3JQQA

Crystal structure of the h286k mutant of ferredoxin-nadp+ reductase from plasmodium falciparum in complex with 2'p-amp
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
312
structure length
261
Chain Sequence
NFINLYTVKNPLKCKIVDKINLVRPNSPNEVYHLEINHNGLFKYLEGHTCGIIPYYNQRCARLYSISSSNNMENLSVAIKIHKYTNYGYCSGFIKNLKINDDIYLTGAHGYFNLPNDAIQKNTNFIFIATGTGISPYISFLKKLFAYDKNNLYNRNSNYTGYITIYYGVYNEDSILYLNELEYFQKMYPNNINIHYVFSYKQNTSFYVQDEIYKRKTEFLNLFNNYKCELYICGKKSIRYKVMDILKSDEKKKKRVHVEVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Plasmodium falciparum ferredoxin-NADP+ reductase His286 plays a dual role in NADP(H) binding and catalysis
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Oxidoreductase
molecule keywords Ferredoxin NADP reductase
total genus 74
structure length 261
sequence length 312
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2009-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3jqqA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 3jqqA02
4QHYA 2X3UA 5GV7A 3ZC3A 4AC9A 3CCMB 2QEXB 4G5GA 2YWHA 1EWYA 4K1XA 4LBVA 4M2LA 1VQKB 3U2QA 3LO8A 1I7PA 1F20A 2CNDA 3CPWB 4WQMA 1CQXA 2D74A 3G4SB 4ZCIA 4ZV4A 4TN1A 1W35A 1W2BB 1YI2B 1VQ7B 3W5VA 2OK7A 1KK0A 4NCNA 2EIXA 1K9MD 3ZBTA 1JJ2B 1YJ9B 3V76A 4HE6A 2BV3A 5JBQA 3LYUA 4TMZA 4YAWA 3WNDA 2BVNA 1VQMB 3WXMA 3W2EA 1W34A 1FDRA 1VQ5B 2BF4A 4DQKA 1EFTA 2BGIA 4LC0A 3CD6B 1WDTA 1FNBA 3AVYA 3MCAA 3WY9A 2OK8A 2J7KA 1ZM9A 2AHOA 4J0QA 3W2GA 2FX3A 2BMWA 1ZM3A 1OGJA 3LVBA 3WBKA 3ZZUA 4FK8A 1YIJB 3VNUA 3CW2A 2DETA 4RD2A 2YWGA 2XNCA 1G7RA 1AIPA 1SKQA 3CMAB 4B4DA 4FN5A 4IW3B 3VMFA 2XEXA 3CC2B 1J9ZA 3I55B 1QX4A 1NDHA 2PMDA 2BSAA 4PGOA 1VQNB 1YITB 1QUFA 5H59A 1XE1A 3AGQA 2CRVA 1KJZA 1QGAA 3FJOA 2QMUA 5THXA 1YJWB 1GR1A 3G71B 3OZVA 3U6KA 1EFCA 4ZGQB 2VNKA 3OW2B 1N8RD 4RCYA 1B23P 1K8AD 1KK1A 3OZUA 1BX1A 3CCSB 1EFUA 1TLLA 4U9UA 1FRQA 1VQ8B 1D2EA 1NJID 4ZGNB 1EP3B 4C0SA 1FNCA 1EP2B 3WNCA 4YAOA 2R6HA 4N3NA 3B78A 2QA4B 3E1YE 1GO2A 4PC3A 3CXCB 3AVVA 1Q82D 4G1BA 1GVHA 2VNJA 4YAUA 3CRZA 3QFCA 5KSWB 1KQSB 4LBWA 2NPFA 1VQOB 4QFMA 3VO1A 1U2RA 3W2HA 3P26A 1OGIA 1R5BA 3FPKA 4YALA 1QVFB 2E1RA 3P27A 1QFZA 2ZITA 3SJZA 3MHPA 1B2RA 2BGJA 4ACBA 3AVWA 4TMVA 3W5HA 3AVTA 3CCEB 5TV2A 1QFYA 3CCLB 4PC2A 1JA1A 1GAQA 3LRXA 3W2FA 2BPOA 2GQFA 1GAWA 3CCRB 3JQQA 3CB4A 5AN9A 1EXMA 2GPJA 1N0VC 1E63A 4YAFA 3B8HA 3CC4B 1VQ9B 3QSYA 1AMOA 4R71A 2QTZA 1QUEA 2BM0A 2OTJB 3ZZ0A 2VNIA 3I1FA 5FA6A 4EH1A 1YJNB 1IB0A 1QG0A 1QVGB 2DCUA 2PIAA 3QFTA 1KTVA 2B5OA 3CCJB 1OB5A 1ZM2A 1JB9A 4M1KA 1H42A 4RD6A 4AF6A 4C43A 1KK2A 1ZUNB 1M1KD 4M4SA 4TMWA 1TTTA 3ZBUA 1BQEA 1DG1G 4RD0A 4P3YA 4B3XA 3OJXA 3WBJA 1Q86D 3VNVA 2EFGA 4M0LA 1DARA 1JNYA 3JQPA 3WYAA 5TY0A 3CC7B 3OJWA 4RD4A 5HXBA 1S0UA 4DQLA 2QN6A 3ZZTA 2C77A 3J81k 1GJRA 1VQ4B 1OB2A 1S72B 1FNDA 2BN4A 2DEUA 5H5JA 1KC8D 4F7DA 1XB2A 5DSZA 2DY1A 4B44A 3CCVB 3I56B 3QFRA 4B48A 1QFJA 3B82A 4Y9UA 1Q7YD 3QFSA 1D8TA 1R5NA 4HE5A 3CMEB 1E64A 3CCQB 3CCUB 4PC1A 2RC5A 1M90D 4ACAA 1G7SA 2VNHA 4ZCMA 1FNMA 5EMNA 3U6BA 2DERA 2QDXA 1VQPB 1TUIA 2HCJB 4G1VA 4M53A 2C78A 4RCZA 4ZCLA 3QE2A 1F60A 4B47A 5GV8A 1FRNA 2VYQA 1H85A 4Q7JB 1KD1D 3JQRA 5TR9A 1VQ6B 4BPRA 3AGPA 4LBYA 4PC6A 4NBSA 1TVCA 1KK3A 1ELOA 3E20A 1SM4A 2HMAA 4TMXA 3OZWA 4MYTA 1YHQB 3MMPA 1EP1B 2B7BA 2XNJA 4FWTA 2RC6A 4P6VF 4YHBA 1Q81D 4LBZA 4Y7CA 1K73D 1KRHA 1N0UA 4H9GA 4MYUA 3G6EB 1E62A 2OTLB 1W87A 4TMTA 1IJFA 1DDIA 2B7CA 1IJEA 1D1NA 1CNEA 3ES9A 3W5UA 1R5OA 4B43A 4PC7A 4RD3A 1A8PA 4AF7A 3A1FA 2QTLA 1G7TA 2VZLA 3WNBA 1ZM4A 2BM1A 2PLFA 4UAJA 4Y9RA 2YWEA 1CNFA 4RD1A 4N3GA 1QGYA 3PENA 1G7CA 3AVUA 3VO2A 1QGZA 1BJKA 4RJLA 1HA3A 2YWFA 1JA0A 1VQLB 1QH0A 3AVXA 1BX0A 3W2IA 1UMKA 2HDNB 1DDGA
chains in the Genus database with same CATH superfamily
3I2JA 2AJBA 1IK4A 4LXTA 5BYKA 5KSOA 2X3UA 2Z0MA 1KZLA 3DV9A 1E1QD 1QOQB 3MCVA 1FL9A 3DVLA 4HVLA 1QZUA 1WOYA 1TEXA 2B25A 4HYEA 4IJQA 4ZQHA 1WMFA 2IDKA 3LF2A 2AL7A 4XZ3A 2KPOA 1N6OA 3F6RA 2YIMA 2FPOA 2VZ0A 2AC2A 3MQFA 3ZWMA 4A92A 2YQ5A 1ZAYA 1MBZA 2VYFA 3G9UA 1V5IA 2WZPP 3IE2A 3OCCA 3RK1A 2YWHA 1AXEA 1H2RS 2D59A 5JSYA 3RJMA 3RUIA 4AYWA 4LHYA 4YCCA 4QQNA 2XT6A 3JQBA 4HD8A 4I9FA 1CUJA 4IY1A 5SY6A 4BNUA 3B6KA 4LWOA 3E3LA 2FOXA 4NU0A 1IZ9A 4CHTA 2VHXA 5BOSB 5JBNA 5JAIA 1UAYA 3R7SA 1IHDA 3I4CA 4NI5A 1QORA 3T5BA 5JJBA 1N7IA 4COKA 3SSNA 1ADYA 1ZC3A 4JYMA 2JEZA 3G4SB 1E79D 4HGNA 2Q3DA 4KI7A 4IDFA 4BWYA 1KRWA 3I72A 4JNKA 1TZJA 4FEGA 3I6YA 4ZCTA 5CVCA 4L8VA 1E6WA 1E59A 2PPLA 3OVMA 3TFOA 1V5EA 5HVNA 1QHSA 4JB0A 1ZRMA 5D3ZA 3HKDB 5CH5A 2V7QD 4MLDA 2O7NA 1SIUA 3PFNA 4HDAA 3GFPA 1QIIA 1PT7A 4YDSA 6YASA 5MN4A 1IC6A 2AGVA 2Y0CA 3FBGA 1H69A 1PWHA 3EJWA 1GG2A 5G0VA 3VHLB 4BN4A 2ES4A 3S8EA 4MEJA 4AZSA 4EECA 1BG6A 2J41A 3HWWA 3RABA 4LRXA 2GVNA 4WKCA 1TDJA 4GW3A 2ZJ7A 5D1HA 5JBQA 4DRYA 1N07A 2O59A 3L8ZA 5C1IA 1VI6A 2XPCA 4EKEA 4TMZA 1U0RA 4K88A 1EX6A 4L3VA 4RKWA 3CE6A 3PHHA 1Y9ZA 2MYPA 4KGXA 2PX3A 1H05A 3K09A 2HQSA 4BX2A 3TRDA 3R23A 3Q9LA 4UUOA 1VB5A 4TTQA 2Q07A 3D6AA 4ND8A 3Q2IA 3NTUA 3T7KA 5F9HA 3ORRA 1B16A 1GGMA 4R8LA 3C8DA 4IZOA 3CBQA 4XM2A 2HMWA 4GLLA 3T7SA 5AW2A 1JIIA 2JVIA 4G3XA 5AI9A 3EVTA 3HKCB 1UADA 2YUIA 3K0AA 1VPEA 7REQB 3HUDA 2C2WA 1GY8A 1B42A 1CQWA 3C0KA 4E1BA 4U8GA 2NYRA 4X6XA 1C0PA 2GZRA 4MWGA 5C7IO 1KR2A 6ADHA 2OGSA 3UWOA 4REMA 3O8DA 3ONUA 1L3BA 4YRLA 1YTUA 1DQYA 2I55A 3EOZA 5LA6B 1XTQA 4MKZA 2JK0A 2K87A 3O94A 3HJFA 1XEWY 1XCBA 1WE2A 2NZYA 4U1RA 2QS9A 4Z7NB 1NJ1A 3BNWA 1G4AE 3H5TA 3H9JA 4QDTA 5TQJA 4CGYA 1VLLA 3GRZA 3FPCA 2P2NA 3CR3C 3HN6A 1RYNA 3SBDA 4YCBA 1CJUC 4MNTA 1EM6A 1GU7A 1NVWQ 3GIRA 1SZJG 1JAYA 2HA2A 4EEKA 2GEBA 2OSVA 3CVOA 2PUEA 3JX9A 5ALNA 2NU6B 3CTPA 1JQEA 1MW9X 1KVSA 1FQJA 1ZU4A 2PRSA 4UVEA 1GKLA 4Q9JA 5FBHA 4OLAA 2DH6A 1RQNA 2IYRA 1BLIA 1EGHA 1T36B 1LNQA 1U81A 2IGBA 1T4GA 2QA5A 4TMYA 5B58T 3T9EA 3UJHA 1N9KA 3LBNA 4YAIA 2DLDA 2IKSA 1W49A 2QN2A 1M54A 5BQXA 1PJAA 4Z7OB 3H5WA 4EHNA 1T5EA 2CD7A 3T1VA 4Y2RA 3B3GA 3V97A 1NF9A 2GYVA 3GBSA 3IQZA 3DE2X 3G5UA 1XRPA 3RTAA 2YFKA 4XCXA 1KDTA 1V5WA 3EFOB 1QHEA 2VSOA 1LKZA 3HP4A 3IDSA 3QPCA 2BH9A 2WF7A 4GPEA 4DMLA 1X7HA 1EHCA 4L6IA 4C0QC 4ZFNA 1FP4A 5BUZA 1NDQA 2OAEA 4NK4A 1M8PA 3PX7A 1M7GA 1Z6TA 4IH9A 2BFDA 3IP3A 5E7QA 5IKXA 1VPLA 3WLPA 3GAMA 5HYVA 1JKJB 1WXQA 4HXYA 2IZ6A 2HOQA 3K15A 3HP1A 4R2JA 4DLWA 1HE1C 2J0UA 3QHQA 4KSCA 2CFRA 5FI5A 1NB0A 1ENYA 1ODLA 1Z22A 3C3MA 1YULA 3HFSA 2QDKA 1YQDA 4BPBA 1KZ7B 1N5IA 5DRYA 4M37A 4JYCA 1IWPB 1LV7A 2A1TS 1NAIA 5BP7A 1HKUA 1P1HA 4P5PA 4DR2B 1B0ZA 1GL6A 2AX4A 2I1WA 2ZUCA 4UD2A 1P6XA 5CVVA 3SM9A 4DQUA 4I1IA 3QW2A 1U2EA 1NU6A 4F3CA 4EF4A 5ALVA 3BK1A 3U1VA 3HABA 2RD2A 2XUQA 4P86A 1VQ8B 2V8BA 1W5TA 2YHAA 4UBLA 1UPTA 3QHPA 2WF9A 1N1EA 4WLUA 1PE0A 3F6PA 3WB1A 1A7AA 1J23A 1BKDR 3TSCA 4PWZA 4JJAA 1FMFA 1T1SA 3NUQA 4W8OA 4H7KA 5AKJA 2PH3A 1CUGA 3QXSA 2FSPA 3AVVA 4DNPA 3C5VA 1JKMA 3WLLA 1DBWA 2W2KA 4QJ3A 1KS2A 4E09A 5DNCA 3W2TA 3QJYA 1G5RA 2W2XA 3QEMB 4C7KA 4EZEA 4TQGA 1ZESA 2RGNC 3ZLUA 5BW8A 3P0EA 4HNRA 2C59A 4WNAA 4JVLA 2X9NA 3PLRA 4FDLA 2R7LA 4GEGA 1AXRA 1P19A 3A0UA 3THWA 4Q3OA 1RRMA 2OBSA 3N2NA 4E6EA 1R4MA 1WHTA 4EGQA 1YQXA 5FEUA 5CVUA 2WR8A 1LVGA 1YBHA 1X7XA 2E4UA 3C4JA 1UANA 4HH4A 3A4YA 1JIXA 4CKEA 3NAZA 3AB7A 5T57A 4E14A 4FNOA 1JHAA 1HV8A 2AK3A 3OJCA 4MEBA 4BQSA 3H6KA 1EVZA 3L82B 1MIHA 1KDRA 4P7KA 3VUEA 2NNLD 1CXZA 5HDQA 2G83A 4PINA 3E82A 4XYBA 1YUMA 3QEBZ 4GSYA 3INNA 5FBWB 3GT3A 3LGSA 4LHWA 4BWGA 1DTWB 1V1MB 3GNLA 4I99A 4X93A 1YS1X 4KXXA 2G0NA 1KEKA 3AVWA 5LOVF 1O94A 4OYLA 4O2AB 4QOGA 3IEPA 4RZXA 1KTIA 2WLSA 5P21A 3SEFA 5LOVB 3UGTA 2NIPA 2XE4A 4WWHA 2CEAA 3U7HB 1QLHA 4H0FA 4ZVNA 3LT0A 4P3XA 1WDWB 1WVMA 4TVKA 2CWDA 1WL8A 2J6CA 3DO8A 4FILA 4ID9A 1RNLA 3WSWA 5CEEA 1ZGZA 3HA2A 1CJSA 3UPDA 3QX3A 1P5ZB 1Y89A 3EMBA 1RTKA 1H8EA 2QG6A 3NPAA 4PRZA 4XQ9A 4W8GA 3O3OB 2ASVA 4PV7A 3QUAA 1NWCA 3RUDA 4MRRA 4XKWA 3F6BX 1D1PA 3DC7A 4JT2A 5SYNA 1KAQA 3VNQA 3B5EA 3FCOA 1Z16A 1I80A 1PK9A 4YC7A 4FYWA 4D3YA 3CCRB 2X8JB 2XKKA 4AJHA 5LNK6 4Z4VA 5L95A 1PR4A 4ZCPA 3NOXA 2NO5A 1NMQA 3ZU2A 1RPZA 2CY0A 1DADA 3FZYA 4U7WA 5AKKA 4DRZA 2G88A 4N3BA 1CERA 3V1TC 1QCYA 3TINA 2HK8A 2RGNA 4DCGA 2IXFA 4MW2A 1C1DB 4XX0A 1OLSA 1YZUA 4YAFA 1CFZA 1X94A 2HZ7A 3HB0A 2CSXA 4G86A 3LQQA 3W8DA 3RSGA 1UT5A 1HKHA 3MXOA 2X9GA 4QKQA 1IEWA 4YP1A 3TKAA 5CG2A 5AVTA 4IV8A 1D1QA 5THQA 2VTDA 4AZ3A 1SQ6A 4D4MA 5FUBA 2OBXA 3W5SA 3EPRA 5BMVB 1X70A 1FP4B 5A9TA 4BLOA 3QEKA 1FSGA 3Q0TA 2TMYA 4BN0A 4HFRA 1JP7A 1AKEA 2PFGA 2I9KA 2FW0A 1V9LA 2VP9A 4DDTA 1CUDA 2CJXA 2V9PA 1LV8A 1KJQA 4PQFA 1XELA 1MHTA 5J3JA 2JARA 4TTVA 5U9CA 2QL7A 3EGEA 4EPRA 1ZM2A 3KEOA 3WRXC 2EZ9A 3HCNA 2CL5A 4L51A 5HOQA 3BMCB 1E2IA 1CTQA 4I6GA 1LWNA 3DHYA 3PDCA 1QRSA 3GDFA 1D2CA 1GA4A 1XNJA 1KK2A 4K6CA 5LA6A 4BNNA 3WL7A 5EQFA 2H2GA 3A2LA 2OZPA 2WSYB 5K2MA 1XRQA 2WWVD 4H59A 1E3ZA 3RIHA 2W2QA 2VCYA 4UBOA 5B3JC 2NV0A 1E2BA 2VAXA 2JI6A 2BY4A 1TGYA 1P9NA 3CGGA 3HHEA 4TRRA 4XKJA 1TA4A 3JYOA 3C3BA 2VXOA 2NZXA 3GMSA 4R1MA 4NNPA 4UAUA 4A23A 2PTHA 5LMUB 3P2EA 5DO9A 1IVYA 3GOQA 4H17A 4ZZ2A 3RJ9A 5HIKA 2X3YA 3NDRA 3H2IA 5EKXA 4KG7A 2BR5A 3EGVA 5TY0A 4L28A 5D1NA 3DHVA 5A1TA 1S0UA 3T1HB 4AZWA 3FFWA 2QMEA 1KZ1A 1WMDA 2B4AA 1WUYA 2CJWB 1L5HA 4F72A 3PEWA 2P90A 1CF2O 1ZCFA 1HTWA 3J81k 4G07A 2B3TA 4WZ6A 4CQLB 5I7RA 3N5KA 3HDVA 4MQUA 1BKYA 4CLOA 2F4VB 1Z8HA 4XX1A 3G7SA 4MA0A 1KC8D 3NOVA 1TA9A 4EPWA 3DMRA 4FVTA 1QTRA 3CTMA 1CRWG 4QNRA 3NHPA 3WK8A 3VHXB 3SVLA 5DSZA 2D6FA 1H5UA 1TAUA 2O54A 5K4GA 1IMOA 3QPWA 4N0PA 4Y2YA 1AA6A 1C9DB 2AZXA 1KC1A 2H11A 4B48A 3NNDA 3AIIA 5F5XA 2FPLA 2DFPA 4ETIA 5L4SA 4WZBA 3RHZA 4G5YA 1KI4A 1ZH4A 2X5JO 1FK8A 1W2WB 1UM8A 1GQQA 3HA7A 1NUAA 4B46A 3AINA 2QM3A 4R5MA 4AL4A 2VUSA 4AJOA 3ORQA 2OYSA 3G8DA 1OYOA 4BX8A 4E0BA 5KS2A 1PYGA 2DPLA 5JD3A 3KQPA 2IOQA 3CCQB 5EHGA 2JF0A 2PH1A 1USVA 2OY0A 3BJMA 2GSDA 2WWTA 1DO0A 1GQOA 3BWBA 1E1NA 4M6WA 3SZGA 4ASUD 4CTMA 2RC5A 2IV2X 1TYDE 3H6HA 4IIJF 1B8PA 1OILA 4I7EA 2AFIE 4HNAA 2H5JA 3GUYA 4MITA 4YQFA 4MYCA 5EMNA 3ASYA 3U26A 1ISHA 5EWJB 2P69A 4G1UC 3OX2A 1TB4A 1E6MA 1FFAA 2DBZA 3HY3A 2HBRA 4UE3S 2BCJQ 4H27A 3DNPA 5DOZA 1WW2A 3FDIA 3K09C 2OP0A 2IDJA 3TQFA 2IQIA 3JASA 3VYTB 1H9AA 2G71A 3EPPA 4L76A 3INYA 2WFZA 1G19A 4Q3NA 3CLSC 3TLZA 3NHJA 3GPIA 1GNSA 1IN6A 3ZK9A 1C9YA 2CKMA 2EWVA 4BNJA 2FH5B 2GHTA 2NLOA 4Q7JB 1XZNA 1NLMA 2O1SA 3DL4A 3PXXA 4QAQA 5CX1B 5BN4B 2FPPA 4AMBA 3IVGA 2J0QA 3ZDCA 4KWEA 3JVVA 2I67A 3U48A 3A04A 4RTSA 2PH7A 1S8FA 4CQJA 5TEWA 3SLRA 1QVVA 1XCMA 3KT8A 1Y34E 3H13A 1U0LA 3VTAA 4HUJA 1JSLA 2GA8A 3D9QX 2ANBA 1XWFA 4OPOA 3TTTA 3WYNA 4YQZA 3K2BA 5GONA 3U56A 2ZUEA 1Z08A 2WYWA 4TMXA 4OFWA 3D8NA 4RGQA 4ENPA 1C7QA 5EZ6B 5ERGB 3G2KA 2B7BA 2O48X 3ZI4A 2VBUA 2C7OA 2R8XA 2ZI7A 2ZUSA 4F7WA 2ZZEA 5CT5A 4DM3A 5BVHB 4B5KA 1WB4A 2H5LA 1HK7A 4EPTA 2ZULA 2QX4A 3D5QA 5DWQA 3THSA 1K0UA 1KI7A 2XCSB 1T0PA 2GILA 3HO6A 1Y6RA 3MTDA 3T41A 3GYGA 2O8EA 1WQ4A 5J2UF 4IOJA 2E4XA 3Q8LA 5CW2A 1GADO 4K87A 5DS0A 1T13A 4DDUA 2XDQB 4KUHA 3L46A 2ON6A 4HEHA 4QUGA 3W1EA 4V39A 1RLMA 2F48A 1WTAA 5LQSA 1BS9A 3JTEA 2WYIA 1NC3A 1CNEA 1P1RA 2I3ZA 3A6JA 3EYWA 1BXRA 1K3FA 4QNMA 4NMWA 3OEYA 4V0NA 3IHWA 1YS2X 2BTOA 4GLJA 4PS0A 4W7IA 2QTLA 2CZGA 1FFCA 1Q77A 2VQ3A 2R00C 4OMCA 5EMJA 5A2QA 2Z3VA 2QN9A 4QPZA 1HT3A 2ZT5A 3VFDA 3CZCA 4Z4ZA 3BFKA 3HZZA 5KYXA 2GXSA 3RRBA 2BKUA 2Y1DA 1B1CA 4TLMB 2WWXA 3PX3A 4BO6A 4BNXA 2ZSFA 1DWQA 4NX2A 2R4TA 3GJ0A 4A1OA 2H85A 5JDCC 2YXNA 3QBVA 3UWMA 4DCUA 1X7GA 3AF4A 2CLIB 5GJWC 3GLSA 1MG5A 2FFRA 1HE3A 2I8AA 3EDMA 3PC8A 1RM0A 2SBTA 2GK3A 2XUOA 4QQKA 1ZH0A 1ZNQO 2E5FA 5FPSA 1NXWA 2E55A 3MCZA 3U17A 1X19A 3NUGA 2WV9A 1QPBA 5E9AA 3UOAB 1SUDA 5KJEA 4RFSA 1QFXA 2K4MA 3GAFA 3E4CA 4YUXA 3OURA 4EMTA 1Y6ZA 2WTMA 1ZI6A 3B36A 4CBVA 2GA9A 3NG1A 4CN9A 1J39A 3HJAA 1HR0B 3GFQA 2R65A 1UPXA 4HADA 3A9CA 2ZCUA 3HXQA 3ROZA 3LQ4A 4PVDA 3MWFA 3ELUA 2PSJA 4LA4A 3HAGA 1F8GA 1E60A 3AR2A 1M72A 1XVTA 2NU7A 2V5VA 4FCTA 2SKCA 3AG6A 2YZMA 3HM2A 3OZEA 5L3VA 5C8YA 5JW6A 3WGQA 5AHXA 1TQ8A 3GFBA 3I6IA 3VZRA 1E94E 3KEGA 1QPZA 2VYNA 1T26A 3GLIA 1HE4A 2VF8A 5JI2E 3IUPA 1KEEA 4PABA 3IVMA 4GMFA 3C3YA 4BV3A 4KAAA 3Q3AA 3SHWA 2JJ1A 1O87A 1O8BA 3DXFA 4RZ3A 2NW6A 4YJ2A 1P75A 4MR7A 3AT1A 2W00A 2IODA 3EXEA 4JJ8A 2G6BA 3MM4A 2EFEB 3L0IB 4KFUA 4F9EA 1CQXA 3ROTA 4GWLA 3FTCA 2H5IA 1HDIA 4NPHA 1T9CA 2WV7A 1C1DA 3BWVA 1PGJA 1JEJA 5KKAA 3S29A 4H6WA 3IA2A 2A57A 4R9NA 1A5ZA 3IT0A 1R4AA 2WZDA 5L6MB 3FNGA 4K9NA 2PCJA 1QP8A 1WNFA 4FZJA 4LPKA 3E81A 4YGYA 1R50A 4PYRA 1U04A 4ZCSA 4DBLC 1FYEA 1X0VA 4YRBA 2WWYA 1E43A 2EERA 3TL3A 2KW5A 1QGUB 4TKUA 4NQRA 3VX3A 3PHLA 5FNVA 1SBQA 4UM5A 1GCIA 2O50A 2IYVA 4BP1A 1YJ8A 1VSVA 3PS9A 3ZHXA 2CMHA 3DE6X 3CYFA 4XYMA 3I53A 3DEHA 1XKXA 2PUHA 1NN1A 2WYHA 1OTYA 1P73A 3C6QA 3GLRA 3L5OA 3MCUA 3P2MA 3PL5A 4E07A 1HQYE 3P9XA 1Z8DA 4LJYA 5FHQA 4PGHA 1L5NA 1D4FA 3P0FA 3T54A 4W5RA 1CUZA 1SC6A 1G3RA 4OUKX 1YBMA 1Y5RA 3WTBA 4XUGB 5JNLA 1G66A 2FR0A 4BMZA 2MTBA 1ADCA 2XCOA 5DH9A 4OBXA 3CE9A 3IKMB 1R10A 3ASPA 2QIPA 2W6MA 2YWCA 1KZHA 1QHHB 1W5BA 3KHUA 1MJGA 4Y2HA 3ZDEA 4UPVA 4R6WA 3Q41A 5EUQB 5DYNA 1Q7GA 2WWFA 4MVCA 3CSDA 4MRPA 4PPFA 3O73A 4D74A 4DNTB 4OXIA 3VZQA 4NE2A 4Q7KA 2HGZA 1W36C 2YN0A 2YVQA 4G6ZA 2QJRA 5AKGA 1UPBA 3P9IA 2IJGX 3TMAA 2BD0A 1EVJA 4HAIA 3TZCA 1GOTA 1OZHA 1XZLA 3H2JA 4CCYB 1G8JA 2OB1A 4Q18A 3OKCA 2XQGA 2Z6VA 1NOJA 1DQZA 1JS1X 2YBDA 4YT4A 4JUDX 2LD4A 1OAOC 2Y92A 1ZN2A 3A9RA 4PR0A 4QOIA 2C5BA 3RSLA 1YF3A 3VDMA 4NCBA 2QD4A 5E4TA 3TM4A 4BHTA 2XCQA 3GRUA 4KR3A 1BA2A 2GLTA 1L0BA 3V9AA 4CEIB 5HZHA 3K94A 4F45A 2DB3A 3JATA 3WJ1A 2WM9B 4PX5A 3F71A 4MA5A 4E3WA 1UC9A 1RM3A 3H0CA 3IVCA 2IE8A 3LSYA 1QXSA 2E0IA 1CP2A 2XMDA 4LRUA 5EPUA 1G8PA 4H1HA 1YVPA 1EJ6A 1KBZA 5GGYA 3I01A 4MUFA 3VAAA 4AJEA 3E3OA 2P11A 3ZE0B 3IB6A 2QAGA 2P9EA 2GRUA 2QQFA 3A3YA 3DW3X 2ZTHA 3TLAA 5JPDA 1NT4A 4MGHA 4F56A 3PPVA 1YI0A 5DCUA 3ILSA 1JLLB 1TAGA 2FPIB 4HXFB 4F6RB 4MKRA 5L7TA 1DCFA 5A3VA 1H2EA 4TYMA 3PUHA 1VHDA 4MOWA 3I1YA 3NH6A 3K0BA 5ES4B 2OORC 4UDYX 1B15A 1QIMA 4MUBA 1K5GA 4ONEA 2IUSA 1A4RA 1TCCA 2IPOA 2Q28A 4IFTA 2POQX 2ONYA 3HKDA 4M9UA 1JHQA 4ZK2A 1LFAA 3SJCA 1MRZA 1HGXA 4HXEB 1IH8A 4GR4A 2QXYA 1JSZA 3EXHC 1YL7A 4Y0NA 4QD3A 2IWHA 2CEKA 2IA5A 1XD9A 2R86A 4H1WA 1HT2E 1IBMB 3LC2O 4V03A 2NU9B 9ATCA 2OZLA 3UFBA 1GNRA 2QL6A 2ZSKA 2DYKA 2CUTA 2ZROA 3AJEA 4MH0R 3LUBA 5CX1A 5J9FA 3ZX5A 1NUHA 4PLGA 5CVDA 5FWDA 2OXTA 8ABPA 1FW6A 3L8CA 4LTNA 3D3WB 3RM3A 4W1RA 1FF9A 4ND3A 5AHWA 4GYJA 1NBHA 3SBEA 3IP5A 4MQ4A 2GN9A 3TSWA 3AEUB 1AB5A 1ZG3A 2IELA 2P3MA 3BXGA 3QUQA 3IPRA 2EFDB 4HH1A 2HA6A 2JIDA 3TPCA 3LXXA 5KTSA 2CUNA 2I0FA 4CR7A 4PNPA 4CLHA 1C3OB 1JQLB 1JJVA 5HK9A 2XGGA 4MPRA 5HBRA 4PZ9A 5JMOA 4EY5A 3WQZA 4M1ZA 4RELA 4WNIA 2X23A 2VAWA 4GXQA 3GEHA 3GRCA 1UMBA 3F5MA 3KR9A 3EW9A 5HGXA 2GNPA 1IPFA 3EWSA 3EODA 4ZOAA 3OJ0A 1EP3B 3CUYA 3Q7SA 4BZWA 4OATA 1QH8A 4R1SA 4B40A 5CB6A 1CY6A 3GFTA 2R6HA 1T34A 4FN4A 2ZUVA 3BB3A 1P39A 4E2ZA 4DE5A 3PDHA 4M8KA 1NVAA 1UXGA 5BSRA 2X85A 3CXCB 4RK5A 4L0MA 3HFJA 3GLFB 1XA4A 3MOSA 4ZN6A 1P18A 1DXYA 1HLDA 4JSYA 3TCNA 4EI9A 4BVJA 2QF7A 1T5TA 3K71B 3INTA 4TLLB 4OFXA 2WUVA 1TD1A 2XQVA 1J22A 3MRXA 4HWSA 4WPGA 4X9XA 4RXUA 5D5PA 3CP8A 1TT5B 3Q3EA 1ZUD1 4KPFC 2CLKB 3ZHVA 5F9FA 3RLFA 4D9NA 4Z4FA 1UFOA 5FYQA 2P40A 3PRJA 4BO8A 4IVRA 3ETDA 3KKPA 4K46A 3RS8A 3ZVLA 1VJ0A 1O95A 1ZA1A 3JW8A 4KO3S 4TL7A 4UMVA 1I18A 1KZ9A 2BHTA 3KQYA 4J16A 4XOPA 2GMWA 2WJ3A 1M73E 2XYPA 1DRWA 3RT7A 4JLKA 3NDPA 5BN5B 1QFZA 3OQOA 3TJRA 4KIGA 1P2TA 1QK3A 2HDWA 1YACA 2XSZD 4GC5A 4XQFA 2OL4A 2E87A 2PM8A 3IO5A 5I7AA 4F84A 1N2GA 1GRRA 1U8AA 4GSKA 3GVIA 3SHOA 1EZ4A 5DSXA 4Q00A 3TNYA 3OTQA 3SLGA 2BSQA 3KQTA 3LY5A 2HMYB 2C8LA 3GBPA 4F2HA 1AUQA 2PQ2A 3C14C 2Q6IA 4LECA 4QTUB 3WGTA 4URFA 4F21A 5EQTA 2C4KA 1Y9JA 2DSTA 3HG7A 3ND9A 4OGFA 3WJ2A 4JJ6A 4O63O 3AFNA 5BR4A 3DHWC 1RJEA 2X8AA 4QPCA 3OJEA 4EATA 5BNWA 2ZBEA 4X8IA 3LRXA 3O9MA 5M3BA 1LTKA 1I4TD 4J9VA 4DDMA 4DLZA 4MQMA 3OQIA 5DX8A 4BKQA 2NV6A 3QUBA 3WR5A 4RDIA 1N1MA 2H1IA 2IXAA 4J94A 4JI8B 1EQ2A 1BWQA 1GGHA 1R0YA 2NZJA 4O4IB 1MDBA 1L7AA 4FUQA 3C3WA 2PKCA 4IS3A 4CMEC 1O4WA 2R6AA 3ZG6A 2FUG1 4UCXA 3QTBA 3OX3A 4ZRMA 4L95C 4E5SA 3GXOA 4UMEA 2E82A 4NU8X 3ZR4B 1FRVA 4O4LF 1OTXA 1XF1A 4FYJA 1X87A 1DO2A 3HJNA 3V5NA 1PDOA 3DTYA 1AZLA 3R7NA 2JD1A 5CA0A 1RPNA 4LHSA 3BWMA 1G8KA 3GB9A 3PL1A 1CR0A 1YGPA 2W6CX 4D5GA 2VQFB 4GFDA 2OCGA 3QWBA 1TTQB 2RCNA 4DV4B 1HVXA 1LPBB 4HVTA 4C76A 1JJFA 3KPUA 5D51S 5I4KA 3K5WA 5L4LA 3A9VA 3MWEA 1YJNB 1COWA 1BS2A 1CHNA 5IUNC 2BOVA 1U8YA 2F8LA 3VPAA 3NBQA 2PDAA 2FB9A 5BVGB 1MNQA 1E2UA 2QG4A 2SHKA 3DR5A 2NQ8A 4IQFA 1HO3A 2R9VA 1XD2B 3A10A 4QYXA 1KC3A 3C6KA 3OA2A 1KOLA 2ZYUX 5F76A 2PY6A 1PW7A 2W9XA 4NU5A 5FL7D 3AUKA 4F46A 5EHXA 1E58A 1EX9A 2YXEA 4GOOD 4KAXA 4EA8A 5I7EA 2C9DA 2PX5A 5AXAA 1QJCA 3ASQA 1V8BA 1YZVA 2BFNA 2HMVA 3A9SA 3EGWA 3PC7A 3QMVA 4KODA 3F6EX 3B7GA 4RHCA 5AT1A 4ZXFA 2QVGA 1BDHA 4MLPA 3LVQE 2DSNA 4PZYA 4UPDA 4AZVA 5CA0B 1VJGA 3VI4B 2E85A 4QEDA 3WOHA 2FWAA 1ADFA 3I1JA 3OFND 4AKEA 5JYCA 4KFCA 1DG1G 3KWMA 1E9BA 4ZYVA 1LB1B 2OBBA 4XLZA 3J80A 2C7QA 9ABPA 1Q14A 1UQRA 2D06A 5YASA 3TWOA 3OUUA 2ZIXA 3A1UA 5T6MA 2ATVA 4NHOA 2HJRA 1OX4A 3KWJA 3O84A 4Y2TA 5EY5B 1PEAA 2HK9A 5AUNB 1QLJA 1FMCA 5HF6A 3WZMA 3VKWA 4R8MA 3TFQA 4C5CA 4FWBA 4RW0A 1N08A 1KIFA 1OWPA 3B52X 3DPUA 3CC7B 1TF5A 4JVNA 3I34X 5EIEA 4NYIR 3FMOB 1PGPA 2IF2A 5JVDF 4D45A 1YDFA 3ZV5A 2JLAA 5KNDH 3ZH9B 4YYZA 3WLIA 1GYPA 3ANNA 4PRKA 2ZSAA 4G5QA 5EP1A 5C4GB 4BNIA 5JNTA 2UYHA 2QQEA 1GLVA 1XAGA 3FA2A 5HFJA 2IX3A 3Q5EA 3C45A 3UB2A 4PN3A 4DQ0A 3X3HA 4YV2A 1T8PA 5FPPA 3V33A 2FVGA 1US8A 2ZBUA 4S3MA 1BJTA 2B37A 1QF9A 1E1RA 1DQSA 1XZDA 3L6OO 4TT8A 1KZYC 4BNKA 4CM8B 1B00A 5ARBA 5F12A 3I56B 1LBEA 3G0OA 2QTBA 4ER7A 2NZWA 5CA1A 3KAQA 1V45E 3IURA 4R3WA 1Z0FA 1Z88A 2D54A 1O4VA 2OM2A 3A4IA 3BKXA 4LUCA 2XB2A 2FVXA 1CUHA 1EDZA 2J3IA 3DGFC 3UUWA 6AT1A 1IVSA 4AQYB 2E3JA 1N2IA 1Z36A 3MWJA 4TV8B 5EN4A 1QS0B 1PG2A 3SZ3A 3V4LA 3GDGA 4RKRA 3A58B 4ERNA 1V4VA 1PWZA 1DJPA 2V8OA 4XD7D 4C4OA 2XVYA 3PNLA 3GRPA 3DE1X 3DBLB 3OHSX 4NJEA 2XE7A 5FUWA 4AJLA 2V7QA 1RYFA 1ZH6A 3N8KA 1JKXA 1YRLA 3ROMA 1SBYA 3WVNA 1Y80A 2GOYA 2QMOA 1VSQA 3HBNA 5ENDA 4V0KA 4F1KA 4WT7A 1ENPA 4FLMA 1VQPB 1E7WA 3G6KA 1XZQA 3K2EA 4ITVA 4JWKA 2GPAA 1ND5A 5F4ZA 2WFLA 1H6BA 2M6RA 1VYHA 3E18A 3FGNA 1KZGB 1P7VA 3IH5A 5EWLB 2PQ6A 3WSVA 3PICA 4JKIA 3PDWA 3A3OA 2FLWA 3NXSA 4INJA 1G8MA 5DM60 4ZZ0A 2VSNA 3MWYW 4M76B 2MCFA 2Z83A 5K0BA 4Q1BA 1SQSA 3ABIA 1CDZA 4EFMA 3HKEB 2VH5R 1A50B 3EQZA 4PFSA 1BPLA 4LE1A 5IWAB 4YJ3A 5JNVA 4JT8A 1IZYA 3NBZC 4YJFA 4D9HA 5CYGA 5KU1A 1Z5UA 3DE5X 1AE1A 4OHZA 1OAKA 3QVJA 3LNCA 5KTOA 1TCVA 4OB7A 4ARCA 2QRPA 4A91A 5EMHA 2GSWA 4PC6A 3VR6A 3EXG2 3K35A 3WP0A 1AQNA 3RK4A 1MVNA 2YQ4A 3ZTYA 4L8LA 2JC3A 4M0FA 5DBHX 4HTAA 4XSHA 2AEJA 3GIDA 4UNSA 3T51B 2VP3A 2JA2A 1ELOA 3KOMA 4LVNA 4MWBA 4CG2A 4MUNA 1NNEA 4RM2A 3H18A 1Y0RA 4FYXA 1J42A 1J5PA 2C5EA 4ZI7A 3U7FB 4BEJA 1OGYA 3CCFA 5BUCA 1JTEA 2FAXA 3OZRA 1S4QA 2RC6A 2HRZA 2YS6A 1XU4A 1F6BA 1SPXA 4LCJA 2W11A 1WNTA 5CHYA 3GO4A 3AK4A 3EX7C 3TW4A 1L7QA 1EZ1A 3G2QA 4IIUA 4DR3B 4YJFB 4QUAA 1PJQA 2ODQA 3OQ6A 1N1DA 5CX4A 2B1RA 1HPLA 3CSSA 2V7BA 3EE6A 3P2JA 4G5FA 5GONF 2WEKA 4D4LA 1QKKA 2FQQA 3C5CA 5A89A 4O4IF 3NDJA 2HYDA 3MG9A 4N03A 1U98A 2ZRCA 1MC1A 1WUHS 4JLPA 1ZBDA 2EGGA 4OA8A 1TE2A 4KV9A 3TPFA 1NW6A 5JE8A 4BMVA 1BN7A 4OM7A 4XIGS 1MH1A 3TW0A 4PC7A 1N0HA 1LNZA 1BXGA 3IPXA 2P3SA 3SR4A 5A5GA 5FAXA 3PHGA 2VZLA 7YASA 1XDGA 1DJLA 3GVCA 4WKGA 2J30A 2PSSA 1XEAA 3OLVA 4IEEA 4UAJA 1ZMXA 1ZD2P 5DHQA 3EY4A 1LK5A 4PR3A 1LCIA 1E6CA 1Y81A 2HREA 2FW8A 3MGGA 3FNFA 1UKYA 1W5EA 5BRJA 3SHFA 2IXGA 2HSDA 1HNNA 4N18A 3ZD7A 1QVZA 2OSBA 3GOHA 1NLZA 1SG9A 4QXMA 1FFDA 1CW2B 1SOVA 2XEDA 2FX2A 1TGVA 4MDYA 1MO6A 2PGXA 1QV7A 3T7CA 2UUPA 1QH0A 3FHJA 2ZS9A 4BGUA 5FUQA 4FNAA 1JEYA 3W2IA 3NB0A 4B8WA 1SUAA 1JHMA 2I7XA 4QSHA 2WJHA 5SYMA 3ZBQA 3SIWA 1DDGA 1JWBB 1USWA 4Y3UA 2ORWA 1ZL2A 5DTEA 1FJ2A 2O1EA 3OFSA 5E95A 3WADA 4EAQA 5IZCC 3QUTA 1HOTA 1UKVY 3E23A 3PDIB 2FTKE 4MW9A 3NC1C 4P3NA 3WIDA 4EX6A 3C6YA 4KEAA 2XIQA 1U0OC 2DTDA 3VNSA 4AU1A 2HK7A 4X00A 3TFWA 1E98A 3EHEA 1ECFA 1EBFA 2CXPA 5IM4F 1NYTA 1GZUA 2GZHA 2KB0A 1W4CA 2W48A 4KOAA 4PF1A 3G02A 3MTIA 3HXPA 1E9FA 1NZJA 5B6JA 2J48A 4DR6B 1E3LA 3G0DA 5DIFA 4MX8A 3OQ1A 4OQXA 3E9RA 2IIVA 5E6RA 4CFSA 1FVXA 3PLAE 1T4DA 1MX1A 1ZGAA 4FS3A 4HWOA 2QSUA 1JFVA 4LCEA 1KF0A 4MVJM 1RQRA 1SB9A 1WZNA 1MA3A 1TM1E 3HVIA 4ZT4A 1K4MA 3UHAA 1UIRA 3QIAA 1FFBA 3HWRA 1CV2A 3MQ4A 4Q6WA 1X13A 3RUHA 4CEHA 2WVJA 3S2FA 3TAXA 3VZSA 3NASA 3RWOA 1RWKA 3ANYB 1NI4A 1Y8QB 3WGHA 3CVUA 3NVDA 2Q99A 4PG8A 1QGUA 4R1OA 5EXDA 1Q1EA 4CKBB 3C85A 2QZZA 3R6GA 1MAVA 1COWD 4D99A 2Y93A 5IJ9B 2EF1A 1IBSA 3OPYB 3HRKA 1Y0YA 1V16B 2RG1A 3NH9A 4FT2A 4CMJA 2N47A 4UREA 1FYFA 4URWR 2I7TA 2PWAA 1JVSA 2G06A 2NYVA 3BE8A 3OBIA 3QE0A 1P4GA 5SICE 4Q12A 4I50B 4P4GA 4C2BA 3GLGE 1R0CA 1YS4A 3BSSA 1IONA 1JG1A 3COVA 1RXVA 3JQGA 3KFXA 3NTXA 4UVDA 4GM1A 3B6MA 4M3NA 3SHTA 5EG5A 4REOA 3KKZA 1LRLA 2AJCA 2IX9A 4GMKA 4OHCA 3VSDA 1WZEA 1L5LA 4V3BA 4UQLA 3V76A 3BG5A 1TC1A 1V6CA 2XRMA 5ESXA 5CCXA 2FMHA 3ANMA 4ZKEA 1SOAA 4O2LA 1HEYA 1JEEA 3F9RA 4KH1A 4ND8B 3TSZA 4MR9A 4MYRA 4AMUA 5A4JA 3WNDA 1E2LA 1FS6A 1CZLA 1GFSA 4Q47A 5COBA 2I6QA 3K2QA 5G02A 1MABA 2O8VA 3W8NA 3ZD8A 3D8UA 1J1IA 5EIHA 1Y1SA 1PGOA 3D2BA 1KI8A 1OV6A 1YRQA 3B1ZA 4MV3A 1S4MA 1Q2XA 2HA5A 1H0SA 3M2PA 2E18A 2ZJFA 4LXXA 4Q1AA 2GTIA 2M9MA 3PWSA 1OXBB 1AURA 2VT2A 4GOND 4JP1A 3RYTC 3UOWA 4DVJA 3OE7A 2C3YA 2ZIGA 3DKIA 4GX2A 5K8JB 1O5TA 3CD6B 3LW7A 4H15A 2JLBA 5FWNA 4O4IA 1X0XA 4CIXA 3OHMA 1Z5VA 4RS4A 1RTTA 3FR7A 1UBOS 5M5BA 2FFJA 1CLEA 2AHOA 1TC2A 1WB6A 3NM6B 2VC2B 1XTPA 5G40A 2VZEA 1RXUA 4GGMX 2RBKA 4RDJA 1XZKA 4KBFA 3O2QB 4LY0A 4TKZA 4TQ9A 4LX0A 1C4XA 4MPTA 4MIOA 1AO0A 3L0OA 3P94A 1UBMS 5IBCA 2EKDA 1PL8A 1YB4A 2D1YA 2H00A 3WBKA 4FLFA 3A6DA 2W6JA 1GRCA 3CSUA 2MR6A 3ESXA 1ORVA 5AYVA 2DETA 4B6PA 1YK1A 2CCGA 3MTEA 3O1IC 3PCTA 1WD5A 1CIVA 2XNCA 1ESMA 5KC8A 1EVEA 5AKZA 4PHGA 4BVLA 4YV1A 4B84A 1QZXA 5EKUA 4ILEA 2QJWA 4BLTA 4WOJA 5BSKA 2QPTA 2G72A 2WT4A 4UJ5A 1J97A 5JISA 5HIJA 3WWPA 4IXWA 1PT6A 4G8BA 1QP4A 4D26A 4OAPA 3X2EA 4O29A 3H2SA 1BEZA 2GETA 1MFZA 3KZVA 4XPIA 1KP2A 2HTFA 2EGHA 3N2KB 5KNBD 2E21A 2F4NA 3CCCA 5D6OA 2QNRA 2PT9A 1FU4A 2ZIUB 1GHTA 3IUEA 1JYFA 1R0XA 3OLCX 4FXOA 3TXXA 2BZGA 3LTNC 2BMEA 4OMFG 3LKDA 5CRIA 5AJXA 3C97A 4KN9S 1WP9A 1MABB 1VG8A 5DU2A 2R96A 1PGQA 5KX5B 3U3ZA 3CNNA 2GJKA 3G9ZA 4IIHA 3D0OA 4BNZA 5KKCA 4AJPA 1EXVA 4ETNA 3O93A 1H3EA 1P4JA 2WG2A 2XB4A 3ACDA 4DA9A 1KQGA 1BCRA 5KQPA 5E7IA 3ZY4A 3OCXA 1D6JA 4BE7B 2DUWA 5CDFE 5EKDA 1CVLA 1CPYA 3HGTA 1DTEA 3VU9B 4KNYA 3HR4A 3NAQA 3NGLA 3D7RA 1XTUA 1R64A 3HR7A 3ISVA 4YRJA 5FYDA 4CF6A 1KWGA 2Q4BA 3HEBA 4Z4GA 1WCIB 2C97A 4LSMA 4IICA 1FXSA 4GPIB 2C29D 3BY2A 3CRMA 1FQWA 4QIHA 2G28A 4MGKR 4F91B 3RY8A 4YQYA 3LC0A 1G60A 1QC5A 2GFIA 1KSFX 1M2VA 1NJID 5F21A 4LDAA 2CF4A 1PNOA 5KQRA 3GFVA 5H9WA 1RXYA 2WA1A 3CH4B 1EFDN 4RZSA 3B78A 2WDZA 4ZOLF 3IJRA 1GPNA 4KR0A 2ATCA 3Q3JB 4QODA 5AM1A 3ZWAA 3ZLBA 1C3LA 3S28A 2QLTA 4II3A 1IHPA 1UK7A 2O2CA 1VCMA 3DBRA 4NP6A 5BNFA 2O57A 5SZIA 1HUQA 4BQPA 2DKFA 2PN1A 3OQHA 1BX3A 2G9RA 4Y2QA 3DE7X 1VI5A 4RJIA 5K0GA 2YINC 4ASUA 1WUTA 5ALTA 1E1CA 1T5OA 2WJAA 2WSMA 5DP1A 5IYZF 4CWAA 4F2DA 2XNDA 3QTTA 4XUCA 5TQ0B 3TLCA 1U65A 4Q3BA 3RUEA 4AF8A 4TUYA 4I4IA 3WYBA 4WUTA 5T41A 2V7XA 2V58A 2Y1XA 3QPVA 4J76A 3RRFA 4AJKA 4PAGA 1BN6A 4YRIA 2PXXA 4YRQA 3UC9A 4C9BA 3DDUA 4RA9B 1YOVA 3NHBA 3QUSA 1V37A 5BSGA 1KMIY 3NIGB 1JHOA 2F67A 2YXBA 1E77A 4RQAA 1XZHA 3E3MA 4RY2A 3S1AB 2KLBA 2FZWA 4RORA 4ZOQI 5AVYA 5L7YA 2A1TR 4ETWA 5KVVA 5LWQA 4ZTBA 1I7QB 4P4UA 3RSOA 2AR0A 1GNPA 3EW7A 4G25A 4PS1A 4MVJD 2BGJA 3SQDA 4ZAZA 2YNMD 2WP0A 3KXLA 2O7RA 4A2PA 1E3XA 4NZYA 3E4DA 3KTAB 4BEVA 4NHEA 5CLJA 4UJ3A 4ME6A 3FAKA 4DJJA 3ICOA 1VYUA 3U80A 1GDHA 3ZXIA 2XVXA 2I62A 5AW5A 3WQHA 4KWIA 3S44A 1JIJA 5BWOA 2OO3A 2OBNA 4URUR 3CEMA 3UJCA 1G6Q1 1P7ZA 2Y2UA 5DX0A 3D31A 3W5DA 3HK2A 1GAQA 2O8BB 1G17A 2HIGA 4UZUA 3PUNA 1XDUA 3PQFA 4BTLA 3TIGA 1BTOA 2BPOA 4OQNA 1XJWA 4DLNA 1RQXA 4EKGA 1BE6A 2H3EA 5DCWA 2NAPA 2KMLA 2WFAA 3CCBA 3JV7A 1GAEO 1GAWA 3BXFA 4YIKA 3QKTA 3FWZA 5AIBA 1IWOA 1ZK2A 2FX5A 4L4RA 2WVAA 4J75A 4LY3A 4W5NA 4L78A 3LOUA 2CHQA 1K75A 3JZMA 3R40A 2AVDA 1DLJA 4UNQA 3X2FA 2JL1A 1SRQA 3M3PA 3NTRA 4NYMQ 1XRJA 5KOHB 1Z6GA 3MD0A 4C20A 5GTDA 1NVEA 3CA8A 1Z26A 4PY2A 1EE9A 2G67A 1I2MA 5CBKA 5J5AA 2PSEA 1I7SB 1UMBB 1RBQA 3P2IA 3ZZMA 1Y5NA 3UWSA 1FC0A 1Y8RA 3A28A 4EKIA 1SELA 2P41A 3IP6A 2OTJB 4MJ3A 4XW2A 3PFWO 3BGVA 2YQZA 2HA0A 2QQ0A 4PXYA 2P2LA 3O4VA 3BXPA 3TRKA 5JAMA 1I51A 3K8YA 3LBFA 1HDCA 3KDAA 1JR3E 3AXTA 3I04A 4DG8A 4R81A 4GX1A 1CR4A 1KWKA 4RMHA 1HEIA 4MUIA 4NK5A 2JS7A 3SDZA 2VKTA 2GKOA 4Z4QA 4YEJA 4NU6A 4Q7MB 4LYAA 1RJFA 2PLAA 1RHUA 2VH2A 3QBDA 4MV4A 3DJYA 3NRCA 4E70A 5KHLB 1JHXA 4WV3A 3I83A 4K81B 1CQJB 4FR0A 5IM5A 5K3DA 4A0HA 4UOZA 5A5DA 5T6BA 1PFQA 1T2FA 2OD2A 1ZSYA 1CIPA 1FOEB 2AR7A 2B8EA 3KCNA 4RF4A 5CBPA 4OXNA 4QUHA 4A2QA 2EW8A 5KTTA 3TH5A 3UFXA 3VNVA 5D85A 2PE3A 1HXHA 3HKEA 3I05A 3IAXA 3QBEA 2XWSA 5IKMA 1GXSA 2AF4C 2MSCB 2ZJ0A 5DHFA 3RBZA 4MVJF 2EKPA 2ZOSA 3B1KA 1UXHA 4KMOA 4IFBA 1I8TA 1CR2A 3SEJA 2TSYB 4MRNA 3ZUPA 5AVQA 2I6XA 4RPKA 5JPCA 4JJEA 1ZEJA 1EJ0A 2R6FA 3R24A 5HMMA 5EIBD 3WIVA 3ZHSA 1Z8NA 3GUHA 4TTRA 3NVKI 2OQ2A 1I5RA 3WISA 3G5MA 4UM9D 3KV3O 3LWDA 4PO3X 2JGEA 1OB2A 2ZJ4A 1SVOA 4RJKA 3QE9Y 3EPHA 1DAIA 2IXDA 1EM8B 4B35A 4GKBA 2GYYA 4QQ8A 5KWEA 3Q7IA 3A1DA 4XDYA 2ZTUA 1C7JA 2QK4A 4V0OA 1M34E 4BMXA 1IM5A 1KA9H 1V2HE 3RGWS 3M5DA 1RRPA 2Y71A 4K2AA 4YJGB 3DMYA 3UMCA 5C1OA 1KDPA 1KORA 4DSAA 1A9TA 3LT2A 2BH2A 3OO1A 1RDFA 5BXQC 4RJ2A 4AVYA 2YIDA 3AETB 3IQDB 4YUZA 2PRYA 5ICGA 1KFBB 2E4WA 4Q4LA 3CMEB 1WJGA 4C4ZA 3RTEA 4EO9A 1U1FA 4UCWA 1WPQA 3ETGA 1UBFA 1U4OA 4MQ5A 5B1HA 4O3MA 1B93A 3HNRA 1VSUA 3JQ9C 1XEXA 2VA8A 3E22B 4FFSA 2AB0A 2DHRA 1OHHA 2VNHA 5AJVB 3TUJC 4QVIA 3X0DA 5JLAA 3WB2A 4MJ7A 3RC9A 3U6BA 2ID8A 2CYCA 4I5GA 5FXMA 3IT1A 4BB5A 5G0SA 4O2RA 2BGMA 4YMVA 3NNSA 4NH0A 4EUFA 5D3MA 1FTSA 2MR5A 2W2LD 1RZRA 1T2UA 3HADA 5KU7A 1VHWA 4V0ME 5ALPA 4DGQA 2A0KA 2O2GA 3QU5A 4FGSA 4YREA 2HWKA 3OEWA 1E4VA 2A3NA 5GV8A 1V8DA 2O7SA 4IIGA 2JFUA 3EVGA 2JIZD 3ROFA 2CW5A 4OLBA 3IPAA 7ABPA 2C88A 4TUYB 1NVUQ 1CJKC 5AK5A 3RYHB 4DV5B 2RGGA 1CQPA 3V8VA 4NAHA 1OPXA 2I4RA 1NUPA 1BEEA 3WGUA 4CCSA 3LUDA 4GOLD 1VQ6B 3VZBA 4D79A 1JWLA 4B87A 2ZYHA 3BIFA 1N0WA 1ZXXA 2ACWA 4NJMB 2QMYA 1DRVA 3GJ7A 2DUMA 1YR9A 3KR0A 3UWDA 1Y6FA 2O8FA 3AUXA 1SKYB 3F2IA 3GRVA 4RMJA 5CDHA 3DB1A 4WMLA 1DEXA 1AKQA 1GZ7A 1R8JA 2YMPA 2OENG 2VPTA 3H6GA 3TW8B 1A72A 1AMNA 5DI9A 1VL0A 3IEKA 4GICA 3OZWA 2QUIA 5MGNA 2UZ3A 1N6HA 1I1OA 2JH9A 4JB2A 1P3JA 2Q4EA 2Z4SA 2WHPA 4OVKA 1H2BA 1KJ9A 1TIKA 1N2OA 1ZLYA 2NACA 2PWBA 2C4HA 4JMQA 2ZI3A 3BCUA 2JI9A 4L5AA 4MQ6A 1DMRA 1NA5A 1PZGA 1PDVA 4LBZA 1I3KA 2DULA 1H23A 2I1QA 1SHKA 2NXCA 1JHDA 1PAUA 4MYUA 1KEEB 3BIOA 3HS3A 3NHYA 4FD2A 5L51A 1PNRA 2PJDA 4QLOA 1Q7BA 3VO8A 4YEDA 3FYTA 4LJSA 2AQ8A 2GM9A 2C5FA 1W46A 5G2OA 1DXOA 1E62A 1UBRS 3COSA 5H7XA 4GMDA 4OBBA 4L8GA 4G1FA 3LPNA 4DMKA 3DZIA 2G7ZA 1IJEA 1GGFA 2Y1KA 1FNSA 3R7BA 4C5BA 1WPRA 2XYGA 1CZRA 1T2AA 1H2FA 1A8PA 1EJBA 1NONA 2EWWA 2WNHA 4ZARA 4FNGA 3U4DA 5CEJA 2O3QA 2EFJA 5AI8A 2J7PA 4MVWA 2BM1A 4ZPJA 3RRNA 5HDBB 1UJCA 2Q6TA 3KIPA 3WHLA 2BISA 2PVPA 1T35A 4BB9A 3OIGA 4U0KA 4LRYA 3EPLA 2XBUA 3OD5A 4HQRA 4LE2A 3N0RA 3M34A 4LRQA 3HCRA 4OLFA 4GDFA 3PENA 1C3JA 1RIIA 1P0CA 1OFVA 1T15A 1TZ2A 4J0GA 4JIGA 4XIIA 5CLLA 4B6RA 4BFSA 4JYBA 1NV9A 3P45A 4HDSB 1BJKA 1J49A 4Y9SA 4X0CA 1AKNA 2NTYC 2B94A 2NADA 3RVLA 5EZYB 1VXOA 2ENWA 1BX0A 3VYUB 3F4KA 3JZAA 3WYGA 3LUKA 1P80A 2O19A 1AKMA 3C5WP 4ZQBA 4NMLA 1QHFA 1T9BA 3HKCA 3K0AB 1EWRA 2QJOA 3KEQA 1JT9A 1XFOA 1KFCB 2R84A 4EWLA 2H31A 5DW3A 1U8CB 2D3NA 2VBGA 3HZRA 3L7KA 4FD3A 1LX7A 5J40A 1I2AA 2MSLA 3DKRA 4AC9A 2XECA 3IP1A 4JA0A 5DX1A 1GGVA 4PYLA 4WFKA 4BQQA 1U1CA 1MO3A 2AFIA 2QEXB 2YV4A 4CQLA 2BFFA 2BJHA 3OE1A 3DFMA 1NLFA 2O4CA 4C89A 5EIAA 2YVLA 3RAGA 4BEWA 4X6LA 1JWAB 1T2VA 4KGVA 4MQEB 1C0EA 1JPNA 3GELA 4BXOA 1UDXA 3NDIA 1X8JA 2FWBA 2G1JA 3HXKA 1FBTA 3CJQA 3ORSA 4WFIA 4D6XA 4JQOA 1NQOA 5LZ2A 3LKVA 3BHIA 2P4EA 4WQMA 1IG3A 2KYRA 1GNLA 3KYCB 4IZ6A 2PX4A 4RE6A 1J33A 4QYWA 1RWWA 1ZYUA 4N8DA 3GPCA 3KLNA 1EUZA 3NWBA 1GZVA 3PNVA 4LSGA 1YO6A 4LNHA 4ABYA 1MEEA 5HFAA 1X6VA 3FNIA 3ZCQA 5JS1A 3P9YA 1W6UA 4K03A 4I50F 4EEXA 3HI4A 3W5VA 2LGJA 2O2IA 3A06A 3JCZA 1JA9A 1LRJA 3C87A 1A3CA 3SMVA 1W48A 2ZQ5A 4L07A 1VP9A 3V34A 3C7AA 3DV2A 3KELA 4LQ4A 3RBVA 3WLEA 3HU1A 5B1DA 4BFVA 5I9BA 1AV6A 2XDYA 3UYLA 1JZQA 3TLBA 4AY6A 3KTFA 2ECQA 4RHYA 1PW5A 1S2IA 1NVXQ 4FX5A 4MMYB 1U5BB 4UATA 5ER9A 2JPDA 3N53A 4A0RA 4JR1A 1I5OA 4DIDA 1EA5A 1F2DA 3PRYA 1DJOA 3K4PA 4KZPA 1OY1A 1I24A 2G80A 4WY2A 5JSFA 4B76A 1VQMB 2EP8A 2FE4A 2PWYA 2RHBA 3THRA 1CY7A 4B3HA 2H1SA 3X2SA 2HLDD 2X8LA 3OPYA 1T3LA 1P44A 2O7QA 5U1PA 2Y1GA 1HG1A 2WUFA 3WGYA 4A8JB 2ZJ6A 1XOIA 4ENRA 1GZHB 1Z4IA 1XJ5A 1FFYA 2XYHA 3OZAA 4PICA 5DI3A 4PGAA 4EJFA 2JZNA 3NGMA 2GESA 3M4YA 2C54A 2X9VA 3ERCA 4BQIA 4S0XA 3KWLA 2WJGA 3SP1A 4CG0A 1JV2B 1NN3A 1Y8ZA 2A59A 4Q02A 2AUTA 3IUBA 3KO8A 4W63A 4J0QA 4E03A 3N74A 4HRVA 4MRMA 1M6VB 5C31A 1NBOA 1CY2A 1XK6A 4QRDA 4WKOA 2F8TA 2VWQA 1TM2A 4U5XA 5A4FS 3AM4A 2O5EA 2Y4NA 4RGVA 1ETHA 1PYOA 3SLDA 1OKKD 2OZVA 2JAOA 1J7JA 4ZO6A 5FTNA 1U6KA 4IIXA 4M7WA 4M21A 1I3LA 2P9YA 3ZQ6A 1U31A 2BZ0A 1B4DA 2GBPA 3WWOA 3OTHA 3MILA 5K3OA 4FFLA 1L7MA 3CLTD 2V6BA 1D1TA 1AKYA 4M7OA 1VSBA 5AXDA 2XMBA 2ISQA 3G8YA 1T1RA 2BTQA 4GI1A 2J45A 4A6DA 1SUFA 1XJQA 1M6NA 3JU3A 1NXPA 2DQZA 4KQ9A 4ZVMA 3CN7A 4GWGA 4XFKA 3M70A 4PE5B 5JAHA 4B4DA 4N8SA 1JEYB 1JZTA 1HDRA 4J43A 2NUTA 3F7MA 3UEOA 2OLKA 1NJ6A 2J3MA 3BQ9A 1AK1A 1R0WA 4UU8A 3OMWA 1V9CA 3T1NA 1PJBA 4YRZA 2WF6A 2JCYA 5A5FA 5ADHA 3ZHTA 2XWQA 3R7AA 1BC5A 2IC5A 3BCHA 1QVWA 3LHSA 2E4ZA 3MSCA 3P19A 1NE7A 4U9IS 4C4SA 3IAS1 3L1VA 2V96A 1EFHA 3QYJA 2QRVA 3R9IA 1OIVA 3W5JA 4CEJA 1U7ZA 3Q87B 4IRUB 4WOCA 4GMXA 1D2MA 4O6VA 5EXSA 1B6SA 2ZL5A 4G9EA 4RY0A 2IDZA 1NVKA 3LRTA 3N8HA 1SZDA 1QNFA 1CUFA 2N75A 4DJEC 4Z0NA 4RZ2A 1Q0TA 2QLJA 2EJCA 4TYWA 2HV8A 5FKJA 4OBWA 3RFUA 2JIZA 3KKQA 2AS0A 4BBJA 4ZCRA 4BNFA 1BE8A 3TPZA 1X1QA 3G71B 4C22A 5KNBH 3LDFA 3QLEA 1EFCA 4KQGA 1BD3A 1LGYA 1Z4LA 3IR7A 2D13A 4RA9A 1N7HA 1ZIYA 2PYZA 3N7TA 2R1TB 1YB7A 2J3QA 4NBTA 1U5CA 3CESA 2H1VA 2VYCA 3FTFA 1PTJA 4NBNA 3EEYA 2GZ1A 3WK5A 3BIWA 1XT6A 3GL9A 3H7IA 2NN3C 2WAOA 4KQIA 1G63A 3O47A 1W75A 4N65A 1HDXA 5EZYF 3EEFA 4CW7A 5JCXA 1YFJA 2QVZX 3HC7A 1RC0A 4S12A 2QY6A 4OL0A 5IM4A 5EGSA 5JMWA 5FBKA 4KTTE 3A7EA 4XVUA 1W0KA 3K7EA 3RAJA 4DREA 5HG0A 4XOTA 1L5VA 4LYEA 4TM7A 1VA5A 2B9VA 2CCKA 4IJVA 2WOOA 3VOAA 5HKKD 4C6TB 5JTTA 5C3UA 1QG6A 4YXWA 4V1CA 2H4WA 2I3BA 1N92A 2W6ZA 4RZIA 1GVHA 4KXFB 3GGJA 3KOYA 3PEUA 1WXXA 3Q40A 4HI0E 4MMZB 2R2AA 2X19A 2R3SA 4X1IB 2RGYA 4CT0A 5BSVA 1QGDA 2VCHA 5JZMA 1U3CA 5K7SA 3ZX4A 1NNI1 2HM7A 4IFEA 4X45A 2IXBA 4B34A 3KOXA 1VQOB 3KEFA 4AICA 3VGPA 4NENB 4FT4A 1BMQA 2VHTA 1T3HA 5M29A 3AF5A 4AROA 5ICMA 3UUEA 4P53A 1FP6A 3E3AA 1L7XA 2O2DA 4HLUC 1J8YF 2AF3C 3SYLA 1Z4PX 2R00A 4XB6B 2CK3D 1KO8A 1H6DA 3VO9A 5JT1A 3S1SA 5FV4A 3DBVO 4HDKA 4YI5A 2I33A 4FW8A 4MWDA 4K6HA 1K6IA 1Y7LA 3TG2A 2QYOA 2RKWA 2CVFA 2XUKA 5KJ6A 4QU0A 4KC0A 1G8SA 3RVMA 2FU5C 4XB2A 4EHBA 1NXSA 1QB8A 4DCTA 4JUFA 1Z0SA 2P2SA 3K0FA 4GRAA 1G20B 1WSWA 2PGOA 3A14A 1H8HA 4L5IA 1XI2A 3TX2A 3A11A 1KYVA 4NJEB 1HDEA 2UKDA 1R3DA 3PJFA 1FNNA 3B13B 5DN9A 4HN2A 3L84A 1S6YA 3QH4A 4Y1RB 5HIMA 3T7AA 2ZU0C 2XUZA 3BCFA 1JHYA 2YNMA 5FADA 2D2EA 1FJGB 1WOPA 1F8UA 1O89A 2BEKA 1CSEE 3QI7A 3V7NA 3WICA 1QRRA 3ECSA 3EZNA 1EFRD 1XMIA 2QU7A 4CEJB 3O8CA 2CXTA 3HVHA 5L3RA 1HE8B 1PK7A 1CUUA 4FLEA 1ZS9A 1ZCZA 1VZ3A 4FHZA 3NAGA 3ZVNA 1OH6A 1H94A 1VB3A 1NW4A 2EBHX 5JTUA 1PJ3A 3FR8A 4MR8B 3EEBA 5CFOA 5IVDA 4HS4A 2Q29A 4CF4A 1MV8A 4M7RA 1QCDA 1C3EA 2G70A 2F8SA 1RQGA 2OE2A 1YGYA 5SY9A 3I39X 3RSCA 3W9YA 4DILA 1N7JA 1LS6A 1SOWA 1XZCA 2RGEA 5TVKA 3EOBI 4EBBA 4YPVA 4ZYTA 2VRCD 1E0AA 1XEFA 4MAFA 2QRHA 4ON9A 4BNHA 3CLHA 1G5IA 5JDIA 5DN6A 1JE0A 2Z5VA 3UXEA 3KHSA 3SC6A 1I36A 1D2AA 1E7QA 4EO7A 5FJJA 2Q1UA 4DA0A 2IGTA 4YR9A 4M8LA 5D8DA 5CD9A 1S3FA 5HP4A 1MX3A 1YU9A 1KTVA 1FSSA 4IPTA 3NANA 5I7UA 2JLUA 1K66A 4YASA 1W85A 2D7CA 2NVWA 1KY2A 1AUXA 4LK3A 4Q66C 5JRDS 2UAGA 5LU9A 1GPLA 4ZOLB 3S3TA 2VF7A 3PXAA 2VWGA 4GRIA 4C4PA 4IHQA 5KPJA 3OQMA 3D4NA 1U99A 4K2HA 1TIPA 4J7AA 3TOSA 5IEJA 3GFFA 3ZD6A 3QXXA 2RBEA 1YFZA 4GMGA 4HPXB 2DR3A 4RK0A 4DAEA 1KVTA 2NUPB 4RD0A 3RSQA 3W7AA 5KOJB 1NJFA 2PZLA 2IV3A 4UBKA 1SH7A 4RK4A 3UCFA 2Z95A 3OT1B 2EFGA 1NRIA 3AW8A 5IYZA 4ZT2A 1M34B 4DIBA 3T7DA 2V7UA 4FR2A 5E7MA 2FN8A 3H19A 1X1CA 3NC4A 1X7ZA 5CNKA 5ALSA 2B83A 4AFNA 4Z4EA 1YR8A 1R6UA 1E0SA 3QTLA 2H4YA 4DLBA 4L72A 3T06B 3T0IA 2HU2A 4QGAA 3D7MA 1UWVA 1A82A 3WGZA 4F4UA 2D2IA 1XVVA 1BNCA 3AHCA 2FA9A 3O4HA 5TJHA 1LW7A 3IEUA 3O38A 4G65A 4L0QA 3RI3A 2BN4A 3WA6A 3CZ4A 2ECFA 4P1ZA 2PANA 2WPDD 5TIIA 5HMLA 2ACKA 2OCDA 3GGGA 1F5NA 3ICQB 2QP4A 2I6GA 3E53A 2EP5A 4C7VA 3GRYA 2C04A 2RGXA 5AKHA 4AUEA 5DVZA 3L8DA 1L6IA 3FDJA 1JMKC 1N0IA 5JXIA 3R9XA 1SQFA 1P61B 2QJTA 1FDUA 4KN5A 3P71T 1WDMA 1BU5A 3BCDA 4WZLA 2MYUA 2A0UA 3AW9A 3HCBA 3JD4A 4NFHA 4ZU3A 5TB5A 5IF9A 1QO0D 4GUDA 9LDTA 4CG3A 2HA7A 1YC2A 1YHNA 2OILA 4X92A 5B3JA 4FGKA 4J1TC 4H3HB 4D0NA 3L0DA 3JARA 3VA7A 1FW8A 1M2WA 1G9SA 2JLSA 1DQNA 2C8VA 2VLBA 4RV5A 3I0MA 5TVGA 2C1XA 2NXNA 3BTOA 2F8MA 3L77A 3FLEA 2EJTA 3C6ZA 1R27A 1DEKA 3E22A 3N2YA 4LPSA 5CGZA 4R54A 3WMWA 4D5EA 2AOUA 3MBOA 2O5CA 2P27A 3UAOA 1D3AA 1RWQA 4AX8A 4U2DA 4BZXA 1UZMA 1X7WA 1YBVA 3TQIA 3LDHA 2JGMA 3ZU4A 3EBPA 3U61B 4B4WA 1FLAA 3O92A 4R51A 3W3AD 4YMGA 4J8PA 1XVLA 3WNVA 2YHIB 1DI0A 3OIFA 3DF9A 1ODJA 3GCXA 3OLYA 5T8KA 6NULA 4QUBA 3CVWA 1JIUA 3EISA 5B1EA 1XXLA 4ZCLA 2R1VA 4PSVA 1I7LA 3IAM1 3ZQKA 4NCJA 3O8OA 5TT0A 1R3UA 3N0XA 1PU2A 2GDZA 4YRSA 1P8JA 1H85A 1L7OA 3RRZA 4KR2A 1KD1D 3AHHA 1VE5A 1X7DA 1CFJA 4HVCA 3F9CA 2Y77A 2AOTA 1E2MA 1DQRA 3GPDG 3GG9A 3LQKA 3OG9A 3K0KA 4I0WB 5TPWA 2IVZA 5IAOA 2PTGA 1T2CA 3A32A 1UMCA 4D3SA 3TAUA 3OY2A 1E9RA 1Q0PA 5LXTF 1VJ1A 5LZ7A 3R76A 4RLSA 3ZPXA 4ZICA 4QXQA 4B9AA 4XR4A 1GP2A 1KYYA 1NR7A 4XD2A 5DGXA 3DT8A 1CS4C 1JB1A 1YI1A 2RJ3A 3D7KA 4U2KA 4EJSC 1NKTA 2XNJA 1WSBA 4UU1A 3TNFA 4P6VF 4YMLA 3L8EA 2ADFA 2ENUA 2IUTA 3D8RA 3T56B 1NUUA 1Y7PA 4TS1A 1MQ9A 3GMDA 5AVUA 4A8PA 1KXJA 5BQFA 4PVCA 2WHQA 3SIRA 2JNWA 5J4KA 1NN5A 4CM9A 3KLOA 4DBVO 1VPVA 3R7WA 4K0KB 2CDAA 4NR0A 4US1R 3JRXA 3SLKA 4MCHA 1OX6A 4C06A 2A5LA 4FYKA 1FFXA 1SKYE 2PUFA 4DNFA 3KG2A 1AK9A 1LDEA 2GD6A 1NVVR 5DCLA 4EHIA 3WQQA 1N5RA 1O94C 1E3QA 1D1NA 1AXGA 1NQXA 3CPEA 3DO6A 2WMNB 2VSQA 3ZXYA 3ZIDA 3VPBA 1KO4A 4FTWA 2XJ9A 3ZV4A 3A1FA 4OP7A 2VZ9A 1PUIA 2WUWE 1G8HA 5KHOC 4TS4A 2IP2A 3ET4A 4NH4A 2X8JA 4C7OA 4O59O 2G5TA 2YWEA 1TAQA 3V4VB 2IVFA 3M1IA 4I5FA 2A0YA 4LNUA 5IC4A 3L07A 5HZBA 1NX6A 2QNBA 2GCEA 3M49A 3AI3A 5ALXA 2F00A 2I54A 3A6LA 1SAYA 3CU5A 1G18A 4KCGA 2ID9A 4X66B 2RH4A 1IN1A 3OCJA 3ASSA 1GUYA 1E3WA 2NSJA 2R47A 2DE0X 1EGAA 2VYND 3MINB 3V1YA 2WTUA 4UBMA 1WB9A 5IHXA 3JZIA 4FBGA 5LSAA 4FUTA 3REFA 3LE8A 1W5FA 3NP9A 3L7MA 4CIWA 2PVSA 5KOHA 1UMKA 2FJPA 2GNOA 1GYRA 4YS6A 2XUIA 1IHOA 1VIYA 3CY6A 4LSZA 3TLEA 2JDID 1V7PC 2AOXA 3STWA 3TD2A 4QPJC 4L9WA 5CJPA 2C07A 3OMXA 3ZC3A 1WQ3A 3MLAA 2W2TA 2YL2A 3A1TA 3G7UA 4US0R 4MGZR 1PI3A 1F1BA 5B2ZA 5IDWA 1VP3A 4FMPA 3UCEA 1DLIA 5BNIA 2OORA 3QRWA 2H7CA 1E69A 5JR3A 4YFYA 4MKFA 1POWA 2AKEA 3PVZA 3NKFA 5ALGA 3S40A 3VR5D 1D07A 5DK6A 4B74A 4P1VA 3A9UA 1XTIA 1TLFA 1WSVA 4LBVA 1R6BX 4I14A 4ND7A 1SFRA 4JS0A 1ISMA 5F2OA 5C81A 4KQ6A 3QEMA 4ZC1A 5A2GA 4F4CA 2D5LA 1A2OA 1P1IA 3ND8A 3R0JA 1P1KA 1V7CA 2CF6A 3MJTA 2QN1A 5ALWA 1W19A 2JBWA 2NTNA 5CT4A 5F2EA 2GF2A 3AP2A 3IJEB 1VBMA 4RKFA 5IKOA 4AG6A 1C0KA 1LPAB 4FHEA 3E2PA 1ENZA 1MH9A 4QBGB 2FPWA 2DG2A 1P0IA 2FG6C 3OX1A 4WOPA 2HR1A 1UD4A 3KQKA 1RI2A 1BSVA 4II2A 3NAMA 5JMPA 1OAOA 2FEWB 4YELA 2VCEA 5LCXA 4F4HA 1ADGA 1N6KA 4QUIA 4RU1A 1ORRA 1I6KA 4XTRA 3HDQA 3H1BA 4YMIA 1B73A 3B2QA 1S2OA 5K0FA 1RADA 1ZK4A 1YZQA 4LQCA 5KO2A 4I3GA 4MP3A 4IOMA 4RIFA 3SQXA 1JU3A 2C9BA 4OXXA 4XCQA 2QY9A 1YJ9B 1CZOA 3AR7A 3NHRA 5E9QA 1PSDA 3TDNA 1OQAA 5AW4A 1ZCJA 3V8EA 4OQYA 1GG9A 2Y8EA 4Q1EA 3VTKA 3GD7A 2EEZA 5LZ4A 1AMUA 1L4UA 4NTZA 2E49A 4U39A 2X0EA 3DZDA 5SY4A 3V46A 4H1UA 5AVVA 1XAHA 1P31A 3BRWD 3K8ZA 2Q4RA 3GGPA 3G2HA 1LDYA 4LJRA 3FZGA 4N0DA 3RRMA 3DAHA 5CD1A 1JEDA 2ZJ2A 4IILA 4NZZA 2MOKA 3G0BA 4XM1A 4DQKA 3QG1A 2HUNA 3UMJA 3GEPA 2TS1A 4HFMA 4F12A 3SEZA 4I9UA 4QPPA 2J0UB 1XN1A 2WZNA 1VDMA 3DEKA 4IKEA 3MCTA 3CX8A 1SC4A 2I4NA 4IJUA 2OVFA 4QGHA 3IOBA 1CQJA 3MCAA 3EDQA 2C20A 2AXEA 2ST1A 2PRZA 3AR9A 4E1AA 5HSGA 4UHHA 5LQCA 3AF6A 4XLAA 1X8LA 2HKIA 3WAKA 5EFOA 1F8YA 1TM3E 1QYWA 1K8ZB 3LUGA 4LVCA 1L4YA 2FV8A 4Z9FA 4OI1A 3KV1A 1UBNA 2X58A 3UBMA 5JBIA 1IBCA 1BROA 2X6QA 3A6KA 5T8KC 5C8YB 5JXJA 3PXCX 2R1ZA 1ONBA 3B1FA 3PFGA 3V8BA 1RT9A 1L1QA 1TQ4A 2BFPA 3NHUA 4GZ6A 3S8MA 4CGZA 1A69A 3FCYA 3O8LA 3VAYA 4BV9A 2NZ8A 1J0CA 2B4YA 4NBLA 1V26A 3W5BA 3GUCA 5ELLA 2Q9BA 4Q3AA 1WXDA 3I6MA 3GSIA 4D1YA 5E0OA 2PKQO 1CQZA 1L4HA 3EEQA 4GG1A 3TIFA 4R0MA 3HGMA 1HZJA 1K86A 5ITVA 3RPEA 1NTOA 4PAWA 4XLCA 2BFCA 3K1ZA 3RVKA 3CEHA 3TB6A 4F2PA 1T3GA 4FJ0A 2ZE8A 3P2YA 5CLIA 2FP3A 3HVKA 1DUIA 1JKFA 1ZPDA 3IAHA 3NBFA 4FDMA 3GP8A 2D0PB 4CF5A 1WCV1 2OCAA 3BSWA 3IR6A 5EJ8A 2PKEA 3A70A 4W4TA 1Z29A 4G4IA 5T4BA 4WZEA 2ZG6A 1HE5A 5H59A 4DKJA 1DAFA 1VBFA 4EYSA 4G0MA 5HOEA 5IC6A 1LNSA 2EGUA 1P5HA 1AKRA 1WMEA 3EXFA 4Q3CA 1PR1A 3KAJA 5KNCD 3ASZA 1RE0A 1DFHA 1QKIA 1PO7A 1TAHA 5EYPA 4XB1A 3N8IA 3G1TA 2H54A 4EJ6A 5CP8A 4KQWA 3U6KA 1SUIA 3LY8A 3GROA 4GOMD 4XQCA 5H02A 1MGOA 3STVA 3VISA 5B3KA 4N0EA 2P77A 2YV3A 4FFDA 5EUMA 1OREA 4KXVA 2FXVA 4NESA 4RVGA 1Y63A 5CLGA 4BCCA 1T2NA 5CM9C 4PSKA 1MORA 3OECA 1ISGA 1TK9A 4P33A 2QN8A 2XKJE 1BZYA 1PFVA 4OX9B 3IQHX 5E1BA 1G64A 4L85A 1DJNA 3RSFA 1H1LB 1BX1A 1LH0A 1W30A 1EFUA 1KXZA 1G3IA 3GZTB 5C5CA 2ZRNA 4LRWA 4ZAXA 4U9UA 2E48A 3VU3A 4QHSA 1KI6B 4BWVA 1TOAA 3FSRA 2Y0DA 4H2DA 3HU3A 4JX8A 4N82A 4D7AA 2AMYA 2X41A 1U2SA 1NXOA 1NW8A 3ETCA 4UVHA 4IEIA 2DPGA 4AZ0A 2W2VA 1YFKA 3ETLA 3T6KA 1JIKA 4DBLE 5EAIA 4D9GA 2PS1A 3ONEA 3R3XA 3P5BA 3W6NA 4FQ7A 1KJNA 3WI7A 1FUYB 3GXBA 3OESA 4Y2GA 4AYXA 5JFOA 1W29A 1DWOA 1V5GA 3CO5A 1KKUA 3FYDA 4NBKA 2Q3JA 3OPQA 1V7QA 4S2EA 3W8EA 1FP7A 1XN4A 3ZCVA 4JYAB 3AG5A 2PAAA 2XDAA 1PQWA 4NCXA 3SZMA 3NONA 5A5EA 1H2AS 821PA 5JAUA 1O54A 2JGLA 1KI1A 2VSFA 1J5EB 5HKKA 1OT5A 1NXXA 1DKQA 1XD8A 5IYNA 2X3FA 4MWOA 3ZQUA 4ZKDA 1PQPA 4R1LA 1EVLA 5LIPA 1Q74A 4ZYUA 1LZLA 1QVFB 2C5GA 2GO7A 3DLCA 4O4JA 4RSMA 2ZB4A 3JASB 1P6QA 3BQMB 4RC9A 4Y1FA 5E6UA 1NBME 1QSGA 4KIWA 3H65A 4CKBA 4KXUA 1U2GA 1JPVA 1YH3A 2HT6A 4DNQA 3EBOA 4AI6A 1WP6A 1YJAA 2P78A 4HUTA 3I5YA 2QB5A 5JY1A 2XYVA 4BJ3A 3AVTA 1U9YA 4JR0A 4MIEA 2UXBB 3MOGA 5CTAA 1BDIA 2ZWPA 1H1LA 1SBNE 4KVFA 1D2NA 2OZKA 4IHJA 4RNCA 1UPFA 5AW3A 1YC5A 4U63A 3TZHA 2PBLA 3EGCA 1Y3CE 1WOOA 2CLCX 4WLVA 4B82A 4UNRA 1QE5A 3LZDA 2GXUA 4H77A 4KVZA 1Z75A 4NDAA 1UWKA 3D2LA 2PLWA 3SAJA 1FP2A 1WDKA 2K5UA 3DR3A 4J29A 4IWNA 1WTHD 2DQSA 2F1HA 4IWYA 5LBUA 3V4SA 5B55A 5K6RA 3HN7A 4HWPA 3GF4A 3I37X 2A4MA 2GQFA 1AVTA 1VBKA 2WRZA 1KDVA 4GR5A 4C29A 4ZCQA 4UNPA 2B21A 2ZCVA 1B1AA 3I9MA 4L22A 4HWGA 5AJWA 4EB6A 10MHA 1VKZA 3EXFB 4IR7A 1JG2A 5I47A 3QEJA 1CK4A 3VH1A 4US2R 1I6WA 1N0VC 1TL7C 3DVSX 4QGGA 1RRFA 2P65A 1ZQ1A 1NFFA 3SFVA 9LDBA 5IULC 2FSVC 3ETJA 3EVNA 3LXUX 3UC5A 3PWTA 1XMXA 3DD5A 1QO0A 1VJSA 2QM7A 3FFAA 4EW1A 1T25A 1U9JA 1YB5A 4M60A 1ZINA 2ZSDA 3P2OA 5FA8A 4DHWA 4OK5A 4Y7DA 4P83A 4AK9A 4BQNA 5AM0A 3IP9A 2J6BA 2Q7OE 2R0QC 3E9ZA 3E3NA 5JWHA 4NEGA 2CFCA 4KLZA 5FCDA 4WY5A 1SXIA 1Q19A 1Q92A 2F6RA 2J3KA 5D7BA 4REQA 3W04A 2W6ID 2FPGB 3LQEA 3EASA 5PGMA 4CTJA 1YMUA 1G4HA 3EWAA 3UXHA 1S01A 4UEKA 1EWTA 1UJBA 3D02A 1P7CA 1WMAA 3TOXA 4WZKA 3LK7A 5C7OO 3K1AA 3WZ2A 1TRKA 2GWRA 2Q8PA 3IXMA 3SHVA 2B8TA 3GJ6A 1TKAA 2QR2A 1U0HC 2HF2A 1A8UA 4GP9A 4R41A 5ALFA 3IR5A 1K06A 4I6JA 4J7XA 1Z73A 5TC4A 4ZTZB 1PSWA 1WKVA 1FJHA 3OWXA 4INAA 1FDTA 2X13A 3D81A 3FH0A 4RYDA 1AV7A 5DYIA 4ND6A 3B3JA 4MUEA 2AG0A 1TTTA 3PPYA 1PJ6A 2F9MA 1M8GA 4KVGA 2P91A 2PKQP 2IITA 1BDMA 2PKYX 4MWSA 4YBRA 3L7CA 2J31A 2D1SA 1J7KA 3EC7A 4JJZA 3HBLA 3JTMA 4LJKA 2Z58A 1NAHA 2NSDA 3AXSA 3JD1A 1KQ3A 3E5MA 5ALZA 1DO8A 4BO3A 1C2TA 2XNSA 3ECCA 1Q22A 4LCBA 3SKBA 2O9JA 4MLZA 1ADBA 1W2GA 3SE0A 1EESA 1FIUA 1K68A 1ZW1A 1P45A 3CKLA 2R25B 3DMPA 1MJ5A 3MMNA 3U4CA 4HSEA 4BMPB 1UPUA 1JR3D 1LW6E 2YW9A 3S7TA 2QL9A 2OBRA 3AIMA 5CB4A 2Y68A 1Z9BA 3UYKA 3QYPA 1DZ3A 1XCOA 2H2IA 1U8XX 1CUSA 1M0WA 2IP4A 2Z3ZA 3HLYA 2W43A 3CGWA 2FHSA 3GJ8A 3I45A 3JQ8A 2WHEA 3K5IA 3P32A 4FKZA 4YAEA 1K6JA 5SZHB 3ADDA 3G49A 2DEUA 1CUCA 2H0QA 3GCZA 3UUGA 1C7IA 3RG8A 4A16A 4K5QA 4JV5B 1VMEA 1J6UA 2IXTA 2HPZA 5I45A 1EYZA 3QVLA 2C4WA 1FYDA 1R9GA 3CW9A 4O4HA 1ZMTA 1MDFA 2C1EA 2VXBA 4L4SA 4P7FA 4AXXA 1KU0A 2VRBA 3BFVA 5HR5A 1EB8A 7MDHA 1Z5ZA 2WYOA 2FRDC 3MTJA 2Q3CA 3RU3A 1RZ3A 4B0OA 5LJLA 3MNFA 4OQQA 4C3UA 1ORTA 4D97A 5K8LA 2AR9A 2OP1A 3LHKA 2CFSA 3QFSA 2D2FA 4ILKA 2Q5IA 3O2NA 3V8MA 1DKRA 3ENWA 4Q9DA 5JXHA 4X7FA 4B2YA 1GEGA 4MQBA 4AIIA 1UEIA 3CF2A 1GSAA 2FR1A 3VU1A 2XB9A 3LI2A 4PNZA 3ICCA 2B1GA 2YYAA 4CMHA 1Y1TA 1R15A 1X8XA 2UYOA 2IWRA 3VR1A 1RI1A 1RRCA 4ZPXA 1HL3A 3TNJA 5C5IA 4HO1X 4LXHA 4BC0A 3Q6NA 1UZLA 1OXMA 3HHPA 3AI7A 4QT0A 1Y6QA 1ZRSA 2QLBA 2QDXA 3SGLA