIA 2GVZA 4A8KA 3KLGB 4N5SA 1TL7A 1SH0A 1IKXB 4JI2F 3PIOQ 3BR9A 4NXMJ 3HD2A 1XJWB 3DRRB 4C97A 4DCOB 3HZGA 3LALA 3R5BA 4B3SJ 3JAMU 4LF7J 2M88A 4UZBA 3EDRB 4P72A 4HKQA 5GMKa 3CW2C 1XNRJ 3DGVA 4C2MA 2XS7A 5J1EB 4CLLA 3FFIB 3M6VA 1VQKS 2EFQA 2H9ZA 2DY9A 4U96A 2CDRB 1S6PB 2QIFA 2WHOA 1PJ7A 5I3PA 2OTJS 1GFWB 3QWPA 4LBHA 4DL7A 3FRYA 1LW2B 3RB4A 3OUYB 1CSJA 5LXYA 4OHVA 2ROPA 4LSNB 1NPKA 1BQMB 2LQ8A 2Z56B 4FF1A 2YNFA 5ETKA 4PG8A 1B64A 4ED4A 4U7CA 2ERRA 2EK1A 3EPGA 5GAEI 1WKJA 1D8YA 2ASJA 2CUYA 3K8WA 2V2QA 2VD3A 3OVBA 2I2YA 1FK9A 2MLXA 4KYZA 2MPUA 3DLBA 1Q7YT 3G4SS 4C11B 1JXEA 2XMUA 4J9VA 3MR2A 2LQ9A 3DXBA 4RNFA 2DYAA 1F5BA 3FK4A 2BANB 4RW9B 1F9EB 4M8LA 4BC9A 1FCAA 2VBXA 4DV6F 5F41A 3R2CJ 1N52B 1RWKB 2IMWP 3ZZYA 1AZSA 5DGAA 5GAHI 3ELHA 1OIAA 2Z58B 4IDKB 4ELTA 3BR8A 2YKNA 1YJTA 5LT5A 2V8DA 3QIPA 1S1VB 1HNWJ 1XMQF 4QYZJ 2Z30B 4MKAA 3BQ0A 4F3MA 4LFBJ 3B82A 4KAIA 1Z1ZA 2XGQA 1RT4A 4X4NA 5CYJA 4X64F 4O3RA 4ECYA 3UN5A 3DOLA 4Z37A 1G3OA 5F9LA 2QN6B 4J9MA 1OJ4A 2U1AA 3J7YI 4WP9A 2RHSB 1VLOA 3IA0A 3IRXB 2WVCA 4M5DA 3MD3A 3BN4A 4Z7CA 2CQHA 4FNHA 3CJQA 3QFHA 1ZH5A 2XMAA 5KFVA 4M5HA 3GR1A 2BRLA 2L9NA 2CJAA 4ZMMA 2B4VA 2DNRA 3MHYA 1QVFR 2J76E 3QYYA 1N32J 4GKJJ 1T9UA 4B3RF 2FYXA 2XY7A 2QJ3A 2ZH9A 3W60A 2ZC3A 5K9FA 4ZJOA 3J80U 3IAS9 1IN0A 1B7FA 5KFZA 2GW8A 3RBEA 3CJ4A 5DG9A 4I56A 2XWYA 4TQRA 3HLUA 3MFIA 3KXDA 1A9NB 2HQCA 3MM8B 3BQ2A 2OMLA 4R25A 2CPHA 5LMNF 2F63A 2C2OB 1IBKF 2RAQA 2HBZB 5E3PA 2RRAA 2YX7A 3L3CA 1XN9A 1KVJA 4ANDA 2ZZNA 3ZZPA 2RB7A 3M8YA 3H5UA 1HNIA 2VOOA 1KLNA 1TFYA 4I67A 3DMJA 5K20B 1VRTB 5DG7A 2K2PA 2HLTA 4ZVSB 2OPRB 1OY9A 1LFWA 4ZOSA 1WI8A 4A8XA 1RXOB 5EX3A 5SUHA 3HM9A 1R0AA 4WE1B 1FKPB 3QO9B 4HL9A 2CIMA 4LRBA 1DJ0A 2OP5A 1AYEA 2L9WA 4QW8A 2AW0A 4ID8A 5DZ6A 2BEFA 2VG6A 2BMBA 1XR7A 1ZZFA 2LXIA 2HZAA 3K58A 3T9ZA 2R8HA 4DQIA 2G1HA 2MMYA 3R7NB 3QMQA 4Y6IA 1XIQA 2HHHF 1YBTA 1Q8KA 4EI2A 1PC4A 5F8MA 3HT3A 4F2SA 2XSFA 1LV5A 5D3GA 4OHZA 1FT8A 1SL0A 2GJ2A 1RBLA 2DHGA 5EGYA 4OZNA 2BKOA 5H9FK 3DRPA 2R7QA 4F26A 4HACA 2CQ4A 1Q8IA 3JYTB 4ECQA 3MMAA 3HHLA 4C0HA 2OEMA 4B3OB 3SQGB 1IR1A 5RUBA 3PJ9A 2XI2A 3IR6B 3GZ7A 4ED7A 1S5ZA 2IC3B 2LQBA 3OV7A 1O5JA 3KWMA 1UFKA 1SQGA 1EARA 3VAKA 1FEEA 2XM3A 1VQNS 3KJVA 2HAIA 2MQLA 4X4UA 1JKHA 2H5EA 3VAJA 2E1MC 1RTIB 4GVBB 3UDVA 4HHJA 5HQ8A 1YLXA 3KYLA 3MEGA 4IG3B 4X84A 5EUHA 2P9EA 4C48A 4EBCA 1U25A 4B9SA 5LSLA 3RRGA 2D3O1 2BDPA 2E66A 4K4VA 2NXCA 3MM9B 1GMWA 1FJGJ 1KSPA 4ECTA 2RMLA 1IKWB 2H5JB 3BO2A 1M5OC 4DQSA 2DNMA 1FERA 4M1KA 3ET6B 4OYPA 1VI7A 2RJZA 2VFUA 4CO3A 2B8QA 2WB1D 5LMUF 3LGNA 4OYOA 4MK8A 4ZK7M 5AXNA 1U1MA 3LO3A 3AY0A 2V5HG 4WFBQ 3Q0AA 4OI0A 4JI6J 2HWIA 3LP2A 2DNPA 1T9WA 4L3KA 4JP8A 5DJBA 3EGZA 3BKFA 5C2CA 3NMAA 3GJSB 4Z2XA 5KOXA 4OV1A 2VBYA 3K5PA 1HD0A 3M05A 3M8WA 1JLCB 2GMHA 2OSQA 4KB7A 4DV0J 2AJ1A 4WKYA 5ETPA 1I94F 3UWTA 3GYNA 2DH9A 3ETMA 5A8RA 4CTAB 1RT3A 2BJ1A 1N33J 7FDRA 4J9SA 1KQKA 4DG1B 2NXUA 3D28A 1FJEB 1KLMA 5KFSA 2DTJA 3BREA 3BS9A 3UVJB 1VBXA 3T5KA 2Z8QA 4FYXB 1WD6A 3AXMA 2MLZA 4CLFA 3O44A 3PCOB 1XK8A 3DLEA 4F0HA 2JLGA 1JLBA 5I42B 3K17A 3MM5B 1TL3B 5I3QA 3W5XA 4ZVFA 3KLIB 4DLGA 1TVRA 1Q78A 2W4DA 3PIPQ 2B3TB 2MHNA 1NJYA 4DSIA 1FJ7A 1UAWA 4ZCMA 3KG4A 3TQEA 1HBUA 4ILMA 2XNRA 2POKA 1C1BA 3QJLA 4K59A 3IG1B 4MKYA 2H5IB 6AT1B 2L41A 4EBEA 2JZ5A 2E5JA 1B3TA 2J9DA 2RF2A 1TL7B 4A8YA 2VBZA 5D8HB 3PO5A 3FBEA 1CPZA 3A3PB 3IR5B 4M94A 1EHWA 3HVWA 5DLGA 1R8HA 2J8AA 5HJYA 1RWPB 3UE2A 1SV5A 3DLKB 1YDLA 4HLBA 4E2FB 1HNXF 3JSYA 3P49B 2HNZB 2VFVA 1E6YB 2ZBQA 2UP1A 1N5YB 2FHOB 5D15A 3MGJA 4P7VA 1RAIB 2I38A 4NCGB 4PCQA 4XPCA 2Y1LB 5HQMA 4DFPA 3Q8YA 4NZ0A 4QIEA 2ZKUA 1FKOA 3RZAA 3DGPB 2DHAA 4N76A 1DHMA 1YJWS 3H0PA 3L7OA 3M2RB 1U2RA 2EFOA 2FGCA 3BB5A 4PUOB 3IGNA 3W8GA 2IPOB 3SFUA 4LF8F 2B6AB 4TXSA 3ZTOA 2FVQA 3C6TB 1YG0A 3BBBA 1R7IA 2KYXA 3MR6A 4DR1F 5F3TA 2N7CA 1FX2A 2LQJA 4BBYA 3T3FA 3QLHA 2DNHA 1ZM2A 2FJEB 3H98A 3VF0B 1DZ5A 4DU8A 3ZNUA 1IKYB 2W24A 2MZJA 4USUA 3GFXA 2Q43A 2XLKA 3MWBA 4ECVA 4DL3A 1XEZA 3QGPA 1GTEA 3H90A 3I9V9 1U2FA 1UVIA 3TEGA 1S1UA 2ALZA 1NHVA 2W9CB 1R8CA 3DXSX 1HBOB 3VCDA 2MZSA 2WCXA 2CJKA 3MEDA 4M5DB 2QL7B 2KN4A 1I51B 5L1JA 3IN5A 1KTQA 3CD7A 4KV8A 4IH7A 1CJTA 3ZTRA 4B3TJ 5IM0B 1S0VA 1KFDA 1AT1B 1JIHA 5G0RB 3HXMA 3IBCB 3TX8A 2OELA 1Q82T 2DNYA 4DV5J 3TYTA 2ZZMA 5CYQA 2FDNA 3NGSA 4DV4J 2AGPA 4JI8J 1KR4A 2D3OR 1Q0NA 2IIHA 3PACA 3WZ0A 3FCWA 3IWNC 1PO6A 2JVOA 2ALYB 2PMHA 2XO7A 3CNQP 2JL9A 3UDLA 3RBDA 4LF5J 4BCAA 4W4MA 2XY5A 1QAYA 3KFWX 2PA3A 2AKWB 4X4TA 4ZA1A 1NMEB 4XO0A 1EQMA 1RCXB 3FGVA 2CQBA 4WFXA 2XSJA 1UA1A 3SZ2A 1ZBTA 1F6TA 1RAGB 3V81B 1C1CB 3N01A 1TMJA 1RKIA 3PY8A 2OPPA 1N5TA 1VISA 2CZVC 1HD1A 1HNIB 3D66A 2ZVIA 1FX4A 3KTQA 2ZHOA 3WC2A 1RTHA 4F3OA 2WK4A 1D8ZA 3N4WA 4ES3A 3F73A 1OO0B 3G2XA 2E5LJ 4EK2A 3C8YA 1NNDA 1R0AB 3H40A 3UNYA 2ZUGA 3LA0A 2GV1A 2GJIA 1V6HA 3OFHA 1Y9OA 1VQ7S 1PJ6A 1NZ8A 4LBPA 4FPRA 4DQQA 3KK2A 1HYSB 2DISA 2CQIA 2IDLA 4EEYA 3QNWB 1RA7A 2RDIA 3WHIA 2OAUA 3O2IA 1LWFA 2DGVA 3H5XA 4UOGA 4C3KA 3DDNA 1FFWB 3P3DA 1LW0A 2GHWA 1K47A 3EGNA 2KT2A 1JWWA 2PI5A 2R7UA 2HKEA 2QLXA 2FHJA 1TTHB 4F0KA 2J0QD 1S4FA 5HVHA 1RTJB 2Y1RI 4NXMF 2RS2A 4OYXA 2VC1A 4D3HA 5HMZA 4CCHA 5HJXA 4PWUA 3TRGA 2IBKA 3T41A 4B3SF 4LF7F 4DR6F 3TA0A 1N5SA 2EPIA 1T3NA 1TKXA 1U6FA 4OX9J 2P9GA 3MAAA 4GO5X 2Q3PA 2XCPA 1LWEB 2OLWA 3RAXA 1VQ4S 4NOHA 3CJRA 1IKVA 1WF2A 2IRXA 2RVJA 1FA0A 4OJHA 3DLLQ 3HHEA 1IM4A 2Q66A 2E1CA 4M63A 1K1QA 4FDFA 2NYIA 4U7UD 3ITHB 3D1OA 4RLEA 5D0RA 2H1YA 3V5RA 1V3RA 2XYPB 5KFWA 3QJPA 3PO4A 2AEJA 4E0DA 2CQ3A 2DT9A 4X2BA 4DX8H 4IKAA 4OLOA 1K73T 2E9RX 2JFKA 1TL4A 1A7GE 3H59A 1FFGB 1S57A 2LXFA 3DN9A 1YRUA 2Q1LA 3LP1B 2JRSA 3RW6A 2CPJA 1GNKA 1PBUA 2P6TA 4RKUC 2OIHA 4CI0B 1EETA 3N6LA 4FF3A 1KRPA 3CWJA 3KHRA 5C5JA 2IM0A 1TKDA 2FC8A 1PJ5A 2OFHX 2W2MP 1HNWF 3GTYX 1W2BR 1FDDA 3N9UC 4FF4A 2DIVA 1UJ6A 1SC4B 3CJ3A 2PDAA 3EJMA 3CDEA 4LFAJ 5L1KA 4YUDA 1TKTB 1CQNA 1MSWD 1HARA 1S6QB 4LRAA 2A6OA 2UV8G 2V9WA 1QDUB 4USKA 3BZQA 5A8RB 3NOGA 4DV3J 4WBFA 4DI6A 2R7TA 1WEZA 1U0HA 1OSCA 3SV3A 4KY3A 2H4WB 2QX0A 3D68A 4KPYA 4MTPA 5T41A 3P5BP 5E41A 3FZBA 4F67A 1MLAA 4DF4A 1UZDA 2D41A 1RAFB 2ZUAA 3PEHA 3K7RA 3TANA 4KHPJ 4RU9A 1SC1B 2YKMA 2XMTA 5B0CA 1HMVB 3PRDA 3DLEB 5HQLA 2YX1A 2HS4A 4NZ7A 3I0SB 4QYRA 3GSIA 3G8QA 8ATCB 4JI7J 4CH0S 4LBIA 3MF5A 2FZGB 1H98A 5IOLA 1I5OB 4Y3CA 2QTWA 2IY5B 3LAKA 4P52A 2YXLA 4C8MA 3PV8A 1IWAA 3ZTSA 1P27B 3TEHB 4CZCA 3Q8QB 4C0OC 4Y65A 4CYUA 1VQ8S 4JUZA 4JV1A 2EW9A 3R6GB 1OMSA 2CRLA 4E8UA 3LPYA 2J9EA 2VG7A 5K8NA 1RCOB 3P8BB 3GJRB 5D78A 2YPYA 2IMOA 3W8PA 1YHQS 1U6BA 4RBUA 1T11A 4KFBB 4WFYA 5B7WA 3JSMA 3HHDA 1VQLS 2KHDA 1HWIA 2KKHA 2EBEA 4O44B 1DARA 3M8PA 1N8RT 5KFQA 3CTRA 3MMJA 1RQ0A 1JLAA 2IBOA 3I87A 4Q0BA 3EZOA 4B9TA 2GQCA 3CCLS 4EZ6A 4WCEQ 4K5SA 4KE5A 1WC4A 4QBUA 3A13A 3PNIA 1RWUA 1CLFA 2HZVA 4F4XA 4KH0B 5H9FJ 1R3NA 2FUG9 2JC0A 4MIWA 3L7UA 3A8EA 5E3AA 4P75A 3H4BA 2M8HA 3WDOA 1TK0A 4ED0A 2GAHC 2BUNA 1S76D 3W9JA 2QRRA 3MMBA 5LSRA 4ECXA 2H48B 2D3ZA 1TAUA 4ICLB 1RHKB 1UJ5A 2YNGB 3GIJA 1YZ6A 4NI2A 4W92B 1L3KA 9RUBA 4R0EA 3LWMA 3DI6A 2NREA 2A18A 1TL1B 2O1PA 4HVZA 2N82B 1JQGA 1F2GA 4RW6B 4AT1B 3L4BC 5CYMA 3AD7C 2F8MA 2VPYB 2KRBA 4V1Ak 5KFBA 4N56A 2DCLA 1Q1KA 2MGZA 2NXEA 3AH6A 5FLXY 1FJGF 1RT7B 2OEJA 2BQRA 1SH3A 4RW4B 1Z2LA 2KT5A 3S6EA 2LMIA 1UVLA 1S4EA 1U24A 1UW4A 5IV4A 4YB7A 2VG5B 4QW9A 1P1LA 1IQTA 1WI6A 2CQGA 3L09A 4WZQA 1BQNA 5AE1A 1QAIA 1JMTA 3M7VA 3C19A 3EYZA 2HHWA 4JI6F 4JOUA 5KT4A 3TUIC 1FDNA 3DOKB 4KIAA 2VICA 4PQUA 4QZVB 3M8QA 4I64A 1H38A 1RBOB 1BD6A 1QVGR 3GLJA 3C66A 4DV0F 3LQVA 2LKZA 2MKKA 2YKQA 2YKPA 2YQ3A 3ZNJ1 1N33F 5ITHA 3M30B 3PHEA 2MZQA 3EGWB 4DL5A 1RJJA 3PKMA 4OI4A 2CJYB 1D9AA 4PXEA 1N54B 5A0YA 3UCGA 3THTA 2KXHA 2DGOA 3DM2B 3V6DA 1SCJB 1P9YA 1NJXA 1JLFB 1OYEA 2RQ4A 2DY1A 4KH1B 1BHNA 3IWLA 2W1BA 3EZUA 4RL1A 4PWWA 1RABB 2ZBRA 4UOFA 3LGMA 4DR5J 3VTIA 2EC0A 2HFNA 1RHUB 1HHTP 4F36A 3GB0A 2AJFE 1HI8A 5LM7E 3OHBA 1PKUA 5C25B 1BWVA 2MJUA 4JBCA 2IM3A 4LMZA 4AUKA 1QUPA 1Q8LA 3T6JA 1ZAWA 4HHUA 1JLQB 2G2OA 2QC3A 1B99A 2JSXA 4ZCKA 3UQSA 2CG4A 2RHQB 5LXRA 2YKAA 4S0MA 2E44A 3D54A 3CGIA 2KFNA 3LH2S 3MI7X 2Y0SD 3OFFA 3QT8A 4LVOP 5KG7A 2WTFA 3QBCA 4RBTA 3V6JA 2GO8A 2B9YA 1UW9A 4A48A 5FDLA 2DGXA 1RA6A 1YZ7A 5J1PA 2YWEA 2D1CA 5ETTA 1MMDA 1T95A 4DLEA 1SKRA 1Q5VA 2FZKB 2HAFA 3MM6B 5B08A 4RO0A 1DTQA 3NCPA 2PI4A 2VH7A 3UN2A 3Q83A 5BR8J 2KG1A 3D0HE 1ZZNA 3FBFA 4PABA 3W1YC 4UOHA 1GMVA 1X0FA 2W9AA 4MYUA 1UMJA 4X4OA 3CJSA 4U95A 2AX1A 4DPWA 3TP2A 4JI0J 5IT0A 1QTNB 4Q2LA 2JWNA 1O0PA 4C6AA 4AD6A 2PMZD 2JEJA 2QMXA 3FBCA 4WKRA 1DTTA 2BACA 2FGOA 3V4IA 4DL6A 4ES1A 2B4OA 1IM6A 4F02A 1RAOA 5CD4H 3KK1A 4CLTA 2WSEC 2FLPA 4BWJA 4JV5J 2CWXA 4KTQA 4YN3B 3MM7A 3LF0A 3OBIA 3ULHA 4ZPCA 2VDIA 1GX5A 4DQPA 5KFCA 5IT9U 4B9VA 4LR9A 1IWGA 1T3OA 4Y2MA 1WOSA 4PZVA 1K1SA 1OPIA 3MR7A 1NPRA 1VDHA 3KLEB 3KLHA 1R89A 5KAKA 3W5YA 1VRUA 3P96A 1WF0A 2JOQA 1H2TZ 1RT5B 2PSZA 4IG0A 2FLNA 1ZETA 5KFLA 4TN2A 5J2NA 2DR8A 1FVQA 3PR4A 1Z2ZA 4KHRA 1CJKB 1YTYA 3O5TB 3RUBL 2HPUA 3CJKA 5HMWA 2F8EX 1JJCB 1Y3KA 3I0RA 4XDDA 4LQ3A 2CVIA 2HBYB 3OTCA 4DMZA 3SCLE 3R3TA 3RB3A 1S1XB 5KG1A 3SDEA 4B3TF 4PPDA 2R8GA 3OL6A 4DV5F 2ASDA 3MR5A 1D09B 3FSIA 2FHMA 1HIYA 3TVYA 4PG6A 3NLCA 4ZPAA 2UUCJ 4DV4F 3U1LA 2VKRA 2FHKA 3RAQA 2AWZA 5D4PA 2QA1A 3BJYA 1ICEB 2HNDB 4FKYA 3QZ7A 3CMQA 4J9QA 4LF5F 2RIJA 4JI4J 1IBCB 1LQ9A 3OR2A 2NUHA 2JVRA 1FEHA 1RTDA 3DC2A 4J9KA 2GFFA 2B5JB 4UQTA 4QCLA 2G1DA 3BSAA 3GV5B 4RW7A 5KFAA 2BJEA 2RILA 4QWEA 1U4BA 4DSJA 1V9OA 1ZPVA 3H8YA 4TY8A 3UD3P 5L9XA 4K2JA 5E3RA 2HHVA 1YJUA 1IBMJ 2E1AA 2Y8WA 2M4MA 2E5LF 1RI7A 2ASYA 3GMGA 1X60A 3KMQA 2QLJB 4H4KC 1O6XA 3OR1A 3O1LA 3UDCA 4DV1F 1VIXA 4Y34A 2I6WA 3GFZA 3DKDA 1BGXT 4KGVB 4CT8A 3OHAA 3G6VA 2XHWA 5U47A 4F4YA 1YBAA 4F4ZA 5SZTA 2OPSA 2UUAJ 3R2DJ 2FIUA 1ZTWA 4ITSA 2IJNA 2KTQA 1S7HA 2DRAA 1B4SA 2YWGA 2P5VA 2UXBJ 2M2BA 2ZDPA 2FVSA 4FS2A 2FVCA 2YNIB 4OI1A 1S72S 3UNGC 1L3UA 2FVPA 2CQ1A 4KKOA 3AJ1A 3R97A 4ZPVR 4C7QA 4LSLB 4Y2AA 1VQPS 1JLGA 1Q95G 2J0XA 4DUYF 1PAUB 1FD8A 1E6VA 2MY8A 1LWCB 2X51A 1DY3A 3DFEA 1X4GA 1WEYA 3AODA 4FKXA 5BYQA 2BRKA 2WVFA 4M5JA 1FNMA 2P9CA 4UY85 5HVFA 1ZM3A 3HMJG 2VOPA 2GHPA 1PBAA 4ZP8A 4CP5A 2XTJP 4LF4J 3O3LA 3W2VA 2R3VA 3JTPA 4ZVUB 5F8IA 2HRYA 2XLIA 1UETA 3KLFA 1IVZA 5FLXU 2RKIA 1A6LA 3AOCA 1U2CA 2AZ3A 2ABYA 1CULA 4WIQA 4C3LA 3DYAB 1FRIA 2MZRA 2E5HA 2VU5A 4NA1A 3KHLA 3CCVS 3EZ5A 4RNMA 4ZP6A 1RAEB 2I5JA 3K5OA 3N5FA 3TW0A 5AJ3F 2FJDB 1UEKA 2JDJA 1X4BA 2QFJA 3GILA 3O6QA 5MAOA 2J0WA 1F9HA 4NL5A 1BQNB 4HDHA 4I7FB 4X65J 3VAFA 4DX5A 4AE5A 4DOZA 2J8SA 1MWQA 2OD4A 2HIQA 2ZBPA 1KVKA 4UZCA 3TVKA 2CJ9A 4WU3A 3R7BB 4CDIA 2BVZA 2H54B 5LSOA 1X9SA 4LFAF 5C2GA 2PE8A 4EWTA 1QUVA 1OY8A 3PG9A 4YR0A 4X4QA 1X5TA 2JEFA 4FXVA 2GHVC 1HQEB 1SPBP 2XWXA 1S9GB 4DV3F 4ZVPB 4M5KA 3E01B 1NHUA 4DL2A 1QTMA 1R0BG 1SUQB 4N8NA 3G8SA 2HQFA 3C14A 3NKYA 5AXKA 4QR0A 1PYOB 3WX8A 4NLYA 1P9QC 3ILLA 1HNVA 5E2QA 1M1KT 2F7VA 3BGRB 3M9NB 4KHPF 4QQBA 3HVTA 4CNYA 5J2QA 4ED1A 1DLOA 2A3JA 2C2DA 3MCNA 3DOMA 3TAMA 1TUWA 2V68A 3IP0A 2M70A 2E5GA 3NL0A 1NJZA 4XDCA 4U6PA 2FHJD 5IT4A 3Q89A 2MEWA 4P2MA 5KFGA 3OTOJ 2KHCA 5KG6A 2VFTA 4CO4A 3LTOA 2C2ZB 2CFXA 2GVDB 1T9YA 4J9LA 1MMLA 1Y5LB 2HNYB 4NLDA 4R8UA 1DQAA 1TV6A 1YJ9S 2Y8YA 5ETMA 4U67Q 2XULA 2YNHA 1HW9A 3DLGB 1NK8A 1BLUA 1EP4B 5HVGA 1VBYA 2VDHA 4F25A 2WOMB 2WVEA 4H4MA 3OFEA 3UD5A 1RT6A 3H5YA 2MZ1A 1HBNA 2D74B 2DITA 3OL7A 5C24A 2XCAA 1S1TB 3VWSA 3MPYA 2G0CA 2DCUB 4OZ0A 1RU1A 1HHSA 4LSZB 1RHRB 1K8AT 2ZE2A 3I5CA 3T1YJ 3DDIA 4I2QB 3M9MB 3LP0A 3AD8C 4WJBA 5J2MB 2C2KB 3T1HJ 2R2UA 5THWA 3U02A 2ZZTA 3SCKE 2HFZA 2O67A 3V2UC 1NK4A 2CADA 5ETSA 3BKUA 5IWAJ 3LUYA 1B0PA 4LR8A 2C2EA 1BXNA 3OT9A 1KQFB 5DLFA 1I6JA 1HI1A 1V5VA 3M8RA 1LEOA 2HVHA 3E8OA 3HI9A 4HR2A 5GADU 4ZKAA 2BA9A 2X3GA 4F50A 2AHOB 2ADCA 2KXNB 1X9MA 1FI4A 4FPIA 1NSAA 5GVQA 1X4HA 2CWKA 4OYAA 4URSA 2QEXS 1V3SA 2FPHX 3KK1B 2F9JA 4NLGA 5B0DA 3DRYA 1SVDA 2V8PA 2MQQA 1T7PA 2ADBA 3A8IA 3NBPA 2HFSA 4PAAA 3G71S 2V94A 2AF6A 2BX6A 5MLCV 2HMIB 4B9UA 3D0IE 2QLWA 3I96A 4CH7A 4N77A 2C2RA 4ZPBA 4EO8A 1LXJA 5KFRA 4IFVB 2W2NP 3U1MA 3KLHB 1SJQA 3OTEA 4NA2A 3LOUA 2J7UA 4RW8A 4WK3A 1RT2A 2HHUA 5L46A 4QIGA 2NZ4A 2R2RA 5J2NB 2B4UA 3VV2B 4IOAQ 2B7CB 3TZZA 2W9BA 5D0HA 4IRCA 2PD1A 2YX4A 1RHMB 2ACMA 1X7VA 3CJKB 4O4GA 4FP9A 2DO0A 1L5UA 4NYZA 2V4JA 5T7LA 1T05B 2FJWA 3DRSB 3G82A 2PEHA 2G4BA 3M6XA 3JTNA 4PWDB 1XTZA 1M5HA 3CPWR 3I9ZA 5C7PA 3MTJA 3OSPA 2Y0BB 4B08A 3OQ2A 2BE2A 1HWJA 4AL5A 1C0TA 1HQUB 5HROB 2YWWA 1HKAA 1FRLA 2AYMA 3MAQA 3D5MA 2IAJA 2VA3A 2K1RA 1AB8A 3EX7B 2ZD1A 3R6LB 1SJ4P 4G1QB 2ATCB 5K14B 3Q2SC 2BJ9A 2J6SA 3D1QA 2BW2A 4DFJA 2QYCA 1JX4A 5BJRA 4OI2A 5B0EA 2VODA 2O01C 1WJ9A 1RP5A 1CS4B 3J7ZT 2L48A 1JK9B 4OJ1A 1TQLA 1B7YB 5KT3A 1GXLA 3V6KA 2UVWA 2DGTA 4HTJA 3Q8VA 2RUSA 1Y10A 4B02A 1TUGB 3T6BA 2PFFB 1FXDA 2MKJA 1VJWA 4ED8A 1MW7A 4H4OA 5A8WA 1N34J 2VIHA 4ZJLA 5JVHQ 2OKQA 1R8AA 3EPIA 4NLWA 1TKZA 4AXIA 1HBMA 1B70B 2EVZA 4DR5F 4CO5A 5KFJA 2GC8A 2DEIA 5HI7A 2AYGA 3QZ8A 4PKDB 5I3UA 3M32B 1JB0C 1J5EJ 2NR0A 1JLEB 3N5BA 2F8HA 4CLWA 1UVMA 1LKZA 1KD1T 1K0TA 3WC0A 1HI0P 1TUVA 1XR6A 5L9NA 4ZHRA 2GGPB 4J91A 4OYMA 3GIMA 3V4MA 2IA0A 3HZEA 3CCZA 4BS2A 2CJQA 2ZH8A 1BMQB 4ZVEA 4Y28C 2JEGA 2O3DA 2PN6A 1U1LA 2ZITA 4JI5J 2MKHA 4I1TA 1OQ3A 1NO8A 2OHDA 1W25A 2N4DA 2DNGA 4R0JA 2AMCB 1U1PA 5A6WA 2OEKA 4FYDA 2KO1A 2Q6BA 4FN5A 1NK5A 2OTLS 3A4TA 3JSBA 4J9UE 1NSQA 1QE1A 4X66J 1ZYQA 2C1EB 2WZ1A 2IRYA 2PIIA 2PMWA 3AB4B 1LK7A 4XTTA 2OMOA 2MHEA 4K5RA 2OGUA 2ZOFA 2DGUA 4ZVGA 2LEAA 1N6QB 4TY9A 5D0GA 2G13A 2J5AA 2LA6A 4TQSA 4UT4A 1UWBA 4Q43A 3TJ9A 5CZVA 3CUNA 4DR4J 4Q44A 1Y7PA 2EKNA 4JI0F 2HHPA 3DU6A 2CNLB 4NCAA 3ETOA 3AB2B 2WW4A 2OI2A 3MMCB 2J9DE 5C42B 4R5PA 2I5JB 4EO6A 1H2UX 1VHFA 1AFJA 4P9SA 1FKAF 3H42A 1HPZA 3IM9A 1CJVA 1XMOJ 2CZ4A 4JV5F 2GJFA 3GJQB 3I5AA 2WONA 3OFGA 3QJJA 3HF5A 3SI8A 3CJ0A 2ZOGA 1REGX 1SKWA 4USHA 2WW8A 3VAMA 3MPDA 2BZ2A 3HO1A 4K0KF 1TAQA 4USIA 1CC8A 4I2PA 2KH9A 1P8GA 5HLFA 4CLKA 2COLA 3J81j 3AQOA 3BF4A 4NMXA 1CEZA 3MECB 1XMBA 5DDOC 2XZWA 5CCMA 1Y5IB 1N0UA 2AGOA 4A8QA 3DHXA 3R1LA 1SJFA 2HURA 4K4WA 3NOCA 2IJFA 4CO1A 5T14A 2CJXB 5HP1A 4FXWA 3K5NA 1TFWA 2VF3A 3TO8A 4DZ6A 2R8IA 2BKNA 3B6BA 1T03B 3CJ2A 5KFDA 3DOMB 3TAMB 1S9EA 1H3DA 1WACA 1PC5A 3VGSA 1YWXA 1NB7A 2F5GA 4KHMA 1VRQC 2UUCF 4K7QA 2AYBA 2QE5A 2DPJA 3R1HA 5CAAA 2YVSA 5F8HA 4OZ1A 2GIQA 2FTRA 5KFYA 1SJ1A 4DJBA 4YHHJ 4JI4F 1WG4A 5E7OB 4FNIA 4MFBA 3MEEB 4DSLA 2MKCA 3M4XA 3M2VB 3H25A 3H5SA 4R8UB 5KFKA 3KK3A 1NXIA 3RR7A 2YNHB 3M2UB 2AGQA 1SJRA 2A2DA 1CC7A 2D3UA 2XI3A 1M1HA 3THVA 3DDKA 4GO7X 2DR7A 3KNAA 5LMNJ 3OVAA 1S1WB 3R5GA 5KFFA 3FEXB 1CQMA 1M5PC 2ZJRQ 3TZXA 4B3MJ 3CCES 4OHYA 3Q8RB 5J2PB 4DR2J 1IBMF 2RT3A 2AT1B 4F4KA 5F0WA 2ZJPQ 4DQRA 5M2UA 3CF5Q 4FXDA 2VASA 2MSSA 2G0IA 3RG6A 3W2WA 1TELA 3D4JA 3CD0A 2H65B 3AXKA 3MPVA 2CNNB 4F4AA 1URRA 4USJC 3BSCA 5A8KB 5I4MA 1PILA 2K3KA 2AJ0A 3C6UB 1HWLA 3C15A 1UFWA 2UUAF 1U45A 2M8DB 4X4VA 2BJ3A 3K59A 1C0UB 3SSRA 2LA4A 5KG3A 2IVFB 3KMSA 1BY9A 2UXBF 1TK5A 4WU2A 4LVNP 5EWFA 2ZEJA 2M5YA 3F41A 4NEYA 2RU3A 1YJ7A 3KLGA 2DGSA 1HL6A 1IKXA 2DNZA 3UFCX 3UCZP 4QU7A 1Y3JA 4ECZA 3DRRA 3F44A 2ZWPA 2MQMA 5LJ5Y 1IR0A 1MMNA 1YJNS 5CQGA 2JJ4D 3FBBA 4OZ3A 3HULA 5J1EA 3FFIA 3LGHA 4L75A 4K4XA 4G1PA 3VVUA 2NCKL 4Y2IA 3ISZA 2RU9A 4LF4F 3POTB 2WB4A 2XG8A 1S6PA 2XMVA 1RT1B 1W2IA 1S6OA 1LW2A 2DNNA 3NCRA 2IM2A 4UUXA 3OUYA 3AJ2A 4NXNJ 4ZITA 1IJFB 4ID5B 1B0TA 2DD8S 2KZMA 2V9KA 2BKPA 3U27A 4RUCA 2MQ8A 4LSNA 3HFZB 1BQMA 3I32A 2XMWA 2D9OA 2MYFA 1S97A 2CXEA 4DS4A 3MOZA 5KTQA 4GC6A 2BV3A 4A8MP 4MK7A 5B0AA 4C11A 4DR7J 4U8VA 3ISNC 5CABA 1PG5B 5GMEA 4LFCJ 4X65F 2BANA 2QLFB 4RW9A 4KJIA 1F5CA 3C16A 5L1IA 4TNOA 2K1RB 4Y0FA 1FF2A 4HI1A 4WYLA 1MU2B 1HWKA 3QRQA 3B54A 4IDKA 4EMDA 1XNQJ 2HVIA 4OX6A 1S1VA 3ONQA 1H72C 1WORA 4TLRA 2C22A 3M8SA 4CM0A 3QGGA 2DBBA 3Q2TC 1WHXA 3R5JB 4DPXA 1FWKA 3QQCD 3TAPA 2KYZA 3ISND 2B56A 4IFYB 1NLKL 1F0XA 3PFEA 1QY7A 3KHHA 3IRXA 3UN3A 1Q53A 2V0NA 3VGUA 2BOAA 1TL5A 3FQKA 1MROB 3M1VB 4K4ZA 2A0FB 5BYRA 2NSCA 3W63A 2AQ4A 1HBMB 1NKCA 2KZZA 4NASA 1WOPA 2OPQB 3FSYA 3IMQJ 4U9RA 2HRTA 3TNVA 3OTOF 1NKEA 5A2QY 2WVBA 2GVZB 3GPAA 3MCSA 4ZHRB 1IBLJ 2K7JA 4FBTA 3OXGA 1T9VA 4NPOA 2V50A 2FY8A 4LR7A 1KP6A 1M5VC 2ZHAA 3SSSA 3QT7A 3MM8A 3PR5B 2XY6A 2JX2A 4GKKJ 1Y0HA 3SV4A 1WHWA 3G96A 4KR0B 4ILLA 3R27A 1S99A 3ZZRA 3NMRA 2F40A 1FRXA 3E2EA 3ZZUA 5JJBA 1QSSA 1UPMB 2L3MA 4P73A 4YB5A 1YKWA 3T1YF 5HAOA 4C9DA 4DU7A 3MFHA 2MLYA 3Q24A 2RS8A 3D6MB 4FZVA 2CNOB 4RJVA 3T1HF 2DXDA 2HK3A 1UWAA 3S8SA 2AJ2A 3EVMA 2AEMA 1QSYA 2OPRA 2ZH7A 4PRFA 1BWEA 3IO1A 2YNFB 2EWHA 2RD5C 3SCIE 5IWAF 3PX6A 2DXEA 2XYGB 1NK9A 4WE1A 3VR1A 1FKPA 5AE2A 5FJ4A 4F2RA 3QO9A 4YQWA 4CO0A 1FK9B 3VGVA 4O3QA 1WDTA 2GIFA 4KGXB 1UL3A 3MZIA 1NH7A 1GT8A 5IZHA 2DNLA 2C2MB 4B9LA 2B0GA 3TX0A 4R5PB 2FVRA 3Q22A 2F65A 4CT9A 1AZSB 4RUBA 3LW5C 2ZH1A 1WC3A 2PO4A 4MJKA 2HFUA 1KWMA 2YKNB 3DLHA 4HT5A 3BGLA 3SXLA 2V8HA 3QIPB 1WTFA 4CWBA 3I6PA 4ED5A 1F3FA 1VIOA 4RX6A 5CA5A 3KG0A 2HWTA 4DR1J 1RT4B 4DWIA 3JYTA 1WC6A 3HSDA 1EIYB 3DOLB 4MKBA 4B3OA 3SQGA 5KFUA 1N88A 4P2SA 3CDUA 2IC3A 3R5AA 3GG0A 1X31C 2RH3A 4Y2KA 3MTKA 4DUTA 1WDDA 2FLOA 5K5MA 3VZIA 1Q4RA 4V19J 1RWVB 4P71A 3PYFA 2DR5A 4LRCA 1NDPA 1RTIA 1VK3A 3C3LA 3UD4P 2J6TA 4ZLPA 4A8WA 1FFSB 2EXUA 4IG3A 1AW0A 1MN7A 3E3XA 3ZZZA 5HP1B 1UKUA 4WFZA 4ATNA 4HT7A 4DCPB 3MM9A 4G1IA 3G8TA 3IM8A 4A8OA 1F3VA 2PT0A 3EE3A 5ETQA 4O0NA 1IKWA 2H3EB 2MKSA 3GCXP 1YI2S 4UQGA 1R8BA 2BBEA 1WC0A 5AXMA 2YPZA 1HLWA 3BQ1A 2ZH6A 1X4CA 3L9ZA 1FDAA 1NH8A 3QSIA 1S12A 3Q8SB 3FZ2A 3IBWA 4FBUA 4QIWD 3NY0A 2CPFA 1VC0A 1VLYA 5D0EA 4DL4A 4NWBA 5JMNA 4B9NA 1U0SA 2W2PP 1AXQA 1OWXA 1Q16B 2QL9B 3PW0A 4GRSA 3EM1A 3EICA 3PTWA 3LPEA 1JLCA 4FF2A 4K8RA 3K5LA 1GMUA 1M90T 4O23A 1KBRA 1B0VA 3DLJA 2FC9A 5ETOA 3DMJB 1UVKA 2HHQA 4CIOA 1WG5A 1U1QA 4DG1A 2KM8B 1SQFA 1N34F 1BUXA 2QA4S 2VL1A 3J81Y 1PIEA 1RSCA 3N79A 4B9MA 1U6ZA 1YRTA 3UVJA 1RACB 4ZIVA 3AHPA 1ZAVA 3PRVA 3F56A 3FEZA 4A46A 2R8JA 2NXJA 2HQDA 2VG6B 2KVQE 1J5EF 2X7IA 1OS5A 4YB1P 3BGOP 5I42A 2MQNA 4YY3F 3MM5A 1TL3A 2DNQA 3KLIA 2LQ5A 2AV5A 1OPZA 5D4NA 4NLUA 4C8KA 1S6UA 3CO9A 5G4DA 4MT1A 3RGIA 5KOWA 1AA1B 4YMEA 4UOCA 1AFIA 3CIZA 4GVLA 2X1AA 3ILIA 4CLUA 5D3GB 1RAHB 4K2XA 3IG1A 4NLXA 1VHIA 2CPZA 4JI5F 3M6WA 2IHR1 3PW7A 3DRPB 4HACB 1HFEL 3MMAB 3HHLB 1XNRF 1HR0J 1NB2A 2C3YA 1Q79A 4FS1A 3DCAA 2CQCA 4BHQA 2RQKA 1JJ4A 5M2RA 1KEKA 3W65A 4K4UA 2HRUA 4RWWA 2W2QP 2EG2A 2GCFA 4X66F 4DR6J 2WVDA 2HGMA 3KJVB 3AOAA 5DDPC 1VJQA 1JKHB 1NJIT 4KSEB 3DLKA 2UU9J 3BYRA 3Q8UA 1G7CB 2QT7A 5KFTA 3MEGB 2HNZA 4NX9A 1E6YA 3TR5A 2DHSA 1N5YA 1U26A 3GYGA 3UCUP 4NCGA 3T9NA 2LP4A 1FNOA 4XAKA 4DR4F 3VZHA 3T1AA 4OX8A 4M5IA 2VPZB 3OTBA 3DGPA 4DN9A 3OSNA 1FDBA 4MMOA 3OVSA 5DDRC 3M2RA 1YJRA 4PUOA 4HTIA 5EWEA 4DPTA 2B6AA 1XMOF 3GYXB 2CPXA 3LP2B 3C6TA 1QM9A 1RWOB 5KFHA 3GCWP 5AE3A 2JHEA 1X9WA 4LFBF 4F3QA 4LIRA 4ZP7A 3C16B 5IT9Y 2AZ1A 3ZTQA 2DIUA 3ENVA 1RWWB 3DHWC 3SSQA 2X1BA 4GMKA 2R7WA 4L6V3 1H7WA 2IA6A 2B7BB 4KC5A 1RT3B 1IKYA 3N6MA 5DZ7A 4MK9A 4CRJA 3THPA 1VQOS 3D67A 3T5JA 3UO0A 2C28A 4GC7A 4UTGA 5CZXA 1KLMB 1ZAXA 3R5DA 4LREA 5K8MA 2BXJA 2KT3A 2GA7A 3G6YA 2Z4PA 2W9CA 2KB2A 1OYDA 1HBOA 3NGTA 2YY3A 2I8EA 2C3UA 3OL8A 4JI3J 1HNZJ 1JLBB 1N32F 4GKJF 5HATA 2CZ9A 3BO4A 4NZ6A 1TVRB 3TJ8A 5KG5A 4NMLA 3BSOA 2KRRA 4ZLNA 3OL9A 3NWRA 1BE4A 2C3OA 2QA4G 1U47A 4Q45A 4HI2A 4ZN3A 4LF2A 1C4CA 1X4AA 4PQAA 1DBDA 5IM0A 1YRXA 2H4YB 4J9OA 1DQ8A 3BPDA 5G0RA 1HBUB 2GAGC 1C1BB 5DDQC 5A2QU 3LAMA 3NG8A 4W98A 1NK0A 4F4WA 3A1YG 4M95A 2E5IA 3GIRA 4DUZJ 4NCBA 4TU9A 3QSYB 4YHHF 2AEFA 1D9DA 2RF2B 2QGFB 2MXYA 3OW2R 1ZS6A 4KRWA 5GAEU 4K4YA 2MJNA 2KJWA 2L08A 1J2VA 2DEJA 2MQPA 3A3NB 1Q5YA 4NLSA 3CIMA 3O8WA 3VGTA 1RU2A 1SV5B 3QRPA 2VB6A 3F0NA 1GX6A 1U8WA 3NGKA 4B3MF 1JXLA 2N7YA 4UUWA 3V81A 1C1CA 1R6YA 1U09A 3BV8A 4DR2F 2BYCA 5JVGQ 2A6MA 1H7XA 4C8ZA 5GAHU 4IO1A 4L74A 3PW2A 2KL8A 4WTYA 3QRRA 3TJAA 1WNEA 1FKOB 1UTAA 3EVWA 4EFAC 1X5SA 4YS2A 1ZA1B 2ZM6J 4OJGA 2HHSA 3GONA 1TR0A 3FDSA 3WIVA 2KFYA 4OZ2A 2BJ8A 4XPEA 4N8OA 2P6SA 4OX7A 1ZTTA 3CCTA 1K0VA 4N47A 4BDPA 2ILYA 1HYSA 8AT1B 2BQ3A 2RNEA 3J7YU 3ILJA 3K2YA 4KT0C 1BQXA 5KFMA 5EX0A 5DG8A 3H2UB 3JTOA 4M5GA 1GXUA 3ENQA 3QLHB 2XZTB 5KT6A 3WIUA 1RHQB 1QAJA 4DN0A 1RTJA 1Z4UA 2GQ2A 1L3VA 1AROP 1KTVA 5BYSA 2MTLA 1FRKA 2BOPA 5E0OA 2DGWA 4C4WA 4ZVHA 3W62A 3FKBA 2XNQA 3IBFB 4RPFA 1VOMA 3BH7B 4KGZB 4ILRA 1XR5A 1S1UB 5KG0A 1LWEA 2QLBB 2A2CA 2D7SA 1G6BA 3QGHA 1YQHA 4UY8T 2Y1IA 1EKSA 2IYGA 2LEBA 3MEDB 3D3CJ 4C8YA 1GXTA 4Q8EA 3NNCA 4NXNF 3W7BA 1QSLA 1FESA 3ITHA 2HWHA 4KV8B 1YJVA 1RZMA 1EX8A 1SI9A 3A8JA 3MPWA 2KM8C 1VQ6S 1CJTB 1D1UA 2QL5B 5KFEA 2XEXA 3UW1A 2BR0A 2PA8D 1FE4A 3B4MA 2VZ9A 3G6ES 1REVA 1EB0A 4RR5A 5CYQB 5HMYA 3FMBA 4DR7F 3LP1A 4KQZA 2SXLA 4CM2A 4ZIWA 5H9EK 4LFCF 3SYZA 4LRFA 4IRDA 2NLWA 1T94A 4QU6A 2QSWA 4OQJA 3CCQS 3MXHP 2R42A 1XNQF 2FZCB 3KNGA 2HLUA 5EN1A 1H2VZ 2KDOA 3KJFB 1JNRB 4ZVTB 3W61A 2XSJB 1TKTA 2KG0A 2K3IA 2AJ4A 4WFAQ 1S6QA 2MZTA 3J7Z5 2OPPB 5B0BA 3HHLC 2X1FA 2VKZG 2DK2A 1VC6A 2NZCA 4ELVA 2E29A 2B4PA 1WKLA 3U1NA 2FJXA 3M8ZA 2W2OP 1D9FA 1RAJA 4IRKA 1NCLA 1RTHB 3QIDA 3J81U 5E33A 4CNZA 1M1GA 1N0VC 4EGLA 4HHHA 2Z2MA 4WP8A 4DBQA 3NWGA 3QAUA 2QV6A 3OLAA 3PYGA 3CC4S 1ZPWX 1S0OA 2HGLA 2DNKA 2QA2A 1HMVA 2BJDA 3KK2B 3J7A1 1R8PA 2LCWA 4NLRA 2DKOB 1KOOA 1WWHA 2XYHB 2C3PA 2RE1A 4WWSA 4X4SA 3I0SA 2LU1A 1KONA 3HHLD 4X4PA 2QMUB 1LWFB 5D6GA 5ETLA 2RSQA 2AIRB 1IBLF 3H2LA 2APOA 1P6TA 1LW0B 1SIWB 4MAKA 2AJQA 1NAQA 2QYGA 4ZDNA 5ETVA 2XLJA 4O3NA 3W5ZA 3D7SB 3UR0A 1SKSA 3ZZTA 4GKKF 3MUVP 4ECUA 4WZMA 1VQYA 2VONA 2ROEA 4JV0A 1G4CA 2F9DA 4I68A 4IH5A 4ETXA 3OTDA 3CC2S 1TKXB 3EMTA 3TZWA 3MAAB 1NU4A 3KHGA 4F7VA 3KUEA 3HHKA 3KDNA 4RNNA 1UZHA 1IKVB 2QSFA 1GMWD 2E7VA 1FNXH 1S0NA 1WC5A 5KG4A 4CO2A 3RTVA 4DX6A 2DNOA 1GH8A 4K50A 3BBCA 1D3WA 1YK9A 4UW2A 1WUUA 3CJ8A 2BM1A 3FRZA 2HFOA 3RRHA 4OI3A 2NYHA 1OY6A 4IR1A 4KFBA 1CJUA 2DR6A 3CULA 2C42A 3B78A 4LF6J 3HD1A 4O44A 4XIUA 1WHYA 4DSFA 5AXLA 2EFGA 4AQYJ 1KS2A 2XGPA 2AYEA 1AUDA 3MURP 3LWLA 1X8DA 2CPDA 4Z7YA 3BGFA 1S9FA 1EETB 1S10A 2EKYA 2RQCA 4EU0A 5GAGI 3CSKA 2HK2A 2JNJA 1QJHA 4P2XA 1O51A 1DRZA 1FRMA 1N4LA 1H73A 4M5LA 4C98A 3W9IA 2JEIA 2OD6A 4P6QA 2R9LA 4DHVA 2Q79A 5B0FA 5IFMA 2VFRA 3PYEA 3QATA 5D77A 2FY1A 3OXFA 2ZH5A 2NQPA 4Q7AA 1X4DA 4USMA 4AL6A 4FYYB 4ICLA 2ZC4A 3I82A 2YNGA 3BSNA 2M3DA 1R6VA 1TMMA 1EAYC 1U0HB 4KGMA 2HS3A 1K44A 1TL1A 3PEJA 4J9NA 2LDYA 2R7VA 2W4CA 4DZDA 1UFLA 3D6FB 4NYOA 2X1GA 2LFVA 4H4KA 4OYIA 4RW6A 1RBAA 1UEUA 3SMZA 3W9HA 2FQQB 4EZ9A 2DR9A 3IWXA 5L39A 4ED6A 2YKMB 2ZHBA 3PX0A 1NK6A 2Y3YA 4PYAA 4JB8B 3QPIA 2Z2YB 1RT7A 3R7SB 1R31A 3CCUS 2WAQD 4RW4A 2R2TA 5CHCB 3NAHA 4AFFA 5JUMA 1U48A 4JI8F 1FTRA 1T9TA 4WXWA 1PAEX 2DHHA 5HL7Q 1NKBA 1SC6A 5AT1B 2VG5A 4L72B 1RWNB 3PJWA 4KO0A 1XBWA 1N36J 4TU8A 1FTCA 4RBVA 2DGQA 4ERDA 2M9KA 2HVEA 3MUTP 5LOQA 4LUBA 3DOKA 3SCJE 2MSTA 4CYUB 3ZXWA 5IS2A 2WBMA 2JLEA 4TYAA 1AUSL 5GAGU 1GAOA 2D9PA 4QPTA 4ZLJA 5E3CA 2YKOA
chains in the Genus database with same CATH topology
1EKRA 3JQKA 1EKSA 2IIHA 2OHDA 3JQJA 4FDFA 4PYAA 4PYDA 2IDEA 2EKNA 2EEYA 3JQMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EKR A;  3JQK A;  1EKS A;  2IIH A;  2OHD A;  3JQJ A;  4FDF A;  4PYA A;  4PYD A;  2IDE A;  2EKN A;  2EEY A;  3JQM A; 
#chains in the Genus database with same CATH topology
 2MY7 A;  3M30 A;  3US5 A;  2HQI A;  2VG7 B;  1MNE A;  2B9E A;  4DR3 J;  4X62 J;  3P6Y C;  4DV2 J;  1URN A;  1VYA A;  3TVZ A;  3BM7 A;  3DM2 A;  2RDD A;  4IQX A;  3JSM B;  3GQC A;  3L7P A;  3SFG A;  1JLF A;  4WXO A;  3HFV A;  2YWK A;  3TUJ C;  4D3G A;  3M8P B;  4G65 A;  5KFO A;  3C2P A;  1F1B B;  2J6U A;  1JLA B;  2IVY A;  3HPO A;  3I56 S;  2JH3 A;  3SQO P;  3JQM A;  4Q0B B;  4NLQ A;  4DV1 J;  3JXO A;  3IGV A;  3D3B J;  4RNO A;  5HK4 A;  1WTB A;  4V19 X;  2FJB B;  5C25 A;  2YWH A;  1UVN A;  5A76 A;  3KLV A;  2B43 A;  3H2V E;  4N41 A;  1KFS A;  1P1T A;  3MPU B;  2VJV A;  1I3O B;  2K8G A;  1FRJ A;  2XMM A;  5F8J A;  4Q8F A;  1JLQ A;  2BM0 A;  1X4E A;  4PG4 A;  4OYZ A;  3MMB B;  3UPF A;  3DU5 A;  4OX9 F;  1HR0 F;  4PXD A;  1KDN A;  4LRD A;  4NI2 B;  4QIF A;  5F8L A;  3HVR A;  4RUH A;  3HKZ D;  3TAR A;  4C8N A;  2ZBC A;  2GS8 A;  4ER8 A;  3MD1 A;  3DI6 B;  5IQQ A;  2CVE A;  3M6U A;  1WOO A;  2GIR A;  5LL6 d;  3HP6 A;  2ZVS A;  4OYB A;  2W8L A;  2VHG A;  2EFN A;  4ZVQ B;  4DXL A;  4IQM A;  4DUY J;  1TU0 B;  4TKT A;  2UU9 F;  1U1R A;  5CYM B;  2AP6 A;  3WX4 A;  4JYA J;  3VAL A;  2HFV A;  3FMW A;  1XER A;  1H6K X;  3NP5 A;  2W8K A;  3G87 A;  2VQE J;  2MGZ B;  3MM6 A;  4O0I A;  3BH6 B;  4YP3 A;  1CG2 A;  4ZPW R;  4NRU A;  1NSP A;  4DV7 J;  4PG5 A;  1FWL A;  1YSJ A;  2ASL A;  2G2Y A;  5GMD A;  3TAQ A;  3GIK A;  1X5O A;  3CDA A;  3HDS A;  2IM1 A;  2DRD A;  3S7R A;  4HDG A;  5A6P A;  2AX0 A;  1NDK A;  3NRB A;  3B4D A;  1REV B;  2V8V A;  3I5B A;  4F04 B;  3IFE A;  4IH6 A;  2EFV A;  5H1S V;  3H20 A;  3PM9 A;  5AJ3 J;  3KJN B;  1H0H B;  1NHK L;  3R8Y A;  2UUT A;  3HSZ A;  2V4R A;  4PQU B;  4USW A;  2LDI A;  3M8Q B;  3NXZ A;  1ZOT A;  4E98 A;  2QMW A;  3EWG A;  3FVY A;  4J7C A;  4B17 A;  3FNN A;  4KPC A;  1JJH A;  1Q8B A;  2XBP A;  2E7X A;  3Q8P B;  3KLE A;  1KQS R;  2VPX B;  3NGU A;  2J7W A;  5A0Y B;  5GAD I;  1VFJ A;  3V6D B;  1KKH A;  5FII A;  1RT5 A;  3EDQ B;  5D4L A;  3NS7 B;  7AT1 B;  3G9C A;  1CJK A;  2V34 A;  4Y2C A;  4ZN1 A;  4JI3 F;  1HNZ F;  4KGK A;  1G2E A;  2GNK A;  4F0M A;  3GU0 A;  1F9F A;  4O4R A;  5HSP A;  1QLN A;  4DL0 C;  4JI7 F;  1YBU A;  5CCL A;  1S1X A;  3ZZ0 A;  3EXY A;  3CT9 A;  1RYR A;  1WG1 A;  4J37 A;  1SB6 A;  4YEA A;  3NEK A;  1QAX A;  1S7I A;  3CDB A;  1UPP A;  3W3S A;  3QAE A;  4QOT A;  2YWF A;  3D9B A;  3T19 A;  4DUZ F;  1FHT A;  1F5A A;  1SL2 A;  2D69 A;  1HWU A;  4WPA A;  1N48 A;  2UUW A;  2OSR A;  4BLG A;  5HAN A;  1GTH A;  2HND A;  3MEK A;  3R5C A;  2UUB J;  3CCJ S;  1UP1 A;  1ROF A;  5FDL B;  4EYI B;  3SBM A;  2UXD J;  3TWZ A;  3CED A;  5F8N A;  2K7K A;  4DDF A;  2B5J A;  4PG7 A;  1Q81 T;  4WTO B;  2HQG A;  2RRB A;  1NSK L;  2ZH4 A;  3OLB A;  1JNZ B;  1U02 A;  3KKF A;  2WBR A;  4ZPD A;  3KUH A;  4J9P A;  4DX7 A;  4U8Y A;  4EUV A;  3EUN A;  1CVJ A;  3CB4 A;  1XWL A;  4OJ3 A;  1DTQ B;  3HSJ A;  3FCH A;  5HBM A;  2IYI A;  1VGY A;  5KG2 A;  2GQQ A;  5L8R C;  1ITP A;  1R27 B;  4PPZ A;  4URQ U;  1CJU B;  3BN7 A;  2ZM6 F;  2XQC A;  4OLP A;  1FXR A;  4TLQ A;  3RYL A;  4MH8 A;  1S59 A;  3AA8 A;  2AU0 A;  3ENW A;  3CDW A;  3HKW A;  4LF9 J;  2CQD A;  4NRT A;  3R9L A;  1DTT B;  1EJ7 L;  3V4I B;  1S77 D;  1Q7L B;  2VV5 A;  2LYV A;  4I6Y A;  1RYS A;  2H51 B;  1GEH A;  2B9W A;  4K4T A;  4NLV A;  1KQG B;  4BC7 A;  1VQS A;  3CD6 S;  3MM7 B;  2YNI A;  3KJQ B;  1WSV A;  2N3L A;  4LSL A;  3IRW P;  2R7X A;  4WP3 A;  1T8E A;  8RUC A;  1H74 A;  3MCM A;  1VRU B;  4FVM A;  2R7R A;  2VA2 A;  1LWC A;  4N7T A;  4IG0 B;  4OL8 A;  4RNH A;  3CJT A;  1U1N A;  5HN0 A;  5CD4 A;  4I0W A;  4EBD A;  3NGD A;  3CJ5 A;  3HHN B;  1JJ2 R;  1D0E A;  1U7L A;  2B9X A;  3D2W A;  1U1O A;  3I0R B;  1LXN A;  3NS5 A;  5CXT A;  4WYW A;  2C2N A;  2N4C A;  3HVA A;  2OH2 A;  3GV8 B;  3NS6 A;  2UVR A;  3VHQ A;  5DGB A;  1VBZ A;  1RUS A;  3NNA A;  3SDE B;  5K8O A;  4LQ9 A;  3RRK A;  5H9E J;  2XZD B;  4U7U K;  1SBR A;  3DYA A;  3CCS S;  4PXB A;  4I69 A;  4DPY A;  4Q2M A;  1NEE A;  4O3S A;  2DPI A;  3OJU A;  4J9R A;  2E1P A;  2DVI A;  2UXC J;  2PGC A;  5HMX A;  4MKV A;  2V2Z A;  4JI1 J;  5DET A;  4DPO A;  5DS7 A;  2KJV A;  4KO0 B;  2QFI A;  4I7F A;  3OR2 B;  2R7S A;  2V63 A;  3KG1 A;  1RTD B;  1VR6 A;  3KDO A;  4ECR A;  4NLP A;  3K5M A;  1EQ0 A;  2ZH3 A;  2IDE A;  2V6A A;  2WSC C;  4RW7 B;  2ROG A;  3FSX A;  5FD1 A;  2V67 A;  2MDA A;  4IYQ A;  1HQE A;  1S9G A;  4EYH B;  1UCN A;  3E01 A;  2GZO A;  1Y5N B;  4TY8 B;  3T5L A;  3DRX A;  2DO4 A;  1VC5 A;  1T02 A;  4CH1 A;  2ZWO A;  5F3Z A;  4ZS6 A;  2F4V J;  1SUQ A;  5ADZ A;  1MN9 A;  4WFN Q;  4P10 A;  3NAI A;  4MYT A;  1WEL A;  3OR1 B;  4PEO A;  4TU7 A;  3BGR A;  4G6V B;  2FJV A;  3PDN A;  1RTZ A;  3PW4 A;  1YGY A;  3L95 X;  2VQF J;  4UF4 A;  2CG8 A;  2GX8 A;  1HQ2 A;  5KT5 A;  2NPF A;  6FD1 A;  3D6H B;  2RDJ A;  2AD9 A;  1NZA A;  2OPS B;  3RB6 A;  3X3U A;  3AD9 C;  4YB6 A;  3OD2 A;  4I6W A;  3PJX A;  2FB0 A;  3I31 A;  2HHX A;  1VS3 A;  1LOU A;  4DCJ B;  3AQP A;  2HEK A;  2VPW B;  1RGV A;  4CLP A;  4KKO B;  2GVD A;  5IC6 B;  2IJR A;  4TYB A;  2Y9H A;  1SIZ A;  2HNY A;  1JLG B;  4JI2 J;  2CQ2 A;  3CVK A;  5KT7 A;  3MCO A;  5M2P A;  1N5V A;  1E6V B;  4OYW A;  2YH0 A;  4ETZ A;  3NGR A;  4JV2 A;  3DLG A;  4OIX A;  1EP4 A;  3CCM S;  4C8O A;  2WOM A;  3BBF A;  3BDP A;  1SL1 A;  2XS2 A;  1FE0 A;  3HT0 A;  2R7O A;  4YR3 A;  4ELU A;  3D0G E;  1GK8 A;  1S1T A;  2X3D A;  3U7J A;  1LFP A;  5F0U A;  4H54 A;  3W2V B;  4ZCL A;  3HK2 A;  3G86 A;  4I2Q A;  2PEB A;  1RIS A;  5BR8 F;  5DM6 Q;  4IR9 A;  2NSB A;  2E9Z A;  5IXU A;  3CE8 A;  3KLF B;  5J2M A;  2UVV A;  2HS0 A;  2RKI B;  4A8F A;  5IV3 A;  4LF6 F;  1CUL B;  3CCR S;  4FYV B;  2JC1 A;  5HO4 A;  3JQJ A;  4AQY F;  3HSG A;  1MWY A;  3CME S;  4QWA A;  3IXQ A;  4M5M A;  3ILO A;  3TI0 A;  5K8P A;  4OFZ A;  1S0M A;  4HYK A;  4DSK A;  4AYB D;  1WKK A;  3CXC R;  1WHV A;  2ZDO A;  1XC9 A;  4OZJ A;  3T5H A;  2FJA B;  3BYP A;  4DV6 J;  3I55 S;  1J5O A;  2CA9 A;  2NUU G;  3H4D A;  2ZJQ Q;  3QT5 A;  3JQK A;  1APS A;  4XK8 C;  3K89 A;  1UEV A;  2HVZ A;  1KHV A;  2ZNY A;  3LAN A;  1S79 A;  2Z0G A;  1SH2 A;  1PYT A;  2ZKT A;  2YTC A;  1XMQ J;  3A3O B;  5B09 A;  1ULR A;  1ZM4 A;  4QR2 A;  4A8S A;  3FC9 A;  2CDQ A;  2G0J A;  2HMI A;  4MIA A;  4X64 J;  3WBZ A;  1N5Q A;  3AAW B;  4QYZ K;  4IFV A;  1PYS B;  4ZPT R;  4K0K J;  5KT2 A;  2YBV A;  3C14 B;  2KFZ A;  5DRK A;  5E5N A;  3B8H A;  3GR0 A;  1ZA2 B;  4ED2 A;  1HNV B;  4RUA A;  2F4F A;  4WII A;  3HVT B;  3W66 A;  5J2Q B;  2HVD A;  2DH7 A;  4LIW A;  2R8K A;  3MUM P;  1DLO B;  1X4F A;  3CO0 P;  1JXV A;  2P8I A;  3GJT B;  3Q23 A;  1T05 A;  3FEY B;  3DRS A;  4YR2 A;  1UA0 A;  4PWD A;  4DS5 A;  2NXN A;  5D4O A;  3PRB A;  2WRM A;  3AFG A;  1FD2 A;  2QO3 A;  4USV A;  4B3R J;  2IVM A;  2C3M A;  3A8K A;  4ANE A;  2JLF A;  3D1H A;  1HQU A;  3G6X A;  5HRO A;  1DUR A;  4YOE A;  1N36 F;  2WSF C;  2JFD A;  2HSE B;  1KC8 T;  3FCV A;  4IOC Q;  3BGU A;  3GWC A;  1TV6 B;  3AJD A;  2DXF A;  2CPE A;  4G1Q A;  1VQM S;  2XHC A;  4QWC A;  4NA3 A;  3CC7 S;  1RWM B;  5K14 A;  2G9O A;  1X5P A;  2QG9 B;  1ACM B;  3UDE A;  1Y00 A;  5EWG A;  2I0X A;  1Y4Z B;  1TK8 A;  3DNC A;  2O66 A;  1NDL A;  1VK8 A;  2A10 A;  4H4M B;  1UVJ A;  5DQG A;  1RT6 B;  1NM2 A;  1HBN B;  1RLC L;  2Z2Z A;  3VQT A;  1IBK J;  5C24 B;  3ENA A;  1RWX B;  1CS4 A;  1RDR A;  3E51 A;  3M9O B;  4ZJQ A;  2BW7 A;  1HA1 A;  2EI5 A;  2ZE2 B;  4DR3 F;  4X62 F;  4DV2 F;  3LP0 B;  5KFX A;  5EHH A;  2MKI A;  2CYY A;  1PGZ A;  3H7H B;  2XMJ A;  3VQS A;  2OJ3 A;  2HYI B;  2DH8 A;  2A1B A;  3C46 A;  2HIY A;  2CPY A;  4MIB A;  4HH1 A;  2E7W A;  4ZP9 A;  2BE7 D;  4OI6 A;  3PKY A;  1XQI A;  1N56 A;  4L3N A;  5HBM B;  4YDX A;  1LWX A;  1RAA B;  4QWB A;  2HQ3 A;  3RB0 A;  3VAI A;  2GML A;  5L38 A;  3IS9 A;  1QD1 A;  2E1R A;  2U2F A;  3M32 A;  1JLE A;  4P7T A;  2LEC A;  2KXF A;  2OO4 A;  2LLZ A;  4PR6 A;  3AOB A;  4DFK A;  4QWD A;  1W7W A;  2EBG A;  4NE9 C;  2GGP A;  4DSE A;  2HHH J;  1OSD A;  3GII A;  1HW8 A;  3IC1 A;  1Q86 T;  3P5T L;  2R4F A;  1TZ0 A;  4WF9 Q;  1T0T V;  1IQZ A;  3NBP B;  2UVU A;  4DPU A;  1R43 A;  2DHX A;  3I4P A;  5DM7 Q;  3JAM Y;  2B8P A;  2V8G A;  3RR8 A;  2ZNZ A;  3ADA C;  2ZBI A;  3RW7 A;  1UJ4 A;  1Y11 A;  4ZVR B;  4RW8 B;  3BO3 A;  1RT2 B;  2VFS A;  2XC9 A;  2F3J A;  2PC6 A;  4JYA F;  1M5K C;  4I6A A;  2W7O A;  5LJ3 Y;  1U8S A;  2W9B B;  1J27 A;  3ZC4 A;  3CD5 A;  1SKU B;  3K57 A;  2VQE F;  1LNQ A;  1EKR A;  1KHW A;  4O4G B;  1S49 A;  3P4U B;  5KFN A;  7FD1 A;  4NYP A;  1L3T A;  2V4J B;  5T7L B;  4DV7 F;  1IR2 A;  3G82 B;  3RAM A;  1F60 B;  4HH0 A;  1N6Q A;  2LU2 A;  3K8V A;  3N6N A;  2ATL A;  3OPK A;  2XMK A;  2V2V A;  5JXS A;  2BAB A;  1V5I B;  3MDF A;  3W64 A;  1LK5 A;  4ANC A;  2BE2 B;  4P74 A;  3OXL A;  1WC1 A;  2ACY A;  1C0T B;  3PVX A;  2Z57 B;  3TUZ C;  4C8L A;  4ES2 A;  2BJ7 A;  2Y1J A;  2NPI A;  3PX4 A;  3MMC A;  5LMU J;  2KI2 A;  4C0B A;  5C42 A;  2IAJ B;  3CCW A;  1K9M T;  2CQ0 A;  2W7A A;  2ZD1 B;  4NEZ A;  4O3P A;  5B0G A;  3UR3 C;  1SJ3 P;  1S48 A;  1DQ9 A;  2KU7 A;  4J90 A;  3JSR A;  2CPI A;  2UZA A;  4I4B A;  1VQ9 S;  1M5S A;  4G3I A;  1WF1 A;  2BE9 B;  3KUG A;  1I94 J;  4LT6 A;  3QGI A;  4CQ1 A;  4CLY A;  2XO6 A;  1GQE A;  2J0S D;  2HZC A;  3MR3 A;  3J7A N;  1C2P A;  4H4O B;  5A8W B;  1W26 A;  3MEC A;  2RQM A;  2W25 A;  4OHW A;  3HX9 A;  2V4Q A;  2EC2 A;  1TKZ B;  2I1R A;  3FQL A;  3PFO A;  1MWZ A;  2E9T A;  4AXJ A;  4ZLL A;  4ENO A;  3RBX A;  2HW3 A;  5ETR A;  4DFM A;  5I3U B;  4FVC A;  1V3Z A;  5L1L A;  2VBW A;  1O8B A;  2CAJ A;  1NJW A;  1PCA A;  5KFI A;  3RU0 A;  3N0V A;  1KNZ A;  1T03 A;  1RE1 B;  3K0J A;  2G2Z A;  3HJF A;  4DEZ A;  4ED3 A;  2O5D A;  2FLL A;  2XS5 A;  2LEP A;  1IUJ A;  2ZH2 A;  3P45 B;  3J80 Y;  4QR1 A;  4OHX A;  3TA1 A;  1KN6 A;  5DO2 A;  2Q6C A;  2VJU A;  2HBQ B;  4IUF A;  1FWP A;  3GV7 B;  1X0P A;  4PXC A;  5CH7 B;  2UUB F;  3VAG A;  1FJC A;  4ALZ A;  4ECW A;  2GMJ A;  2EG1 A;  3MEE A;  1SQE A;  3HJV A;  1U49 A;  3M2V A;  2CJB A;  1YIT S;  4QIV A;  1DAX A;  2UXD F;  4CLZ A;  3A12 A;  4NLT A;  1SXL A;  3M2U A;  3IR7 B;  1NDC A;  1FXL A;  3RBZ A;  3TQ1 A;  3MAH A;  2DJW A;  1QE1 B;  1VMB A;  4OZ5 A;  4RU2 A;  1IJE B;  3AT1 B;  1FO1 A;  5KFP A;  2ZOM A;  3ICL A;  3AA9 A;  1S1W A;  1M0S A;  1KOH A;  4C3M A;  1VRT A;  1HNX J;  6FDR A;  1T9X A;  2MB0 B;  1RHJ B;  4RZR A;  5J2P A;  4PYD A;  2CQP A;  1ZM9 A;  3Q86 A;  1SC3 B;  2EEY A;  4YFU A;  1UWB B;  3GFH A;  2M7S A;  2P2C B;  5E3Q A;  3FUY A;  3MOJ B;  1L3S A;  2RRN A;  4P2F A;  2IRU A;  4CLS A;  1RAD B;  5IC4 B;  4LF9 F;  3RJM B;  1NPP A;  1TP7 A;  5A8K A;  3FJ2 A;  3GE9 A;  3SEO A;  3GFY A;  3C6U A;  1NK7 A;  3VAH A;  3D6T B;  4LF8 J;  1HPZ B;  5DQH A;  1CJV B;  1VBK A;  3JS9 A;  3PXG a;  1C0U A;  2UV8 A;  2GO9 A;  2OFG X;  4URG A;  2OUG A;  3QT6 A;  3V6H A;  2CKW A;  2WON B;  4OV6 A;  2V69 A;  2L9D A;  1J5O B;  3TA2 A;  3ZFV A;  4LF1 A;  3BPS P;  2HHT A;  1EZZ B;  4ZCI A;  2NS1 B;  1FRH A;  4O3O A;  4F8R A;  2CNK B;  4I2P B;  5HLF B;  2K06 A;  3ZO7 A;  4QPX A;  1BC6 A;  3ZZO A;  1YX2 A;  3QWU A;  2M0G B;  2W4P A;  1YIJ S;  3SIP B;  2YH1 A;  4GVB A;  5J1N A;  3BEG B;  1CBK A;  4FYW B;  1WEX A;  1R0C B;  4DF8 A;  4OZL A;  3POT A;  1RT1 A;  3IAM 9;  2BQU A;  9ATC B;  2HG4 A;  4M5N A;  3QFW A;  2IFX A;  2QZ8 A;  1C4A A;  4ECS A;  2I9S A;  4ID5 A;  4L76 A;  2XB2 D;  4W90 B;  2LVW A;  3PYD A;  5IQ6 A;  1RKJ A;  1KVI A;  4HEA 9;  1S9E B;  4Q5V A;  3ET6 A;  4QJV A;  3HFK A;  1PSD A;  1VCT A;  2M52 A;  3EVO A;  2HGN A;  4IOB A;  1MG7 A;  3BKT A;  1RLD A;  2N3O A;  4UST A;  4Y00 A;  3WQP A;  3PZP A;  1A0O B;  3UI3 A;  2UXC F;  3KOA A;  2J9C A;  4JI1 F;  2PFD A;  1YVF A;  2KVI A;  3S1T A;  4A4J A;  3S01 A;  1FVS A;  1DFD A;  3GSD A;  2W7P A;  2FD2 A;  3TUP A;  4WK1 A;  4MFB B;  1OQ6 A;  4IO9 Q;  4AL7 A;  4X4R A;  3OJS A;  2ZFH A;  1WSR A;  3KK3 B;  3BDE A;  1MU2 A;  2EK6 A;  2B51 A;  2J7K A;  4BWM A;  2ILZ A;  4CTA A;  1RB0 A;  3PHT A;  3I4H X;  3VVT A;  3PW5 A;  3EGV A;  2HBR B;  3EXC X;  2R2S A;  4NLO A;  4L73 A;  1IXK A;  1HHQ A;  4TVA B;  2YQ0 A;  3GP9 A;  5F8G A;  3HCX A;  1NBE B;  5ETN A;  2F4V F;  1NRK A;  2RUG A;  4OMF G;  3TOQ A;  4IFY A;  3ZTP A;  3W2W B;  2W01 A;  1G1X A;  2LXU A;  2VUG A;  2VC0 A;  4YDD B;  1MRO A;  3M1V A;  3X1L B;  3GG1 A;  3NCQ A;  2VQF F;  3JB9 k;  2DRB A;  1I1G A;  4K4S A;  1U1K A;  2EFP A;  3NNH A;  1VQ5 S;  3N28 A;  1ELO A;  2Z2L A;  5DQI A;  4A47 A;  4KBI A;  1RK8 A;  5F9N A;  3C15 B;  2MKY A;  3IS9 B;  2OPQ A;  1F2H A;  2YQ1 A;  2F1F A;  4RWX A;  4ZVO B;  1NUE A;  4J5O A;  2V2K A;  3CMA S;  4YY3 J;  2MQO A;  4LJM A;  2DB1 A;  3TZY A;  5EDW A;  5BXI A;  2GVZ A;  4A8K A;  3KLG B;  4N5S A;  1TL7 A;  1SH0 A;  1IKX B;  4JI2 F;  3PIO Q;  3BR9 A;  4NXM J;  3HD2 A;  1XJW B;  3DRR B;  4C97 A;  4DCO B;  3HZG A;  3LAL A;  3R5B A;  4B3S J;  3JAM U;  4LF7 J;  2M88 A;  4UZB A;  3EDR B;  4P72 A;  4HKQ A;  5GMK a;  3CW2 C;  1XNR J;  3DGV A;  4C2M A;  2XS7 A;  5J1E B;  4CLL A;  3FFI B;  3M6V A;  1VQK S;  2EFQ A;  2H9Z A;  2DY9 A;  4U96 A;  2CDR B;  1S6P B;  2QIF A;  2WHO A;  1PJ7 A;  5I3P A;  2OTJ S;  1GFW B;  3QWP A;  4LBH A;  4DL7 A;  3FRY A;  1LW2 B;  3RB4 A;  3OUY B;  1CSJ A;  5LXY A;  4OHV A;  2ROP A;  4LSN B;  1NPK A;  1BQM B;  2LQ8 A;  2Z56 B;  4FF1 A;  2YNF A;  5ETK A;  4PG8 A;  1B64 A;  4ED4 A;  4U7C A;  2ERR A;  2EK1 A;  3EPG A;  5GAE I;  1WKJ A;  1D8Y A;  2ASJ A;  2CUY A;  3K8W A;  2V2Q A;  2VD3 A;  3OVB A;  2I2Y A;  1FK9 A;  2MLX A;  4KYZ A;  2MPU A;  3DLB A;  1Q7Y T;  3G4S S;  4C11 B;  1JXE A;  2XMU A;  4J9V A;  3MR2 A;  2LQ9 A;  3DXB A;  4RNF A;  2DYA A;  1F5B A;  3FK4 A;  2BAN B;  4RW9 B;  1F9E B;  4M8L A;  4BC9 A;  1FCA A;  2VBX A;  4DV6 F;  5F41 A;  3R2C J;  1N52 B;  1RWK B;  2IMW P;  3ZZY A;  1AZS A;  5DGA A;  5GAH I;  3ELH A;  1OIA A;  2Z58 B;  4IDK B;  4ELT A;  3BR8 A;  2YKN A;  1YJT A;  5LT5 A;  2V8D A;  3QIP A;  1S1V B;  1HNW J;  1XMQ F;  4QYZ J;  2Z30 B;  4MKA A;  3BQ0 A;  4F3M A;  4LFB J;  3B82 A;  4KAI A;  1Z1Z A;  2XGQ A;  1RT4 A;  4X4N A;  5CYJ A;  4X64 F;  4O3R A;  4ECY A;  3UN5 A;  3DOL A;  4Z37 A;  1G3O A;  5F9L A;  2QN6 B;  4J9M A;  1OJ4 A;  2U1A A;  3J7Y I;  4WP9 A;  2RHS B;  1VLO A;  3IA0 A;  3IRX B;  2WVC A;  4M5D A;  3MD3 A;  3BN4 A;  4Z7C A;  2CQH A;  4FNH A;  3CJQ A;  3QFH A;  1ZH5 A;  2XMA A;  5KFV A;  4M5H A;  3GR1 A;  2BRL A;  2L9N A;  2CJA A;  4ZMM A;  2B4V A;  2DNR A;  3MHY A;  1QVF R;  2J76 E;  3QYY A;  1N32 J;  4GKJ J;  1T9U A;  4B3R F;  2FYX A;  2XY7 A;  2QJ3 A;  2ZH9 A;  3W60 A;  2ZC3 A;  5K9F A;  4ZJO A;  3J80 U;  3IAS 9;  1IN0 A;  1B7F A;  5KFZ A;  2GW8 A;  3RBE A;  3CJ4 A;  5DG9 A;  4I56 A;  2XWY A;  4TQR A;  3HLU A;  3MFI A;  3KXD A;  1A9N B;  2HQC A;  3MM8 B;  3BQ2 A;  2OML A;  4R25 A;  2CPH A;  5LMN F;  2F63 A;  2C2O B;  1IBK F;  2RAQ A;  2HBZ B;  5E3P A;  2RRA A;  2YX7 A;  3L3C A;  1XN9 A;  1KVJ A;  4AND A;  2ZZN A;  3ZZP A;  2RB7 A;  3M8Y A;  3H5U A;  1HNI A;  2VOO A;  1KLN A;  1TFY A;  4I67 A;  3DMJ A;  5K20 B;  1VRT B;  5DG7 A;  2K2P A;  2HLT A;  4ZVS B;  2OPR B;  1OY9 A;  1LFW A;  4ZOS A;  1WI8 A;  4A8X A;  1RXO B;  5EX3 A;  5SUH A;  3HM9 A;  1R0A A;  4WE1 B;  1FKP B;  3QO9 B;  4HL9 A;  2CIM A;  4LRB A;  1DJ0 A;  2OP5 A;  1AYE A;  2L9W A;  4QW8 A;  2AW0 A;  4ID8 A;  5DZ6 A;  2BEF A;  2VG6 A;  2BMB A;  1XR7 A;  1ZZF A;  2LXI A;  2HZA A;  3K58 A;  3T9Z A;  2R8H A;  4DQI A;  2G1H A;  2MMY A;  3R7N B;  3QMQ A;  4Y6I A;  1XIQ A;  2HHH F;  1YBT A;  1Q8K A;  4EI2 A;  1PC4 A;  5F8M A;  3HT3 A;  4F2S A;  2XSF A;  1LV5 A;  5D3G A;  4OHZ A;  1FT8 A;  1SL0 A;  2GJ2 A;  1RBL A;  2DHG A;  5EGY A;  4OZN A;  2BKO A;  5H9F K;  3DRP A;  2R7Q A;  4F26 A;  4HAC A;  2CQ4 A;  1Q8I A;  3JYT B;  4ECQ A;  3MMA A;  3HHL A;  4C0H A;  2OEM A;  4B3O B;  3SQG B;  1IR1 A;  5RUB A;  3PJ9 A;  2XI2 A;  3IR6 B;  3GZ7 A;  4ED7 A;  1S5Z A;  2IC3 B;  2LQB A;  3OV7 A;  1O5J A;  3KWM A;  1UFK A;  1SQG A;  1EAR A;  3VAK A;  1FEE A;  2XM3 A;  1VQN S;  3KJV A;  2HAI A;  2MQL A;  4X4U A;  1JKH A;  2H5E A;  3VAJ A;  2E1M C;  1RTI B;  4GVB B;  3UDV A;  4HHJ A;  5HQ8 A;  1YLX A;  3KYL A;  3MEG A;  4IG3 B;  4X84 A;  5EUH A;  2P9E A;  4C48 A;  4EBC A;  1U25 A;  4B9S A;  5LSL A;  3RRG A;  2D3O 1;  2BDP A;  2E66 A;  4K4V A;  2NXC A;  3MM9 B;  1GMW A;  1FJG J;  1KSP A;  4ECT A;  2RML A;  1IKW B;  2H5J B;  3BO2 A;  1M5O C;  4DQS A;  2DNM A;  1FER A;  4M1K A;  3ET6 B;  4OYP A;  1VI7 A;  2RJZ A;  2VFU A;  4CO3 A;  2B8Q A;  2WB1 D;  5LMU F;  3LGN A;  4OYO A;  4MK8 A;  4ZK7 M;  5AXN A;  1U1M A;  3LO3 A;  3AY0 A;  2V5H G;  4WFB Q;  3Q0A A;  4OI0 A;  4JI6 J;  2HWI A;  3LP2 A;  2DNP A;  1T9W A;  4L3K A;  4JP8 A;  5DJB A;  3EGZ A;  3BKF A;  5C2C A;  3NMA A;  3GJS B;  4Z2X A;  5KOX A;  4OV1 A;  2VBY A;  3K5P A;  1HD0 A;  3M05 A;  3M8W A;  1JLC B;  2GMH A;  2OSQ A;  4KB7 A;  4DV0 J;  2AJ1 A;  4WKY A;  5ETP A;  1I94 F;  3UWT A;  3GYN A;  2DH9 A;  3ETM A;  5A8R A;  4CTA B;  1RT3 A;  2BJ1 A;  1N33 J;  7FDR A;  4J9S A;  1KQK A;  4DG1 B;  2NXU A;  3D28 A;  1FJE B;  1KLM A;  5KFS A;  2DTJ A;  3BRE A;  3BS9 A;  3UVJ B;  1VBX A;  3T5K A;  2Z8Q A;  4FYX B;  1WD6 A;  3AXM A;  2MLZ A;  4CLF A;  3O44 A;  3PCO B;  1XK8 A;  3DLE A;  4F0H A;  2JLG A;  1JLB A;  5I42 B;  3K17 A;  3MM5 B;  1TL3 B;  5I3Q A;  3W5X A;  4ZVF A;  3KLI B;  4DLG A;  1TVR A;  1Q78 A;  2W4D A;  3PIP Q;  2B3T B;  2MHN A;  1NJY A;  4DSI A;  1FJ7 A;  1UAW A;  4ZCM A;  3KG4 A;  3TQE A;  1HBU A;  4ILM A;  2XNR A;  2POK A;  1C1B A;  3QJL A;  4K59 A;  3IG1 B;  4MKY A;  2H5I B;  6AT1 B;  2L41 A;  4EBE A;  2JZ5 A;  2E5J A;  1B3T A;  2J9D A;  2RF2 A;  1TL7 B;  4A8Y A;  2VBZ A;  5D8H B;  3PO5 A;  3FBE A;  1CPZ A;  3A3P B;  3IR5 B;  4M94 A;  1EHW A;  3HVW A;  5DLG A;  1R8H A;  2J8A A;  5HJY A;  1RWP B;  3UE2 A;  1SV5 A;  3DLK B;  1YDL A;  4HLB A;  4E2F B;  1HNX F;  3JSY A;  3P49 B;  2HNZ B;  2VFV A;  1E6Y B;  2ZBQ A;  2UP1 A;  1N5Y B;  2FHO B;  5D15 A;  3MGJ A;  4P7V A;  1RAI B;  2I38 A;  4NCG B;  4PCQ A;  4XPC A;  2Y1L B;  5HQM A;  4DFP A;  3Q8Y A;  4NZ0 A;  4QIE A;  2ZKU A;  1FKO A;  3RZA A;  3DGP B;  2DHA A;  4N76 A;  1DHM A;  1YJW S;  3H0P A;  3L7O A;  3M2R B;  1U2R A;  2EFO A;  2FGC A;  3BB5 A;  4PUO B;  3IGN A;  3W8G A;  2IPO B;  3SFU A;  4LF8 F;  2B6A B;  4TXS A;  3ZTO A;  2FVQ A;  3C6T B;  1YG0 A;  3BBB A;  1R7I A;  2KYX A;  3MR6 A;  4DR1 F;  5F3T A;  2N7C A;  1FX2 A;  2LQJ A;  4BBY A;  3T3F A;  3QLH A;  2DNH A;  1ZM2 A;  2FJE B;  3H98 A;  3VF0 B;  1DZ5 A;  4DU8 A;  3ZNU A;  1IKY B;  2W24 A;  2MZJ A;  4USU A;  3GFX A;  2Q43 A;  2XLK A;  3MWB A;  4ECV A;  4DL3 A;  1XEZ A;  3QGP A;  1GTE A;  3H90 A;  3I9V 9;  1U2F A;  1UVI A;  3TEG A;  1S1U A;  2ALZ A;  1NHV A;  2W9C B;  1R8C A;  3DXS X;  1HBO B;  3VCD A;  2MZS A;  2WCX A;  2CJK A;  3MED A;  4M5D B;  2QL7 B;  2KN4 A;  1I51 B;  5L1J A;  3IN5 A;  1KTQ A;  3CD7 A;  4KV8 A;  4IH7 A;  1CJT A;  3ZTR A;  4B3T J;  5IM0 B;  1S0V A;  1KFD A;  1AT1 B;  1JIH A;  5G0R B;  3HXM A;  3IBC B;  3TX8 A;  2OEL A;  1Q82 T;  2DNY A;  4DV5 J;  3TYT A;  2ZZM A;  5CYQ A;  2FDN A;  3NGS A;  4DV4 J;  2AGP A;  4JI8 J;  1KR4 A;  2D3O R;  1Q0N A;  2IIH A;  3PAC A;  3WZ0 A;  3FCW A;  3IWN C;  1PO6 A;  2JVO A;  2ALY B;  2PMH A;  2XO7 A;  3CNQ P;  2JL9 A;  3UDL A;  3RBD A;  4LF5 J;  4BCA A;  4W4M A;  2XY5 A;  1QAY A;  3KFW X;  2PA3 A;  2AKW B;  4X4T A;  4ZA1 A;  1NME B;  4XO0 A;  1EQM A;  1RCX B;  3FGV A;  2CQB A;  4WFX A;  2XSJ A;  1UA1 A;  3SZ2 A;  1ZBT A;  1F6T A;  1RAG B;  3V81 B;  1C1C B;  3N01 A;  1TMJ A;  1RKI A;  3PY8 A;  2OPP A;  1N5T A;  1VIS A;  2CZV C;  1HD1 A;  1HNI B;  3D66 A;  2ZVI A;  1FX4 A;  3KTQ A;  2ZHO A;  3WC2 A;  1RTH A;  4F3O A;  2WK4 A;  1D8Z A;  3N4W A;  4ES3 A;  3F73 A;  1OO0 B;  3G2X A;  2E5L J;  4EK2 A;  3C8Y A;  1NND A;  1R0A B;  3H40 A;  3UNY A;  2ZUG A;  3LA0 A;  2GV1 A;  2GJI A;  1V6H A;  3OFH A;  1Y9O A;  1VQ7 S;  1PJ6 A;  1NZ8 A;  4LBP A;  4FPR A;  4DQQ A;  3KK2 A;  1HYS B;  2DIS A;  2CQI A;  2IDL A;  4EEY A;  3QNW B;  1RA7 A;  2RDI A;  3WHI A;  2OAU A;  3O2I A;  1LWF A;  2DGV A;  3H5X A;  4UOG A;  4C3K A;  3DDN A;  1FFW B;  3P3D A;  1LW0 A;  2GHW A;  1K47 A;  3EGN A;  2KT2 A;  1JWW A;  2PI5 A;  2R7U A;  2HKE A;  2QLX A;  2FHJ A;  1TTH B;  4F0K A;  2J0Q D;  1S4F A;  5HVH A;  1RTJ B;  2Y1R I;  4NXM F;  2RS2 A;  4OYX A;  2VC1 A;  4D3H A;  5HMZ A;  4CCH A;  5HJX A;  4PWU A;  3TRG A;  2IBK A;  3T41 A;  4B3S F;  4LF7 F;  4DR6 F;  3TA0 A;  1N5S A;  2EPI A;  1T3N A;  1TKX A;  1U6F A;  4OX9 J;  2P9G A;  3MAA A;  4GO5 X;  2Q3P A;  2XCP A;  1LWE B;  2OLW A;  3RAX A;  1VQ4 S;  4NOH A;  3CJR A;  1IKV A;  1WF2 A;  2IRX A;  2RVJ A;  1FA0 A;  4OJH A;  3DLL Q;  3HHE A;  1IM4 A;  2Q66 A;  2E1C A;  4M63 A;  1K1Q A;  4FDF A;  2NYI A;  4U7U D;  3ITH B;  3D1O A;  4RLE A;  5D0R A;  2H1Y A;  3V5R A;  1V3R A;  2XYP B;  5KFW A;  3QJP A;  3PO4 A;  2AEJ A;  4E0D A;  2CQ3 A;  2DT9 A;  4X2B A;  4DX8 H;  4IKA A;  4OLO A;  1K73 T;  2E9R X;  2JFK A;  1TL4 A;  1A7G E;  3H59 A;  1FFG B;  1S57 A;  2LXF A;  3DN9 A;  1YRU A;  2Q1L A;  3LP1 B;  2JRS A;  3RW6 A;  2CPJ A;  1GNK A;  1PBU A;  2P6T A;  4RKU C;  2OIH A;  4CI0 B;  1EET A;  3N6L A;  4FF3 A;  1KRP A;  3CWJ A;  3KHR A;  5C5J A;  2IM0 A;  1TKD A;  2FC8 A;  1PJ5 A;  2OFH X;  2W2M P;  1HNW F;  3GTY X;  1W2B R;  1FDD A;  3N9U C;  4FF4 A;  2DIV A;  1UJ6 A;  1SC4 B;  3CJ3 A;  2PDA A;  3EJM A;  3CDE A;  4LFA J;  5L1K A;  4YUD A;  1TKT B;  1CQN A;  1MSW D;  1HAR A;  1S6Q B;  4LRA A;  2A6O A;  2UV8 G;  2V9W A;  1QDU B;  4USK A;  3BZQ A;  5A8R B;  3NOG A;  4DV3 J;  4WBF A;  4DI6 A;  2R7T A;  1WEZ A;  1U0H A;  1OSC A;  3SV3 A;  4KY3 A;  2H4W B;  2QX0 A;  3D68 A;  4KPY A;  4MTP A;  5T41 A;  3P5B P;  5E41 A;  3FZB A;  4F67 A;  1MLA A;  4DF4 A;  1UZD A;  2D41 A;  1RAF B;  2ZUA A;  3PEH A;  3K7R A;  3TAN A;  4KHP J;  4RU9 A;  1SC1 B;  2YKM A;  2XMT A;  5B0C A;  1HMV B;  3PRD A;  3DLE B;  5HQL A;  2YX1 A;  2HS4 A;  4NZ7 A;  3I0S B;  4QYR A;  3GSI A;  3G8Q A;  8ATC B;  4JI7 J;  4CH0 S;  4LBI A;  3MF5 A;  2FZG B;  1H98 A;  5IOL A;  1I5O B;  4Y3C A;  2QTW A;  2IY5 B;  3LAK A;  4P52 A;  2YXL A;  4C8M A;  3PV8 A;  1IWA A;  3ZTS A;  1P27 B;  3TEH B;  4CZC A;  3Q8Q B;  4C0O C;  4Y65 A;  4CYU A;  1VQ8 S;  4JUZ A;  4JV1 A;  2EW9 A;  3R6G B;  1OMS A;  2CRL A;  4E8U A;  3LPY A;  2J9E A;  2VG7 A;  5K8N A;  1RCO B;  3P8B B;  3GJR B;  5D78 A;  2YPY A;  2IMO A;  3W8P A;  1YHQ S;  1U6B A;  4RBU A;  1T11 A;  4KFB B;  4WFY A;  5B7W A;  3JSM A;  3HHD A;  1VQL S;  2KHD A;  1HWI A;  2KKH A;  2EBE A;  4O44 B;  1DAR A;  3M8P A;  1N8R T;  5KFQ A;  3CTR A;  3MMJ A;  1RQ0 A;  1JLA A;  2IBO A;  3I87 A;  4Q0B A;  3EZO A;  4B9T A;  2GQC A;  3CCL S;  4EZ6 A;  4WCE Q;  4K5S A;  4KE5 A;  1WC4 A;  4QBU A;  3A13 A;  3PNI A;  1RWU A;  1CLF A;  2HZV A;  4F4X A;  4KH0 B;  5H9F J;  1R3N A;  2FUG 9;  2JC0 A;  4MIW A;  3L7U A;  3A8E A;  5E3A A;  4P75 A;  3H4B A;  2M8H A;  3WDO A;  1TK0 A;  4ED0 A;  2GAH C;  2BUN A;  1S76 D;  3W9J A;  2QRR A;  3MMB A;  5LSR A;  4ECX A;  2H48 B;  2D3Z A;  1TAU A;  4ICL B;  1RHK B;  1UJ5 A;  2YNG B;  3GIJ A;  1YZ6 A;  4NI2 A;  4W92 B;  1L3K A;  9RUB A;  4R0E A;  3LWM A;  3DI6 A;  2NRE A;  2A18 A;  1TL1 B;  2O1P A;  4HVZ A;  2N82 B;  1JQG A;  1F2G A;  4RW6 B;  4AT1 B;  3L4B C;  5CYM A;  3AD7 C;  2F8M A;  2VPY B;  2KRB A;  4V1A k;  5KFB A;  4N56 A;  2DCL A;  1Q1K A;  2MGZ A;  2NXE A;  3AH6 A;  5FLX Y;  1FJG F;  1RT7 B;  2OEJ A;  2BQR A;  1SH3 A;  4RW4 B;  1Z2L A;  2KT5 A;  3S6E A;  2LMI A;  1UVL A;  1S4E A;  1U24 A;  1UW4 A;  5IV4 A;  4YB7 A;  2VG5 B;  4QW9 A;  1P1L A;  1IQT A;  1WI6 A;  2CQG A;  3L09 A;  4WZQ A;  1BQN A;  5AE1 A;  1QAI A;  1JMT A;  3M7V A;  3C19 A;  3EYZ A;  2HHW A;  4JI6 F;  4JOU A;  5KT4 A;  3TUI C;  1FDN A;  3DOK B;  4KIA A;  2VIC A;  4PQU A;  4QZV B;  3M8Q A;  4I64 A;  1H38 A;  1RBO B;  1BD6 A;  1QVG R;  3GLJ A;  3C66 A;  4DV0 F;  3LQV A;  2LKZ A;  2MKK A;  2YKQ A;  2YKP A;  2YQ3 A;  3ZNJ 1;  1N33 F;  5ITH A;  3M30 B;  3PHE A;  2MZQ A;  3EGW B;  4DL5 A;  1RJJ A;  3PKM A;  4OI4 A;  2CJY B;  1D9A A;  4PXE A;  1N54 B;  5A0Y A;  3UCG A;  3THT A;  2KXH A;  2DGO A;  3DM2 B;  3V6D A;  1SCJ B;  1P9Y A;  1NJX A;  1JLF B;  1OYE A;  2RQ4 A;  2DY1 A;  4KH1 B;  1BHN A;  3IWL A;  2W1B A;  3EZU A;  4RL1 A;  4PWW A;  1RAB B;  2ZBR A;  4UOF A;  3LGM A;  4DR5 J;  3VTI A;  2EC0 A;  2HFN A;  1RHU B;  1HHT P;  4F36 A;  3GB0 A;  2AJF E;  1HI8 A;  5LM7 E;  3OHB A;  1PKU A;  5C25 B;  1BWV A;  2MJU A;  4JBC A;  2IM3 A;  4LMZ A;  4AUK A;  1QUP A;  1Q8L A;  3T6J A;  1ZAW A;  4HHU A;  1JLQ B;  2G2O A;  2QC3 A;  1B99 A;  2JSX A;  4ZCK A;  3UQS A;  2CG4 A;  2RHQ B;  5LXR A;  2YKA A;  4S0M A;  2E44 A;  3D54 A;  3CGI A;  2KFN A;  3LH2 S;  3MI7 X;  2Y0S D;  3OFF A;  3QT8 A;  4LVO P;  5KG7 A;  2WTF A;  3QBC A;  4RBT A;  3V6J A;  2GO8 A;  2B9Y A;  1UW9 A;  4A48 A;  5FDL A;  2DGX A;  1RA6 A;  1YZ7 A;  5J1P A;  2YWE A;  2D1C A;  5ETT A;  1MMD A;  1T95 A;  4DLE A;  1SKR A;  1Q5V A;  2FZK B;  2HAF A;  3MM6 B;  5B08 A;  4RO0 A;  1DTQ A;  3NCP A;  2PI4 A;  2VH7 A;  3UN2 A;  3Q83 A;  5BR8 J;  2KG1 A;  3D0H E;  1ZZN A;  3FBF A;  4PAB A;  3W1Y C;  4UOH A;  1GMV A;  1X0F A;  2W9A A;  4MYU A;  1UMJ A;  4X4O A;  3CJS A;  4U95 A;  2AX1 A;  4DPW A;  3TP2 A;  4JI0 J;  5IT0 A;  1QTN B;  4Q2L A;  2JWN A;  1O0P A;  4C6A A;  4AD6 A;  2PMZ D;  2JEJ A;  2QMX A;  3FBC A;  4WKR A;  1DTT A;  2BAC A;  2FGO A;  3V4I A;  4DL6 A;  4ES1 A;  2B4O A;  1IM6 A;  4F02 A;  1RAO A;  5CD4 H;  3KK1 A;  4CLT A;  2WSE C;  2FLP A;  4BWJ A;  4JV5 J;  2CWX A;  4KTQ A;  4YN3 B;  3MM7 A;  3LF0 A;  3OBI A;  3ULH A;  4ZPC A;  2VDI A;  1GX5 A;  4DQP A;  5KFC A;  5IT9 U;  4B9V A;  4LR9 A;  1IWG A;  1T3O A;  4Y2M A;  1WOS A;  4PZV A;  1K1S A;  1OPI A;  3MR7 A;  1NPR A;  1VDH A;  3KLE B;  3KLH A;  1R89 A;  5KAK A;  3W5Y A;  1VRU A;  3P96 A;  1WF0 A;  2JOQ A;  1H2T Z;  1RT5 B;  2PSZ A;  4IG0 A;  2FLN A;  1ZET A;  5KFL A;  4TN2 A;  5J2N A;  2DR8 A;  1FVQ A;  3PR4 A;  1Z2Z A;  4KHR A;  1CJK B;  1YTY A;  3O5T B;  3RUB L;  2HPU A;  3CJK A;  5HMW A;  2F8E X;  1JJC B;  1Y3K A;  3I0R A;  4XDD A;  4LQ3 A;  2CVI A;  2HBY B;  3OTC A;  4DMZ A;  3SCL E;  3R3T A;  3RB3 A;  1S1X B;  5KG1 A;  3SDE A;  4B3T F;  4PPD A;  2R8G A;  3OL6 A;  4DV5 F;  2ASD A;  3MR5 A;  1D09 B;  3FSI A;  2FHM A;  1HIY A;  3TVY A;  4PG6 A;  3NLC A;  4ZPA A;  2UUC J;  4DV4 F;  3U1L A;  2VKR A;  2FHK A;  3RAQ A;  2AWZ A;  5D4P A;  2QA1 A;  3BJY A;  1ICE B;  2HND B;  4FKY A;  3QZ7 A;  3CMQ A;  4J9Q A;  4LF5 F;  2RIJ A;  4JI4 J;  1IBC B;  1LQ9 A;  3OR2 A;  2NUH A;  2JVR A;  1FEH A;  1RTD A;  3DC2 A;  4J9K A;  2GFF A;  2B5J B;  4UQT A;  4QCL A;  2G1D A;  3BSA A;  3GV5 B;  4RW7 A;  5KFA A;  2BJE A;  2RIL A;  4QWE A;  1U4B A;  4DSJ A;  1V9O A;  1ZPV A;  3H8Y A;  4TY8 A;  3UD3 P;  5L9X A;  4K2J A;  5E3R A;  2HHV A;  1YJU A;  1IBM J;  2E1A A;  2Y8W A;  2M4M A;  2E5L F;  1RI7 A;  2ASY A;  3GMG A;  1X60 A;  3KMQ A;  2QLJ B;  4H4K C;  1O6X A;  3OR1 A;  3O1L A;  3UDC A;  4DV1 F;  1VIX A;  4Y34 A;  2I6W A;  3GFZ A;  3DKD A;  1BGX T;  4KGV B;  4CT8 A;  3OHA A;  3G6V A;  2XHW A;  5U47 A;  4F4Y A;  1YBA A;  4F4Z A;  5SZT A;  2OPS A;  2UUA J;  3R2D J;  2FIU A;  1ZTW A;  4ITS A;  2IJN A;  2KTQ A;  1S7H A;  2DRA A;  1B4S A;  2YWG A;  2P5V A;  2UXB J;  2M2B A;  2ZDP A;  2FVS A;  4FS2 A;  2FVC A;  2YNI B;  4OI1 A;  1S72 S;  3UNG C;  1L3U A;  2FVP A;  2CQ1 A;  4KKO A;  3AJ1 A;  3R97 A;  4ZPV R;  4C7Q A;  4LSL B;  4Y2A A;  1VQP S;  1JLG A;  1Q95 G;  2J0X A;  4DUY F;  1PAU B;  1FD8 A;  1E6V A;  2MY8 A;  1LWC B;  2X51 A;  1DY3 A;  3DFE A;  1X4G A;  1WEY A;  3AOD A;  4FKX A;  5BYQ A;  2BRK A;  2WVF A;  4M5J A;  1FNM A;  2P9C A;  4UY8 5;  5HVF A;  1ZM3 A;  3HMJ G;  2VOP A;  2GHP A;  1PBA A;  4ZP8 A;  4CP5 A;  2XTJ P;  4LF4 J;  3O3L A;  3W2V A;  2R3V A;  3JTP A;  4ZVU B;  5F8I A;  2HRY A;  2XLI A;  1UET A;  3KLF A;  1IVZ A;  5FLX U;  2RKI A;  1A6L A;  3AOC A;  1U2C A;  2AZ3 A;  2ABY A;  1CUL A;  4WIQ A;  4C3L A;  3DYA B;  1FRI A;  2MZR A;  2E5H A;  2VU5 A;  4NA1 A;  3KHL A;  3CCV S;  3EZ5 A;  4RNM A;  4ZP6 A;  1RAE B;  2I5J A;  3K5O A;  3N5F A;  3TW0 A;  5AJ3 F;  2FJD B;  1UEK A;  2JDJ A;  1X4B A;  2QFJ A;  3GIL A;  3O6Q A;  5MAO A;  2J0W A;  1F9H A;  4NL5 A;  1BQN B;  4HDH A;  4I7F B;  4X65 J;  3VAF A;  4DX5 A;  4AE5 A;  4DOZ A;  2J8S A;  1MWQ A;  2OD4 A;  2HIQ A;  2ZBP A;  1KVK A;  4UZC A;  3TVK A;  2CJ9 A;  4WU3 A;  3R7B B;  4CDI A;  2BVZ A;  2H54 B;  5LSO A;  1X9S A;  4LFA F;  5C2G A;  2PE8 A;  4EWT A;  1QUV A;  1OY8 A;  3PG9 A;  4YR0 A;  4X4Q A;  1X5T A;  2JEF A;  4FXV A;  2GHV C;  1HQE B;  1SPB P;  2XWX A;  1S9G B;  4DV3 F;  4ZVP B;  4M5K A;  3E01 B;  1NHU A;  4DL2 A;  1QTM A;  1R0B G;  1SUQ B;  4N8N A;  3G8S A;  2HQF A;  3C14 A;  3NKY A;  5AXK A;  4QR0 A;  1PYO B;  3WX8 A;  4NLY A;  1P9Q C;  3ILL A;  1HNV A;  5E2Q A;  1M1K T;  2F7V A;  3BGR B;  3M9N B;  4KHP F;  4QQB A;  3HVT A;  4CNY A;  5J2Q A;  4ED1 A;  1DLO A;  2A3J A;  2C2D A;  3MCN A;  3DOM A;  3TAM A;  1TUW A;  2V68 A;  3IP0 A;  2M70 A;  2E5G A;  3NL0 A;  1NJZ A;  4XDC A;  4U6P A;  2FHJ D;  5IT4 A;  3Q89 A;  2MEW A;  4P2M A;  5KFG A;  3OTO J;  2KHC A;  5KG6 A;  2VFT A;  4CO4 A;  3LTO A;  2C2Z B;  2CFX A;  2GVD B;  1T9Y A;  4J9L A;  1MML A;  1Y5L B;  2HNY B;  4NLD A;  4R8U A;  1DQA A;  1TV6 A;  1YJ9 S;  2Y8Y A;  5ETM A;  4U67 Q;  2XUL A;  2YNH A;  1HW9 A;  3DLG B;  1NK8 A;  1BLU A;  1EP4 B;  5HVG A;  1VBY A;  2VDH A;  4F25 A;  2WOM B;  2WVE A;  4H4M A;  3OFE A;  3UD5 A;  1RT6 A;  3H5Y A;  2MZ1 A;  1HBN A;  2D74 B;  2DIT A;  3OL7 A;  5C24 A;  2XCA A;  1S1T B;  3VWS A;  3MPY A;  2G0C A;  2DCU B;  4OZ0 A;  1RU1 A;  1HHS A;  4LSZ B;  1RHR B;  1K8A T;  2ZE2 A;  3I5C A;  3T1Y J;  3DDI A;  4I2Q B;  3M9M B;  3LP0 A;  3AD8 C;  4WJB A;  5J2M B;  2C2K B;  3T1H J;  2R2U A;  5THW A;  3U02 A;  2ZZT A;  3SCK E;  2HFZ A;  2O67 A;  3V2U C;  1NK4 A;  2CAD A;  5ETS A;  3BKU A;  5IWA J;  3LUY A;  1B0P A;  4LR8 A;  2C2E A;  1BXN A;  3OT9 A;  1KQF B;  5DLF A;  1I6J A;  1HI1 A;  1V5V A;  3M8R A;  1LEO A;  2HVH A;  3E8O A;  3HI9 A;  4HR2 A;  5GAD U;  4ZKA A;  2BA9 A;  2X3G A;  4F50 A;  2AHO B;  2ADC A;  2KXN B;  1X9M A;  1FI4 A;  4FPI A;  1NSA A;  5GVQ A;  1X4H A;  2CWK A;  4OYA A;  4URS A;  2QEX S;  1V3S A;  2FPH X;  3KK1 B;  2F9J A;  4NLG A;  5B0D A;  3DRY A;  1SVD A;  2V8P A;  2MQQ A;  1T7P A;  2ADB A;  3A8I A;  3NBP A;  2HFS A;  4PAA A;  3G71 S;  2V94 A;  2AF6 A;  2BX6 A;  5MLC V;  2HMI B;  4B9U A;  3D0I E;  2QLW A;  3I96 A;  4CH7 A;  4N77 A;  2C2R A;  4ZPB A;  4EO8 A;  1LXJ A;  5KFR A;  4IFV B;  2W2N P;  3U1M A;  3KLH B;  1SJQ A;  3OTE A;  4NA2 A;  3LOU A;  2J7U A;  4RW8 A;  4WK3 A;  1RT2 A;  2HHU A;  5L46 A;  4QIG A;  2NZ4 A;  2R2R A;  5J2N B;  2B4U A;  3VV2 B;  4IOA Q;  2B7C B;  3TZZ A;  2W9B A;  5D0H A;  4IRC A;  2PD1 A;  2YX4 A;  1RHM B;  2ACM A;  1X7V A;  3CJK B;  4O4G A;  4FP9 A;  2DO0 A;  1L5U A;  4NYZ A;  2V4J A;  5T7L A;  1T05 B;  2FJW A;  3DRS B;  3G82 A;  2PEH A;  2G4B A;  3M6X A;  3JTN A;  4PWD B;  1XTZ A;  1M5H A;  3CPW R;  3I9Z A;  5C7P A;  3MTJ A;  3OSP A;  2Y0B B;  4B08 A;  3OQ2 A;  2BE2 A;  1HWJ A;  4AL5 A;  1C0T A;  1HQU B;  5HRO B;  2YWW A;  1HKA A;  1FRL A;  2AYM A;  3MAQ A;  3D5M A;  2IAJ A;  2VA3 A;  2K1R A;  1AB8 A;  3EX7 B;  2ZD1 A;  3R6L B;  1SJ4 P;  4G1Q B;  2ATC B;  5K14 B;  3Q2S C;  2BJ9 A;  2J6S A;  3D1Q A;  2BW2 A;  4DFJ A;  2QYC A;  1JX4 A;  5BJR A;  4OI2 A;  5B0E A;  2VOD A;  2O01 C;  1WJ9 A;  1RP5 A;  1CS4 B;  3J7Z T;  2L48 A;  1JK9 B;  4OJ1 A;  1TQL A;  1B7Y B;  5KT3 A;  1GXL A;  3V6K A;  2UVW A;  2DGT A;  4HTJ A;  3Q8V A;  2RUS A;  1Y10 A;  4B02 A;  1TUG B;  3T6B A;  2PFF B;  1FXD A;  2MKJ A;  1VJW A;  4ED8 A;  1MW7 A;  4H4O A;  5A8W A;  1N34 J;  2VIH A;  4ZJL A;  5JVH Q;  2OKQ A;  1R8A A;  3EPI A;  4NLW A;  1TKZ A;  4AXI A;  1HBM A;  1B70 B;  2EVZ A;  4DR5 F;  4CO5 A;  5KFJ A;  2GC8 A;  2DEI A;  5HI7 A;  2AYG A;  3QZ8 A;  4PKD B;  5I3U A;  3M32 B;  1JB0 C;  1J5E J;  2NR0 A;  1JLE B;  3N5B A;  2F8H A;  4CLW A;  1UVM A;  1LKZ A;  1KD1 T;  1K0T A;  3WC0 A;  1HI0 P;  1TUV A;  1XR6 A;  5L9N A;  4ZHR A;  2GGP B;  4J91 A;  4OYM A;  3GIM A;  3V4M A;  2IA0 A;  3HZE A;  3CCZ A;  4BS2 A;  2CJQ A;  2ZH8 A;  1BMQ B;  4ZVE A;  4Y28 C;  2JEG A;  2O3D A;  2PN6 A;  1U1L A;  2ZIT A;  4JI5 J;  2MKH A;  4I1T A;  1OQ3 A;  1NO8 A;  2OHD A;  1W25 A;  2N4D A;  2DNG A;  4R0J A;  2AMC B;  1U1P A;  5A6W A;  2OEK A;  4FYD A;  2KO1 A;  2Q6B A;  4FN5 A;  1NK5 A;  2OTL S;  3A4T A;  3JSB A;  4J9U E;  1NSQ A;  1QE1 A;  4X66 J;  1ZYQ A;  2C1E B;  2WZ1 A;  2IRY A;  2PII A;  2PMW A;  3AB4 B;  1LK7 A;  4XTT A;  2OMO A;  2MHE A;  4K5R A;  2OGU A;  2ZOF A;  2DGU A;  4ZVG A;  2LEA A;  1N6Q B;  4TY9 A;  5D0G A;  2G13 A;  2J5A A;  2LA6 A;  4TQS A;  4UT4 A;  1UWB A;  4Q43 A;  3TJ9 A;  5CZV A;  3CUN A;  4DR4 J;  4Q44 A;  1Y7P A;  2EKN A;  4JI0 F;  2HHP A;  3DU6 A;  2CNL B;  4NCA A;  3ETO A;  3AB2 B;  2WW4 A;  2OI2 A;  3MMC B;  2J9D E;  5C42 B;  4R5P A;  2I5J B;  4EO6 A;  1H2U X;  1VHF A;  1AFJ A;  4P9S A;  1FKA F;  3H42 A;  1HPZ A;  3IM9 A;  1CJV A;  1XMO J;  2CZ4 A;  4JV5 F;  2GJF A;  3GJQ B;  3I5A A;  2WON A;  3OFG A;  3QJJ A;  3HF5 A;  3SI8 A;  3CJ0 A;  2ZOG A;  1REG X;  1SKW A;  4USH A;  2WW8 A;  3VAM A;  3MPD A;  2BZ2 A;  3HO1 A;  4K0K F;  1TAQ A;  4USI A;  1CC8 A;  4I2P A;  2KH9 A;  1P8G A;  5HLF A;  4CLK A;  2COL A;  3J81 j;  3AQO A;  3BF4 A;  4NMX A;  1CEZ A;  3MEC B;  1XMB A;  5DDO C;  2XZW A;  5CCM A;  1Y5I B;  1N0U A;  2AGO A;  4A8Q A;  3DHX A;  3R1L A;  1SJF A;  2HUR A;  4K4W A;  3NOC A;  2IJF A;  4CO1 A;  5T14 A;  2CJX B;  5HP1 A;  4FXW A;  3K5N A;  1TFW A;  2VF3 A;  3TO8 A;  4DZ6 A;  2R8I A;  2BKN A;  3B6B A;  1T03 B;  3CJ2 A;  5KFD A;  3DOM B;  3TAM B;  1S9E A;  1H3D A;  1WAC A;  1PC5 A;  3VGS A;  1YWX A;  1NB7 A;  2F5G A;  4KHM A;  1VRQ C;  2UUC F;  4K7Q A;  2AYB A;  2QE5 A;  2DPJ A;  3R1H A;  5CAA A;  2YVS A;  5F8H A;  4OZ1 A;  2GIQ A;  2FTR A;  5KFY A;  1SJ1 A;  4DJB A;  4YHH J;  4JI4 F;  1WG4 A;  5E7O B;  4FNI A;  4MFB A;  3MEE B;  4DSL A;  2MKC A;  3M4X A;  3M2V B;  3H25 A;  3H5S A;  4R8U B;  5KFK A;  3KK3 A;  1NXI A;  3RR7 A;  2YNH B;  3M2U B;  2AGQ A;  1SJR A;  2A2D A;  1CC7 A;  2D3U A;  2XI3 A;  1M1H A;  3THV A;  3DDK A;  4GO7 X;  2DR7 A;  3KNA A;  5LMN J;  3OVA A;  1S1W B;  3R5G A;  5KFF A;  3FEX B;  1CQM A;  1M5P C;  2ZJR Q;  3TZX A;  4B3M J;  3CCE S;  4OHY A;  3Q8R B;  5J2P B;  4DR2 J;  1IBM F;  2RT3 A;  2AT1 B;  4F4K A;  5F0W A;  2ZJP Q;  4DQR A;  5M2U A;  3CF5 Q;  4FXD A;  2VAS A;  2MSS A;  2G0I A;  3RG6 A;  3W2W A;  1TEL A;  3D4J A;  3CD0 A;  2H65 B;  3AXK A;  3MPV A;  2CNN B;  4F4A A;  1URR A;  4USJ C;  3BSC A;  5A8K B;  5I4M A;  1PIL A;  2K3K A;  2AJ0 A;  3C6U B;  1HWL A;  3C15 A;  1UFW A;  2UUA F;  1U45 A;  2M8D B;  4X4V A;  2BJ3 A;  3K59 A;  1C0U B;  3SSR A;  2LA4 A;  5KG3 A;  2IVF B;  3KMS A;  1BY9 A;  2UXB F;  1TK5 A;  4WU2 A;  4LVN P;  5EWF A;  2ZEJ A;  2M5Y A;  3F41 A;  4NEY A;  2RU3 A;  1YJ7 A;  3KLG A;  2DGS A;  1HL6 A;  1IKX A;  2DNZ A;  3UFC X;  3UCZ P;  4QU7 A;  1Y3J A;  4ECZ A;  3DRR A;  3F44 A;  2ZWP A;  2MQM A;  5LJ5 Y;  1IR0 A;  1MMN A;  1YJN S;  5CQG A;  2JJ4 D;  3FBB A;  4OZ3 A;  3HUL A;  5J1E A;  3FFI A;  3LGH A;  4L75 A;  4K4X A;  4G1P A;  3VVU A;  2NCK L;  4Y2I A;  3ISZ A;  2RU9 A;  4LF4 F;  3POT B;  2WB4 A;  2XG8 A;  1S6P A;  2XMV A;  1RT1 B;  1W2I A;  1S6O A;  1LW2 A;  2DNN A;  3NCR A;  2IM2 A;  4UUX A;  3OUY A;  3AJ2 A;  4NXN J;  4ZIT A;  1IJF B;  4ID5 B;  1B0T A;  2DD8 S;  2KZM A;  2V9K A;  2BKP A;  3U27 A;  4RUC A;  2MQ8 A;  4LSN A;  3HFZ B;  1BQM A;  3I32 A;  2XMW A;  2D9O A;  2MYF A;  1S97 A;  2CXE A;  4DS4 A;  3MOZ A;  5KTQ A;  4GC6 A;  2BV3 A;  4A8M P;  4MK7 A;  5B0A A;  4C11 A;  4DR7 J;  4U8V A;  3ISN C;  5CAB A;  1PG5 B;  5GME A;  4LFC J;  4X65 F;  2BAN A;  2QLF B;  4RW9 A;  4KJI A;  1F5C A;  3C16 A;  5L1I A;  4TNO A;  2K1R B;  4Y0F A;  1FF2 A;  4HI1 A;  4WYL A;  1MU2 B;  1HWK A;  3QRQ A;  3B54 A;  4IDK A;  4EMD A;  1XNQ J;  2HVI A;  4OX6 A;  1S1V A;  3ONQ A;  1H72 C;  1WOR A;  4TLR A;  2C22 A;  3M8S A;  4CM0 A;  3QGG A;  2DBB A;  3Q2T C;  1WHX A;  3R5J B;  4DPX A;  1FWK A;  3QQC D;  3TAP A;  2KYZ A;  3ISN D;  2B56 A;  4IFY B;  1NLK L;  1F0X A;  3PFE A;  1QY7 A;  3KHH A;  3IRX A;  3UN3 A;  1Q53 A;  2V0N A;  3VGU A;  2BOA A;  1TL5 A;  3FQK A;  1MRO B;  3M1V B;  4K4Z A;  2A0F B;  5BYR A;  2NSC A;  3W63 A;  2AQ4 A;  1HBM B;  1NKC A;  2KZZ A;  4NAS A;  1WOP A;  2OPQ B;  3FSY A;  3IMQ J;  4U9R A;  2HRT A;  3TNV A;  3OTO F;  1NKE A;  5A2Q Y;  2WVB A;  2GVZ B;  3GPA A;  3MCS A;  4ZHR B;  1IBL J;  2K7J A;  4FBT A;  3OXG A;  1T9V A;  4NPO A;  2V50 A;  2FY8 A;  4LR7 A;  1KP6 A;  1M5V C;  2ZHA A;  3SSS A;  3QT7 A;  3MM8 A;  3PR5 B;  2XY6 A;  2JX2 A;  4GKK J;  1Y0H A;  3SV4 A;  1WHW A;  3G96 A;  4KR0 B;  4ILL A;  3R27 A;  1S99 A;  3ZZR A;  3NMR A;  2F40 A;  1FRX A;  3E2E A;  3ZZU A;  5JJB A;  1QSS A;  1UPM B;  2L3M A;  4P73 A;  4YB5 A;  1YKW A;  3T1Y F;  5HAO A;  4C9D A;  4DU7 A;  3MFH A;  2MLY A;  3Q24 A;  2RS8 A;  3D6M B;  4FZV A;  2CNO B;  4RJV A;  3T1H F;  2DXD A;  2HK3 A;  1UWA A;  3S8S A;  2AJ2 A;  3EVM A;  2AEM A;  1QSY A;  2OPR A;  2ZH7 A;  4PRF A;  1BWE A;  3IO1 A;  2YNF B;  2EWH A;  2RD5 C;  3SCI E;  5IWA F;  3PX6 A;  2DXE A;  2XYG B;  1NK9 A;  4WE1 A;  3VR1 A;  1FKP A;  5AE2 A;  5FJ4 A;  4F2R A;  3QO9 A;  4YQW A;  4CO0 A;  1FK9 B;  3VGV A;  4O3Q A;  1WDT A;  2GIF A;  4KGX B;  1UL3 A;  3MZI A;  1NH7 A;  1GT8 A;  5IZH A;  2DNL A;  2C2M B;  4B9L A;  2B0G A;  3TX0 A;  4R5P B;  2FVR A;  3Q22 A;  2F65 A;  4CT9 A;  1AZS B;  4RUB A;  3LW5 C;  2ZH1 A;  1WC3 A;  2PO4 A;  4MJK A;  2HFU A;  1KWM A;  2YKN B;  3DLH A;  4HT5 A;  3BGL A;  3SXL A;  2V8H A;  3QIP B;  1WTF A;  4CWB A;  3I6P A;  4ED5 A;  1F3F A;  1VIO A;  4RX6 A;  5CA5 A;  3KG0 A;  2HWT A;  4DR1 J;  1RT4 B;  4DWI A;  3JYT A;  1WC6 A;  3HSD A;  1EIY B;  3DOL B;  4MKB A;  4B3O A;  3SQG A;  5KFU A;  1N88 A;  4P2S A;  3CDU A;  2IC3 A;  3R5A A;  3GG0 A;  1X31 C;  2RH3 A;  4Y2K A;  3MTK A;  4DUT A;  1WDD A;  2FLO A;  5K5M A;  3VZI A;  1Q4R A;  4V19 J;  1RWV B;  4P71 A;  3PYF A;  2DR5 A;  4LRC A;  1NDP A;  1RTI A;  1VK3 A;  3C3L A;  3UD4 P;  2J6T A;  4ZLP A;  4A8W A;  1FFS B;  2EXU A;  4IG3 A;  1AW0 A;  1MN7 A;  3E3X A;  3ZZZ A;  5HP1 B;  1UKU A;  4WFZ A;  4ATN A;  4HT7 A;  4DCP B;  3MM9 A;  4G1I A;  3G8T A;  3IM8 A;  4A8O A;  1F3V A;  2PT0 A;  3EE3 A;  5ETQ A;  4O0N A;  1IKW A;  2H3E B;  2MKS A;  3GCX P;  1YI2 S;  4UQG A;  1R8B A;  2BBE A;  1WC0 A;  5AXM A;  2YPZ A;  1HLW A;  3BQ1 A;  2ZH6 A;  1X4C A;  3L9Z A;  1FDA A;  1NH8 A;  3QSI A;  1S12 A;  3Q8S B;  3FZ2 A;  3IBW A;  4FBU A;  4QIW D;  3NY0 A;  2CPF A;  1VC0 A;  1VLY A;  5D0E A;  4DL4 A;  4NWB A;  5JMN A;  4B9N A;  1U0S A;  2W2P P;  1AXQ A;  1OWX A;  1Q16 B;  2QL9 B;  3PW0 A;  4GRS A;  3EM1 A;  3EIC A;  3PTW A;  3LPE A;  1JLC A;  4FF2 A;  4K8R A;  3K5L A;  1GMU A;  1M90 T;  4O23 A;  1KBR A;  1B0V A;  3DLJ A;  2FC9 A;  5ETO A;  3DMJ B;  1UVK A;  2HHQ A;  4CIO A;  1WG5 A;  1U1Q A;  4DG1 A;  2KM8 B;  1SQF A;  1N34 F;  1BUX A;  2QA4 S;  2VL1 A;  3J81 Y;  1PIE A;  1RSC A;  3N79 A;  4B9M A;  1U6Z A;  1YRT A;  3UVJ A;  1RAC B;  4ZIV A;  3AHP A;  1ZAV A;  3PRV A;  3F56 A;  3FEZ A;  4A46 A;  2R8J A;  2NXJ A;  2HQD A;  2VG6 B;  2KVQ E;  1J5E F;  2X7I A;  1OS5 A;  4YB1 P;  3BGO P;  5I42 A;  2MQN A;  4YY3 F;  3MM5 A;  1TL3 A;  2DNQ A;  3KLI A;  2LQ5 A;  2AV5 A;  1OPZ A;  5D4N A;  4NLU A;  4C8K A;  1S6U A;  3CO9 A;  5G4D A;  4MT1 A;  3RGI A;  5KOW A;  1AA1 B;  4YME A;  4UOC A;  1AFI A;  3CIZ A;  4GVL A;  2X1A A;  3ILI A;  4CLU A;  5D3G B;  1RAH B;  4K2X A;  3IG1 A;  4NLX A;  1VHI A;  2CPZ A;  4JI5 F;  3M6W A;  2IHR 1;  3PW7 A;  3DRP B;  4HAC B;  1HFE L;  3MMA B;  3HHL B;  1XNR F;  1HR0 J;  1NB2 A;  2C3Y A;  1Q79 A;  4FS1 A;  3DCA A;  2CQC A;  4BHQ A;  2RQK A;  1JJ4 A;  5M2R A;  1KEK A;  3W65 A;  4K4U A;  2HRU A;  4RWW A;  2W2Q P;  2EG2 A;  2GCF A;  4X66 F;  4DR6 J;  2WVD A;  2HGM A;  3KJV B;  3AOA A;  5DDP C;  1VJQ A;  1JKH B;  1NJI T;  4KSE B;  3DLK A;  2UU9 J;  3BYR A;  3Q8U A;  1G7C B;  2QT7 A;  5KFT A;  3MEG B;  2HNZ A;  4NX9 A;  1E6Y A;  3TR5 A;  2DHS A;  1N5Y A;  1U26 A;  3GYG A;  3UCU P;  4NCG A;  3T9N A;  2LP4 A;  1FNO A;  4XAK A;  4DR4 F;  3VZH A;  3T1A A;  4OX8 A;  4M5I A;  2VPZ B;  3OTB A;  3DGP A;  4DN9 A;  3OSN A;  1FDB A;  4MMO A;  3OVS A;  5DDR C;  3M2R A;  1YJR A;  4PUO A;  4HTI A;  5EWE A;  4DPT A;  2B6A A;  1XMO F;  3GYX B;  2CPX A;  3LP2 B;  3C6T A;  1QM9 A;  1RWO B;  5KFH A;  3GCW P;  5AE3 A;  2JHE A;  1X9W A;  4LFB F;  4F3Q A;  4LIR A;  4ZP7 A;  3C16 B;  5IT9 Y;  2AZ1 A;  3ZTQ A;  2DIU A;  3ENV A;  1RWW B;  3DHW C;  3SSQ A;  2X1B A;  4GMK A;  2R7W A;  4L6V 3;  1H7W A;  2IA6 A;  2B7B B;  4KC5 A;  1RT3 B;  1IKY A;  3N6M A;  5DZ7 A;  4MK9 A;  4CRJ A;  3THP A;  1VQO S;  3D67 A;  3T5J A;  3UO0 A;  2C28 A;  4GC7 A;  4UTG A;  5CZX A;  1KLM B;  1ZAX A;  3R5D A;  4LRE A;  5K8M A;  2BXJ A;  2KT3 A;  2GA7 A;  3G6Y A;  2Z4P A;  2W9C A;  2KB2 A;  1OYD A;  1HBO A;  3NGT A;  2YY3 A;  2I8E A;  2C3U A;  3OL8 A;  4JI3 J;  1HNZ J;  1JLB B;  1N32 F;  4GKJ F;  5HAT A;  2CZ9 A;  3BO4 A;  4NZ6 A;  1TVR B;  3TJ8 A;  5KG5 A;  4NML A;  3BSO A;  2KRR A;  4ZLN A;  3OL9 A;  3NWR A;  1BE4 A;  2C3O A;  2QA4 G;  1U47 A;  4Q45 A;  4HI2 A;  4ZN3 A;  4LF2 A;  1C4C A;  1X4A A;  4PQA A;  1DBD A;  5IM0 A;  1YRX A;  2H4Y B;  4J9O A;  1DQ8 A;  3BPD A;  5G0R A;  1HBU B;  2GAG C;  1C1B B;  5DDQ C;  5A2Q U;  3LAM A;  3NG8 A;  4W98 A;  1NK0 A;  4F4W A;  3A1Y G;  4M95 A;  2E5I A;  3GIR A;  4DUZ J;  4NCB A;  4TU9 A;  3QSY B;  4YHH F;  2AEF A;  1D9D A;  2RF2 B;  2QGF B;  2MXY A;  3OW2 R;  1ZS6 A;  4KRW A;  5GAE U;  4K4Y A;  2MJN A;  2KJW A;  2L08 A;  1J2V A;  2DEJ A;  2MQP A;  3A3N B;  1Q5Y A;  4NLS A;  3CIM A;  3O8W A;  3VGT A;  1RU2 A;  1SV5 B;  3QRP A;  2VB6 A;  3F0N A;  1GX6 A;  1U8W A;  3NGK A;  4B3M F;  1JXL A;  2N7Y A;  4UUW A;  3V81 A;  1C1C A;  1R6Y A;  1U09 A;  3BV8 A;  4DR2 F;  2BYC A;  5JVG Q;  2A6M A;  1H7X A;  4C8Z A;  5GAH U;  4IO1 A;  4L74 A;  3PW2 A;  2KL8 A;  4WTY A;  3QRR A;  3TJA A;  1WNE A;  1FKO B;  1UTA A;  3EVW A;  4EFA C;  1X5S A;  4YS2 A;  1ZA1 B;  2ZM6 J;  4OJG A;  2HHS A;  3GON A;  1TR0 A;  3FDS A;  3WIV A;  2KFY A;  4OZ2 A;  2BJ8 A;  4XPE A;  4N8O A;  2P6S A;  4OX7 A;  1ZTT A;  3CCT A;  1K0V A;  4N47 A;  4BDP A;  2ILY A;  1HYS A;  8AT1 B;  2BQ3 A;  2RNE A;  3J7Y U;  3ILJ A;  3K2Y A;  4KT0 C;  1BQX A;  5KFM A;  5EX0 A;  5DG8 A;  3H2U B;  3JTO A;  4M5G A;  1GXU A;  3ENQ A;  3QLH B;  2XZT B;  5KT6 A;  3WIU A;  1RHQ B;  1QAJ A;  4DN0 A;  1RTJ A;  1Z4U A;  2GQ2 A;  1L3V A;  1ARO P;  1KTV A;  5BYS A;  2MTL A;  1FRK A;  2BOP A;  5E0O A;  2DGW A;  4C4W A;  4ZVH A;  3W62 A;  3FKB A;  2XNQ A;  3IBF B;  4RPF A;  1VOM A;  3BH7 B;  4KGZ B;  4ILR A;  1XR5 A;  1S1U B;  5KG0 A;  1LWE A;  2QLB B;  2A2C A;  2D7S A;  1G6B A;  3QGH A;  1YQH A;  4UY8 T;  2Y1I A;  1EKS A;  2IYG A;  2LEB A;  3MED B;  3D3C J;  4C8Y A;  1GXT A;  4Q8E A;  3NNC A;  4NXN F;  3W7B A;  1QSL A;  1FES A;  3ITH A;  2HWH A;  4KV8 B;  1YJV A;  1RZM A;  1EX8 A;  1SI9 A;  3A8J A;  3MPW A;  2KM8 C;  1VQ6 S;  1CJT B;  1D1U A;  2QL5 B;  5KFE A;  2XEX A;  3UW1 A;  2BR0 A;  2PA8 D;  1FE4 A;  3B4M A;  2VZ9 A;  3G6E S;  1REV A;  1EB0 A;  4RR5 A;  5CYQ B;  5HMY A;  3FMB A;  4DR7 F;  3LP1 A;  4KQZ A;  2SXL A;  4CM2 A;  4ZIW A;  5H9E K;  4LFC F;  3SYZ A;  4LRF A;  4IRD A;  2NLW A;  1T94 A;  4QU6 A;  2QSW A;  4OQJ A;  3CCQ S;  3MXH P;  2R42 A;  1XNQ F;  2FZC B;  3KNG A;  2HLU A;  5EN1 A;  1H2V Z;  2KDO A;  3KJF B;  1JNR B;  4ZVT B;  3W61 A;  2XSJ B;  1TKT A;  2KG0 A;  2K3I A;  2AJ4 A;  4WFA Q;  1S6Q A;  2MZT A;  3J7Z 5;  2OPP B;  5B0B A;  3HHL C;  2X1F A;  2VKZ G;  2DK2 A;  1VC6 A;  2NZC A;  4ELV A;  2E29 A;  2B4P A;  1WKL A;  3U1N A;  2FJX A;  3M8Z A;  2W2O P;  1D9F A;  1RAJ A;  4IRK A;  1NCL A;  1RTH B;  3QID A;  3J81 U;  5E33 A;  4CNZ A;  1M1G A;  1N0V C;  4EGL A;  4HHH A;  2Z2M A;  4WP8 A;  4DBQ A;  3NWG A;  3QAU A;  2QV6 A;  3OLA A;  3PYG A;  3CC4 S;  1ZPW X;  1S0O A;  2HGL A;  2DNK A;  2QA2 A;  1HMV A;  2BJD A;  3KK2 B;  3J7A 1;  1R8P A;  2LCW A;  4NLR A;  2DKO B;  1KOO A;  1WWH A;  2XYH B;  2C3P A;  2RE1 A;  4WWS A;  4X4S A;  3I0S A;  2LU1 A;  1KON A;  3HHL D;  4X4P A;  2QMU B;  1LWF B;  5D6G A;  5ETL A;  2RSQ A;  2AIR B;  1IBL F;  3H2L A;  2APO A;  1P6T A;  1LW0 B;  1SIW B;  4MAK A;  2AJQ A;  1NAQ A;  2QYG A;  4ZDN A;  5ETV A;  2XLJ A;  4O3N A;  3W5Z A;  3D7S B;  3UR0 A;  1SKS A;  3ZZT A;  4GKK F;  3MUV P;  4ECU A;  4WZM A;  1VQY A;  2VON A;  2ROE A;  4JV0 A;  1G4C A;  2F9D A;  4I68 A;  4IH5 A;  4ETX A;  3OTD A;  3CC2 S;  1TKX B;  3EMT A;  3TZW A;  3MAA B;  1NU4 A;  3KHG A;  4F7V A;  3KUE A;  3HHK A;  3KDN A;  4RNN A;  1UZH A;  1IKV B;  2QSF A;  1GMW D;  2E7V A;  1FNX H;  1S0N A;  1WC5 A;  5KG4 A;  4CO2 A;  3RTV A;  4DX6 A;  2DNO A;  1GH8 A;  4K50 A;  3BBC A;  1D3W A;  1YK9 A;  4UW2 A;  1WUU A;  3CJ8 A;  2BM1 A;  3FRZ A;  2HFO A;  3RRH A;  4OI3 A;  2NYH A;  1OY6 A;  4IR1 A;  4KFB A;  1CJU A;  2DR6 A;  3CUL A;  2C42 A;  3B78 A;  4LF6 J;  3HD1 A;  4O44 A;  4XIU A;  1WHY A;  4DSF A;  5AXL A;  2EFG A;  4AQY J;  1KS2 A;  2XGP A;  2AYE A;  1AUD A;  3MUR P;  3LWL A;  1X8D A;  2CPD A;  4Z7Y A;  3BGF A;  1S9F A;  1EET B;  1S10 A;  2EKY A;  2RQC A;  4EU0 A;  5GAG I;  3CSK A;  2HK2 A;  2JNJ A;  1QJH A;  4P2X A;  1O51 A;  1DRZ A;  1FRM A;  1N4L A;  1H73 A;  4M5L A;  4C98 A;  3W9I A;  2JEI A;  2OD6 A;  4P6Q A;  2R9L A;  4DHV A;  2Q79 A;  5B0F A;  5IFM A;  2VFR A;  3PYE A;  3QAT A;  5D77 A;  2FY1 A;  3OXF A;  2ZH5 A;  2NQP A;  4Q7A A;  1X4D A;  4USM A;  4AL6 A;  4FYY B;  4ICL A;  2ZC4 A;  3I82 A;  2YNG A;  3BSN A;  2M3D A;  1R6V A;  1TMM A;  1EAY C;  1U0H B;  4KGM A;  2HS3 A;  1K44 A;  1TL1 A;  3PEJ A;  4J9N A;  2LDY A;  2R7V A;  2W4C A;  4DZD A;  1UFL A;  3D6F B;  4NYO A;  2X1G A;  2LFV A;  4H4K A;  4OYI A;  4RW6 A;  1RBA A;  1UEU A;  3SMZ A;  3W9H A;  2FQQ B;  4EZ9 A;  2DR9 A;  3IWX A;  5L39 A;  4ED6 A;  2YKM B;  2ZHB A;  3PX0 A;  1NK6 A;  2Y3Y A;  4PYA A;  4JB8 B;  3QPI A;  2Z2Y B;  1RT7 A;  3R7S B;  1R31 A;  3CCU S;  2WAQ D;  4RW4 A;  2R2T A;  5CHC B;  3NAH A;  4AFF A;  5JUM A;  1U48 A;  4JI8 F;  1FTR A;  1T9T A;  4WXW A;  1PAE X;  2DHH A;  5HL7 Q;  1NKB A;  1SC6 A;  5AT1 B;  2VG5 A;  4L72 B;  1RWN B;  3PJW A;  4KO0 A;  1XBW A;  1N36 J;  4TU8 A;  1FTC A;  4RBV A;  2DGQ A;  4ERD A;  2M9K A;  2HVE A;  3MUT P;  5LOQ A;  4LUB A;  3DOK A;  3SCJ E;  2MST A;  4CYU B;  3ZXW A;  5IS2 A;  2WBM A;  2JLE A;  4TYA A;  1AUS L;  5GAG U;  1GAO A;  2D9P A;  4QPT A;  4ZLJ A;  5E3C A;  2YKO A; 
#chains in the Genus database with same CATH homology
 1EKR A;  3JQK A;  1EKS A;  2IIH A;  2OHD A;  3JQJ A;  4FDF A;  4PYA A;  4PYD A;  2IDE A;  2EKN A;  2EEY A;  3JQM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...