3JQQA

Crystal structure of the h286k mutant of ferredoxin-nadp+ reductase from plasmodium falciparum in complex with 2'p-amp
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
312
structure length
261
Chain Sequence
b'NFINLYTVKNPLKCKIVDKINLVRPNSPNEVYHLEINHNGLFKYLEGHTCGIIPYYNQRCARLYSISSSNNMENLSVAIKIHKYTNYGYCSGFIKNLKINDDIYLTGAHGYFNLPNDAIQKNTNFIFIATGTGISPYISFLKKLFAYDKNNLYNRNSNYTGYITIYYGVYNEDSILYLNELEYFQKMYPNNINIHYVFSYKQNTSFYVQDEIYKRKTEFLNLFNNYKCELYICGKKSIRYKVMDILKSDEKKKKRVHVEVY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferredoxin NADP reductase
publication title Plasmodium falciparum ferredoxin-NADP+ reductase His286 plays a dual role in NADP(H) binding and catalysis
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Oxidoreductase
total genus 74
structure length 261
sequence length 312
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2009-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3jqqA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 3jqqA02
5TR9A 3CCEB 2GPJA 1EP2B 1NDHA 4UAJA 4PC7A 3ZZUA 4LBZA 2YWGA 1QUEA 1ZM3A 1QVGB 5H5JA 1KD1D 2RC6A 1W35A 1AMOA 3J81k 2PLFA 3OZWA 3MMPA 1IJEA 2BVNA 4LBVA 3U6KA 1VQLB 2DY1A 4RCZA 4TN1A 1A8PA 1TLLA 1YI2B 1GJRA 3ES9A 4P6VF 2J7KA 3QFCA 4AF6A 1KQSB 3G71B 3QFRA 1D1NA 3CC4B 1SM4A 1M90D 1VQ4B 1FNCA 2VNHA 3CXCB 3AVTA 3W5UA 4K1XA 4PGOA 2DERA 2BM1A 1VQNB 3W2HA 1EWYA 3W2EA 2VYQA 3VMFA 2QN6A 3CPWB 3OW2B 4RD1A 5EMNA 4NCNA 1N8RD 4J0QA 1EP1B 4FWTA 1K9MD 3CD6B 1OB5A 3CC7B 4B4DA 2QEXB 1D8TA 3CC2B 1TVCA 4AC9A 1CQXA 5TY0A 2BF4A 1DDIA 2C77A 1D2EA 3B78A 3CMAB 3AGQA 3W5HA 1GAWA 1XB2A 4YAWA 4IW3B 1TTTA 1GVHA 3MHPA 1KC8D 3CCVB 1QFYA 3U6BA 2ZITA 2PMDA 1J9ZA 4RD6A 1R5OA 1KTVA 1BX1A 4FN5A 5FA6A 1JNYA 1VQ7B 4RJLA 3OZVA 4TMXA 3E20A 4B47A 1SKQA 4ACBA 3ZZTA 2C78A 1QVFB 4G1BA 1EFUA 2QTLA 4MYTA 4RD3A 4RCYA 3FJOA 4M1KA 4G1VA 2RC5A 1Q7YD 3CB4A 4HE5A 1EFTA 5HXBA 3AVXA 4ZCMA 1K8AD 4U9UA 1G7CA 1K73D 1FNBA 3QE2A 5TV2A 1BJKA 3MCAA 1QH0A 1KRHA 1FRQA 1F60A 1NJID 3V76A 3FPKA 2OTLB 3CMEB 2BN4A 4LBYA 1TUIA 4QHYA 1Q82D 1UMKA 1KK3A 1JB9A 1DARA 3QFTA 1VQOB 4LC0A 2BGJA 3I1FA 2VNJA 5H59A 2OK7A 1N0UA 3W2IA 4AF7A 1JJ2B 4ZCIA 1CNFA 1XE1A 1E62A 4PC6A 1VQPB 2FX3A 2R6HA 4MYUA 4Y9UA 2DETA 1KK2A 1YJWB 3JQQA 3WY9A 3VO2A 1ZM9A 5GV7A 2E1RA 1S72B 1F20A 3AVVA 2VZLA 1W2BB 4R71A 2QMUA 3CCRB 1FRNA 2OTJB 3U2QA 2BV3A 4Q7JB 4N3NA 1YIJB 1G7TA 1OGJA 3P26A 1G7SA 1QFZA 3WXMA 4B48A 2YWHA 1ZM4A 1KK1A 4TMZA 3I55B 2EIXA 3ZBUA 4PC2A 3LRXA 3OJXA 1OGIA 3G6EB 5KSWB 4P3YA 2B7CA 4TMWA 4RD0A 2VNIA 3ZZ0A 3JQPA 1QGAA 3WYAA 4WQMA 4N3GA 4DQKA 1BQEA 4C43A 1OB2A 1R5NA 3CCLB 1DG1G 2NPFA 4ZGQB 3WBJA 5THXA 2CRVA 1FDRA 3LO8A 2BSAA 3OJWA 2B5OA 3CCMB 2BMWA 4ZV4A 1H42A 4NBSA 3VNVA 1IJFA 3CCJB 4H9GA 1S0UA 4PC3A 3AVYA 4G5GA 2VNKA 2DEUA 4B44A 1AIPA 5GV8A 1YHQB 1G7RA 4DQLA 2QA4B 3WNBA 3QSYA 1FNDA 3I56B 2BPOA 3QFSA 4YAOA 1B23P 3LVBA 2D74A 3E1YE 1ZUNB 4YAUA 2BGIA 4QFMA 3OZUA 1VQMB 4ZCLA 1B2RA 3G4SB 1DDGA 3LYUA 4Y9RA 2YWFA 4YHBA 4HE6A 1EFCA 1WDTA 1YJNB 1GO2A 1U2RA 1GAQA 3AVUA 1M1KD 1FNMA 1KJZA 2XNCA 2X3UA 1E63A 4RD2A 3CRZA 3W5VA 1W87A 2HMAA 1QGZA 1YJ9B 2YWEA 1QUFA 1QX4A 1W34A 3PENA 1ELOA 1VQ6B 1KK0A 1EXMA 1QG0A 4B3XA 3WNCA 1VQ5B 1QGYA 3VO1A 2GQFA 2CNDA 1VQ9B 4M4SA 3ZBTA 1E64A 4ZGNB 1H85A 3VNUA 3B82A 2QDXA 1YITB 4TMTA 4EH1A 4ACAA 3W2FA 1GR1A 1JA0A 1ZM2A 3WNDA 2AHOA 4Y7CA 3B8HA 2DCUA 4C0SA 2HCJB 2B7BA 1Q81D 4RD4A 1Q86D 1QFJA 3SJZA 3WBKA 3A1FA 1IB0A 1N0VC 1JA1A 3CW2A 4FK8A 4YAFA 4TMVA 2HDNB 4BPRA 3AVWA 4M53A 3W2GA 5JBQA 3CCSB 1R5BA 3JQRA 4F7DA 1VQ8B 2XNJA 2XEXA 4M2LA 2PIAA 1CNEA 3P27A 3ZC3A 1HA3A 2OK8A 1VQKB 2QTZA 5AN9A 4B43A 1I7PA 5DSZA 4YALA 4LBWA 4M0LA 1EP3B 1BX0A 2EFGA 3CCQB 4PC1A 2BM0A 3CCUB 3AGPA
chains in the Genus database with same CATH superfamily
5D3MA 3VH2A 4NXNB 2XCQA 5HRUA 4G0UA 3NUQA 1AKTA 3L0PA 5IRCD 3WAGA 3GZTB 1DQZA 1MAWA 2P4EA 5IJ9B 2ABWA 3ZD7A 1I5RA 5E1OA 5CVTA 3WL5A 3FYUC 5IKMA 1SAYA 5I9LA 2A33A 4HLUC 2ZT5A 1J1IA 4I9GA 3GLHB 2POQX 4X24A 4B6FA 1PL6A 4E22A 4HLQB 4F11A 1Z39A 1O94A 2IY8A 5H3HA 4WEOA 4LJ5A 2Q8PA 2XDYA 3A4LA 2MMGA 1T9HA 2IVFA 2GD0A 4FXOA 4PGAA 5BNWA 3IE2A 3C74A 4OXKA 3MMPA 3U6KA 2PA0A 1VQLB 1DJLA 5EIBD 4QBGB 3M6UA 6NULA 4J94A 1C5KA 3JATB 3ZCXA 1UDBA 2LV8A 4OOSA 1A1SA 3V46A 2JJYA 3W9BA 4I5DA 1CJBA 1G8MA 4P4SB 1X7HA 2C4HA 1F0KA 2IA5A 4YT4A 4TTPA 4GKAA 5ALIA 2RJNA 2IE8A 4ZVNA 3TR5A 2ZUFA 4J7CA 1EJBA 3QPWA 2IPAB 3RIMA 1FDVA 1FYXA 3H5VA 4JP8A 4WJKB 5D3ZA 3U7QB 2QRMA 4BLQA 5K8JB 3NH6A 1EVJA 3TOSA 3R1IA 3S2ZA 3ZHOA 5EUCA 4LHXA 1HR0B 3BVPA 1PR5A 1KA9H 2RGGA 3FKQA 4K40A 2O59A 4CM5A 2BFPA 4DZRA 2F48A 2B8NA 5EL0A 1NYLA 4V1CB 2WTMA 4X44A 3MMXA 4TXLA 1NB0A 1TKBA 4UD6A 3IMCA 4IGAA 4EHDA 3BSYA 4CIDA 2QW0X 1JKJA 3AUTA 3BGSA 3D3NA 5DX8A 1KY2A 1W5BA 2B9VA 1VXOA 1Y34E 1KJNA 1JEDA 3ZE1B 2JHPA 1H2HA 4TTRA 2VF5X 4I55B 5L4SA 2B6NA 2C2GA 1NXOA 3GC6A 3RASA 4DREA 2OLKA 3PPXA 1K0UA 3GFQA 4ZAGA 2X3YA 5AXAA 2Y1LA 4C0HA 1V8BA 2P69A 3H9GA 3LBYA 5FAKA 3EDCA 4DIOA 1AS0A 1W4RA 2BSQA 4B3SB 1Q0RA 4FMPA 1ZU4A 3ZGZA 4EO4A 4QT0A 1W25A 3LUCA 4IYJA 4UE2A 5JMPA 1SZJG 5EMNA 3S5UA 1E1RD 3L0ZA 4WHMA 1XZ8A 2R1VB 2J9FA 1SURA 4GOOD 4II2A 4REOA 2YZMA 2VPTA 2WD7A 4JR0A 2J4FA 2GZRA 1JRLA 4HSEA 3HP4A 3MTBA 1VJSA 4GHWA 2UYGA 2BM9A 1JHOA 1L4MA 4OL0A 3RUFA 1Q3KA 2B5WA 4P8RA 1BDIA 3ISTA 2Q2QA 3EZ6A 1DLJA 3PVDA 1ZI9A 3GGGA 3CC2B 5HIJA 2VJCA 3CNNA 1NVKA 1MRZA 3TCNA 3L4BC 4S1PA 1XZNA 2V6IA 1MPTA 4J1TA 5F4OA 2Z1NA 1EIZA 1PBTA 2ET6A 4N3BA 3RSHA 3WIVA 3O21A 4RM3A 4BNIA 5HQ3A 4PAQA 3TFOA 2J9RA 5IULC 5GINE 1F1BA 2WU0A 1NU6A 1EXWA 4XVUA 4UU8A 1N25A 1GAWA 2JJ1A 3VDXA 2OC9A 1N32B 1XZQA 1XTVA 2OE2A 2JIRA 1XMQB 2DMRA 3OKCA 1WP9A 2IXTA 1KC8D 2O3UA 2Q07A 5EZ6B 1FLNA 1SEPA 2FVYA 1XCJA 2QD1A 2PSJA 5HFNA 3QEOA 1QYDA 4LFBB 3DLPX 3WOHA 3V4LA 4GLFA 2PN1A 2HA6A 3MSCA 3WL3A 2VT2A 3EVEA 5LDHA 2O7QA 4KPUB 1VQ7B 2ZZKA 3PDUA 1YXMA 3OIDA 1M2JA 2DY0A 4JSTA 1O6CA 3L1KA 4BE9A 4IILA 4E1BA 4AY2A 4ACBA 1RAEA 1S2MA 5GJWC 3RVDA 3E7FA 3VO8A 3JAMA 1CQWA 5B4TA 4EATA 3GGPA 2FPUA 3EPHA 1T8RA 1ECGA 3JD0A 1BE1A 1KZ4A 3TH5A 3CE6A 2DYKA 2ROQA 1BG6A 3UXMA 2HMTA 3BFKA 1YVUA 3HFJA 2VO1A 3WSWA 1VF7A 1Q6ZA 2PYIA 2H63A 2Q6IA 5BN4B 4NCXA 5EIOA 2XRMA 1JR4A 5E4JA 4G4SO 1R4MB 4XGQA 3A1UA 1AF4A 3IBCA 1QYVA 4I6JA 3TLCA 2ZCUA 1RQGA 3JZIA 5GOZA 4TYYA 1ZEJA 1GDHA 1E7MA 1DU4A 1R6XA 4Q4HA 4QLAA 4X61A 5TRDA 3GLGB 1M2KA 2NVOA 3KPWA 1M66A 3IEPA 4JS0A 2I2FA 2X0NA 3HXKA 3RGWS 3WYDA 3WA7A 5BSWA 1DAPA 3HCDA 4PO8A 1P9RA 2YRWA 2ZYSA 4U9UA 2VHJA 4L4ZA 3GVCA 4F9TA 2ATCA 1G7CA 4XTCS 4HQ6A 4YUVA 1EFVB 3C2QA 5T4FA 3T99A 6AT1A 4S35A 1NLMA 3QE2A 1X7GA 2QT9A 3ZGOA 4B0OA 3ZVNA 1U7TA 1Z38A 1ZOOA 2Y67A 2HQBA 1KZ9A 8ATCA 5FWYB 1XKXA 2C9CA 4Z9BA 1E3TA 2SNIE 5E1MA 5BW8A 3IQDB 4RJ2A 1IPEA 3R75A 1IN8A 5AVRA 2F3UA 3Q3HA 2FR0A 3V76A 5EUQB 2XE6A 1PX0A 2SBTA 2BN4A 3TL6A 5FJIA 4YEJA 3I09A 5K05A 4WWHA 4KUHA 2FPSA 1W85A 3MJRA 4FKBA 4FOLA 4LS3A 2GF0A 4B74A 1YFJA 4BCCA 1E5XA 2WWGA 1R9JA 3C6MA 3DAOA 4H31A 5CVEA 2UUCB 3M33A 2GESA 2HNAA 4K2HA 1QB8A 2V5AA 4OSPA 3JYNA 3JQ7B 1YFLA 3A8JA 4LC0A 1OI3A 1PL8A 1T3LA 4YB8A 3G85A 1AB5A 4OLFA 3VKWA 3I9JA 3UJNA 1QLHA 1Q84A 1YFZA 2OK7A 3R3XA 2FWAA 3ESDA 3L7NA 5EA2A 2QRJA 3G23A 1IXYA 1L7RA 3H05A 1K9VF 4IRUB 1NWCA 3TRHA 3GJSA 3CP8A 4ZCIA 1EEHA 5ARBA 5TQ0A 1Z6ZA 3CKKA 3SBXA 3TI7A 4PO3X 4MROA 4RSGA 4G9EA 2CD9A 4CT0A 3S8MA 4UTZA 3CLKA 1KSGA 3RF6A 4I1SA 5DH9A 4XD7D 4WZZA 2TMDA 3ZH2A 3AI3A 4OF4A 3JQQA 3TSOA 3IRVA 3CUEF 3E22A 1E3MA 3HTXA 1LK7A 1YAHA 2LW7A 3ESXA 4PX3A 1XBTA 3OOHA 3VNRA 3GJXC 3CJQA 5AICA 4TSFA 1L5YA 3VSBA 4C4XA 2OUIA 5IWCA 1IZYA 1HQKA 4MKIA 1DXQA 4P98A 1T5DX 2EFCB 4X6LA 1GL6A 3E8MA 4MRSA 4YDHB 2EBWA 4TKLA 1XRJA 5ESRA 3S55A 5B1YA 3R5TA 3CCRB 1O6BA 2IYAA 4WZBA 3LA6A 2WUEA 3PR1A 2QZPA 4M76B 2F1JA 4GPEA 1KDPA 2J3MA 5DI9A 4IEFB 4KWTA 2I7CA 4ETMA 2ZE7A 1C7IA 1XDUA 5CB8A 5JHGB 4K88A 3LQRA 2CZQA 1TA4A 1LC3A 2VZ9A 1N6HA 2PWPA 2V6JA 4PG8A 3I53A 4OHMA 4YFYA 5ALOA 4DNQA 1MIOB 5CXSA 3G2PA 1TIBA 5AM1A 1XKTA 4EYKA 1Z74A 4QOEA 2CVZA 5AQEA 1Y0RA 3OEEA 4HZGA 1E3ZA 5BUZA 2WM2A 3BREA 4GZ3A 1WV0A 4JJ7A 4BRWA 1Z3IX 5E8RA 3TINA 2N47A 3CURA 1DCKA 1YUNA 4OGLA 1FP2A 4ESHA 4MYHA 4HZUA 2JFQA 1YV9A 4RM2A 4TL9A 4C2UA 4FMCF 1Z4NA 3B1ZA 3SFZA 1JF8A 2ASEA 2L19A 3I4FA 4H6PA 4GVLA 2ON6A 4PGHA 4B4UA 3P4UA 3PUYA 1SWWA 1T9BA 1UOPA 2NV4A 3D3WA 2B5VA 3KXDA 3KNZA 4TTAA 1FX0B 3NVMB 2QQ0A 5H80A 1KVSA 2AR7A 5EP1A 1KDVA 4A26A 1H8HA 5I4BA 3VJKA 4X00A 3HDVA 4N3GA 3W5JA 1SOUA 1QB7A 2HWXA 3ASRA 2V1UA 5EQFA 2FSFA 2DFLA 1P0PA 2ACKA 4QAQA 3JWEA 3ZWAA 1J8VA 2XXJA 2PUCA 3ZW8A 3UMSA 2AN5A 2GKOA 2BUAA 4Y3UA 2P2LA 1B00A 1I36A 2BEJA 2Y8EA 3ANNA 3QMPA 3PE4A 2PUBA 3E2PA 3IOEA 1KOLA 4PXSA 1FF9A 1J0AA 4NULA 3T7RA 1SUFA 3PRJA 4CM3A 5IDXA 3VHXB 3INYA 5D86A 5BSYA 2FWPA 1Q9SA 3U31A 1WU8A 4NJMB 5KTMA 1MG5A 3UG7A 2CVOA 4HD8A 1OV6A 4D44A 4DRXB 5LUAA 4YC7A 1QU3A 1H42A 1ZI6A 2CLMB 2HPAA 4EENA 3P9SA 1ULUA 3FDJA 2J6CA 4XWTA 2D1SA 4EY3A 3DFIA 3EPKA 4Z4SA 2VWQA 3HEMA 1ZJ4A 4E70A 4BQSA 4YJGA 4IIYA 2HBQA 5LYJA 4GO1A 4EZEA 4S1OA 3FCSB 4HAIA 4RBNA 2C4WA 3DMTC 5A5GA 5JRZA 4BGEA 1EDBA 1KDOA 5ECGC 2FZLA 3QLUA 1ZCAA 1TUEA 1M2FA 2I1VB 3WZLA 4CHTA 2JFNA 3Q7QA 1TZCA 2GJSA 2Y4NA 4M9QA 5I7OA 5D3KA 3B2NA 3N3BC 2YJGA 1YRYE 3K0BA 1G64A 3I56B 1H8ED 4U2GA 3WQRA 1ZG3A 2I3AA 4JBNA 2IEIA 4MPRA 4TLLB 3S2UA 2IYNA 4H7PA 1U0BB 2A9FA 5JLJA 1YQUA 1V0FA 4RABA 2VF2A 4YT5A 2C61A 3PI7A 1JFFB 1X2EA 1I4DD 4CF7A 1ZH0A 2ZJ6A 3K5WA 3ZV7A 3I8SA 1GTSA 3GJRA 5DYIA 1PL0A 5LBUA 3RRJA 5BV1A 1Y1QA 2I03A 1OGYA 2MINB 1A5SB 3ESAA 3H19A 1LDNA 4Y1GA 3I9NA 1K3UB 2BFWA 5A3VA 2I65A 3SQNA 2V7UA 1OKKD 4JQSA 4D81A 3RKSA 1HEYA 3VPSA 3IEUA 5EEGA 2P35A 2IHZA 4L0MA 4F45A 4QYMA 3LUGA 3V3TA 5KYYA 1VKZA 3K0CC 4Q4AA 5EZYA 3UZUA 1ACJA 4FU0A 4B3TB 1P2SA 1SK9A 2VRCD 3I28A 4FGZA 1IN5A 2RHWA 1IQUA 2J0EA 3I30X 4RE6A 3I23A 2XWBF 1XPRA 1WPGA 1YS6A 4X0CA 1M83A 3A3YA 4JVMA 2NTEA 1K08A 3QUSA 3WK8A 2OGZA 5FBRB 3SZMA 1QP8A 3BN3A 4X6YA 1AX9A 5BORA 2ZJ4A 4EG1A 1ZMOA 4AMGA 1W48A 3AW8A 3BGDA 3GFTA 1JQ5A 2CL6X 3EIOA 1VG0B 2C9ZA 3EISA 1FMCA 2I4MA 3RG2A 3AUSA 1MAUA 3V4OA 5HBRA 1OZGA 1RYFA 5LCXA 2Q4DA 5B64A 3PENA 4WRRA 1N78A 3G8AA 4OPVA 1N7HA 4O63O 3V8EA 2VQ6A 5C8XA 1ECCA 1J00A 2F00A 1X15A 1KQPA 3FZYA 2VJPA 3CLUD 3DLCA 2GM3A 5JFOA 1CVLA 3FUCA 3U7EB 1I2ZA 4DDHA 4UCQA 5BYBA 5ELMA 3VNUA 1SUDA 3TQHA 4G8BA 1VRCA 2WFLB 3UT5B 3V1UA 2IZ0A 4EGSA 2HRDA 3PDJA 1J2JA 3KKMA 3OQHA 2HA0A 2XB4A 3GBVA 3EPLA 3LXUX 1ZINA 2Q2VA 4Y7CA 4YQYA 4EFLA 2D5AA 4URXR 1ZA1A 2CFTA 3E9RA 3QVMA 4JJAA 3D0KA 3WWCA 4BGUA 4A36A 2IZ1A 4BVEA 3Q2OA 4R2IA 2ECOA 3QPAA 4IINA 1GU1A 1I33A 4WADA 2WI8A 3LRTA 1IRIA 3Q2KA 3HPRA 4E5SA 2WB4A 2JFPA 1WIWA 1QVWA 1WDMA 2HF2A 2HO5A 2IEZA 2RG1A 3O9ZA 4KOAA 3RARA 5H0IA 1C50A 1HNNA 2QWXA 2IDJA 4W5JA 3W05A 4EVRA 3EEYA 3HWWA 3X0DA 3B53X 3IOCA 4DIDA 3H8SA 2VJOA 4C5AA 4Z4GA 2Q6LA 2FPIA 5LP6C 1D1TA 5CGQB 4DTIA 4XDYA 3AQIA 4CLRB 1G2PA 1E5LA 1GRNA 5E6SA 2ARKA 1KAOA 4JJZA 1E3QA 2NSDA 4M1TA 4AUMA 1JBEA 2A8YA 2H2FA 1PJ3A 1UBFA 3C8DA 3TCXB 4XLLA 1Y7LA 1SU8A 2G1UA 2GBFA 3EZYA 2NZXA 5F35A 4A6XA 3KR2A 3ZVLA 4LZWA 3JATA 2XWQA 1G59A 3PR2B 2BUBA 4RMJA 4NBKA 5KYUB 1KBQA 2E6KA 1E2NA 2BRUC 3EGDB 5L3SA 1R0XA 4P4SA 5J63A 4JR1A 4MMXB 4MPDA 1NLFA 1WF3A 5FI3A 1H0KA 1ZIXA 3T38A 1T0HB 1S4MA 1GPAA 1SHLA 1L0BA 4RGYA 3GMSA 5DGXA 5JEEA 3WGJA 3O4JA 3U7JA 1CUDA 1R0ZA 3LY9A 3PQFA 4Q3BA 5FPKA 3WLNA 4YALA 3U7QA 3ZJ4A 3M4YA 1FFXB 3X2SA 1NAIA 3W3AA 3EX7C 1JWAB 4RTOA 3IAM1 2TMKA 3CCQB 3HG7A 5KIAA 4R3WA 1DJOA 4RZUA 1OBFO 3LSTA 2RARA 1DWPA 2YHSA 3MLAA 3BRWA 1GSIA 1IG3A 1WWKA 4C04A 5JO9A 3ZX5A 1NT4A 5GONF 1L8OA 2XA9A 3IX7A 4UAJA 3OLXA 2WTXA 1HMPA 4C6TA 5HDBB 2QZ4A 2ZSUA 4LBZA 2VA9A 1K8RA 2HNKA 4YPFA 1ECPA 4ZDJA 5B36A 2D2XA 3A1DA 3FWKA 3GZNB 4BCBA 2FLVA 2PSSA 2AI3A 4HYYA 1KD1D 1ZA2A 3GEIA 2RC6A 5LU9A 1C7ZA 3J81k 3R5SA 4HCJA 1QCDA 2G9NA 4C3UA 5SY9A 3T3DA 3TTWA 2VP2A 2GBLA 4HNHA 3IP1A 5AVKA 1LJUA 4PO1A 4TV9A 3JQ8B 1HC7A 1U8ZA 1XHFA 2Y1GA 1PI3A 2FZVA 2FFJA 5F5XA 3RYCA 3AKEA 4LRSB 1MF7A 4B8YA 4ARSA 3TPFA 1BXRB 5IDQA 3IHLA 3AF0A 4JT9A 2XNDA 4J3JA 4PN7A 2ZCJA 3H9CA 3QFCA 1H4VB 3LC0A 1XZJA 3WSTA 1JV2B 2R1VA 4QPZA 1KDYA 5HSGA 3B13B 4LZZA 4J4TA 5DU2A 2CXHA 3QFRA 3TGWA 3IBTA 2FVGA 1Q92A 1YASA 1M34B 3LU1A 5F1KA 1ZRHA 5G4LA 2QZZA 5I3ZA 3B9QA 5A4MS 2EYQA 2Z3WA 3F3MA 1U9ZA 4JUDX 4TGLA 3EDOA 4UJ5A 1U9IA 1IIRA 2Y92A 2CZGA 5FR2A 4RDJA 3J7AC 3HL0A 1DTWA 4LGCA 1US8A 4KKXB 4RQAA 4EO7A 1IDOA 4JLOA 4TS4A 2ZT8A 1UJMA 1C8KA 3QNWA 4IX9A 1F51E 2OCLA 1K98A 2IYZA 4EG8A 4Z4ZA 2MSNA 1T2AA 3W06A 1E77A 1DUSA 2ERYA 1NV9A 3G0IA 3P0EA 1E6UA 3HLKA 4R8SA 5DE3A 4HWKA 3TRFA 1SCIA 3OZAA 3QFHA 5AKKA 3LUKA 2EYUA 2AB0A 3UBTA 2CJFA 4HK4A 1EIWA 4YECA 3UJAA 3VDRA 2OEPA 1WR8A 4B6OA 2K2QB 2D7DA 3LPCA 4MMZB 2GK3A 1FTWA 3L7IA 4EEXA 4KN9S 4OSEA 3FB1A 3ZX4A 3VVMA 5KWEA 1KY3A 3IIMA 1D04A 1WMFA 3BFPA 5AOBA 4CUZA 1E2HA 4FT4A 4XDGA 4A6EA 1I80A 4WOBA 1FLVA 1NQTA 1R6UA 4MWEA 1R4ZA 3KSUA 4FWTA 3A9SA 4NCHA 2ZETA 4KPUA 5DP2A 4A1OA 3IHWA 2DH6A 1DOZA 4ROSA 2X6WA 4OLJA 2LP4Y 3IAM6 4BNJA 1JHDA 2WPNA 1WUJS 4HDMA 2DFDA 3KB8A 1YB1A 4UU1A 4Z4FA 4XWWA 1D5WA 2W22A 1JFVA 5HE8A 3WA6A 1GA6A 1Z7EA 5CX4A 4JOQA 3D6HA 3VU8A 5AHKA 3W4KA 3IKJA 1CIVA 4CM9D 3R6GA 2D5CA 1T4CB 4YMLA 4X7RA 3E6AA 4CCYB 3C6BA 4LWPA 3A6HA 5DNCA 3JYHA 4RF5A 3ROMA 1O9HA 1R4MA 4ZAYA 1A9SA 2BF4A 4YWJA 3NU1A 1AU9A 2QW8A 4CM7A 5EE0A 1LV7A 3MJTA 3GX1A 3ZNQA 4EG6A 1FX1A 3EPPA 5CB4B 1WRBA 5GJVC 1A98A 1DBPA 2CJWA 1QHXA 4EJMA 4J16C 2FN9A 5H3LA 3KB6A 4GEGA 3OZGA 1Z2EA 3MLEA 1VIAA 4XWYA 5FOWA 3OG9A 4WLNA 5T6BA 1T4GA 2A30A 4TV8A 3A37A 3NG1A 2BKVA 1IM2A 1EFVA 2GAFA 1QLJA 3ANTA 4F21A 4WMLA 5I6DA 3U56A 3C70A 1S9HA 2OTCA 2IS1A 3PX7A 2R84A 4PU0A 1H22A 4LKRA 1WUIS 4D0SA 1ZRNA 1L3BA 4IJUA 1U0SY 3SX0A 4W5NA 2R751 3RU7A 3RJTA 1O4VA 1TYCA 1VKRA 1N5MA 1HDYA 1PR4A 2O0LA 3NZEA 2WQ6A 1V5VA 3F74A 2L18A 3KUXA 4MVJA 1CJTC 4JP5A 1G291 3PPWA 4OQFA 3QKSA 3SZGA 1M9NA 2YBDA 1TU4A 2QRZA 2DTXA 3WLRA 4UM5A 4OI0A 3P96A 2AG8A 2TMYA 3RS0A 4OXQA 4U9IS 1V3VA 2Y2UA 3EBLA 1UXJA 3SFVA 1TFUA 3P71T 2ZEJA 4ZOAA 4IG9A 4RD3A 4UM9D 4G01B 2IXEA 5EZSA 4EB8A 3WLEA 2RC5A 4WTOA 3TR0A 2V6MA 3MN1A 4FP9A 3F5FA 4Z9YA 3S70A 1IIBA 5IXYA 2B82A 2QY6A 5JS7A 4QPJC 4MVCA 1EZ1A 4TWBA 4WJLA 4W6QA 6PFKA 3CS3A 1SKUA 3D8BA 3GV0A 5KNDA 4Z9FA 5GOTA 4E7PA 1WM1A 3U4HA 2BELA 2QKYA 1OY1A 3CSSA 1T3HA 3DPUA 2OY0A 2JAWA 4LGYA 3GFVA 1JDNA 5EJ7A 5KYNA 1RWQA 3BTSA 5ULLA 1LWNA 1U65A 2PX5A 2ZAGA 1BX3A 3L41A 3FVRA 2RGAA 4MO2A 1TJ4A 1WETA 3DR3A 3MCAA 4ED9A 1DELA 1O0CA 3PA6A 2GO7A 5F21A 2WVHA 1DUIA 4URZR 1SBIA 3SR0A 3GNQA 4PRLA 1KO1A 5F1PA 4B76A 2IYWA 2H00A 3BMOA 3WLHA 5DHFA 3OCJA 3ROFA 5KWJA 3BUSA 1K89A 1TVEA 5JWOA 4LF5B 3TTXA 1OT5A 3AF3A 4ON9A 1Y5NA 2NVUB 4G26A 3AG5A 4WVLA 1ZIPA 3FPBA 3KOZA 2P2ZA 3PSAA 5BSEA 5LPNA 2WE7A 1ECJA 1TYZA 3GRUA 1MIOA 4KGVA 4OHUA 2CMFA 4ABYA 3ZU3A 1K68A 4DLSA 5BQFA 3U7FB 2FH5B 4P5PA 4EA8A 2YHUA 5CH5A 2ONCA 3BHIA 4WBNA 1SUSA 1PJ8A 3BK2A 3HU2A 3O73A 5DHAA 2DQYA 2WP0A 3KEOA 3FROA 1OZAA 1ZL2A 2C5LA 4FDMA 3TOVA 3EVFA 3ANXA 3CBQA 2FPXA 2WNIA 5ERXA 1RM0A 1N8KA 4XCQA 3HKCB 4M9UA 2DAPA 1USVA 2JNWA 3DZDA 3H9EO 4YRPA 3DO5A 2DYIA 4HX5A 4MDYA 3OW7A 1TB4A 3Q8LA 2X53S 4MQMA 3JQBA 1NNEA 3GVIA 5DS0A 1YJWB 3MGCA 1NBMA 4IDPA 4JY7A 4NBWA 3CA8A 3KQYA 4JCCA 2OAEA 2PS1A 4L78A 2E1RA 2NZUG 3KYCA 3P9RA 3UJ9A 1EFHA 2B3DA 3LLSA 3T5MA 1S72B 1PD0A 2V97A 1LXCA 4HQLA 1XCMA 4EITA 2XWPA 1TNDA 2DR2A 3IUPA 3ABRB 4MYDA 5BSXA 1TA0A 4IQGA 2H2GA 3V55A 1FRNA 3NXKA 2J0UA 1M6YA 3ZNPA 1ZKMA 1B8OA 1ONPA 3ORHA 3QLVC 2X40A 1YIJB 4PZAA 3LFTA 3AX6A 1XZKA 1YFKA 4YRTA 3U40A 1M6EX 2BGRA 4LRTB 4EJSC 3QKRA 1GA4A 2GFIA 3R3SA 1ZUIA 2IJGX 3L6CA 1MHPA 3MTDA 4JLDA 5ALFA 3I04A 2B3TA 5CDUA 3Q0EA 4M8LA 1QFZA 4HQNA 5B1HA 3KJQA 4K6CA 3OT5A 3UJCA 3UBMA 4LYEA 2XE4A 3ZW9A 2RCYA 1SOWA 1NPYA 2EF0A 4E09A 2HY7A 3B5JA 5A4FS 1VG8A 3L82B 4RMHA 4URHA 3OJXA 5L9AA 1GZSA 2VWGA 1YDGA 1N0IA 2D1QA 3SBDA 1EFKA 1L7PA 4MJ3A 4B2PA 3T51B 5HF6A 3CPJB 3I9V1 3MCUA 1A3CA 2PH3A 5CVCA 1GZDA 1KAEA 2DRIA 2XVXA 3BOSA 1B3RA 1H2WA 4D0LB 2D8MA 1JXOA 1N3BA 2ZI3A 3ROZA 1RAGA 1VHTA 1WPXA 3AF5A 4F60A 4OJNA 2XVZA 2Q5CA 4R2JA 1H65A 3E8XA 4OQ4A 1NW8A 4BV9A 1R00A 2X0RA 3JPWA 3ORFA 5LFAA 2V0GA 3HADA 1XEXB 3KKPA 3OPXA 1JFFA 2UZ4A 3ETCA 4YAEA 4EVQA 3FLEA 2QTMA 1AUQA 4KLCA 4JVSB 1WB4A 8LDHA 3TNLA 2MINA 2Q9AA 3HCPA 3DBVO 3SIWA 3ZWOA 1I7DA 3DCNA 3PHLA 1DG1G 1XMXA 4FZRA 1IK6A 3D8NA 2IP2A 3UAYA 5K03A 1IWBB 4QOFA 5DO9A 2D5BA 2AQKA 2XLCA 4PLZA 1JXAA 1N7GA 4CKWB 2FJPA 4F1JA 2J5XA 1G8JA 2DJ5A 4OQNA 1EVZA 1NJ8A 5EXXA 2GPTA 13PKA 4K86A 1OFHA 2PE5A 2IZ5A 1NFRA 2VRWA 3M6LA 1QK4A 1U2ZA 3FDIA 5KOHB 3IQZA 3VNVA 2CF6A 2CFRA 4L5YA 1KBZA 1PJLA 4S0ZA 3TWOA 4H0FA 3HGQA 4KO4S 4G5GA 1JQEA 2X7JA 3GA5A 4P7BA 4UBIA 4DGSA 1NATA 5C1PA 3SZRA 1YHQB 2F90A 4I3GA 1EA7A 4N82A 3U9LA 4DR3B 3KTAA 3ZXSA 4LVOA 3GLIA 4KKTA 1EBUA 3HABA 2EJUA 3W7BA 2PWBA 5ALMA 4C03A 2BMJA 3FBGA 3KP1A 3PLNA 3CZ5A 1HPLA 4QEZA 4B7XA 4DG8A 1VKNA 1VSVA 4F4HA 4IDOA 3LBFA 1RAIA 2XMZA 4RMGA 1X7XB 3ZKWA 2AC2A 1HYEA 1VC2A 2VTVA 1MRSA 2IUUA 3RIYA 1HDEA 3BRQA 3VNQA 3WXBA 1AK1A 2B36A 5FOQA 1YJ8A 4Z0TA 3E70C 2XVYA 1GPKA 4B79A 4UUAA 3G8BA 4C4YA 4NCAA 2VLBA 2H0QA 3UT5A 2YXPX 3HUFA 4L02A 5GJBA 3GEHA 5ALQA 4R1OA 4ZU3A 2YWFA 2REXB 1CQJB 1WQ4A 1Z5ZA 3QNMA 5HZMA 4E1AA 4Y6PA 1GTG1 1NXQA 3G68A 3L77A 1D2GA 3KRTA 3L0IB 3V6LA 1J7KA 2IEDA 3PG5A 2VH5R 4FPXA 3UOAB 4BMVA 1FNMA 3ED1A 2HA7A 3LX4A 4C7KA 2PJZA 1C4WA 3RFFA 2ZYGA 3DHVA 1HEUA 1K3TA 1MVNA 3A31A 3GXOA 3GLFA 4PLPA 1E6KA 4LRYA 4MR7A 3PFCA 1EH5A 1Z56C 2FX2A 2R6ZA 3I9V6 1L7XA 2EZ4A 5D01A 2QNIA 5DDIP 4AJKA 1XRLA 1YTLA 4XYBA 3R5FA 4RXMA 4MA0A 5AW1A 3Q39A 1AY0A 1PKVA 3MELA 3AHHA 1ZVJA 1RPNA 2NZVG 5E9JA 4RTSA 1P62B 5D5QA 1WCWA 5DVZA 4JKIA 3QE3A 1GN8A 4I5IA 1MNAA 1Q7TA 2JCGA 1SKBA 3WQZA 3OA0A 4FI3C 2JN9A 1FBTA 2RGDA 2AN9A 4CLRA 3JYPA 1XQXA 4QU8A 3KSBC 4P38A 4CQMD 2L0XA 4CR7A 1E6LA 4YREA 1SVLA 2FW0A 3GDGA 3LIPA 1GEGA 1GY8A 1EX9A 2J9GA 3E81A 3ECCA 4FEEA 1R4NA 1ZNWA 2AVNA 3EVCA 3L1JA 4POAA 3TZKA 3L07A 3RJ5A 1YB4A 2VZ0A 2V4UA 2WM3A 3N2EA 4OQDA 4YLGA 4IIJA 1H6CA 4RTNA 1JHQA 2HTFA 2R7AA 1GSOA 4PY2A 3EGDA 3WL7A 1YKSA 4WFKA 4WK6A 4UASA 4ACAA 2CJPA 2OCIA 4EFDA 1EE1A 2ZL7A 2X0KA 1RKQA 2ZBPA 2VYVD 3DVRX 4L4RA 1U7DA 4OOFA 3T1TA 4HFMA 5JCOC 1LSUA 2JAOA 4D3ZA 2XHEA 4GMFA 4DM3A 2HCJB 1U2GA 5B3JA 4B7CA 3AOGA 4ZO4A 2C4KA 4PINA 4AKSA 3ZIUA 2B1IA 3KZNA 2XCTB 3BRCA 4P6YA 1GTVA 1V47A 3QLJA 4I9HA 3S6JA 4F2PA 3DAGA 2B1RA 2IIBA 2Z04A 4ODIA 2IIQA 1E2UA 2QA5A 2UYYA 3IHTA 1KKLA 1XZAA 3O9VA 4XGRA 3NTLA 3HR7A 1SOMA 3EFHA 4EFKA 3R7DA 3O4RA 3JZFA 4FK8A 1RFGE 1W88A 3EGVA 3I2YX 3I37X 4RW0A 2BFCB 1R9GA 1VHOA 3JR7A 4NSNA 5BVGA 1G1MA 3L7LA 5KBYA 5L51A 4KC0A 4JJIA 3ZDQA 1NVTA 1FMLA 1XEFA 4M53A 1LRJA 3EXG2 4KXWA 1YT5A 2X86A 3F98A 3KJXA 4O2AF 4BMZA 2P8JA 2R1ZA 1BWQA 3QPDA 1OAKA 4HRVA 4F4JA 4C4OA 3U5ZB 3DB1A 4EUFA 4H0CA 2Q49A 1JSZA 3WLKX 4F06A 2YVAA 1Z08A 3RRXA 1OXMA 4Y1FA 5CYOA 3I1YA 4CF4A 1LPSA 4P1ZA 3FIUA 2PWYA 2OOKA 2Q2WA 2EFEB 1BU8A 1NG9A 2IBMA 4D9BA 4JBGA 2ZW9A 1FFHA 4UAUA 1L1RA 1Z2OX 4C21A 3OFNA 4DYVA 2JGNA 5K6AC 3UW1A 2C4UA 4B43A 3KCQA 5YASA 3CCCA 3HBAA 3C43A 3VKUA 2Q3MA 3HJRA 4N0EA 4GWGA 4JAVC 4OFWA 4UBMA 4CMIA 1YCGA 1E2JA 3PPVA 1PNVA 1Z6XA 4W1RA 2BFMA 3A6EA 1I1OA 1NZDA 4BNXA 3CU5A 3OM9A 4JQOA 1GQYA 2EFGA 4W8OA 2PFKA 2JCBA 4D4GA 3WRYC 2ID8A 3VR2A 2VJIA 4EF6A 5IPFA 4MGYR 4LF6B 2O0MA 3LECA 3NDBB 4WPGA 1PEKE 2RK4A 3HHPA 3SM9A 2ZBRA 3ZLJA 4DABA 1J22A 1ANKA 3WK4A 2R11A 1DV2A 1JA9A 2AW5A 4K6KA 1E9AA 2RDMA 4LFAB 3ZGYA 2WJZB 4X8MA 2Z8YM 3OAAA 4YUZA 3I1IA 1OXKB 2QI9F 4B73A 4AVYA 4QGAA 3PS9A 5ABPA 2Y1CA 4MLZA 2ZM5A 3IVXA 4ZJYA 4WE3A 1E9CA 1XGKA 3RLIA 4K6OA 3G17A 2PZMA 2QTTA 2X15A 4XLEA 4TLEA 3G2KA 3UMRA 5T7BA 2XZTA 4MQUA 1PV4A 1XZFA 2A4MA 1CP2A 1NDUA 4KXYA 5HW0A 5A5FA 2Z58A 3GVJA 1NUAA 2F3QA 2DHRA 3C3XA 4KSCA 1RXVA 3K0AA 1UD4A 1PFYA 4NFHA 5TMPA 5EHQA 1RZUA 4F4UA 3HH8A 1RRVA 4TL6A 1UCFA 1R15A 2ZYAA 3CH6A 3CNOA 3LX8A 3CXUA 3WLLA 2GRUA 2GM4A 5DV9A 4CMJA 1LQ2A 2W6ID 3IT2A 1I0ZA 4R31A 4XOPA 1TPZA 3LQ1A 1RWMA 5BWLA 3JXEA 4MQ6A 1YVPA 2Y2VA 1EDZA 2A14A 3KXKA 4DIKA 4X5OA 1RI4A 4QTUB 3E9DA 4KIGA 3VX4A 2XRYA 1OF1A 3CZCA 3PNLA 1EYZA 3WMRA 3AUUA 3UOWA 1OTXA 2FMTA 4FZ3A 1FQJA 2FZCA 4EHIA 4G37A 4XR9A 1UBNA 2XMPA 3OF2A 2VP4A 2CVHA 3ST7A 2ANCA 2AWNA 2WJAA 4GUDA 2IEGA 3V2UA 4EW6A 2OMKA 4F3CA 4IFBA 4L4XA 1KYVA 2OZKA 2ZIEA 1QPZA 2JC3A 3L6OO 2YXLA 3PUNA 3CX4A 3CF0A 4ZO6A 1L6IA 1NJ6A 2QUHA 4K8RB 1ENOA 1N2ZA 3U7GA 3THWB 4RSRA 1T1GA 3NHJA 1XHLA 3K35A 4KQGA 1V8PA 7ABPA 3CVWA 4L85A 3IYLW 3VPAA 1K3FA 4JJ8A 2GD2A 5F1YA 1IBCA 5J2UB 3WTCA 1N2BA 4V1CI 4RWEA 4X93A 2AMLA 3I5XA 4JJEA 4RIGA 4YRDA 1QTNA 3I52A 1HRDA 2UVPA 2NOAA 2VBCA 3Q8MA 1F2DA 3HY4A 4O02B 5K0BA 1TUBA 3DWIA 1PLKA 1ABFA 4HEQA 2XNKA 3MAAC 1NI3A 3BJRA 4R9RA 4H3SA 2PU7A 4EDHA 3L84A 2Q7OE 1RI1A 1LDYA 1CLEA 3JVIA 4AURA 1FU7A 1QIMA 2VFAA 2X85A 5T64A 1SG9A 4G67A 1BW9B 4UEKA 1KE2A 1S2OA 2G07A 1S89A 3ASSA 4OM7A 4EJFA 3P0IA 4GKKB 1K2VN 4J07A 1FUEA 2UVDA 1SUWA 2BR5A 3KR9A 2B1QA 3ONWA 4RZHA 3ET5A 4ZO9A 4CGZA 1UMDA 1KMHB 3Q6MA 4BNTA 4HXEB 3AM3A 4KR9A 4TYNA 3JARB 1TAHA 2PLAA 4KK4A 3ZEIA 4L28A 2B92A 3K5IA 4WXEA 1HF3A 3QTBA 2JD1A 5BR8B 1QFXA 3JAWB 3WKAA 2AOVA 1OLXA 2ATEA 3DCJA 4WESB 3FPSA 2UZ1B 1IUPA 2CHFA 3N0WA 1T36B 4NV1A 3UCXA 1OB0A 1ONBA 1T2FA 3TVDA 4E15A 3U3JA 4U1RA 3PGMA 1MA3A 1YRHA 1AKVA 3PICA 4RSHA 2VR1A 1PN3A 1T9GR 2X5XA 1XFOA 3T7SA 1TM4E 4HDKB 4LVUA 2JBWA 5JDIC 2HCBA 1QFYA 1GYPA 1ZUD1 2BBWA 3HN2A 4Q02A 2J07A 1V11A 3TMAA 1IOVA 4B32A 2WINI 4N18A 3RS7A 5JSHA 2DHQA 1JTVA 4OAOA 1CQPA 5JZOA 1M6VB 2GVNA 4PLCA 4BNWA 2PX3A 4H1WA 3FZQA 1BEZA 1HK7A 1L7NA 2PUWA 3IR5A 1HE2A 3ESRA 4BP9A 4CIWA 2GOYA 4BEBA 2J7PA 1G8SA 1CZOA 3NANA 4RMNA 4CDRA 1HDRA 5J9FA 2OHVA 3WMWA 5J4HA 3BXFA 3H99A 3LI2A 4I50F 3WGUA 1EVYA 3HVHA 5PGMA 1ZESA 1GU7A 2NVUA 1EGVB 2XNSA 2ZRIA 5LQDA 2Q3HA 2AJTA 2PAAA 3KO8A 3FOEC 2N1MA 4G1BA 4QGGA 1OYOA 4L0CA 2GXAA 4GAEA 1VP9A 3DCIA 4FQ8A 5CM9C 1U8CB 5KAPA 4GM1A 2HWYA 5F5NA 1KZGB 2MTBA 1DXYA 3TMKA 2K2WA 4ALKA 4M1KA 4E0FA 1I0LA 4MGZR 5DEIA 1CCWA 2XITA 5DTMA 5LZ9A 1E89A 3AY6A 4EW1A 5IF3A 2MR5A 5JI2E 4NC9A 3CB4A 4GD3Q 1S7CA 4JLWA 4PRZA 2OV4A 3U4AA 1NN1A 3AVXA 1CDOA 3AL2A 3GCGA 2XUGA 3W5CA 4P0QB 1O95C 2PMBA 1QOPB 2WJYA 2ZUEA 4FHCA 1AGYA 5ALKA 1ZGGA 3S2YA 3E35A 1KO8A 5ALRA 3TLKA 1IM8A 4BQPA 2V0CA 3UAZA 1GLGA 2QJFA 4K9SA 3SHVA 1NJSA 3QFFA 4RKFA 3ABZA 4C4AA 2Z6UA 4E94A 2O8BA 3H84A 2WTBA 3OEHD 1LI5A 5EXSA 2PE3A 1KFEB 3AHEA 5DN9A 3BXXA 4OA5A 1IZ8A 4ERNA 2H4HA 1AKEA 3GUHA 3JU4A 1RI5A 3G1UA 1V7ZA 5SZJA 5A0TA 2R2AA 1X74A 1C3JA 1DBWA 3FF4A 1E3IA 3FPKA 3KZCA 4D79A 4O3MA 3VR5H 1H9CA 3DC7A 3E5HA 2R7LA 4WXMA 1BWPA 1SUCA 4KH0A 1N07A 4Q93A 4V0KA 1N5RA 3V6MA 1ISJA 1Q82D 3JW8A 3GRAA 4HAUA 3LT1A 3HU1A 4PGMA 5HTOA 2W90A 3AR3A 3L8ZA 4CIYA 4ZRMA 3WQSB 2PBZA 2ESRA 1AD2A 1DE0A 3O0DA 4BYGA 4EHAA 3R0IA 1CQIA 3ASYA 1X9IA 4RDCA 1RACA 1ICEA 1E43A 4WNAB 4ZALA 3RJ9A 3RVRA 5MGBA 1G5FA 2OCYC 5F2EA 4KWCA 2H1WA 3DT8A 1QV6A 2I2WA 5JCPA 3MWFA 2O8FB 1DEHA 1RRGA 1RYNA 4EF5A 4TS9A 1PUIA 3NKLA 4IHKA 4CM4B 1QAQA 1RT9A 4I1IA 1AA6A 3H5LA 3CCBA 3IAAA 3GIDA 3PQ7A 3T7CA 2QP3A 4UJ3A 1DXOA 1KK2A 4G6IA 2A0KA 5BSUA 4F84A 2VP3A 4DUPA 2H1SA 2PZFA 3E5MA 2GPWA 3T3NA 5BY2A 1L9XA 4V0LA 2JLZA 2QRUA 3VI4B 4ENTA 4FJ2A 3W90A 2QENA 3LSYA 2CXQA 3TIXB 3SQDA 3CT4A 1CUHA 3UK6A 3UKJA 2IS6A 1ULBA 1XYYA 1Q0ZA 4Y2PA 5FOXA 1TAGA 4AN1A 1K66A 2C5AA 3GY0A 2GK7A 1FP1D 4DA9A 3CPXA 2I8AA 2OTJB 4RK4A 1ZVKA 2ZSKA 4B6PA 2I3ZA 2BZGA 1AHNA 1J23A 1GPH1 2H5EA 3IP3A 1Z4JA 1Y37A 3ACDA 1X1BA 1GZ3A 1KH1A 2IYEA 1J8DA 5KYKA 4CL3A 4BFLA 5FD8A 2HDHA 4OYLA 1OH5A 3H4IA 1DOHA 3MUEA 2C4MA 3O1LA 3WYCA 4DIUA 4ZYUA 1B73A 3C98A 3GGOA 5AKHA 4AS2A 4EUHA 2FEXA 2NV0A 1IBKB 2GHIA 1DBIA 3UH1A 1G1AA 2O23A 3D3EA 1OLUA 1NFQA 2HB6A 3SKBA 3PHHA 5FBHA 3VISA 4YAGA 3GJ6A 1YH3A 1GD1O 1BFDA 1SIWA 3QWHA 4ZI7F 3B52X 5FI5A 3U17A 3TW8B 3BMNB 2B4KA 4EW2A 4UUBA 2ZP1A 2WHXA 1N9KA 3MIZA 3OQNA 1XMIA 4UU0A 4RY8A 3FYHA 3U9TA 4BE7B 5EHXA 1BMTA 1XN4A 2PS9A 2Q6VA 1IUNA 4W5WA 4L0DA 3EG9B 2P2SA 2HJVA 4X41A 5K7SA 3EY9A 1EQ2A 2X4DA 3PX2A 1TTPB 2WRZA 4FMBB 4P1VA 4PGFA 3B6JA 2XOKA 3OPMA 4CI0B 2GZMA 2PZKA 3E15A 1UZNA 4FUTA 4ND4A 1P61B 5JZ9A 4CM1A 5JMOA 3IAXA 4R41A 2O1SA 2XT0A 3OM1A 5BRNA 4YT2A 3ZK9A 4DN6A 2O07A 5LD2B 4OHXA 5EKXA 1GZ4A 5THXA 1EK0A 3W8FA 2D0PB 2DM6A 2I4IA 4ZV7A 4ND5A 5JCJA 5AMXA 4LC9A 1TAUA 1HFKA 3F6SA 4JGBA 3ESCA 3KKKA 2ZTUA 5GM2A 4YJ2B 3KAKA 2YNMC 1O77A 1P7YA 5DM4A 2G8NA 1KY5A 2H52A 4PC3A 2YMLA 2PU5A 3DG9A 2CMDA 3KKEA 4N4AA 1NASA 3VZSA 2DEUA 4MEBA 2J67A 3WMGA 2JLRA 1UKVY 1WO8A 2GNPA 2J5QA 5L7YA 1UBMS 3JYOA 4EJ6A 2QD4A 2I6QA 5EKTA 2OZEA 2OZPA 1N9GA 2YZ7A 4L0QA 2PRJA 3IUYA 2VL7A 1MDFA 4ONEA 4YP5A 1ZGJA 3FOZA 3EODA 1JTFA 4OFBA 5TF4A 1ODTC 4KPGA 2VBSA 3L1IA 1OXSC 3PLAE 1U2TA 2GEKA 4N6NA 3OX1A 2UUAB 1OWNA 3ZY6A 4AJ4A 5IS2A 3OTWA 3E1YE 4PZPA 2VWPA 4OB7A 4BRSA 3VSAA 5ECWA 5JAQA 2ZUVA 4ZQHA 2UYHA 2ZTNA 5J2TA 3WK9A 2A0YA 3OZUA 6GPBA 1AHHA 4AKIA 2ODWA 4ZVOA 2I3GA 4R1LA 2H4XA 3EULA 3TKLA 4AMYA 4Q15A 4TKVB 2L2QA 5FFMA 1FUIA 3BMXA 2D7JA 4KNVA 3VR0A 5BRAA 4QUGA 1U2RA 1LW6E 5JIBA 4MV8A 4YRFA 1ITZA 3AVUA 3IEVA 4DDMA 3QHPA 3GU3A 1J2YA 2G1AA 3DE5X 4TX1A 3AKYA 4YCMA 2DWOA 3N0VA 3SBOA 1MGPA 5BQPA 5LZ5A 3L8YA 1KL7A 2XF8A 4FT2A 4IF4A 2J09A 4X8OA 1J0CA 1IFXA 3Q9UA 4MW4A 2ZYHA 4FMDF 4OHRA 3A35A 1U7PA 2E85A 4L2IB 3AOEA 4BVAA 4DBVO 1Z7BA 2Q9BA 2P4QA 4IYRA 5HZKA 2BFEA 2GEUA 3SC2B 3DP7A 2J3IA 2ZSAA 4V0QA 4WK4B 4P58A 3VGJA 4KO3S 1AKWA 3GOQA 2IOQA 1Y1SA 3KCNA 3VH4A 2WJ4A 3ACCA 3BERA 4QXQA 3R3VA 5J5VA 3A3BA 2GHRA 3PFFA 4WOKA 2JZNA 3EA4A 1XWFA 2WPDD 4Y2GA 3UH0A 4B7ZA 4JV5B 4RVSA 2AOTB 3TTSA 2I4RA 3KLNA 5LXTF 2JG3A 4ALLA 5AFSA 4IO0A 1SUIA 4ZGNB 1O94C 1VMEA 1L5KA 1WUYA 2YFHA 4G0PA 2GJ9A 2VPQA 1YITB 3VR4H 3JWPA 1KOJA 2ZIAA 1U02A 4BNFA 3W2FA 3IAHA 4F2DA 4FJ1A 2H1OA 1VKJA 5SZKB 3V7YA 1P31A 4KSYA 1X39A 1YSCA 2YHIB 5CDGA 2E5LB 4D8TA 2F6RA 1Z6QA 1WXXA 2ZQ5A 1Y33E 3KQLA 1VCHA 1X42A 3L9XA 5EYPB 3BC1A 3E1KA 3DEAA 3K5PA 4IDGA 2CNLA 4DQVA 1C7QA 3OLYA 3RRBA 2PAFA 2WHEA 3BIOA 3SEZA 3D6VA 3PCTA 1TI7A 3CB2A 3K30A 4EMUA 2GK4A 3HHEA 2Q5FA 3JD3A 3MD0A 4RZQA 2ZDQA 5A62A 4DCSA 1PIWA 3OOSA 1EPUA 4HB2A 2O0KA 2B1GA 4PFJA 1NM5C 4BXOA 3V80A 1T0JB 1E4VA 4R69A 5AVJA 1Z8NA 1L4LA 4KR0A 1UKZA 3WRXA 2Q3LA 3DW3X 3SVZA 5LM3A 4EVIA 2ZRDA 3OLCX 3PE3A 4S1VA 4TWIA 5JU6A 5F73A 4X1YA 5IN4A 4J4HA 2DPXA 3AJ8A 4IXWA 4DWVA 5CA1A 1MOZA 4BEWA 1YJ5A 4PF1A 1KNXA 4H3HB 5IJ0B 3QX9A 1A4IA 4E5UA 4CDMA 3D02A 3MWLA 5FV4A 1CJUC 3AO0B 1BHSA 2CBXA 3ECAA 5AM3A 4ZRDA 2REOA 2ZUWA 1NR7A 2VATA 5SYAA 4WKPA 1TLTA 1SHJA 4Q3EA 1ISPA 1C4OA 3TD6A 1EK5A 1EM8B 1F0YA 3PV0A 1L8AA 2ODEA 3UWKA 3VSDA 1ST3A 4MCJA 4K0KB 3MILA 3UHPA 2OBBA 2JI6A 4LFCB 3U49A 3T15A 3QUAA 1EGAA 5DSZA 1IUOA 1YOBA 1U0GA 2F43A 3FNEA 1APBA 1YMUA 1ZNZA 3FPJA 4MAAA 1QYWA 3AUJB 3FGPA 2M5SA 4WZEA 3D8RA 3PQEA 1KZLA 1BX0A 1K7XB 5DXFA 1RZVA 2GJAA 3AXTA 1MB3A 2CNOA 3Q7SA 4HBGA 2ZRLA 4MIKA 3AGPA 1QHHB 2EJVA 1QYCA 4O4JF 1B6SA 1Q7RA 2OZVA 4LXYA 2Y66A 1S2IA 1M6HA 2A94A 2IYFA 1NW4A 1A8IA 1QO0A 4HDRB 3LQEA 4ZP1A 5E4FA 2YUTA 5TJ9A 2ZSEA 3NBKA 3TK1A 2QE7A 1KFJB 2YYZA 3O2NA 3EGWA 1JHZA 2IOHA 4ZODA 4ZOQI 3D7NA 3W7AA 2V5VA 3HFRA 5EXTA 1KMMA 2FDRA 3HA3A 4OQYA 5FRDA 3QXGA 4C0AC 4BX0A 4D25A 1AUVA 4RGBA 1AMOA 3KHKA 4IZ6A 2X4LA 3D8SA 1GFSA 4YDSA 4C0QC 4J1TC 4R8MA 1T34A 1YS4A 1NN0A 1ZFNA 2GRJA 4QDKA 4YP6A 3LH5A 1J20A 3GVLA 1VHQA 5CXUA 2JVIA 3WWEA 2NZ8A 4ES6A 4LJAA 4PSAA 4AK9A 1EDOA 1JZSA 1S96A 3HR4A 1BD3A 3PFGA 3REQB 4TTJA 6REQA 3PKIA 3VC2A 1SXJC 2MMCA 2B2NA 3NOXA 3GRVA 5FYQA 1EB8A 3COSA 4URWR 4WH0A 4CI9A 3IQGX 3BHMA 1YJAA 3ETNA 4B1FA 4ENSA 3LOPA 4PLGA 3AXSA 1C0KA 3SXJA 3REGA 2WZNA 1Q91A 1VJ0A 1W19A 1SM4A 5CG1A 2VBVA 3ENNA 1B1AA 4NDZA 3IJRA 1KMHA 1M90D 1C2TA 1K88A 2O5EA 4U7GA 1VQ4B 3K32A 4YP7A 2QJTA 1FNCA 1HE1C 4YS6A 1MN6A 4CKEA 2IY9A 3T35A 3EHEA 2C7OA 1ZI8A 4YMGA 5FO0A 1PJSA 5JAOA 1UP6A 4QKQA 1T8WA 2CL0X 3AVTA 2CNWD 2AG5A 2J85A 1SG0A 3EZLA 3ENQA 3S2EA 5H02A 3PXDA 4LY3A 4WESA 2G17A 1PFUA 2LTAA 4Q3DA 1FW6A 4KPEC 4AJ9A 4HEHA 2XUPA 3B3GA 1DO2A 4IZOA 2YXEA 1F3OA 2XD4A 2WJVA 3QKIA 5D51S 4R1PA 1FP4B 4KR3A 5KSYA 3HKEB 621PA 4XLFA 4DV7B 2QTNA 2O2JA 1VLVA 2G72A 3SX2A 3T7AA 1PT5A 3BF7A 5EHIA 4KUGA 2QYOA 3EGXB 5LA6F 2IXGA 4S2EA 1PJRA 3NHKA 3FVVA 3VC7A 1FDWA 1KYZA 1ML3A 1M6VA 1T8SA 5LQNA 1AGRA 4YJFB 4J0QA 4MWGA 4O59O 2QAGA 3LWZA 1TM5E 4KKVA 1PT6A 1K7CA 2GLTA 3HRKA 4P5EA 4Z4EA 3SHTA 1DQRA 1NJ2A 1RKVA 1RVDA 1OB5A 3TKAA 3ZY5A 2N1BA 3CC7B 2AFRA 1XPJA 3D0QA 1FTSA 2E4WA 3AUAA 2VYNA 4OHBA 1PJ4A 3HB0A 3OJEA 2PH1A 4Q4JB 2J33A 3AIOA 3IV7A 1UBKS 4X1KA 4QECA 4K7JA 4UATA 4BUJA 2Y76A 4O2RA 1ISRA 3H87A 2G7MC 1TVCA 4N12A 1P74A 1Z62A 3VHXA 1AQIA 1H2FA 2IIVA 3L0YA 4KAJA 5TY0A 1G6OA 3EK2A 5JC8A 5CEFA 4DDKA 1RZRD 1LTQA 1UFRA 2D0IA 4AYTA 4AXXA 1GFWA 1PT9A 2FN4A 4CMAA 1D5CA 2AX3A 2VSNA 4IOKA 5CURA 7AT1A 3AGQA 3OC0A 1SD5A 2WOOA 3AR9A 1GNRA 5EJGA 5KJ1A 1ID8A 3SYRA 1NQ5A 3BXGA 1TTTA 3IESA 4Z2AA 2F62A 4B4VA 1RXCA 4J9VA 2DJIA 4MUMA 1ECBA 1NRWA 1WAMA 4OYHA 4LOIA 4Q34A 5ERYA 3ZHSA 4DUGD 1OWOA 2CCGA 3DJFA 4NH4A 4BIIA 2JHAA 2PVCA 2V9CA 2PEZA 2JJ2D 3O74A 4IGIA 4DE5A 2DPYA 1JJIA 4KLRA 4CJXA 4Q7QA 1W4BA 3VU9B 3RBZA 1M54A 1SXJE 3GF4A 4J76A 4ZOBA 1AURA 1BX1A 3K8QA 4E5VA 4ABTA 2V7WA 2JAXA 1K0FA 3M5CA 4FZ5A 4IIGA 4OGGA 5C8DA 4MR9B 1NVXQ 1Z9BA 3I9LA 3JS5A 2OHXA 4NZMA 3KUDA 4P82A 4AO7A 5TPWB 3CF2A 3ZZTA 1R6AA 1V16B 3EEFA 3I92A 4JLBA 1QZXA 5HDQA 1GKKA 2HQRA 2CY0A 2X5JO 1GEEA 3AL3A 5A05A 3R3WA 5K3FA 3OZSA 3DBHB 1I8DA 3A1CA 2H3HA 2ZTVA 1YBHA 1QZZA 1A76A 1ZZEA 1DJNA 1E4EB 1G66A 1PCXA 4YRQA 1X1DA 4DCPA 3LM8A 4FQ7A 1IBLB 1PJTA 4P3PA 1KWKA 3Q87B 4RCYA 3MINB 4LK2A 3FSEA 3RVLA 4WNAA 4J1NA 4G1VA 2ZXIA 2JGIA 3FPCA 1VJGA 3FRJA 3H5WA 1X7WA 2C2HA 4N03A 4BNKA 1Q7YD 1YBVA 3DEIA 2BTQA 2O8FA 1KP3A 2P90A 2BMFA 4R1MA 5B1IA 4CV3A 1YVRA 4Q3NA 5F9HA 3AR4A 1YR9A 3NM4A 3ZHTA 1LX6A 5B58T 4D8WA 3BNWA 1UXKA 4HPJB 5CDSA 2J3DA 4DR1B 4BKRA 3VR6D 1PNQA 3DZ8A 4HXGA 3O8OB 4M89A 1LLFA 2V4MA 1YC5A 4QT4A 2XGOA 3IUQA 5J47A 2GZHA 3JWJA 5B6IA 5CX1B 1FMTA 1USIA 2PRKA 3G0DA 3LGXA 1D0SA 2FPMA 2C92A 4MRMB 2GSWA 2AZTA 4LJ7A 2XTAA 1UFQA 1FRQA 3WSVA 2PX8A 3FETA 4XYEA 1BLIA 2OTLB 2CUZA 2KW5A 3C1OA 3W7VA 3GGCA 4S05A 3CLVA 1LQUA 2IYRA 5T4HA 2GZ3A 4YCSA 1KAHA 3H4TA 5DSXA 3G7NA 3MBOA 5TARA 1AKMA 3LT2A 3BRSA 2PQ6A 3OPYA 1Y42X 2QVCA 1BXKA 1EZZA 1KI4A 5DGCA 1ZGZA 2QY9A 2P2GA 3D7MA 3UCFA 4A0GA 3H0KA 2AXNA 3ZD9A 4BB6A 1TO2E 4F4CA 1KFBB 4XWAA 5AK4A 2E2WA 1KDZA 3ZU5A 1KI7A 2ID7A 1GIAA 1Y8CA 4PYOA 1XTBA 3H11B 1XE1A 1HETA 3A10A 2C9DA 3BXOA 1UBUS 2IWRA 1V0JA 2GASA 4E14A 1ZJWA 4ASUA 3M6AA 4ZT7A 3FHJA 3TW8A 1E1QA 1CR6A 1TZJA 1YI8A 2PGIA 2PRYA 5TNXA 3RO7A 1P9WA 1ODJA 4ZCSA 2P67A 4FR5A 3T7EA 2QT1A 1P91A 4YMHA 3GUCA 2JA1A 3DKIA 3PXEA 2NNLD 3SZUA 1JDVA 2NU9B 3GAZA 4AZTA 1YB2A 5G02A 3VPGA 1ZNXA 2H4YA 4WY5A 3RS8A 2QMZA 3EXIB 5JALA 1LK0A 4EKEA 1Y4DE 4PR0A 1V5WA 2IYPA 3H5TA 3QLUC 1H5QA 5D5HA 5KCMA 2VH1A 4GOKA 1TCUA 2Q5EA 4XN0A 3QTTA 3EFEA 3ICQB 4ZEVA 4MKFA 1F6DA 4KOEC 1CY1A 5CVDA 5ADUS 1XP8A 4L9WA 5DYTA 5EIFA 3AFOA 4F2WA 1QGED 2R0QC 4D4JA 1U8AA 2DOKA 1F2UA 1A0OA 2QTHA 3I76A 4KQ2A 1W46A 2P30A 3IMKA 1VBMA 3L40A 2QYSA 4XQCA 5CHEA 3S0JA 4O2BA 1C0IA 3VUFA 4U0JA 1W4AA 5B55A 1D1PA 1XWWA 1GG5A 1LSOA 3IDSA 3S1LA 1PBNA 4WZBE 4DVJA 3PNMA 5HEKA 2QG9A 4MS1A 3NASA 3CC8A 1MVLA 1RYDA 3DL0A 4RLHA 5I7UA 2OWDA 3AEQB 4RETA 5DCYA 5CFMA 2ZZFA 1DNPA 3JV7A 5HR5A 2C58A 3N05A 2Y0BA 1QHGA 1AOXA 2H29A 2W83A 3GEGA 5KSWB 3HVUA 4FWIB 1LSJA 2IYSA 2XD9A 4BNDB 3Q3AA 4OG2A 2XCSB 1G5PA 3DZFA 3HBFA 3KB2A 2VJMB 5BT8A 5A0VA 2JI8A 3K0KA 2IW1A 3DTYA 4IXNA 5A71A 5K6RA 3QVXA 4DOMA 1GV1A 3L7AA 1NUSA 2GAOA 2IHBA 2FSUA 4LRXA 2ZIXA 3D0OA 3T1OA 1R8JA 3QIVA 1KIMA 5KJ6A 3EXFB 4OB6A 2A0FA 1L8QA 3OPQA 4DJTA 1AS3A 4NEQA 3KDSE 3V1NA 1I30A 3IBYA 5I9MA 2AE1A 4U7DA 1KQNA 2BR4A 4MW5A 4RTLA 2PLNA 4E5KA 1UPXA 5ITVA 3N8NA 5DGTA 2UU9B 2MU1A 2WHPA 4RPHA 3WTBA 2HI0A 4NXMB 1HVXA 1WPQA 1R64A 1K8XB 2X8JA 3ZBPA 1Z22A 5FA8A 1GGJA 5JADA 2OQIA 2VP9A 4XGIA 2Y1XA 4WXYB 3LUFA 4EKDA 1A8UA 3L7JA 4ZK2A 3IUBA 4QRHA 4B6SA 4OY3A 4B83A 1HZZC 1Z0SA 1RYBA 5AKIA 1A7AA 1K06A 4MV4A 4B3GA 4TYPA 4XVQA 3TM5A 5B30A 2I22A 3KL4A 4JXXA 2NQTA 1LWOA 2G70A 4D1YA 1UIRA 4ZV4A 5BSGA 2HW8A 4W5TA 1GUYA 2GPAA 4X1IB 4FNGA 4CCAA 4CKCB 2NUBA 3NBFA 2GNOA 3AEXA 3GBSA 4WZTA 4Q21A 5AOAA 2DLCX 1QCYA 1GPMA 2WJWA 1MQSA 1SCAA 3BD7A 5ER9A 1QHYA 4YRMA 5KTKA 4DR6B 4U2EA 4EUKA 1PRYA 4ARAA 1ZEMA 2JKVA 3ZW7A 5K01A 1T0PA 3VVBA 1CY7A 4RVCA 4C2BA 4CCSA 3ANYB 1RYYA 3HMKA 4ZTUB 1FNDA 2EQAA 1ADBA 3G5AA 3CNQS 2GEJA 3SLGA 4FYVA 4IX1A 4L08A 3ZTYA 2WYHA 2B21A 2JLAA 4KN6A 3MBIA 1KO4A 4KEAA 2XZOA 2WZPP 1XD2B 2IL1A 3QELB 1BE8A 1UBHS 1M7BA 2PGDA 3CEJA 4FTWA 1ZICA 3RVJA 4Q4CA 2FPPB 2D1FA 1F5NA 4GG1A 4JYZA 2R87A 3FSGA 4JJFA 4KLAA 2O2EA 1RQ7A 1W1UA 5AVXA 1HE3A 2J32A 5DTJA 1GO2A 5E4YA 2YHIA 3FI0A 3MPUA 4JUBA 2WSYB 5M3BA 1NE7A 1E5QA 3DTTA 3VFDA 3ZHXA 3BD9A 1JDZA 1WD5A 3H17A 5EYPA 2DT5A 4BFXA 1E63A 3MB8A 1Y6ZA 3T06B 5K0FA 4X45A 3M9XA 4LDQA 4OH7A 2YVKA 1W44A 1WW8A 2P68A 3BTOA 3VJRA 4US0R 1B8UA 1EE9A 1PZEA 4GH5A 3PL1A 4E32A 4XLAA 1XU7A 2CE2X 1H66A 2HRRA 1XP5A 2COUA 1LJLA 1OYVA 4TQGA 4Y9SA 4BMYA 3PJRA 3GCWA 1XALA 5TGZA 1C9NA 1SCDA 1KIFA 2Q4TA 4KR2A 3V97A 2C04A 2QVBA 2ZROA 4CXMA 1F17A 1WKBA 2X4GA 1DQYA 1MAVA 2VZ8A 1XVAA 3CG0A 4D9IA 4QBIA 4IHJF 1I6WA 3WJ1A 4QLOA 5IUNC 5K4AA 3AP1A 1T9AA 3D6UA 3E7WA 3PRKE 4LMAA 2PTGA 2YJ4A 4MXDA 4JHXA 5K0GA 5JW6A 4UZUA 1QG0A 1XDGA 3Q9LA 1I1NA 1OU0A 4MZXA 5IJ0A 1KRXA 3BICA 4MLDA 2IZZA 5H68A 3FFWA 4GSLA 4D96A 3U3KA 1CUEA 3MOIA 1N2CB 4JCOA 1MXFA 1FJ2A 1I3CA 4YWHA 4DDTA 2CLKB 3BM5A 4LJKA 1TO6A 2D59A 4LJLA 3RVMA 1VI5A 3SR3A 1Q7BA 2LDXA 2FPLA 3LYLA 4OMUA 1ZM2A 9MHTA 1E2BA 3KLOA 2EX4A 3JRXA 2O52A 4C0SA 2NAPA 2JIDA 3Q1LA 4L57A 3WIBA 1JQBA 4TVSA 1YJXA 1BMFD 4ND2A 5F3DA 4PVCA 2RHDA 3D6NB 3NM6B 4KP7A 4RC9A 4I99A 2QXYA 4BB0A 1RABA 3O2QB 1GZHB 3H6GA 4IUBS 1IEWA 5AVQA 5IAJA 2VPPA 2VTEA 1ZN7A 1X0XA 2ZAOA 4MYCA 4R83A 1WG8A 4TWRA 1X19A 2RI0A 3Q5DA 2DF8A 3EEIA 4LGMA 3IHKA 3DP9A 4KQJA 4A27A 2YICA 1KQOA 3CNHA 3U7IA 4UULA 1A50B 1XA3A 4J1QA 2DQSA 4F92B 5FH9A 2JVJA 3M4XA 3EIUA 4US1R 1T3GA 4D3DA 1A88A 1U9IC 5IVKA 4HLNA 1G8YA 3FNFA 3GVXA 4WVFA 1V5IA 3ONUA 1Q50A 4JI1B 4DHWA 4R9UC 4OFZA 1CR1A 4XM1A 3F1KA 4KYTA 5EWLB 1KIAA 4NU6A 4HMOA 1MQ9A 3KJNA 2P6RA 1ZSYA 3L4SO 4C0BA 4BVHA 1Z12A 4LNAA 1GARA 5K3AA 4XX0B 4M2LA 4KJZA 1E4YA 3GUZA 3F7MA 4L3WA 4C07A 4DC0A 5IJAA 2QM8A 4E2FA 1NZFA 1CNEA 1JEQA 3LCVB 4ZOCA 3REQA 1R16A 2BAGA 4G5FA 3STXA 3ZDEA 3BBLA 4BMPB 1QU2A 1I3KA 1BFUA 1T1IA 5ALLA 3F6EX 3ECSA 1J39A 2QXTA 1B4DA 3FNBA 3E3LA 2CHEA 4RO0A 1O96B 1GPUA 1NNSA 2A3NA 2H7XA 3VYRB 4XSHA 3VZDA 2AS0A 1YE8A 2VBFA 3QP9A 4RZXA 4QFCA 1B0AA 1I7SB 3B9RA 4DWWA 3TQIA 5K6TA 5L4LA 1G2QA 2A5GA 2FXIA 3ZJYA 2A9VA 3AFMA 3TLMA 2C1EA 4ALNA 1ZD8A 2F9FA 2RONA 4RL6A 3EXEB 5AQ1A 4DB4A 3PJGA 4IMJB 3OKXA 4TKOB 3NCHA 2BHLA 2M6RA 1OHHA 1JE0A 3IPLA 3CH5A 3IIEA 3L1HA 4BX3A 3Q9NA 5BN5A 4JUAA 1IXKA 2YMQA 1YRLA 1U98A 2WJJA 4AS3A 3FZNA 3A1EA 4NNJA 1C80A 1KI6B 4XPIA 2IYLD 2ZJ7A 1JG3A 2FY8A 1UBGA 2VCYA 4ALMA 2GKSA 3IQFA 4GI7A 4Z7JA 4OQXA 2YXDA 1USWA 1W94A 1FP4A 4A73A 1C29B 4D43A 3KLPX 1UDWA 2HZ7A 3HKEA 4XW2A 5ELLA 4WKOA 1SG6A 5DXAA 3SC6A 3T34A 4YV0A 2X8KA 4FNMA 2ZRCA 4R7GA 3N0TA 3VZQA 4HQKA 4BLSA 3AI7A 4U7FA 2X7HA 4H4DA 3OY7A 3CJRA 3CZAA 4LXQA 5TIIA 2D6FA 1VSQA 4QUAA 5JSFA 5JCXA 2TMGA 1OILA 2WSLA 3LD9A 2IH2A 4AF6A 3HNOA 4JL5A 1A5ZA 2FOXA 4KGXA 1PJQA 2AC4A 1ZJ6A 4C0KA 4KXMA 3C97A 4LDJA 5GONA 4GX0A 4WEQA 4GGPA 3EFOB 4M9ZA 3AYZB 2G5TA 1P6XA 2DUUA 2PQ2A 3IQXA 4DUZB 4Q4JA 3ZHZA 4EGFA 2NTYC 3UC5A 3OP1A 4W63A 4FFRA 5K0ZA 1L1EA 4QFBA 1N2XA 3QLEA 1NF2A 1DUVG 1ZHFA 2C3OA 1JR3A 4O2AB 3ITDA 3OEWA 3RR2A 3QPBA 4L73A 2ZQZA 3AHCA 4DLWA 3EUFA 4MW0A 1OV4A 2Q4OA 3FRIA 2OYSA 5AW9A 1SIOA 2JIQA 4RXTA 4EUEA 3DO6A 4WECA 3ZI7A 2XA2A 3KKNA 4EBBA 1Z4PX 4YP9A 5HOEA 1D2RA 2GA8A 1Y1RA 3LPAA 1Y1KE 4ZXPA 1KARA 4UM8B 3DE0X 4OH1A 3H0EA 3EAQA 2IXFA 1OU4A 4M54A 1PG5A 3TE7A 4Z1MD 3DOOA 3EIFA 1VSTA 4GGMX 5CPFA 2WYWA 5GP1A 6ADHA 5J40A 4WKNA 2IZ7A 3TNDA 1HSOA 1P1KA 3ZCVA 2B0CA 2GXSA 4K3VA 3ZDRA 2OAGA 5EPOA 2BEKA 4ZC1A 1NVEA 4JB3A 3FNHA 3OW2B 4B6GA 3ZHUA 4CWAA 2VP0A 3MWKA 4IJKA 1DKUA 2G77B 5ERGB 2P79A 1L7DA 2OD2A 2OILA 3LOUA 2H8KA 4D45A 2GJPA 1X13A 3FPHA 4NBUA 1PQUA 1V1JA 2YW9A 2ODPA 4DCNA 1GV0A 3HDQA 5ENVA 4V02A 3T9DA 2JI9A 5FAXA 3R9XA 4N1AA 1TYAE 1HMYA 2O6HA 4XE5A 3NQ41 1FRFS 1PG0A 3I0ZA 1DZIA 4GLLA 4RQUA 5KNCA 3QEBZ 4L9SA 3GNTA 3RIHA 1V16A 5DHUA 1Q2UA 3V7NA 4AICA 5KKNB 2I9KA 1M5TA 2CEAA 3F71A 4TZTA 2PZLA 3FLMA 5COAA 3T0FA 3TW6A 1E3EA 1GFZA 4O4HB 3PFWO 4IOLA 5G53C 4ND8B 4HNAB 2PBFA 1KI3A 4OBBA 1PDOA 1JR6A 1C4KA 3FNRA 4YGXB 2P40A 3GPBA 4AMBA 1Z25A 2NUPA 2VDJA 4CMGA 1JDUA 1IHPA 3G13A 2FHSA 3IA2A 3EVDA 1MB4A 4IM7A 4YMVA 4I3FA 1TUGA 3ZIDA 3T6KA 4N7MA 3B78A 4HN9A 1U4OA 3DH0A 3TDKA 4EPXA 3P32A 5I5GA 2Z5GA 3FOWA 1P2UA 1P6UA 2EDCA 2G80A 4MQ4A 1BWRA 5BXYA 3O8RA 5J5AA 4N5NA 2X3FA 3ZGVA 2XSZD 4R8RA 3I5YA 4GVPA 2FSIA 3R44A 1KGSA 1AA9A 1XL1A 1FDUA 4P34A 1EK6A 3W5SA 1ZVMA 5K0JA 1JKMA 1Z0ZA 2ZM6B 4CM8A 2UXDB 1ISHA 1REQA 4KV9A 4R2KA 5K0EA 2I2CA 4BBPA 1IBSA 1HQCA 1QZUA 5DIFA 2FFQA 2LKCA 4ZQFA 1J09A 1E6WA 2VUUA 4RHYA 5FADA 3JQBC 4YCCA 3L49A 4Z7OB 4EDFA 4D97A 1ZUNA 3LRPA 5M29A 1KEUA 1Y89A 3TEMA 1DX9A 1SEVA 5K8TA 2PKWA 3ND8A 2QIOA 3D3JA 2NYVA 1R9MA 8OHMA 4ISBA 2HZBA 2ORYA 3SNHA 5KOJA 4JSRA 4M60A 2I2DA 2PKEA 3JAKB 2C5BA 4ENQA 3HFGA 5FOUA 1G41A 1KS9A 2GXQA 4WOJA 3N8GA 4EAAA 1Y6FA 4K6FA 3ZDDA 3GPLA 4Z4YA 1O95D 1E6EA 3ITEA 5CMLA 4GPTA 2HUNA 1CERA 1MZVA 2EP8A 2ZYDA 4GXRA 3UGQA 5LP6F 3OQOA 1ADGA 1VPTA 2GCOB 3VV2A 4R01A 5FPSA 1UADA 3EC1A 4CDNA 1JIKA 1Y9DA 4XQ0A 4JVNA 3NAQA 2GR9A 2W0MA 1IXSB 1QPGA 4US2R 3LNCA 4HFNA 5THQA 4ZCMA 1W59A 1DC5A 2C54A 2I4OA 3OCUA 2PM8A 1F4LA 5HK8A 4U3JA 2GPBA 4LX0A 2EKQA 5CVVA 2YIMA 4PBTA 1I3LA 2NW6A 1AV7A 2NU9A 2XAUA 5KTPA 1RPAA 1ZITA 1XQ6A 2LNDA 1UDXA 2GMWA 5F51A 1P1FA 3EXIA 2Z2KA 3C3YA 1UD5A 1S02A 1GYQA 3DTVA 4NARA 1T6NA 1PG2A 3KDPA 4ZHQB 2P9CA 1G60A 1NJID 2AF3C 3TOXA 3M1AA 1LC0A 4DV0B 2CT8A 4HVLA 5IBCA 2KPOA 5AIBA 4Q6WA 2E1BA 3NBUA 1DAFA 4DNPA 4FGJA 5LP1A 4HATA 1KYIA 1GKLA 1EWRA 3RPEA 2ZAIA 1JIXA 5FORA 1Q1EA 3M3PA 1X92A 3TSCA 4IVNA 1DARA 1EDDA 1SZPA 2EJWA 1K4YA 3FCAA 1U5BA 4QXPA 2Z0MA 2ADOA 3DDSA 1BE6A 4UEQA 4BJHB 4JN6B 2WFMA 1ZJYA 2V6BA 4OXXA 4AN0A 1PJZA 5A4IS 1ULSA 2C3PA 2K7FA 3ICEA 3NETA 4HMPA 1PVDA 2ZE8A 4MQEA 4OA8A 4FFBB 3WYNA 2VJQA 4DV3B 3H1BA 4TXNA 3QX7A 1Q57A 3SKXA 1N36B 5ANRB 5IVHA 4EQ6B 1TLFA 4JX9A 4UBOA 2VXCA 2UUBB 1IB6A 5JXGA 1U1DA 2QTCA 2WIGA 3WLSA 1YU9A 2CDCA 3LMKA 2VUIB 4Q39A 3T0GA 1JWLA 3ZYZA 1O3YA 4V0MA 3BEOA 1NY6A 5L3QB 4DA7A 3WQHA 2V7VA 3EXFA 4BWVA 3WY9A 1U0LA 3VO2A 5AD1A 1ZM9A 1SC3A 3L8FA 4S1NA 4BQQA 2AJLI 3MB5A 4PICA 2RBEA 1CX9B 3RK0A 2CXXA 2ZPAA 4R1UA 3RTBA 4B3CA 3O8QB 3CQ9A 4CMEA 3T7DA 2Q7DA 5CFNA 4HWOA 2ZZEA 4DLPA 1QRUA 2FX5A 1PWEA 1BCRB 2EKBA 4OJTA 4AF8A 1NBME 1XMOB 1UD8A 3HUUA 1QYIA 1AQNA 2CE7A 1DV1A 2XIJA 4MUYA 1IQ0A 1EK1A 3LF1A 4BKMA 3WP1B 4BJ6A 2G9ZA 2MYPA 5KMGA 1CDDA 2OCPA 3FTNA 4TKUB 3UQZA 4XR6A 1G7SA 3F2VA 1YBMA 1M0WA 1ZUWA 2IU6A 2Y6UA 5CFZA 3A8TA 3V7UA 1F9EA 2D5LA 1NMYA 2YWHA 2PZBA 4OHCA 3WGNA 2BSXA 5HJ7A 3RYFB 1U7WA 3LYAA 4EWLA 2HA3A 4EBFA 3PSHA 4AZVA 3Q0IA 4IL5A 1F5SA 1QH1B 4RTKA 2UZ3A 2NLOA 3WLTA 4P81A 2FFAA 4DM4A 4F3RA 1AUPA 1YS1X 2FMKA 2VNSA 5T5QA 1Z29A 2DECA 4PYQA 5ADHA 3SSNA 2WWXA 1CUXA 3U26A 4JLPA 4AROA 2UUPA 3PWZA 3HYLA 4QJ5A 4O25A 4ZGBA 2W43A 4U6NA 1GKIA 1ORTA 5CTAA 4FB5A 2ZKLA 4GRAA 4MVYA 4HEA6 4WKBA 3UN1A 1KWGA 1LEHA 4QYXA 2V8BA 2QHXA 3JQPA 3OUTA 4RULA 2YJNA 5EUBA 1ONNA 1GITA 3OT1A 4D5EA 1XR3A 4IWNA 2CUTA 2OPBA 5BSTA 5B57C 4QQNA 4F6RB 3CVVA 1XIVA 3ER6A 1LNQA 1COWA 1SVSA 3FVTA 2F4NA 1CUBA 2GYVA 2ZRPA 3NYRA 4LZJA 5FL3A 3ZYCA 2EBFX 4AZ3B 4P22A 1XFAA 2YXNA 3W4IA 3DBIA 2HWUA 4IIDA 1N75A 1GPDG 2FPPA 2PVSA 2Z8XA 4RH3A 1EUCA 5F5LA 4ZT6A 2ZR8A 2YNMD 1EEXB 4PQGA 1X77A 2JLXA 1T10A 3D2LA 4I55F 1UIMA 4URUR 4ZGQB 3GN1A 4RK1A 1YQEA 3C3MA 4X3PA 3LX6A 1FDRA 3LO8A 3OSZA 4PX9A 3V4PB 3GCXA 4D4MA 2JI4A 3E0QA 4WI1A 5B5SA 5C18A 3W3AH 5JXIA 4JLJA 4RVUA 2QN9A 4HDOB 4BN0A 2IHTA 3WIEA 4NBSA 1T3TA 4JBIA 2M1XA 1MEJA 1FXWF 2I33A 3ZD6A 4P32A 4H9GA 3KELA 5M04A 2LCFA 4J8PA 4D0RA 1S7GA 3OE1A 4OP7A 4QVJA 3X1ZA 1U2GC 5BPHA 5B3JC 2Q99A 3QVGB 3ZXIA 4ETIA 3DFZA 1FQKA 1HH4A 3BH0A 1MU0A 3BE8A 3OI7A 3DGFC 4KNYA 1Q5PA 1Q0QA 2DBYA 1OX4A 1W581 3P19A 4FHDA 2O1XA 3LGSA 2XI4A 5G1PA 2CVFA 3FYTA 1RQNA 3N5CA 2HIGA 3DPIA 1O54A 1PGNA 2H7VA 3O26A 4G25A 3TPZA 4B8WA 4M8SA 4MDHA 3V2GA 3EOZA 2PX2A 1ILEA 1E1RA 4DJ5X 2I99A 1RRFA 4BV8A 1W4LA 3GLIE 1L4EA 1DAOA 2VBGA 3P9KA 4MKXA 3VZCA 3WYBA 2X6YA 4E12A 4YRBA 5CFLA 1IMJA 2PT5A 3UJ7A 2VXYA 4RHUA 3Q11A 3QSGA 2WLTA 4NU5A 1RHMA 4GMHA 4ZCTA 1XDDA 1UDRA 1X86B 1FS6A 4EPVA 1I6LA 4DV4B 1BCSA 3N2KB 3G0GA 4QUJA 4Z7NB 1DX6A 4YCAA 3RU9A 3T4UA 2XQGA 1FTQA 3MGBA 1WTHD 4OPSA 3SLNA 1IAVA 2IIPA 2OVBA 3LPDA 3PD1A 3NIDB 4J7UA 1CUZA 4JEMA 4PCAA 3A7DA 3P5BA 3UHAA 1CLUA 4QRIA 1LA2A 3DUFA 4XONA 2WSIA 4TVOA 4UDOA 2WSBA 3DEFA 4AZWA 1TGYA 3HSYA 3DMPA 3IB3A 2JARA 1I14A 2GN8A 4HNRA 4HGYA 3PA1A 5E6TA 2WSSD 1ETUA 3EZGA 4MA5A 4DFDA 1ESEA 4EX7A 4E07A 4MVJG 3IJ5A 5FJJA 4X7PA 4WA8A 3ZY3A 2OBRA 3GLFE 4UNIA 1CPYA 1XZEA 1X1EA 3BGOS 4I46A 1U81A 4JLKA 1CZLA 1HLPA 4PR3A 4L8FA 3L4KA 1QUFA 3R7BA 3NEAA 1O94D 2F67A 4DW8A 1DZ3A 5IAGA 4CG1A 4E2XA 4N9WA 1VQ6B 1WSRA 2XCUA 1KK0A 3H1EA 5EWLA 3ONDA 4Y9DA 3D26A 2WU8A 1T1EA 3DDOA 3F5MA 2W8BB 5IYWA 1NVVQ 2ZSFA 1QGYA 3DFMA 3EW9A 5E9AA 2PMEA