3JQQA

Crystal structure of the h286k mutant of ferredoxin-nadp+ reductase from plasmodium falciparum in complex with 2'p-amp
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
312
structure length
261
Chain Sequence
NFINLYTVKNPLKCKIVDKINLVRPNSPNEVYHLEINHNGLFKYLEGHTCGIIPYYNQRCARLYSISSSNNMENLSVAIKIHKYTNYGYCSGFIKNLKINDDIYLTGAHGYFNLPNDAIQKNTNFIFIATGTGISPYISFLKKLFAYDKNNLYNRNSNYTGYITIYYGVYNEDSILYLNELEYFQKMYPNNINIHYVFSYKQNTSFYVQDEIYKRKTEFLNLFNNYKCELYICGKKSIRYKVMDILKSDEKKKKRVHVEVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferredoxin NADP reductase
publication title Plasmodium falciparum ferredoxin-NADP+ reductase His286 plays a dual role in NADP(H) binding and catalysis
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Oxidoreductase
total genus 74
structure length 261
sequence length 312
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2009-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3jqqA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 3jqqA02
1N8RD 4FWTA 1E64A 3W2FA 1YHQB 1FRQA 5TR9A 1FDRA 2QA4B 4G1BA 1K73D 3WNDA 4DQLA 1E62A 3AVVA 3CMAB 1SM4A 4RD0A 2BGIA 1VQ9B 4PC2A 4FN5A 1SKQA 1S0UA 2BM1A 3CCEB 1JJ2B 2PIAA 3U6KA 5HXBA 1QX4A 3QE2A 1QFZA 4PC1A 3P26A 1UMKA 3WNBA 4H9GA 4HE6A 5DSZA 2QMUA 1NDHA 4PC7A 2OK8A 3CMEB 2B7BA 2OTLB 1I7PA 3QFTA 2GPJA 1N0UA 2J7KA 2D74A 1NJID 5JBQA 2GQFA 4TMZA 3FJOA 1B23P 2BN4A 1JNYA 2OK7A 1BX0A 4NCNA 1ZM2A 5KSWB 3G4SB 4ZGQB 1D2EA 1YIJB 1KC8D 1VQ7B 1QG0A 2BGJA 1QFJA 3W5VA 1WDTA 1FNBA 4RD4A 4PGOA 4LBYA 4TMVA 1VQKB 4ZCIA 3W5UA 3VNUA 2B7CA 4P3YA 4YAFA 3CB4A 3AVWA 2AHOA 4M1KA 1W87A 1G7TA 3OW2B 4YHBA 1G7SA 2PLFA 2BVNA 1VQ8B 5GV7A 2ZITA 1Q81D 3U2QA 2DCUA 3AGPA 1EFUA 4U9UA 1IB0A 1F20A 1YJNB 3G71B 1D8TA 3LO8A 1BQEA 3WNCA 1KK1A 1DDIA 3W2EA 4J0QA 2RC5A 2CRVA 1EP1B 1ELOA 2FX3A 1EP2B 3LVBA 3OZWA 1ZM9A 1FNDA 1KJZA 1M90D 1Q82D 1FRNA 1GR1A 2YWEA 1EFCA 5THXA 1R5OA 1QGYA 1QGAA 4K1XA 3CCJB 2YWGA 3ES9A 3CRZA 2X3UA 1ZM4A 1VQOB 3B82A 1TLLA 1FNMA 1JB9A 1TTTA 1AMOA 3LRXA 3QFSA 2QTLA 5H59A 2BM0A 1KD1D 4FK8A 4RD3A 1A8PA 2C77A 1QFYA 2NPFA 3OZUA 2E1RA 3ZC3A 1KK3A 1JA1A 5TY0A 3ZBTA 1EWYA 3WBKA 4NBSA 1YJ9B 2XNJA 3W2GA 4MYUA 2XEXA 1S72B 1H85A 3OJWA 3J81k 4DQKA 1GVHA 1EP3B 4Y9RA 3CCLB 4RCYA 4B48A 1QGZA 1VQPB 1VQMB 3AVUA 1DG1G 4HE5A 4WQMA 2OTJB 1G7CA 3P27A 1AIPA 1JA0A 1B2RA 2BF4A 5TV2A 1KTVA 3MMPA 4F7DA 1DDGA 1W34A 4B47A 3CXCB 3CC2B 3B78A 2DERA 4M53A 2C78A 1M1KD 3QFRA 4B43A 2RC6A 4Q7JB 1GAWA 1E63A 3W5HA 3FPKA 3AVYA 2EFGA 5AN9A 5FA6A 2YWFA 1K9MD 3CD6B 2VNIA 4YAWA 4EH1A 1J9ZA 3CPWB 1HA3A 2EIXA 1KK0A 1OB2A 2QDXA 4ZGNB 1CNFA 4YALA 3VMFA 4N3GA 2VZLA 3VO2A 2XNCA 1VQNB 1EFTA 3E1YE 5GV8A 1H42A 4BPRA 4IW3B 1QUEA 4YAOA 4ZCMA 1OGJA 1Q86D 3VO1A 2BV3A 3LYUA 3AGQA 4AC9A 4B4DA 3CCMB 2QN6A 3WYAA 4RD6A 3CC4B 4G5GA 1KK2A 3WY9A 2VNHA 1KRHA 4PC3A 3CCQB 3MHPA 3I55B 1IJEA 4RD1A 1U2RA 1YI2B 3CCSB 4RCZA 1GJRA 3PENA 4LBZA 2R6HA 1W2BB 1VQ6B 3I56B 2CNDA 4LC0A 1IJFA 3ZZTA 3AVTA 1N0VC 3U6BA 2BSAA 3VNVA 4PC6A 2QTZA 1ZM3A 4AF7A 4Y7CA 4R71A 3CCRB 4N3NA 1BJKA 3A1FA 4ACAA 1VQLB 1QUFA 1TVCA 3WBJA 3CCVB 1KQSB 1R5NA 2DEUA 1OGIA 1CNEA 1GAQA 3WXMA 1OB5A 3G6EB 4Y9UA 3AVXA 3CW2A 2HDNB 3JQRA 5EMNA 1F60A 4TN1A 1K8AD 4ACBA 1VQ5B 4RJLA 4YAUA 1G7RA 4G1VA 4TMWA 3V76A 4QFMA 3ZZ0A 4TMXA 1Q7YD 1BX1A 4M2LA 2DY1A 1FNCA 3CCUB 4ZCLA 2QEXB 3CC7B 1CQXA 5H5JA 2B5OA 1TUIA 2VYQA 2YWHA 3SJZA 1XB2A 3W2HA 1VQ4B 3B8HA 2VNKA 1QH0A 1YJWB 1W35A 3QSYA 1QVFB 2PMDA 4RD2A 3W2IA 2BMWA 2HCJB 4TMTA 4UAJA 2BPOA 3MCAA 1EXMA 4M4SA 4B44A 4QHYA 3JQPA 1XE1A 1QVGB 4P6VF 1YITB 3E20A 4M0LA 4MYTA 3ZBUA 3OJXA 3QFCA 3ZZUA 3JQQA 4LBWA 1ZUNB 1GO2A 1D1NA 1R5BA 3I1FA 4LBVA 4C0SA 4ZV4A 1DARA 4AF6A 4C43A 4B3XA 2DETA 2VNJA 2HMAA 3OZVA
chains in the Genus database with same CATH superfamily
4NARA 4DA8A 3X2FA 4CMAA 3JQGB 1Y4ZA 4NE7A 4HAVA 3EK2A 5JMOA 3IXMA 5DYIA 3MMXA 3KQNA 3SBEA 1MHTA 2OCKA 4R2XA 4XVUA 3F6PA 5KYXA 1GZ6A 1TUBB 1M75A 3EF3A 3ANSA 4TQGA 4DG9A 3AHGA 5CG2A 3HS3A 1G5HA 1TVMA 1YT5A 4G5HA 1SIOA 1CZOA 1CTQA 2ASEA 3WKAA 1LB1B 2YNMA 4JP3A 3R9KA 2GK3A 3CNBA 5DSXA 1O9BA 2G7MC 4JFRA 2J4CA 1O95C 4DR4B 3AF2A 1P3Y1 2GPWA 1NSTA 1G41A 4D5EA 3ZW9A 3TEFA 4EUHA 1UMKA 1Y0RA 3JSXA 3KXPA 1VYHA 1FMTA 3RVJA 3ISVA 2M6SA 2QRZA 3GEHA 3ZU5A 3ZXXA 4JS0A 4R3NA 4EX6A 1YOVA 2C9ZA 2CLFB 1VL2A 2OTLB 1S4MA 3OPOA 3SMVA 2OB1A 2C61A 2PMFA 4GI5A 4QBTA 1YDGA 1H2YA 3D5QA 5GIOE 3LHKA 4YRCA 3RWOA 4DCGA 1EFAA 1KFCB 1TU4A 4UHFA 1UXJA 1YRQA 5EYPA 5K0FA 3OEEA 1EFPB 3O5AA 5JCJA 2J3IA 2R48A 4CQJA 3A06A 2J45A 1DINA 4LWZA 1LQUA 2XI4A 3EIUA 1Y0YA 4EDFA 2G9VA 2MSEB 1BX0A 1EX9A 5JU6A 3DHYA 3ZV7A 4EEKA 4XFDA 5ERXA 1ZM2A 1NUQA 4Z4YA 3UHFA 1M8FA 3NB0A 1H4SA 2UZ1A 1TW2A 4D0LB 4MQMA 3M8KA 3SEFA 3FMPB 1EMDA 3JARB 3EH2A 2IPOA 1XAGA 1LDGA 2WJ4A 1Y1TA 8ATCA 1JMVA 3H05A 1E6WA 2REOA 3DB1A 2XMCA 3PL5A 5GGXA 5TE9A 1QFJA 1CULC 1PNVA 1Y34E 2H85A 5CA0B 1FNBA 2Q6LA 2FWPA 1GXSB 5DX0A 3IAEA 1B1AA 3KX2A 4J0CA 3M33A 1NJFA 4TTRA 3DL2A 2ZJ0A 4TSFD 4KLNA 2QJRA 4DC0A 1GGJA 1N8KA 2G09A 4P3YA 1O7JA 4XASA 4YAFA 2RKBA 5C5EA 3QE0A 1ITZA 4NAHA 3OURA 3V2UA 1HT2E 4XLZA 5CXUA 2X42A 1PTJC 4GMDA 1PEYA 4PAOA 2FQYA 3A37A 3BMCB 1TT7A 3ICPA 1IUOA 3F7MA 1CUHA 2I87A 4WWHA 1F7VA 3EIWA 3PNQA 2BSQA 2IYSA 3PEVA 4BFSA 4MDEA 1OYOA 3M6XA 4HVAA 2B1GA 3ESDA 3ETJA 3IEVA 1YRAA 4TTIA 2HHLA 3Q88A 2ZL7A 2A9FA 3Q6NA 3DWGA 3H94A 3TLGB 1U2EA 2TMDA 3A58B 1C4KA 4MKIA 3RWBA 4D82A 1KYYA 1ZH6A 4UFPA 3SHFA 1TADA 1WP4A 2WSBA 2NACA 3K9GA 2V3VA 2Q4BA 1IDOA 5BSYA 2P5TB 1VLHA 4JY7A 4RU1A 1QO9A 1TU3A 3W8DA 1KK1A 4ZGGA 3LDAA 2QW0X 5KINB 3CX3A 1Z5UA 3LPCA 5C34B 4J0QA 3TKLA 4XXHA 4D8TA 4MYRA 1T2AA 2R4QA 3UV6A 1BDHA 4U7FA 2GWHA 1KE2A 1Z6ZA 3UB4A 1R9MA 2QORA 1PJTA 3LOUA 3ZDZB 1M74A 1NXQA 1BD4A 1PFVA 3FUCA 1P6QA 3C3KA 3CLUC 1JFFB 4UMDA 3X1MA 5HHTA 1L5HA 2RI1A 2PLRA 4J0KA 1KMMA 4RTSA 4E1AA 4WI1A 4A0QA 1IRIA 1EBUA 2NN3C 3IUQA 2FKNA 5F2NA 4RTJA 1UR5A 1CSEE 4R2WA 2PEYA 2PMCA 3JVEA 4LNAA 4CKBA 4OV6B 5IYPA 1MIOA 2JA1A 2DQZA 4JX9A 4DK1A 1E1KA 3NTLA 2CLDX 3I28A 1GPLA 1RHMA 2GS9A 2W71A 5E3JA 2I3ZA 1P4HA 1M34B 2H59A 4UVDA 2AC7A 3AY3A 2CUZA 1TM4E 4MRRA 4K28A 4GWLA 3RFFA 2CLMB 4GDMA 4R1SA 5FHQA 1A77A 2AOTB 2EVWX 2Q3LA 3ES9A 1R9NA 1TF7A 3UB2A 2VXOA 1YRYE 2R1UA 3LX6A 1P6UA 3RVNA 5EHIA 5C3MA 5CB8A 1RXYA 2UKDA 3GMSA 5AHRA 1IN8A 3NMUF 1W0JA 1NMYA 2A2ZA 4MGKR 5BW8A 4QUZA 4TS4A 4Z4ZA 3CIOA 2XZDA 2ZM6B 3P45A 2V58A 2CXUA 5HJ7A 2VP9A 3Q7EA 2LPMA 1T8TA 1AA6A 4O63O 1H69A 1JEQB 1SFRA 1TDJA 3V7UA 4NECA 1UJ6A 3B70A 1YR2A 5AICA 3LFTA 3U9LA 3F9CA 1MX5A 2JIRA 3C41J 2PVPA 5FL7A 5TS3A 3WGVA 4ETNA 4FHZA 4JA0A 3H1PA 3ZYZA 3OZIA 4GD3Q 2MSKA 2AE2A 2JCGA 1SUIA 2VSFA 5C4GB 3T5AA 1VIAA 4DLSA 2W6NA 4Q24A 1SOMA 4U7DA 1YL5A 4PVDA 3L43A 4HQRA 2K87A 4OFZA 2HC9A 2E4AA 3I9JA 2G0AA 3GD7A 1ODJA 2QUBA 4EW3A 1VLZA 1HE1C 2AR7A 2Q3JA 5J58A 3RJ9A 2P5YA 2XNJA 3H2JA 2JFVA 3RRXA 2RK6A 2O1XA 3PFBA 4S12A 1DRJA 1HMPA 1GY8A 2NUPB 2OHXA 3BICA 2R1TB 1M2FA 2RHDA 1V16B 2F1MA 4FFBB 4H16A 5IEJA 1CY8A 4AZVA 5JJLA 2R84A 1BRMA 3KTOA 1QTQA 1OFIA 3ZWMA 4FJ1A 4X20A 2QUHA 1O0CA 5CJJA 2YWXA 3Q9NA 3WADA 3KCNA 4EO9A 1DQZA 1UKCA 3OJFA 4C01A 1ZO8A 2XIQA 4UTPA 5I9NA 2O8FB 3L6OO 4QAJA 5FB3A 1AB5A 1XZLA 2A1TR 4NJMB 4JBIA 1J4AA 1L7EA 2F1HA 2WF5A 2Q99A 3K8ZA 4N6NA 4NHOA 4QXMA 1QO0D 3JZIA 2Z43A 4KNWA 4QOHA 4WESA 3RABA 2YICA 4UBJA 1DFIA 1E98A 3R8CA 4D5GA 2OBYA 1FB5A 3K8QA 4R0NA 3WC4A 4UUNA 5G4LA 2X8JA 3IJEB 3UQZA 4R5MA 2N42A 2V4UA 3PKJA 1FS5A 3ZWKA 2ZULA 4DPMA 1UF9A 4DWJA 2WNHA 1QH1B 2D1YA 1F0PA 4ZVNA 5TGZA 2VATA 4RA9A 5KNDH 1N34B 3JWHA 3HADA 3GBPA 3GRFA 4TMKA 4TWZA 1E63A 4EF6A 5C7YA 2BBTA 2JGNA 1JDSA 3UMBA 2VIIA 2EFGA 1L1QA 4MIOA 5DNVA 3B9QA 3WLKX 1XD9A 4CMEA 2FPPB 2OCPA 4OXQA 4UVIA 1PSDA 2DJ5A 4KXWA 4MQBA 3WGLA 4PN7A 1J9ZA 5IUNC 1M76A 3NORA 4HN2A 4PXYA 2OV4A 1GG9A 5TVGA 3UUFA 3UNXA 1VI6A 3WMXA 2EIXA 5FR1A 4N65A 3UJAA 2H2WA 2BL4A 2VF7A 3OO0A 1AK9A 3ZNPA 4F5DA 2ZFUA 5DLPA 2SKCA 1ZZGA 4JQYA 1X1CA 1DC5A 4WKNA 4XN0A 3OZCA 1XWFA 4EK9A 1YU6A 4X07A 3CH7A 3KV3O 3UN1A 4N3GA 3UXMA 2P91A 2LTAA 4FCTA 2OD9A 1NMXA 2XVYA 3OLVA 4M1ZA 4PEVA 4WINA 1XZGA 1YRHA 1PKVA 1JYSA 4Z3KA 5EUCA 4Q6BA 3JCZA 4KDRA 3FCCA 4YHHB 3FYHA 3OEWA 3O91A 3W5AA 2B9EA 2XVAA 3GARA 3JQAB 2Q3MA 2XT0A 5FWYB 2JEZA 3O2NA 5HM8A 3QVLA 1KS9A 3B3GA 3F46A 1MAAA 1V8DA 3NJ8A 4MWTA 5C35A 1FMLA 3QLVC 1CRPA 2CLHB 2ZSEA 1EDEA 2DBYA 2OHJA 4PHCA 2QYOA 5CPFA 4XOIA 3EG5A 1EGHA 2Y1DA 3BXPA 2NTVA 1RT9A 1UDXA 3VOBA 5IKEA 4L57A 3ZE9A 3CCMB 1UWLA 1Y4DE 3KJIA 3C16C 4F6RB 2B99A 5KX5F 3HYNA 5C5IA 1YQDA 1RQ7A 3CLRC 3Q3HA 1L5OA 2W7TA 3JQ9A 1DBPA 1NHWA 4GNKA 1YXMA 1JHUA 1AUPA 5J47A 2QRUA 3HK2A 3WRXA 3CCQB 3F1KA 3HJHA 1ADJA 3DO5A 1NE2A 3CSDA 2MYPA 3LCUA 2I2DA 3GG9A 3ANXA 1O1YA 1YI2B 2FJUA 2CFTA 3O9MA 2C5HA 2BC9A 3PDIB 1G8JA 4NPAA 5AW3A 4A8JB 2WJPA 3GLUA 3E5NA 3VKVA 1H9BA 2WYRA 4Z1MA 3K6JA 4DIOA 5LMCA 2ORYA 5DWDA 4LIPD 4DR7B 5GY7A 1CRLA 5CM2Z 1KI8A 4Y1GA 4WLFA 1E2JA 1AGNA 4O4JF 5JNVA 3FR7A 1EE1A 1GRCA 2ZI3A 3DLAA 4JCCA 1IFXA 4KXUA 4Z2YA 5SY9A 1PT6A 4YR7A 2AKEA 2Y92A 2WIFA 4V1CB 4HWRA 3I6BA 1BCRB 3AONB 2BSAA 3E9ZA 4DA6A 1OH6A 2FLVA 3FSJX 5E4TA 4AF7A 1IHPA 3IO5A 4AO7A 3I9MA 3GMIA 1SVMA 2IOFK 3NOVA 1RACA 2GLTA 3ZE7A 3Q3CA 1B0UA 1U8YA 2QGNA 4XZ3A 2BFEA 3SHQA 5JE8A 1J56A 3QVGB 1G8AA 3Q15C 4IIBA 3WLPA 3ZZMA 1O97D 3P0IA 1KU6A 4PGGA 1L4YA 1RQNA 4QDKA 2QAGA 3PLRA 4CMJA 1WOOA 1KFEB 3QHPA 4BJ3A 2P75A 4JLSA 4NJEA 1U2DC 1K97A 2FP3A 4Y6PA 3ICCA 5DFAA 5ALIA 5J4YA 3EHDA 1FSFA 1WMEA 1UAAA 3IDQA 2FPMA 1AM4D 1PG2A 2H52A 1S2OA 3GUZA 2X6XA 2PZJA 3QEMB 1F8XA 4QICA 3PUIA 4KNVA 2CLOB 1H4VB 2C7PA 1X7WB 4C4SA 4NMXB 2WM2A 5JH7F 2QRVB 3WGOA 2FVGA 3LGXA 2WFMA 4G5FA 3IR7A 3R6JA 3D6TB 1N5OX 1RRCA 3DDCA 1CEQA 2WZCA 4D8VA 3ZVNA 1L5YA 1E1CA 5GJCA 3ZD8A 3O8QA 4OUDA 4KODA 4LYHA 4GOND 1TD9A 4ACBA 2FK8A 2R6FA 2PL3A 3I04A 5DOVA 4ZVKA 3LVFO 1AJEA 2B8TA 4QTTB 3KUKA 3CG4A 4YCCA 4JMPA 4WXRA 4C1NA 5A62A 4TLLB 3OCUA 2C42A 1DQYA 5DI3A 1I7QB 3WB9A 4NH0A 5EXDA 4EBFA 4Y6RA 2BJVA 2CYCA 2BFFA 2GYVA 2PNJA 3PXUA 2AOVA 1PBNA 3TTXA 1E5QA 1VPDA 4J1TA 4IICA 5E8JA 1U4SA 2ZYGA 3LLMA 1I51A 3NH6A 3FAZA 4TV8A 2D7DA 4WVFA 3PFCA 5FWNA 1QJCA 3AI3A 1IPHA 2B4KA 1UL1X 4YQFA 1T2DA 3TSYA 2ZRPA 4JYCA 3SSNA 3Q2OA 3QXXA 1G38A 2DQSA 3NP7A 3WLRA 2EAUA 1XZNA 3COZA 3FUTA 3TR6A 2Z2XA 4DCTA 4RUKA 2ZBEA 3DVAA 3CNLA 2OHOA 1RAAA 3PVDA 2W6IA 2JIBA 5L3QA 4Y0VA 1N1EA 2VUUA 4F4HA 4L4UA 3G0HA 2HSZA 1JPNA 3K9HA 3MG9A 1GZ7A 3NJRA 4L07A 2IZZA 4LGYA 1OFVA 1PX0A 4P2GA 2IHNA 5F9FA 3B60A 4R8KA 2O5RA 4DZZA 2C99A 1WOPA 2B5OA 3VH4A 1Y5RA 3ZWCA 3TD2A 1UBSB 1P0MA 3V1UA 4D45A 3EEOA 4QOGA 1U11A 1NW7A 3E7XA 5IWCA 1VKZA 1ADCA 5JSUA 3F97A 2P4UA 1U0BB 3X2EA 4YYZA 1HSOA 4C4AA 3I12A 4XWYA 2A5YB 1XSEA 3T95A 3C5EA 2W6QA 1T5HX 4JC0A 4FFNA 1U2SA 3K1ZA 1U9ZA 2DPHA 2JRCA 1QCDA 4FINA 4EJSA 1SXHA 1WU8A 2D1FA 5NULA 4JUBA 2AJCA 4BLUA 2BD0A 1BKYA 4OI1A 2ICAA 1FTWA 4AN0A 4BMYA 1XXHE 1H2AS 2E4WA 2GYWA 5A4DA 3D43A 2ZSKA 4JLDA 1A5BB 5DYTA 3RY8A 3T5DA 4D9KA 4NCXA 1LBSA 4FOLA 1XEXB 3X2SA 5JS1A 5IVHA 4XYMA 3LUPA 2B98A 3ZIUA 4E31A 3LP5A 3C3WA 3DHNA 4D3XA 1XE1A 2YY6A 1DQSA 4PICA 5DASA 3G6KA 4I55A 2PGNA 4KUGA 4Q18A 2GT1A 3E20A 4M0CA 3TH5A 4JASB 2JN9A 3IPXA 1N2EA 1OZAA 4EGFA 3GHHA 3EF1A 4WSOA 1XROA 4L4SA 5F9MA 2J59A 2YCLA 4YJFA 2YZMA 1KYVA 1A5ZA 1V2HE 1N8NA 3DE0X 4GRDA 1XNRB 4LI3X 1KRXA 3TE7A 4M36A 1NVWQ 5FT9A 3ZCTA 2SCUA 3OCZA 3PTAA 1Z2NX 5BV7A 3UV7A 3IP7A 2R2GA 3D4LA 1GARA 5AHKA 1KE1A 4ENQA 5ELLA 5BSTA 2QGFA 1M34E 2KHZA 1SXPA 5TPWB 4Q3NA 2BT4A 3PQCA 1YHQB 4ZOEA 4PN3A 3IIJA 1Q21A 2B2CA 2HBZA 4NDZA 2YJZA 3E3AA 4I4TF 2LKCA 1L3BA 5GIPE 1LSOA 2BKUA 1FFDA 3EY4A 3MXTA 4KIWA 3OJEA 2R68A 1T26A 2VA9A 3HVRA 2XBMA 3ILYA 5HFAA 4FN5A 3V8VA 5HZAA 4UBOA 3TQTA 2R8RA 2BLNA 2ZE7A 4FDMA 3K4HA 4YRIA 3H6KA 4AJLA 1Q77A 1V5WA 1WB9A 5K03A 3KJZA 2R97A 4K1LA 1M1NA 3R0QA 3OFSA 4XGKA 3T51B 4QGSA 1SUSA 1AZTA 1QSGA 2BCEA 3ABOB 3J81A 5GGYA 1UH5A 3WBBA 2BRUA 3AL2A 5DSZA 1ML4A 5DGTA 1NDHA 3PHIA 4R2MA 4GWGA 1SUCA 1UDBA 1T9BA 2IUTA 3DBVO 3NEPX 1QCYA 4PWZA 3SZUA 5DX8A 2GXAA 3FVVA 1ESCA 1C8BA 4MQFB 2JKVA 1TEXA 5DLEA 4EGCB 1VDZA 4HQFA 5DE3A 5JQGA 3ZNNA 2X5JO 1Z4JA 3HPRA 2R87A 5T6BA 1KWKA 4OBWA 3BWBA 1BOOA 1P80A 4E0BA 3KOMA 4O0LA 3WMFA 4E6EA 4KFSA 1JNYA 2X4LA 1IOVA 1W4CA 1E99A 2WFLA 2X1VA 2RHTA 1Y9AA 2Y1WA 4FZ5A 4U6QA 3CZAA 3TE6A 3QQ5A 2H16A 1VC2A 1J8YF 1F0KA 2HBRA 3L79A 4FTWA 4RVNA 2NIPA 2P9ZA 3B5JA 3BIWA 3IB3A 3RFUA 1QQBA 4PONA 3DZ8A 4U2EA 1GGMA 4WKCA 1F38A 1GADO 3BXFA 4NFYA 4PU0A 3GLIB 1RRGA 3WBFA 4AZ0B 1X7YB 4X92A 5F12A 2E5FA 3DT6A 4RYLA 3CNHA 4AMVA 4UKDA 4V0NA 3GIWA 1VMDA 3MOIA 1MVLA 1COWD 4RE5A 1DXYA 2ECQA 4WNIA 5G4KB 1CNMA 3K72B 3T9CA 5ICSA 1Z36A 2O0MA 4PNZA 3SYNA 4BL5A 1E4VA 3OLWA 3SVZA 5IYNA 5CT6A 3AHIA 2EX1A 1DIHA 1C9JA 1DMSA 1V5EA 2PLNA 3U3ZA 1V3QE 2Z57A 2AHOA 1FQKA 1OXBB 1CDZA 2B1RA 3BA6A 3FVRA 3PHHA 4R81A 2F3RA 3LC7O 4YCSA 3C48A 5JBIA 2R6DA 3TZCA 3ZD7A 1EFRD 4DYHA 1KI4A 1G7SA 1LRLA 4QQFA 4QDOA 5ESWA 1QBGA 3VSEA 4QXRA 4DMRA 3I5XA 3ASYA 3E9DA 4K9LA 3EWAA 4YASA 4O2AF 2FZLA 2X6RA 3DL4A 3T1OA 5BY2A 1Q11A 4B4KA 1D4OA 3TTSA 1IY2A 3RR2A 2PS9A 2EGHA 3JD2A 4MEBA 1NXSA 1G5TA 3MWJA 3TL3A 4AUMA 2OYCA 1UMCA 2X76A 5AO9A 5A71A 4C3OB 5ALEA 3WK5A 2WD7A 4IOKA 2CRVA 2GXUA 1C50A 2WIBA 3FPAA 3Q11A 2H5LA 4OQMA 3H75A 3I45A 1XRPA 2HHJA 1GCAA 2Q9CA 3CR3C 3WLHA 5A3QA 5F78A 3LVBA 4ZOBA 5T3UA 1QRRA 3VYVA 5K3AA 4W5TA 4KK3A 5LBUA 5J2TB 1YL7A 2IE0A 1V47A 3DR3A 1Y3AA 2XRFA 5CW1A 2QRMA 4MZXA 3PGJA 1ZNXA 1B8UA 2MINA 4ISBA 2X0JA 4AYXA 1SZDA 1D09A 4M83A 4QUHA 5A9RA 2OCBA 2Y1OA 1KEVA 5CCXA 1YQ9A 3ICOA 4IQGA 1HX7A 4DBZA 4I50A 3UJ3X 2Q8PA 1FA9A 1P1BA 3OD5A 1R0BA 2VSYA 2ZXHA 1O94C 1PZFA 3O84A 2OBLA 4F9TA 2ZTSA 3TK1A 1DLIA 4RY8A 1VQOB 1QYVA 3RVSA 3WGUA 1AKUA 5LA6F 1T0PA 4Q19A 2X9LA 4L50A 4OP2A 1L8AA 3HB5X 4W5WA 1AT1A 1GNSA 3L7MA 4NBKA 4RSGA 4V2IA 4Q9LA 3PEWA 1AMOA 1XTPA 1PAUA 2RAVA 3K35A 1DEHA 4YJGA 1I3KA 4KO4S 4V24A 4MVYA 4XUCA 1JTFA 4NMLA 3V7YA 4N5HX 3P1JA 1YR3A 2XJ9A 3M1AA 1EGVB 1DUSA 3S99A 2AG5A 3USZA 3ONFA 4PV7A 5AVZA 3KKQA 3CZQA 4G23A 4PO9A 4O0MA 3H9EO 4Y1FA 1VL1A 3SOPA 3T9BA 1O96A 5G1PA 4HT3B 5JH7B 3IHWA 4MGZR 1S02A 1PHPA 4AQYB 2PJRA 1JG4A 2DWPA 2RK4A 1J7KA 1FP4B 2Y93A 3EEIA 2OXEA 3F49S 1CWUA 2FPIA 2H1SA 2QLMA 4HLQB 2IP2A 2JFZA 4ILKA 4N8DA 3O4FA 4HG2A 5EVCA 1L7RA 1KK3A 2EG9A 2R6AA 1JE0A 3GROA 1GL3A 4MPRA 1KXZA 1W4LA 3G2NA 5EMHA 3MINB 3QX8A 4U7PB 5EIBD 1H0HA 2W9XA 3D3EA 2CXTA 3S68A 4BLRA 3AR5A 3SYRA 2ZSJA 3HABA 5A04A 4NCHA 1THTA 2AZ4A 1JHVA 1I30A 3DC7A 5JAIA 3LQ2A 5KNDD 1F06A 1ZWLA 2IZOA 3EXAA 1IMOA 1P1FA 1A0OA 1X9IA 4FNMA 4BMOB 1Y4AE 4EABA 1VGVA 3L1JA 3IOEA 1BG6A 1K1EA 1PJAA 3KT8A 3S5JA 1ZVJA 4A9AA 2CXXA 4Z3DA 4CNBA 1U4OA 1ZKDA 2HRZA 2WJ6A 1LLFA 3A6PC 1G3QA 1C9NA 4XRRA 3V8EA 3G49A 5BR4A 2QWXA 1WVIA 2C04A 4JBWA 5ECYA 5K6AC 4YYEA 4XLTA 1D5CA 4FHFA 2REQA 4X84A 3SZGA 4BE9A 5KTMA 1GKUB 2ZBGA 4ZOLF 5AK3A 1GUFA 1N9GA 1DG1G 3ZU4A 1KJWA 1T1GA 2GDZA 4XGQA 1A2QA 2DFLA 5F5XA 1PS9A 3FSEA 5TSDA 2Y71A 3EG9A 4MW2A 4U7HA 2NSLA 3PHCA 4DA7A 3Q8LA 1E3WA 1G2IA 1R4AA 4CVNA 1XTTA 3SIWA 3BJEA 1M54A 3ZLVA 2XOKD 5BOVA 1X9HA 1EXNA 4NY1A 4DY4A 1KHTA 2ATVA 3UAWA 1FYXA 5KHOC 4NC9A 1KRWA 1M2JA 2YV5A 3UK6A 1YD7A 2Q6VA 4BV9A 2GCOB 4CETA 2DERA 1CDDA 1HLGA 2CHVA 1RI5A 1ST2A 2YTZA 2ZJ8A 1PP4A 3HP7A 4GMGA 4TYMA 5FNVF 1EDDA 2I4NA 1TTQB 3ZWAA 1WEKA 4EY4A 5FADA 3WQRA 1KZ6A 3JVDA 3FPKA 3L4SO 4B0OA 2E21A 2G82A 3FVWA 3ZDQA 3SR3A 3F78A 3O1HB 5IH7A 2FWMX 1PQWA 2RGYA 3A4NA 1N2XA 1WPGA 2YMQA 3ZGYA 1HYBA 1MO2A 2OGUA 1GTZA 2AS0A 3NM4A 4UW9A 1D1QA 2VDRB 5F3WB 2ZAIA 4EYKA 2QA5A 3PQ3A 1IN5A 4YMGA 3LM8A 4RC9A 2NZVG 3FLMA 1SOVA 3GT0A 1DRUA 3I1IA 1VHJA 1J0DA 4CDNA 1R6AA 1Z12A 3MRSA 4U1RA 3VMMA 4D42A 4C0QC 3EVEA 3CY6A 2GI4A 3FW1A 2YC2C 1Y9DA 5DBHX 4KR7A 2F4VB 1WW2A 5AP9A 4RAQA 4EPXA 3U4QB 2PKCA 2AL7A 1JRLA 1RM0A 4L0QA 2V9ZA 1HYHA 1RI4A 2P2NA 2ARKA 1MOZA 3SJ7A 4EMTA 4PW0A 2GFQA 3TWOA 1QIFA 3N74A 3OICA 2JDIA 2YJ5A 3EODA 3QPCA 4TZKA 2Z6AA 4LOKA 4GQNA 5TT0A 2PE5A 1FXWA 2AQKA 3D1JA 3ONNA 5JAPA 4B3BA 1QE0A 2EX0A 1QGDA 4NU0A 2A9QA 2ID7A 1U6JA 1HSZA 1MC5A 5FEUA 1CUXA 1SAYA 3GUUA 3DE5X 4UD2A 2RD2A 4B4DA 2I5PO 3FDZB 4YONB 1R6BX 4V3BA 2NU8B 1L4KA 3TZBA 3WRYC 1NNSA 4YI3A 2ZCJA 4H3HB 4M6WB 1G4AE 3FYUA 4PG6A 1E0SA 4AX8A 3DE7X 4I4TB 3LYHA 3DEAA 1P0CA 2CMHA 4BVGA 4HZIA 1ZGAA 5HK9A 3AJAA 3VAAA 3EDOA 2PRYA 2J0UB 3RU7A 5MFPA 3EQ9A 5FOVA 2V7PA 3IT3A 3NXSA 3JRXA 4XLCA 3I55B 2ETXA 2HF2A 2I8CA 3KHSA 4FDVA 4X60A 2A1IA 2OT3B 3SFVA 4UJ3A 3PI7A 2H7XA 4R1LA 3GDOA 5LQDA 2ZE8A 3GHYA 1YZGA 4IPTA 3M2TA 1C30A 3I83A 5C3UA 4R16A 1M6VB 1Z7YA 3PENA 1ZRNA 4KACA 3STWA 2HWYA 3D2BA 5J1SB 1UUFA 1XQBA 1VQ6B 2BTQA 2Z3WA 5EP3A 3WB1A 2IDJA 2JD0A 3EY9A 5I7OA 3WYCA 3QX7A 3AEZA 4P3NA 1SD5A 4ND5A 2Q0XA 3P9QA 3WAJA 4BP9A 3PFFA 3KQYA 1O54A 1QH8A 1L7QA 3FOWA 4C1BA 2JRLA 2AWNA 4EWLA 1ZMOA 4K0RA 3SBXA 3D6JA 4L2IB 4UM7A 1JQ5A 5D3ZA 4IP0A 2OQIA 2XHZA 1A04A 3EDYA 3L4KA 1WXXA 3DZHA 5LWQA 3GAMA 2PE3A 1FBNA 2QHXA 1HTTA 4OATA 2ZLBA 4QBIA 3ROFA 4YUWA 1QHYA 3F4LA 1D4FA 3KSZO 3NYQA 1S9DA 3ABQB 3NHRA 1D9XA 2P9QA 4JI3B 1E2HA 4PZ0A 5L3SB 5D5PA 1CY7A 2NXJA 2JIZA 2ZUTA 1GDDA 1HQDA 4PHGA 3ZS8A 3ZE6A 1LUAA 1DAPA 3LCCA 1P9WA 4TXMA 1FRVA 1C7JA 3DTVD 3EDQA 4J0JA 3UJBA 1DKQA 1VZ3A 4ZN6A 4Q1CA 4TWIA 1MGOA 2FMXA 4Q6WA 3JASB 3TI7A 3Q2KA 1TAUA 3TFWA 5I4KA 4BEWA 2XXJA 1M0EA 3LX8A 1L8OA 1UEXC 2Q3CA 4II7A 4HADA 4ZAVA 2C58A 5IXJA 4D79A 3AUXA 3ADPA 1ODFA 3E61A 4Q3DA 5EIAA 5L3VA 2COEA 2GJPA 4DV0B 1JI0A 2CD7A 3W8RA 1RNLA 3DO8A 2FFJA 3NAZA 4NSNA 4Q47A 4D3DA 4DV4B 3V8PA 1K7YA 2IS1A 1P8AA 3P9ZA 3EWIA 3HBNA 1HOTA 3I92A 4JR1A 2FN7A 2XMRA 4UU1A 5ECDA 1HFWA 4L8YA 3TW4A 3EN0A 3WKDA 4EFLA 5I8PA 2NZYA 3F2VA 1DE0A 5DNDA 5DRYA 4IDBA 4KRYA 1X7ZA 4O2AB 3QLUA 3BBLA 4TMWA 3UUWA 1G20E 4M7PA 4XONA 3W90A 2BFOA 3WQBA 3L4BC 5BT8A 4JV5B 1RIFA 1Y9ZA 2F9MA 1SJ9A 2O7SA 3TM4A 1IJKA 2XCRB 3WFIA 2HBYA 3HB4X 3STXA 1Y6QA 1OJ7A 1T0IA 3C2QA 3HCAA 3M70A 1SVOA 2Q62A 1D6JA 4TMXA 2FPXA 1I13A 2H2GA 2WMNB 1IB6A 1AF4A 4K9OA 4QU0A 4RL4A 5FUXA 3N05A 4OK5A 1C7QA 4R5HA 1BX1A 1M2VA 1BIFA 3OLZA 1JQDA 4H08A 1DHTA 4N5NA 1GZDA 2CGEA 2WM8A 4BAZA 5ALFA 1MO3A 4DJEC 1BGVA 3F90A 4E3ZA 3FYSA 4F4IA 1Q12A 3AJDA 3O4VA 3L3BA 2ZDQA 2FGJA 3QFFA 3ZTYA 1WW8A 2POCA 1JDVA 1KKMA 3OTIA 3GELA 4RFLA 5IRCD 4KUHA 3DSRA 5TMEA 3D7SA 3LCRA 1Y82A 5J2UA 5KJEA 3F6CA 4ARSA 5KTPA 2CJWA 2QX8A 3R6TA 3H9NA 1QIIA 2D1RA 3P19A 4UAUA 2D8AA 3GJYA 4LGCA 1BA2A 3DV0A 2YINC 3G82C 4HDNA 4K9NA 4HRXA 4XEHA 3P97A 2OCGA 3VR5D 1ENPA 1CW2B 2Y8EA 3E9QA 2A5DA 3G13A 3CH6A 4YFVA 4ZHQA 2VS1A 5DXAA 1AD2A 2TS1A 4GMKA 3R7NA 5E3HA 4G0UA 3BXEA 4URXR 3OOHA 4MRMB 4ZKEA 3T61A 3FHLA 5LA6B 1VTKA 1N4AA 4HWKA 2XYRA 3JQDA 3CLSC 1V1RA 1XGKA 2PGOA 4NV1A 2NUBA 2XAUA 2DHCA 4WN9A 4CKXA 4R1NA 2IRWA 3DLPX 2BJHA 4MV5A 1T5BA 4H4EA 4RTMA 1WW3A 1ZJ6A 3FIJA 1GPBA 3UOGA 2VHYA 3SXUA 1N33B 3I6IA 4F1JA 1F9EA 1LF0A 4O8ZA 2CC2A 2XA1A 5TPZA 5E6SA 1E18A 2QL5A 1HR0B 1PE0A 2J87A 2GVZC 2ZR9A 1JR3E 4OD0A 2WTXA 4LBWA 4TQAA 4BVEA 1UPXA 4BEBA 5E2BA 5EKUA 3SDZA 2IYXA 3BKWA 3ERCA 1K06A 2JFUA 3S1AA 5AK6A 1LDYA 2R8BA 4KB5A 4Y6SA 3W8FA 4DRXA 4EELA 2QN2A 3GJRA 1NN1A 2BEUB 2QG4A 1TZKA 3ELYA 3URKA 3HMKA 1KGDA 4AI6A 4OKSA 3O31A 1Q15A 3PHBE 4C7OB 3GJ4A 3W78A 1U1EA 1E5DA 5DN6D 2XTJA 3I39X 3IAS6 5EOVA 3TLBA 4PLGA 4R8RA 4E30A 3D6UA 5BOSA 5KYWB 3T53B 1O4VA 2WZDA 2LDBA 3C8DA 2A88A 5CTAA 2OXFA 2C3MA 3A4MA 4IV8A 2EYQA 1K73D 1QS0A 3NNDA 1Q0HA 5DHFA 5EZ6B 3NDRA 4ZV7A 3L06A 2B35A 4B3SB 5CXSA 3S8EA 1G6Q1 1ZJZA 4KSYA 4KEAA 1MB3A 3RFVA 1DIOB 2BGLA 2VJNA 4HAZA 1JPVA 3DTNA 4ZOLB 5TEWA 1T0UA 1IZ0A 3MCTA 3P9RA 1ZMRA 1MEJA 1JZTA 4AKEA 4BNZA 4H9GA 5JAMA 1GGKA 2OD2A 2XDYA 3JAWA 4GOXA 4ARBA 5HNKA 3ER8A 1UC5B 2JI9A 1T6YA 2OK8A 4RM3A 3LQEA 1KIAA 4NOMA 4Q5IA 1KZ1A 3AR9A 3TN7A 1YACA 3UIEA 3S1SA 3CN9A 4OAPA 1R18A 3THWA 4KH1A 4MCHA 4XQEA 4ARCA 4EUKA 3F74A 5FNVB 2XQFA 5JXGA 1NWCA 4KK4A 2AG8A 5L6LB 2B8JA 5D2CA 1VPVA 1VP9A 1DU4A 2HXSA 5AW1A 5ENVA 2XUOA 1NM5C 1JAZA 2RHRA 4DW8A 1YR9A 1U5AA 2A35A 1FFXA 2J4DA 3PXCX 2AUTA 1AN9A 2CHUA 2DPYA 2YFHA 3KQVA 4KAJA 1KO5A 1R8SA 1Q17A 2NV0A 3T3IA 4MUKA 3BIXA 3KC2A 1ZPDA 5HIJA 2QXYA 3TVYA 2Q27A 5FI1B 4KQEA 4OGWA 3BJZA 3DM5A 3V9AA 3THYB 1L5QA 1YBVA 4WV3A 5IDWA 5EG5A 1WPQA 1ZW6A 2PHZA 2V8BA 5EUBA 4ARIA 4U6SA 1TKCA 2VQ6A 3LY9A 4Z4GA 1XNQB 2C95A 3C3XA 1H3FA 1CF9A 3H5AA 3WLMA 4AY5A 4JLWA 3GJSA 3CZ5A 5B2FA 1N7GA 1ULUA 4Q1EA 4BN0A 4QUJA 4WK4B 3UH0A 2EKPA 1J2TA 3P9CA 1HE2A 5D8DA 4BDSA 1J07A 1J2EA 5KOYA 5H83A 5IJZA 3I76A 1Y1KE 2IYTA 3CC8A 4H18A 2YASA 2EEZA 4U3JA 4AD8A 5AMXA 2Q4OA 2IU0A 3UG7A 1P33A 1SHZA 4UFNA 4QXOA 3X1ZA 2B3DA 4D9CA 2D6FA 3VR1A 2BSXA 2F1JA 3OFJA 5K45A 3CZPA 2VBIA 1T6NA 2ZATA 4H6PA 1AO3A 4KC0A 4NCBA 4LV6A 4C3VA 1T24A 4WA8A 3CRW1 2C2HA 3IIIA 1E9BA 3ONYA 3PNSA 4Z4TA 4ERNA 1KNXA 4WZBE 3SR0A 1ZP6A 3RRZA 5B4VA 3CPHA 1G21A 1JAXA 1DT3A 1FS4A 1G6HA 1E20A 3A36A 3DV2A 4A6DA 3DT9A 2DCUA 1YNOA 3A26A 4B33A 2WKPA 4LZZA 4ESOA 1I3MA 1ZI6A 3MTJA 5HRCA 4I5DA 5HQ3A 1D8TA 4JVMA 2NQTA 5DTMA 4UNNA 1BQEA 4XLHA 5JALA 4LY9A 1MJ5A 5H16A 1Q1BA 5JD5A 3BGDA 3ETHA 2J6CA 4XX0B 4DQXA 2Z5GA 3ZGXA 5M29A 4AF8A 3MWEA 4CKCA 4HC4A 4FUQA 1NUUA 1K7FB 2WIJA 4QGFA 2QTVA 1ECPA 1OI2A 3DW3X 5FNZA 3H9CA 2W0SA 4ZODA 4F5ZA 1M7GA 5ILGA 4F3NA 1CX9B 1R0WA 2I71A 4RK7A 3VVBA 3Q3IA 2NT4A 4KKTA 3AW8A 1G4UR 2TMKA 1PR6A 4DHWA 4PANA 1KJZA 3KHUA 3PFNA 5ESRA 5IS2A 4FYKA 4MVJI 1NLFA 2ZS9A 1L4MA 4ARZA 5HPYB 1W4AA 3HL4A 1SVSA 4UDNA 1KZYC 1LQTA 3QE9Y 3RS7A 2EGUA 3KSRA 3G23A 4OOSA 3O94A 1DC7A 4MVJM 2Y0BA 4OOVA 4MS4A 5E8RA 2H4XA 5FOWA 5JW6A 4Z2AA 1S7CA 3AI2A 2OAGA 4R2LA 4KVFA 4WL0A 3QY0A 5I9SA 3H8VA 2D4HA 3D0RA 3SYLA 1DIBA 4FGKA 1RHUA 2C2KA 3EMBA 5JMPA 5JSZA 3TB6A 3A9SA 2VTBA 4U5XA 2X3UA 3GLTA 3K9QO 3C7AA 2D5IA 2INGX 2OVFA 4ZVSA 1BW9A 2DG2A 4I4IA 3NWEA 4I4NA 3QGMA 4MS3A 5AVOA 1ZNQO 1V7CA 2E37A 4GG1A 1AQJA 4QNNA 4BB6A 3UXHA 3LHDA 5M5BA 3QLTA 4DQ0A 5JV5A 1GGFA 4GGPA 5FOTA 3OX3A 3E53A 4BRZA 2C31A 5I7VA 5J35A 1EJ6A 2WC1A 4O3MA 3K0FB 2DB3A 3AJ9A 2WZBA 5EMLA 5JC1A 3RYFA 1Z5ZA 2QN8A 1LH0A 3BQNB 1ZHHA 2PUTA 2IOYA 4Q9IA 3UKOA 1KQFA 3ZYCA 3ILHA 3WAKA 3ZBQA 5LP1A 1EVQA 5HMMA 1A4IA 2WWGA 4XARA 4RVOA 2AQHA 5EZQA 4ZT7A 5E4JA 1DT5A 3DDZX 3KPUA 5IJAA 4X65B 2G28A 3L1KA 4TT8A 3OEHA 1UJMA 4R8LA 3DEZA 3EVGA 1TB4A 4MW9A 1SQFA 5AW4A 1JSCA 1YJ5A 3RUEA 4A91A 1NU8A 3PDHA 4F9FA 3MNFA 5CB4F 4TKZA 2HR1A 4LQLA 1OZFA 3E8SA 5T4FA 1ZEMA 1S72B 1E8DA 1GAEO 2AKYA 2P7IA 2QN7A 4C0BA 5BRAA 4YTEA 3A9CA 1JQEA 3VC7A 1V5IA 4E6PA 4V38A 3GA5A 3OQNA 2JANA 2HQOA 4RZSA 3W34A 2IF0A 2WHXA 3F3KA 4H7PA 1XD2B 3N8IA 4OH1A 4RCYA 4YMUA 3UWDA 5E9QA 4E5DA 1UT8A 2C59A 2FR1A 3BEOA 3EGXB 3MEQA 4FD3A 4FOOA 5DLDA 1H6BA 3HB9A 4OP7A 1WM1A 4LYFA 3VR3D 5AOAA 2C7RA 4JVSB 4Z8XA 1RZRD 2QBYB 3OETA 2DF8A 3DTYA 2OXTA 2D7JA 5FDFA 1Z6TA 2Q7OE 4EB0A 4JQSA 2WUEA 1P4JA 2O0KA 4GWKA 1QV6A 3LCVB 4UVHA 5B64A 4MB6A 4MO2A 3R5XA 5FI0B 4XX1A 1B2RA 3ABSB 1KHHA 3E7PA 4KBFA 2IY7A 3LYAA 3UUGA 2BWJA 2J9XB 4EM6A 2G4LA 3DJYA 1G63A 3IBGA 4M53A 1VJTA 2PBLA 5L45A 3IB6A 2VJQA 3NDIA 4JBHA 3V9PA 1JBEA 4LSWA 4LOLA 1MAHA 5DHAA 5GPBA 3OSZA 3NTXA 3TECE 1PK7A 4INAA 2BEWA 3VC1A 2IPAB 3HZHA 2P4SA 3HH8A 1PFUA 3A4IA 4BJHB 3MMSA 5TMDA 1OA0A 1KEKA 1WD7A 4AS2A 4DCMA 3JR3A 1E0AA 5GONA 3N2GA 5BN3A 2VWQA 1M5TA 2JD2A 4KQCA 3SBDA 3K6SA 1PQUA 1BJRE 1OT5A 2GD0A 2E5LB 4BX8A 4ZQGA 3FCEA 1WXIA 4JFAA 2IHUA 3D4BA 4X1YB 4NQZA 4ZGNB 4LX8A 1V25A 3CKLA 3OE5A 1GT6A 4YLGA 1DBVO 2Z1DA 4BFYA 5CDTA 4X05A 2YWRA 1WZCA 3O38A 1W9HA 1JDUA 3WLEA 4LSGA 1FVXA 1S2NA 5EY5B 1RQ2A 2QP9X 2QTWB 5CIYA 1HE4A 1G21E 4D81A 3DLBA 2IEYA 1YUNA 3TD6A 4FOSA 4CKBB 4O29A 3ZX4A 4CIDA 3AFIA 2G0NA 4TUYF 3LBHA 1AZSC 1K5DA 4G89A 4BPRA 1GQ2A 4S05A 3HKEA 3KKOA 5A4KA 3KJXA 2II6A 4WRRA 4TL6A 1MW8X 2W2QA 3A4TA 5TGTA 1SR8A 1FX0B 1RCUA 2CYAA 1W25A 2J5BA 2VN8A 2E4UA 3EPRA 4UREA 2Y4NA 3RVOA 3SU8A 2BV3A 1AHIA 1MPXA 1SIBE 2Q5EA 2WOJA 3WK8A 4ALIA 3IDZA 5C80A 2GMWA 4AC9A 4ERXA 1O6ZA 2BELA 2Q1YA 3OE1A 4OHPA 1B74A 1G3MA 2DAPA 3QEOA 2CHQA 2XB4A 3O8NA 3JYNA 5HRAA 1NASA 3MUOA 4QGBA 2E9SA 3WZLA 1YU9A 2RHMA 4J16C 1VHOA 3A3PA 5FO1A 1Q14A 2RAUA 4F04A 3JWGA 3P4YA 2VJOA 4U0KA 4CCAA 1AOXA 3BTSA 3T5BA 1TF5A 1U80A 2BAGA 3WE7A 3G2QA 3GVLA 1KJYA 4RDJA 2R86A 4J7CA 4Q93A 4F96A 5AVJA 1U3VA 1RKXA 4HTFA 1UD3A 2PK3A 2H5IA 2POQX 3C45A 5ANRB 3GYGA 5ICEA 1IEQA 4ZO6A 1RLIA 1E60A 3OF5A 2VEOA 3D54D 4ZJYA 1U98A 1DEOA 4E13A 4X6XA 1AZLA 3U7EB 2IZ6A 2WVJA 2I7XA 3EOAI 4P5EA 1NOJA 4YVFA 1AH2A 1MRSA 1KYQA 1RJDA 1SZCA 4RD1A 2GKGA 3W4KA 5FUWA 3RUFA 5KWSA 1LI4A 3IERA 4Y1RA 4RA6B 4X91A 3D3NA 4ZI3A 3LK6A 3EEYA 1BS1A 1G5RA 1KKLA 2ODNA 3JQCA 2IV2X 3KU1A 2OCYC 1HT0A 5C37A 4PHFA 5IVPA 4OQLA 4ICIA 1CIJA 1P9OA 2PU7A 3MUNA 1FP1D 1ZUIA 2P90A 4MARA 4A3SA 5EJ9A 3U3KA 1FW8A 3GWGA 1XAHA 1CZHA 5EE3A 4ZZ2A 3ZZTA 3AVTA 1EVIA 3ZVKA 1ZMTA 1GPH1 3HVHA 5JCXA 2JZCA 1FDVA 1FC0A 1JW9B 2J0VA 2IEIA 4CCYA 1H6CA 1I1OA 3ZUGA 2QTZA 1LXCA 2EP8A 3L0BA 4GX1A 1IBRA 1U99A 1U9IA 4LW8A 4CL0A 1HGXA 5A4JA 1POWA 2P6UA 3FCAA 2FSFA 2FR0A 3EZNA 1VL5A 3AQIA 4QPJC 4CR7A 4K0KB 4X20B 3WP1B 1SHKA 1TYDE 2QRJA 2EZ8A 1E1NA 1DEKA 3LVQE 4LOHA 4PAWA 5I45A 3KKNA 1KI9A 2KVOA 4KW7A 3RDPA 1DBWA 3GNLA 3PKIA 1QUFA 3CESA 5GZ6A 5CU7A 3UOWA 3ZTTA 2XMZA 5JEEA 1KWGA 1CJCA 3BEDA 1C9DB 5G0SA 3R0ZA 3EF0A 5KCZA 2PX4A 3M3PA 2OD7A 2YVAA 3JQFA 4QIHA 3I2GA 1KP3A 3I4LA 5EC8A 3BS4A 4IXMA 4PGMA 4CL3A 2HX1A 4BJ1A 2NYRA 1Z6GA 1SMKA 3RE1A 4L9SA 1PFGA 2Q2VA 2XRMA 5CVTA 2OLKA 3HHPA 5K0SA 1KOJA 1NBMD 3M89A 3GRZA 1AKTA 1LGYA 2HGZA 5BRNA 2CVOA 2GM9A 3VU1A 4CHGA 4GLJA 1VHEA 3DKVA 4WY8A 3HZRA 3O47A 3VR6H 5ICMA 2Q41A 4F6LA 2BFAA 2BGRA 1T5OA 5B30A 2GBLC 4BO0A 3IR5A 3K96A 4KPGA 1HQYE 1OI4A 4UHCA 5A3VA 3WJ7A 2AEEA 4RJLA 3GLHB 3C3DA 4RQBA 2MMGA 3G0IA 1BEUB 4I2NA 3TB4A 1CUVA 3PJFA 1OHHD 4JLAA 3T38A 1E2EA 2XA2A 3GH1A 3PGLA 4EG0A 1OLXA 2GEVA 4E5VA 1W5BA 2OBNA 2QRGA 4CQNA 1GQFA 3QU4A 3NBKA 3TSCA 2W83A 3AG6A 1AS3A 3PUYA 3B2QA 1Y7HA 2OHIA 1YTUA 4FILA 1AS0A 3G05A 5KB3A 1FMJA 1E8NA 1G55A 3H5VA 3MD9A 4YMWA 2CHGA 4OQYA 2XGJA 2I03A 3PJDA 5KAMA 3RS5A 2PQ6A 2ZS7A 2NO6A 1CY2A 2JAOA 1R4MA 4M9RA 4YWHA 3STYA 1IL0A 1MC1A 1T10A 1TM1E 3ASSA 3O4JA 3U3MA 5I3CA 5JJIA 1XLTC 3WGKA 3LD9A 5DP1A 5CGZA 5BNWA 2QTGA 3HGMA 4QOIA 4R54A 5L9AA 2FU5C 4YJDA 3P7MA 3DH0A 1PW5A 2XVXA 5EE1A 1J97A 4G4JA 3I53A 2XSZA 1GV0A 4I5GA 2HLNA 4KOEC 4EZBA 5JUWA 1GNQA 1VQ4B 5E1DA 3W7VA 5TARA 3BM5A 1EKXA 1QU3A 2ZANA 2WZQA 2H2AA 2ZL5A 4Y6QA 1EJ2A 3IO3A 1YJWB 2CL6X 2G4VA 1HTBA 3WB2A 1E1MA 2YYYA 5LC1A 1SU4A 4EG3A 6ADHA 2R8OA 3TJRA 1V26A 1II8A 4TV9B 4DL9A 1ZR2A 1V39A 2QTHA 4YAJA 5ARCA 2GNPA 1VQ1A 1OQAA 1DSSG 2PNFA 2EEPA 4TVSA 1QP4A 2SKEA 4QTXA 1MG0A 1NQOA 1PO7A 1CR2A 1JIQA 1PHRA 3DDUA 1L5NA 3WK6A 4BLQA 3VOSA 4BQQA 3N3BC 5F52A 4XD7D 5KCMA 3VJMA 1SVKA 4DHEA 4ER0A 5FO0A 3OTQA 4JI2B 4IFBA 4Z7NB 3QVKA 3BH0A 3C5HA 1QF9A 2B2XA 2VJDA 3G17A 1V7PC 4MICA 5FCDA 3V2GA 1AHNA 4R2KA 1BEEA 2UYQA 2AI2A 4LXIA 4MVJP 3GEPA 1B1CA 1U8ZA 1RSZA 5FI5A 4RF2A 3WWYA 5GTDA 1EFLA 3VYSB 3EZGA 4XEUA 3GLFA 5IBQA 1C2YA 3THRA 2FN9A 4TOIA 4WKOA 4AKHA 3IEIA 2VHQA 4U9IS 4YC7A 2HIAA 3ULKA 4ML3A 1D1NA 1YR8A 2YOGA 4B6SA 3BERA 2CHFA 3RC2A 1ZH8A 3OPNA 4PYLA 3VKUA 4OYYA 1GITA 3BMOB 4FR0A 4JENA 1J8DA 3AF1A 3AUYA 5KYNA 3MGAA 2LUOA 1LZKA 4C43A 4H7DA 5LDDC 2HMAA 4HFNA 5PNTA 1WXQA 3INYA 4ZEOA 2JIDA 3LOQA 5D01A 1QYRA 3U4CA 1D2HA 4YRPA 4BLWA 4IHJA 2PD3A 2WJJA 4W99A 1TCBA 2OM6A 3W7AA 2M1ZA 4EUNA 5BQ3A 3HZZA 3U3DA 5CB4B 4TTVA 2GAFA 3KWLA 5JSKA 1FRQA 1JECA 1A8IA 3PX2A 1MQ8B 4RTLA 4WH0A 1Z0ZA 3BGIA 3DDSA 2Q1WA 2WUDA 3QOFA 4NJEB 1RLMA 2OBRA 4OKNA 4XCVA 1UAYA 2QYHA 4MSUA 2MSLA 2O8EB 1ZH4A 1FPMA 3ND6A 3PCRB 2GA8A 3TRKA 1NW4A 4WLEA 2YHBA 4WW0A 2I78A 3DKRA 3NBAA 2DUWA 1TTHA 2HDWA 3IVAA 2G04A 3S4YA 1WEHA 1WHSA 2PMKA 1ZUWA 2P9FA 1T9DA 4AU1A 2GQ0A 1K8QA 1UZAA 4G2TA 3A2LA 4KFTA 4RLQA 1KJJA 4O2BF 5AVKA 4ABYA 3U13A 1C7EA 4F12A 2VQEB 1JR2A 4CIYA 2AV6A 1YR7A 3PFGA 2WQ7A 3RROA 1C7IA 1ABFA 1C1DB 1V35A 3R23A 3O8QB 4OUDB 4WNAA 3NTRA 2R65A 3N59A 4HRYA 4IQ0A 1N5LA 3CTMA 3OY7A 1RI2A 3QFTA 4FKBA 3SQOA 2A0KA 2B1IA 2YOHA 5EN4A 2VF2A 5DI3B 1T8SA 4FKZA 2FEOA 1S7GA 2QLBA 1QH9A 5KJ1A 2BFFB 2HCRA 2Z4RA 4BZPA 2VNSA 3GVKA 3MJHA 4X97A 5LYJF 4G5OA 3OQMA 2XDQA 3E4CA 2ECKA 1L5ZA 2BN4A 1KI7A 4L9AA 3ZY6A 2C3PA 3PGVA 1KZ7B 4TPKA 4P3XA 1IK6A 5JRZA 1Y42X 1MMFB 1MB0A 1T2FA 3MS2A 1AQLA 2V6JA 1AGYA 5BWBA 1SIUA 4QYSA 1DHRA 4ALJA 4PPYA 4GZLA 2JB9A 2ZXIA 3BF8A 3O4RA 3ZDAA 4U00A 1RHJA 1II0A 4IILA 1XBTA 1Z07A 3EZFA 4X93A 2G70A 5EZSA 1K6MA 5AK5A 1GRQA 3WWPA 3E8XA 2JCVA 3FMOB 1SHJA 1HF3A 3EA0A 3I0ZA 3G0BA 3GLGB 1O0BA 1C8VB 1ZC3A 2QGGA 2I6QA 4IEIA 1ZU5A 3DUWA 5LLDA 2BHNA 2NO1A 2C7QA 1XALA 2QN3A 4FFRA 4XW2A 4TUYB 3KDSE 1DX6A 1BQ4A 4JUIA 2X9GA 1UJBA 2JVIA 4ENPA 1QOQB 1XDDA 2HF8A 4RDKA 2IZ7A 4FC6A 4IJUA 4MWDA 2XE6A 3PPYA 2WQ6A 3CUTA 1Q20A 3NVAA 1HDXA 1TYAE 4EJSB 3T3HA 3NLLA 2R8XA 3DBLB 3I4FA 4R6WA 2DBRA 1PL7A 2EERA 4L8JA 4P3IA 1UPBA 2WQZA 3A6ZA 2P9JA 3O6VA 4S35A 1PKXA 5JISA 1IC6A 4YN3A 3VX3A 1QB7A 3IULA 3Q0IA 4HXYA 1H5UA 1E1DA 1Z0KA 1WJGA 3ANYB 4QEZA 5JFGA 1G8KA 4FDTA 3I0MA 3Q6IA 3H83A 1N6OA 4ZMBA 2OESA 1NXTA 3PQDA 1E1LA 1FDIA 1ZJ5A 4WZKA 1FP2A 3EBPA 3GJ8A 3R9WA 1BFKA 2ODPA 2ZSDA 5C1PA 3GIDA 4QASA 3C6ZA 1QR2A 1XPUA 1KOLA 1T91A 4JU8A 1GVNB 3KB8A 2QVYX 4MUFA 2O5VA 3GGGA 9MHTA 4YJFB 5HW0A 1WF3A 3TZ6A 2OHHA 1KDTA 2KQUA 4LY6A 1KERA 3KSDO 1Q2UA 4IVPA 3WA7A 1ZM9A 1FXWF 2QM3A 4UZFA 1XE3A 4YRFA 3G2PA 4BB9A 4ES6A 4NOLA 4X6UA 2JH9A 2IEAA 2AG0A 2JGIA 3MRVA 2XQIA 3C15C 4QXPA 3H8SA 2I62A 2N1BA 4Z0NA 3KHKA 2J7PD 3RC1A 1MRNA 3BL6A 1I0ZA 1U7UA 3KB1A 3M34A 3NT4A 3HVIA 4MS1A 2VOEA 2ZI4A 1KDVA 4Q9AA 2QRLA 2GJKA 1VG0B 3TPFA 5H81A 2BEVB 4BFUA 4P84A 4X41A 2P69A 2GM4A 3PFKA 3KLBA 3ER9A 2YWGA 3N8GA 4AUNA 1ZM4A 5HKKA 1GKYA 4KYVA 3U7QB 3RC8A 2BP7B 1TLLA 2VR1A 3QE4A 4ZDKA 5IT4A 1SEPA 5L6MB 5ENZA 3HGQA 4NF2A 3ZVMA 2CUNA 4TL8A 1I9GA 4TRJA 3LRXA 1FCJA 3JZDA 3ZDBA 3MAGA 2GHTA 1M1NB 2HMTA 2MOKA 4G36A 2PRSA 1IOLA 4XGIA 3TOZA 1QRUA 4GR9A 2AYXA 3OP1A 5C8XA 3DONA 1M1YB 3UATA 4ZAGA 3OM1A 4ZVUA 4W9MC 16PKA 3FA2A 1SXIA 2WM3A 2FPUA 4E4YA 3ORSA 4XJTA 2AFIB 5BN5A 3RNOA 4B40A 4EAAA 3JAKA 3W05A 4HH1A 4HNAA 3ZWVA 4ESVA 3E58A 1XZPA 4ZD6A 1NI3A 4CR8A 2D3LA 4RNCA 2H31A 4UFOA 4BGEA 1QYWA 4GKJB 1YV9A 3WYNA 1M10A 1NFRA 3TPCA 5BUSA 5ICGA 5IPFA 3PZRA 2GBGA 4Q16A 2DJIA 5IK2A 2F3QA 3LAWA 1EG2A 3K1TA 3VSCA 1EWVA 1D2AA 3FM9A 1EWYA 3BRCA 2FSGA 2YMPA 3BSWA 4CZ2A 3ICQB 2X5XA 2GPBA 1VHQA 4X8MA 5IMBA 4M8NE 3NHZA 4R4JA 4C30A 5JPCA 2IT1A 1WP6A 1L3CA 1P7WA 4P6YA 1W49A 4OQXA 1ZVMA 1BMQA 3PE4A 4YMSA 4DXAA 3VNBA 2FW6A 4I9UA 2QK4A 4PBTA 4DLLA 1R50A 1GYRA 4LRYA 1DKUA 5TC4A 4Y9RA 5F4OA 3CCLB 1RHQA 3LUCA 2O7VA 2Z56A 1V1MB 3N2ZB 1XYGA 2OV3A 5FBLB 3WYGA 1K7EB 4YAGA 1IVYA 3ESQA 4DZRA 3EC2A 2EIHA 3CUKA 4Z4WA 3P2JA 3BSFA 1WV0A 4DVGA 4I3FA 2UXCB 4O4IA 3HCRA 3O3OB 1R0CA 4X8HA 3OH8A 3NIDB 3CUVA 1SHLA 1TJ3A 3CB2A 3EGDA 2YUIA 4KMMA 3CPEA 4Q1VA 2VSXA 3BQJA 3M5CA 3ZW8A 1AIPA 1JP7A 1NA5A 1X7XA 3IUJA 3VM6A 5KDLA 1DG9A 3EZ7A 4WUVA 5FPPA 2I9KA 1QVAA 2HUPA 1F5SA 3MMPA 1KKUA 2NNLD 4ECAA 2HSGA 3DOOA 3BJRA 4QDUA 3B78A 1L7OA 1Q1ZA 5SYMA 4FGWA 2XCOA 2FLKA 2HO5A 4G8JA 4NMWA 4LN1A 2V7GA 2QJWA 2RC6A 4LMRA 1DIGA 2XWJI 2ZRHA 1XPRA 4IJKA 3IPYA 3G85A 2IF2A 4R41A 3M2PA 4F93B 3BC9A 1K9MD 2LCQA 4EI9A 1UMCB 1JSXA 1NVBA 4RMIA 2WD7B 1KPHA 4FYPA 4XLLA 3OPYI 4EL0A 1PK8A 3A7DA 1FFYA 1JHAA 3JQ7B 3MTIA 3PWKA 4ZCRA 2OM2A 3FTFA 1LPBB 1E3TA 5IZCC 1LTKA 2CVQA 3OU2A 3VTFA 3TSWA 5IABA 3IPRA 5JJBA 3OZTA 4DSUA 2ACVA 1UKEA 3KPWA 1Z4LA 5JADA 3JQAD 4UZUA 3BGVA 1T29A 2G3YA 3P0HA 5FXMA 3TKAA 1P29A 5J4HA 2JAUA 1JLLA 1G5PA 4I9NA 4GMXA 4E7OA 2MINB 2YS6A 4PZLA 1NLZA 1P7VA 3IUSA 3T56B 1FEZA 1ORWA 1J09A 4BO5A 4BIMA 4YRZA 5F2OA 2F59A 2X7XA 1TQ6A 4OHCA 4BZZA 1Y3BE 4IRXA 4PGFA 3SJAA 1T9CA 5TDHA 2B37A 1XZCA 1M83A 1FFHA 1LRJA 4W63A 4YRRA 5DHUA 3WYFA 4D74A 4ZHQF 3TGLA 1WETA 2OKGA 2VT2A 4LJKA 3R0JA 4X5OA 2P4QA 4Q9HA 3E70C 4GXRA 3EVTA 3ILSA 1Z0JA 4JOQA 3HVJA 4L27A 3OCXA 2QE7D 1U0GA 4HRVA 4YJGB 1K9VF 4B2LA 3TUZC 1I32A 4PHHA 1DQPA 3G9UA 1KYWA 1ONNA 3L01A 2V9CA 3AEQA 4M1YA 1R0ZA 5FEMA 3URMA 5J4KA 2JJMA 1IM2A 1SBTA 1PEAA 1SXGA 2ID8A 1FUIA 3OSUA 4LNHA 1MQSA 2WU3A 1SKBA 4EY3A 4KRXA 4YJHB 3KOZA 3L46A 1DAFA 3RT1A 1NMZA 2ZQYA 1W5TA 5CLHA 2GEBA 4KKXB 4LXHA 2DLNA 4O2BB 3GDFA 1X8LA 2BHTA 2X19A 2X13A 1M0WA 1U2RA 4LRWA 1R5JA 5I7WA 4LJ9A 2WAAA 3CCSB 4W1RA 3I52A 5E7IA 5JQWA 1CS4C 1E2IA 1GJRA 3NHBA 1RAIA 4ASUD 2PKEA 4NK4A 4HS4A 4WXMA 4LDPA 1MD9A 5EPUA 1S96A 2C4MA 5TQJA 3BH7A 4AO6A 1J0EA 3FHCB 1O3YA 4IM7A 5F21A 4C78A 1Y8RB 4K03A 4L6IA 1GSAA 1JFLA 3RUIA 2R60A 2FZVA 3LRTA 4A7PA 4JKYA 4R68A 2H1FA 5DJ5A 1WXWA 1BKSB 5LYJB 3QI2A 1K6JA 4U9HS 4OG2A 1NPDA 4R6XA 3UMSA 1Q0UA 1DWPA 1I3NA 5HTKA 4BEJA 3OM0A 4DSNA 5KNBA 3FKQA 4X3PA 1XVUA 7MHTA 4QQNA 3QG1A 3WKEA 3IE1A 1Q3TA 3KLNA 3R20A 5A4FS 3W6OA 1SCBA 2GEFA 3CH4B 3CU5A 1Q6ZA 2ZUWA 2REQB 4EG1A 4MA0A 1TE2A 1RYEA 1UK7A 3MFQA 1UBRS 3RHSA 1YQXA 3ZGNA 4MIEA 1G16A 5DXJA 2QUAA 4IRUB 3IBTA 3IBSA 4PF1A 4J0IA 3SF0A 5BWNA 1KEEA 3I01M 3LW8A 3PA2A 1JG6A 4X8OA 5ETJA 4ZI7A 3H6HA 1WSDA 4PLVA 4QVAA 1SOAA 1QVRA 1XTJA 1Y89A 3MJFA 3E8MA 4KZKA 1JR4A 2H06A 4OGGA 4L15A 1GZVA 3BRSA 1JIXA 1E9EA 2NVOA 1XMIA 3MWLA 4P8RA 2VHTA 4N0EA 4CU2A 3OFND 2D9RA 1TC2A 3OCWA 4N3CA 2GCEA 5FPQA 4KR6A 2RK3A 1DTWB 2G71A 2RDMA 3WSVA 4Q12A 5FTMA 3PPWA 4TRNA 1XVAA 4CLEA 3NRCA 2ZSHA 4MV3A 1H3NA 1LV7A 3MTGA 1G98A 1SVLA 3LC1O 1F6WA 1XLVA 2VUIB 3GEDA 2PAFA 1UOEA 2AZMA 1KAEA 3K32A 3L04A 4YAUA 3VR2D 1ESZA 2HHCA 4LV5B 4YUXA 1U1CA 3LKBA 3PC2A 1Y8QA 5T8KA 1QE5A 3P2YA 2CF6A 2G6BA 4LJAA 2K7ZA 3GT4A 3VO9A 1AQIA 2JVJA 3I5UA 3KOYA 2GLUA 4XUGB 3TLAA 2SKDA 4HPWA 1WU7A 3KYDB 4GI1A 3VZDA 3AYXB 3ZK9A 4DCOA 1USKA 3LT0A 2GGSA 4PBRA 3FFWA 1T6XA 1SU6A 3LOPA 2J4FA 1IMJA 3ET5A 3V00A 5A2QA 5IJ0B 4IIFA 3FMVA 2VSNA 4M7WA 4OLHA 2ZU6A 1A1VA 1KAOA 2XJ4A 4ZVQA 2BISA 5HQJA 1LNQA 1P5FA 1UK8A 3ENVA 3L7OA 2ZIFA 3QUBA 4PGAA 3DCIA 1WPXA 4DANA 4X7CA 2TSYB 4B73A 2F62A 1T3LA 4DSZA 3MA0A 4AJ1A 5BN4A 2LRHA 4LZWA 4WK0B 2PMEA 4ZO4A 2X1LA 2O19A 2FUEA 4YRLA 2C3OA 4I9GA 1QNLA 2ZJFA 4TYWA 1PJCA 1JH8A 2YIDA 1CRZA 4MJ3A 3W2HA 2CVPA 1OY1A 5B36A 1U4NA 2EZ4A 5LNK6 4N7BA 4KKSA 1KXJA 3FYUB 2C94A 4U0JA 2VSOA 5KTKA 1E79D 2BH2A 3TLXA 1C0LA 2UAGA 5DGXA 5L46A 5KVQA 4ZU1X 2PFGA 3KOXA 4GPD1 2LCFA 4UEWA 4DNXA 3RVMA 1EA5A 5G40A 4G0VA 2RH8A 1WR8A 1VRCA 1PEDA 3GPDG 3GT7A 3DBHA 4A5SA 2BE7A 4CIBA 5KVVA 1GZUA 5L4LA 3N8KA 3BRQA 4JEIA 4DV2B 2QMHA 3H9UA 1BX3A 3EGCA 3KG2A 4GECA 1U1GA 4DRYA 421PA 3HYCA 3ND9A 2E1BA 2OOKA 4O4HF 1LI5A 4PS1A 3C43A 5JJCA 4AXXA 4BLTA 2IHZA 2Z9DA 4RZQA 3OIGA 1K08A 1QCZA 1VYUA 4J07A 2BGUA 2I6FA 2XUFA 1JHDA 4MQEA 4ER6A 2HREA 1KU0A 3IVCA 2QTRA 4G4IA 3HCFA 4G1CA 1ARZA 1FQOA 1V6AA 2QB5A 4MYTA 3RJ5A 3PNPA 4M1WA 1TA4A 4QG3A 1GO2A 4GKKB 3LE8A 1R5BA 2QJFA 3P71T 4XDYA 5H3HA 2PYIA 5DS0A 1RWPA 1ZOSA 2R66A 2XVZA 2KI5A 3M6IA 3B1WA 1ZONA 4PTZA 5F3DA 1OB0A 3FWPA 3ACDA 3WDLA 5D5QA 4PG8A 4ZYTA 1N78A 1CB0A 1N1DA 1U3FA 4A0HA 3Q5GA 4QT4A 3IKTA 2QJOA 3UK0A 2HM7A 3K09C 4DMMA 1A7AA 2Z98A 2PUBA 1YZLA 1VECA 2GN0A 3HBMA 1E3ZA 2UVQA 1MXFA 3NIBA 4MJXA 1G8YA 8GPBA 3HM9A 3P9KA 4J6EA 2BZSA 4EKEA 5TR9A 3AY0A 2O2XA 5F4JA 2FYTA 4KQ6A 5E2AA 5JD6A 2NT3A 4ZGBA 2P3SA 4GPEA 4GSLA 5JDIC 2NZUG 2ZR7A 3FFAA 1AN0A 1ZXLA 3DBRB 1JT2A 4EKNB 5JZ9A 5FLYA 4C21A 4NR0A 4D41A 2HT6A 3GJTA 1MCZA 1IQ0A 3OZAA 4QBKA 1JJ2B 3H1BA 4QPNA 4QUEA 3IJRA 5E6UB 2QY9A 2B61A 4WFQA 5HXBA 2JASA 4ZO8A 1M1YE 4KV9A 1QFZA 2JEYA 1SC1A 2HJGA 2XZPA 3U7HB 4RJTA 3ZCQA 1A7JA 1I4OA 2C4UA 2QMUA 1WKVA 2BKEA 2BMEA 1NVDA 2R6ZA 1B6RA 2PJZA 4MVXA 4WD3A 2DC1A 1JZQA 4HGNA 4KQFA 4WN3A 2V0CA 5IBPA 4BWFB 4EHKA 3UMYA 1FW6A 1BCSB 4GZ6A 3KDPA 4UATA 3SHOA 3SS7X 4AJOA 1H8HA 2RBKA 1E9RA 2ZETA 4HDMB 2P7HA 4JJEA 4PTYA 5CLGA 4CT5A 3DBIA 1X7ZB 2WWRA 2ZI7A 3PDJA 4P4GA 2NLOA 4UE3S 4HEA6 2PS0A 4LJ8A 3AF4A 4B7XA 4GR4A 4WACA 4KGZA 5B55A 3HYRA 3QI7A 2OK7A 4JA2A 4CWAA 2HH9A 3B1FA 1JEYB 2VYVD 4GP7A 3NEAA 1PS0A 5U4QA 3MQFA 1D2EA 4JJAA 2CDCA 1PNQA 1YIJB 3IOMA 4OXKA 1M2VB 4IDHA 2I91A 2QS9A 3BOSA 4P34A 3TW8A 3JAMA 1XR3A 3QEJA 4H6XA 5IYZB 1FXSA 3VGJA 4MPTA 1SCQA 2PEZA 2HI0A 2WK1A 1ND6A 2XLBA 4O02B 3M4YA 4G1FA 1JHZA 2NW6A 2FFRA 3EPHA 3AMVA 1L7NA 1V4VA 2YFQA 1OAOA 1PGOA 4HAIA 1VB5A 3DZDA 2JIOA 1JE1A 1WCV1 3BN3A 3EVDA 3EXEB 1VP3A 3LY5A 5F1YA 5ITWA 1ZH0A 3DV0B 1QANA 4P9SA 1YMQA 3PHLA 3UPUA 2VL7A 1IZ9A 2NOAA 3CB4A 4X94A 3GRPA 1M9NA 3PRYA 4GQIA 4HBGA 4ZHQB 8AT1A 4FGJA 3Q6RA 3BL8A 1P75A 1Z25A 1T43A 2WOOA 2VQFB 1DAIA 2ZAMA 3WLTA 1ZIYA 2O2SA 1ZSNA 3LY8A 4DJJA 4WOPA 2BVNA 4B3JA 4OB6A 2ZSBA 5GONF 1VQ8B 5J40A 4OQQA 3RU2A 4C7KA 2VWGA 4Y3UA 2IHYA 1Q81D 1NTRA 2ZYSA 4I6EA 5CDSA 4ZTUB 1DKMA 3PGKA 3OD1A 2CF4A 1EQ2A 2WJYA 1CY0A 2DZDA 3G71B 3TRFA 2WYIA 5IYQA 1BMFD 3HPQA 4FYWA 4K6OA 3PC4A 4J43A 4B2PA 4N41A 5BSFA 5LXTA 2EBWA 1CJUC 3ZY5A 4L0CA 2HQBA 4DCPA 2JLUA 1UJ2A 3CLTD 1ELOA 1KVRA 1T4DA 4O5OA 2A92A 5DH9A 4NBNA 2IP4A 2H1VA 4MA4A 4EI8A 1E2UA 3GMDA 4OJNA 5H9VA 4G0QA 1EP2B 1HE5A 3LPNA 3BCHA 2W6ZA 2CFIA 4J1QA 3S1AB 4MKGA 4UUQA 2JHFA 4BVAA 4RVSA 3ZU3A 3H84A 2DKNA 1G8PA 1S2IA 1XV5A 4RDCA 4KFCA 1W75A 5SYAA 4EJ6A 3H6GA 2IUSA 2XE8A 3H18A 5CH5A 1RJ9A 3GLGA 1VPWA 5I51A 2PX8A 4UQPA 1R1DA 5JMWA 4EG6A 4M98A 2R1VB 1CXZA 1NQAO 2QQFA 2C82A 2QU7A 2VDOB 3AIIA 2DFDA 1NC3A 3B89A 2VKQA 3BULA 2ZT6A 1UD5A 4JJ8A 3R7FA 2O7QA 3HJRA 2GR9A 2KSQA 3CF4G 1U1FA 4GOLD 4KI0A 3BWEA 3BE5A 2ZI5A 3EXG1 1NVUQ 3IBYA 3K5PA 1POXA 2R0QC 3BIOA 2P9EA 1KYXA 5BWOA 5JSYA 4TYPA 2PBFA 1R0SA 2AEFA 4GH5A 5GADl 2QI9F 3L5OA 5CFQA 1MP0A 3OZRA 3K53A 4KE6A 1JEJA 4A2WA 3NHJA 1LBIA 3FTDA 4BDTA 2OXRA 1E6KA 4KQ2A 2F9LA 1ZL0A 1J42A 4MTCA 4NIMA 1M7HA 3JAWB 4H7HA 1PJRA 2WAOA 5JSQA 2WRZA 2NO4A 1OXKB 3ZH2A 4BCCA 4X63A 2K2WA 1T2EA 1WS6A 1Z0FA 3EMVA 3F7NA 3I9KA 4RXUA 3HU1A 4YP1A 3EPLA 1F2DA 3MTQA 2HY7A 2A8YA 5CVUA 2ZUUA 1Z6PA 3QBTA 4PYIA 4TMFA 1Z0IA 4FS8A 3WAGA 4AJJA 2W2NA 2O8FA 1YS7A 2VP2A 4GPBA 1ZEJA 4TROA 4MVJA 1MT3A 3UUEA 3KXDA 3S70A 2QY6A 4BFXA 2VPPA 1TEHA 3HLYA 1T35A 3IDFA 4KTVE 4K6FA 2QKYA 4GP9A 3H86A 5BV8A 5SZHB 2YVQA 3B6ZA 1SVWA 2I2BA 3KZKA 4RKEA 1Z6QA 3ZBTA 4R40A 1WCIB 2GRJA 3ZDDA 3ZKWA 2XIJA 4B34A 4POAA 1YJ9B 4MCJA 3SLDA 4PHTA 3SLRA 1OWOA 4DSTA 1WCWA 1J7JA 3CW9A 2JFWA 4X1IB 3W2GA 3A7EA 4L72A 2HAEA 4E2YA 1BVRA 1P5RA 2YV4A 5AVSA 5JD3A 1H85A 2ZAGA 4NNPA 4ITUA 4UULA 2Y1CA 3Q0TA 4QU9A 2QQ5A 1MXHA 1NFQA 4X3OA 3Q7SA 4XSGA 1QR6A 1ZCAA 1A4RA 2XBUA 4HGRA 4BKRA 4M0MA 4FOPA 4UNQA 1W59A 1M2KA 3G68A 4DWVA 3MK31 1QIGA 2XNDD 2X0EA 2IWHA 2CYBA 3RAPR 4IZHA 2RHJA 3HO8A 1YQGA 4DARA 4U3JB 3AVUA 4M9QA 3GQBB 2WHQA 1U1DA 3VKFA 2X8BA 4Q3BA 1QXSA 3FPHA 1SXJC 1T4BA 2Y68A 5DBEX 5B1EA 5KSOA 4L73A 4IVRA 1JA0A 4YI5A 5HYVA 4IDOA 5G3YA 4TTQA 4CN9A 1RFGE 4MUGA 5H3CA 5TV2A 1PVVA 1KTVA 2XYHA 2GFIA 3QUCA 3EIQA 4OJTA 3TW6A 4HYEA 3CC2B 4G0XA 4JEUA 2YXLA 1QOPB 1RWMA 2F3UA 3N8HA 4GC5A 1TVKA 3L40A 2YYSA 4M54A 4EB3A 4W7HA 1ZOOA 2MR5A 3ZHVA 4Q7JB 4DN6A 3JVIA 2XUAA 3WSTA 3NBYC 3F73A 4OM8A 4TTJA 3ILXA 5HQ3B 2VP4A 2A0FA 2R11A 4BE4A 4A8HA 4FYMA 2XT6A 3EIOA 3QIAA 1L5VA 2LD4A 3BWMA 5EZYF 2P0YA 3EGWA 4NYMQ 5B2ZA 1QO0A 1W9MA 2VHWA 5EXXA 3RJZA 5KOHA 1QG4A 1V3TA 2WSYB 2ZUBA 2WIDA 3IP8A 3IT2A 3NUGA 3CQ9A 2FW7A 2CF5A 4O4HB 1MX1A 2J5XA 4OBXA 5FAXA 1I6LA 1XLWA 3BZWA 1IE3A 4YQEA 3RVDA 3WK9A 1U8FO 1EDZA 4CMIB 2QLFA 1R6TA 5AVTA 4OSEA 4EQ6A 3NJ4A 1OCEA 5TB5A 1N0HA 2DHDA 2WG2A 1M1UA 3BRWA 2XH8A 1LY1A 3WGTA 4XMYA 2AUNA 2GBPA 3AUFA 1ZN8A 3HNRA 4UU7A 4N5DA 1VQNB 2I7DA 2JAQA 2V7XA 2OY0A 3KJHA 5U1PA 3NT2A 5AVWA 1N5IA 2WV9A 3A4LA 4US0R 1E7YA 2PD6A 2ZTVA 2WWFA 1RYHA 1P7CA 2R5FA 4P2NA 4EHAA 3QU7A 3RU9A 2QU8A 1Q0TA 3NYIA 1GTMA 2WI8A 1ILWA 3RBZA 5GM2A 3UT0A 4LCEA 5F23A 1UOPA 1XVIA 4Z1OA 3AGQA 4Q1FA 1QLHA 1G17A 2LXNA 2ZWOA 1QTIA 4M0PA 3Q3JB 5EKDA 3SKVA 1U2GA 1F6BA 4C0XA 1HL3A 3U7IA 4AN1A 1ZITA 2DBQA 3DNMA 3BDIA 4RDIA 3WMEA 3IAHA 2UVPA 4D7AA 2KYRA 4XYGA 1U9JA 4JT4A 5ARDA 2DRIA 1VXOA 2EWWA 1B43A 2XMBA 3RYFB 4KR0A 4UUPA 3V34A 1A2KC 3DDNA 4YAEA 3HM2A 5KEIA 4NXNB 2XYVA 3NATA 4DCNA 4J94A 3FAKA 5K0EA 3DAFA 1DKRA 1Y1RA 1T36B 2WE8A 2JCYA 1NF8A 4XE5A 4E4TA 2IUUA 2BEJA 2D0DA 4Y2SA 2F90A 4PAAA 4UPDA 4XKVA 1N77A 4ZOAA 3M49A 4ZIRB 2XUGA 3EZ6A 3IPAA 1CF4A 3H42B 4R9VA 1NSFA 3PEUA 4F3TA 4TLAA 3KAJA 3ZPXA 3NCHA 4JT2A 1Q7EA 3CZ4A 3JD1A 4W9NA 1G2OA 1HORA 4EEZA 5CITA 2DXIA 2QR3A 3IMEA 3WGIA 2WAXA 1D3AA 1RQPA 1GUZA 3C3AA 3QVVA 1F4LA 4IHJF 5C5DA 2GZHA 5LDGA 2FWNA 2WTUA 3DHWC 3PR1A 4O1IA 1DO0A 1T0BA 1OH7A 2W6JD 1C1YA 1Q2XA 3RSCA 3V97A 3A3BA 3ER6A 5A9SB 3ZE1B 3T54A 2RGUA 2B4QA 1PZGA 5TLSA 1KBQA 2HKIA 4PZDA 1XN1A 4UHJA 4DJAA 3ZKAA 1SURA 1J0AA 2PZGA 2O14A 1K2WA 3LQ6A 4Z99A 3U3XA 3A8JA 3GCDA 4AB1A 1TVCA 2DUNA 1IEVA 3WTBA 3LKZA 2WMYA 5AM0A 4EPYA 3MT9A 4QSMA 3HG7A 5I4BA 4B3HA 4LC9A 1ZL2A 3HEMA 3KQWA 3GFOA 5AJYA 1GFWA 4HEJA 4RABA 5DRTA 4C0WA 3HKDB 2VH2A 3B7GA 4YMTA 3R2JA 1JQKA 1W46A 4YEDA 1NSYA 4WXHA 5FRDA 1TIPA 1XDBA 4I1VA 1EPUA 4RXMA 5CFNA 4BN4A 3CLRD 2WF8A 1D0IA 5FV4A 1IUNA 1NR5A 3E48A 2VNAA 2DPXA 3FZGA 1A5SB 3W0LB 1KEWA 1NMSA 3CRRA 3ED1A 2C2OA 2QZ4A 4D3SA 1XZEA 5EMNA 4TN1A 4S04A 3MJTA 3S27A 4WDQA 3CSSA 5C5CA 2ERYA 2OCXA 3LBFA 1SCDA 4L8LA 2P1ZA 1BGXT 4ZXFA 5L7YA 1VQ5B 3L0OA 4ANFA 5AI8A 1ID8A 1E2DA 1XLUA 5F5LA 3ZCSA 1JQAA 1OZ0A 2I4LA 2VYFA 3MBIA 4DMLA 4KWCA 5GONB 1IHYA 2ZUDA 3K6SB 2QJTA 1YOBA 4QUKA 2WVAA 4I19A 1KY5A 2AOWA 2AOUB 2JBHA 2X40A 4IXNA 4RQTA 4ZYUA 2RJNA 4MRNA 1BZYA 2QUKA 4JVOA 2WIKA 5I47A 4AY4A 3L6CA 3AETA 1TLFA 3KKEA 3DAGA 3UPDA 3V6MA 5I9BA 1OGYA 5IM4F 3B3QA 5A0VA 3KQTA 1CUYA 1EGQA 5IG2A 3EUAA 2XNSA 2F43A 5IKOA 4X95A 4YECA 2GZDA 4PPFA 1DGQA 1F2VA 1A76A 1PD0A 1WVMA 2ZM5A 2GUGA 4RZHA 3HCNA 3F6YA 6AT1A 2H65A 4R0MA 4YREA 4YRMA <