3JQRA

Crystal structure of the h286l mutant of ferredoxin-nadp+ reductase from plasmodium falciparum
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
312
structure length
256
Chain Sequence
NFINLYTVKNPLKCKIVDKINLVRPNSPNEVYHLEINHNGLFKYLEGHTCGIIPYYRCARLYSISSSNNMENLSVAIKIHKYEQTNYGYCSGFIKNLKINDDIYLTGAHGYFNLPNDAIQKNTNFIFIATGTGISPYISFLKKLFAYSNYTGYITIYYGVYNEDSILYLNELEYFQKMYPNNINIHYVFSYKQNSDATSFYVQDEIYKRKTEFLNLFNNYKCELYICGLKSIRYKVMDILKSHDEKKKKRVHVEVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Plasmodium falciparum ferredoxin-NADP+ reductase His286 plays a dual role in NADP(H) binding and catalysis
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Oxidoreductase
molecule keywords Ferredoxin NADP reductase
total genus 79
structure length 256
sequence length 312
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2009-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3jqrA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 3jqrA02
4AC9A 2VNJA 3OJWA 1Q81D 1J9ZA 4WQMA 2RC6A 4P3YA 3LYUA 1SM4A 3CCUB 4QFMA 2BVNA 2B7BA 1FDRA 4YHBA 3W5VA 3CCEB 4B48A 4DQKA 1YI2B 1GO2A 3WBJA 4HE6A 2GPJA 2VZLA 2EFGA 1CQXA 3ZZTA 1F20A 2FX3A 3CCMB 1K73D 4C43A 1FNMA 2PIAA 1YHQB 1QVGB 1DDGA 1VQ6B 2VNKA 3WNCA 1ZM3A 5THXA 3ZC3A 4QHYA 1TLLA 1KQSB 1VQNB 4R71A 3MCAA 1W34A 4LBWA 3W2HA 2J7KA 3G71B 1EFTA 1VQLB 3A1FA 1ZM4A 2QDXA 3CMAB 2EIXA 4M4SA 1U2RA 4RJLA 3CCQB 1G7CA 3U6BA 2PLFA 4TMXA 1VQ5B 3WXMA 4LBZA 5DSZA 3LRXA 3CRZA 1Q82D 4RCZA 2ZITA 3SJZA 4RD3A 1M90D 4AF7A 3CC4B 1QGYA 5EMNA 4J0QA 3FJOA 3P27A 3CCLB 1QGZA 4B43A 3CC2B 1KJZA 3CD6B 1NJID 4EH1A 3CMEB 2BN4A 3V76A 4F7DA 5KSWB 1VQMB 1EWYA 1QFYA 4N3NA 1UMKA 4TMVA 1VQKB 4FN5A 5GV7A 1K8AD 3AVXA 2YWFA 3LO8A 1W35A 4PC1A 1D2EA 3E1YE 1JNYA 3CB4A 1R5NA 1HA3A 1QGAA 1QFJA 2B5OA 3MMPA 1QFZA 4PC3A 3CCRB 1I7PA 4LBVA 5HXBA 2YWEA 4U9UA 1VQOB 2BGJA 2RC5A 1OGIA 3W5HA 4MYUA 4N3GA 1KRHA 3B8HA 1TVCA 2DEUA 2QTZA 2QTLA 1ZM9A 1N8RD 3E20A 3OZVA 1KK2A 3AVYA 4PC6A 3VNVA 4C0SA 1FNDA 1YJNB 1KK0A 3W2IA 4FWTA 3VMFA 4PGOA 1VQ8B 3CCSB 4K1XA 3WY9A 4FK8A 1G7RA 1YJWB 2B7CA 4UAJA 4ZGQB 1R5OA 1EFUA 2BM0A 4Y9UA 5TR9A 1EFCA 4LBYA 1QX4A 1IB0A 1QG0A 1EXMA 2DETA 1ZUNB 2C77A 3PENA 1R5BA 4PC7A 3I56B 4B44A 4ACAA 1JA1A 4ZCIA 1KD1D 2CRVA 4RD4A 1B2RA 1AMOA 2BMWA 3CC7B 2OTLB 3ZBUA 1GJRA 1YITB 2BF4A 2R6HA 1BX0A 4B47A 4NBSA 1SKQA 3WYAA 1BX1A 2BPOA 3ES9A 1IJFA 1W2BB 1QUEA 1FNBA 2CNDA 4P6VF 2DERA 3ZBTA 3AVUA 4B3XA 1A8PA 4TMTA 3U2QA 1KK3A 1D8TA 4TMZA 4Y9RA 1JJ2B 2OTJB 5FA6A 1FNCA 1Q7YD 1BQEA 5TV2A 1CNEA 3I1FA 3OJXA 1H85A 3VO2A 3OW2B 4RD2A 3QE2A 2QMUA 3AVTA 2OK8A 4Y7CA 1W87A 1N0VC 1QH0A 3AGQA 4Q7JB 3JQQA 1GVHA 1GAQA 5TY0A 3CPWB 4YAWA 1XE1A 3CW2A 4B4DA 2QA4B 2VYQA 4RD6A 4YAUA 2YWGA 3W2FA 3AGPA 1EP2B 1EP3B 4MYTA 4TMWA 4TN1A 1M1KD 3VNUA 4ACBA 2E1RA 3QFTA 3VO1A 2HDNB 2VNIA 2BM1A 3MHPA 1EP1B 3B78A 2HMAA 2XNCA 2BSAA 2PMDA 1E63A 1OB5A 1TUIA 4RD0A 4RD1A 2GQFA 3WNDA 2XNJA 1DG1G 3P26A 4M0LA 1E62A 2OK7A 4ZV4A 1JA0A 3W2EA 3CCJB 1G7SA 1KC8D 1AIPA 3B82A 1S72B 3G4SB 1GR1A 3OZUA 4ZCLA 1ELOA 2D74A 4BPRA 1Q86D 5H59A 1N0UA 2C78A 2XEXA 1NDHA 3AVWA 1G7TA 1YIJB 1D1NA 1QVFB 4AF6A 1QUFA 3ZZUA 4ZCMA 4HE5A 2AHOA 3LVBA 3QSYA 3J81k 1DDIA 2BV3A 1VQ9B 1KTVA 4M2LA 4YAOA 1VQ4B 4G5GA 3OZWA 3ZZ0A 4PC2A 2NPFA 5AN9A 1E64A 1WDTA 3CCVB 1YJ9B 4RCYA 1VQPB 3AVVA 3QFSA 4NCNA 3JQPA 3WNBA 3QFRA 2YWHA 1OGJA 3U6KA 3I55B 1FRNA 2DY1A 3W2GA 2DCUA 4DQLA 4YALA 4M53A 2BGIA 1VQ7B 1ZM2A 1S0UA 1OB2A 5GV8A 1JB9A 2HCJB 3G6EB 3FPKA 1IJEA 3W5UA 4YAFA 5H5JA 5JBQA 4LC0A 1KK1A 1CNFA 4G1VA 1BJKA 1B23P 4IW3B 1H42A 1DARA 1FRQA 2X3UA 1GAWA 1XB2A 3CXCB 4ZGNB 4H9GA 3QFCA 1TTTA 2QEXB 1K9MD 3WBKA 4G1BA 4M1KA 1F60A 2VNHA 3JQRA 2QN6A
chains in the Genus database with same CATH superfamily
4LWOA 3DMTC 1Y80A 1D4ZA 4UAGA 3EGIA 5FCDA 3J81A 3A3PA 1MRSA 4BQFA 1AF4A 2W90A 4LZOA 4JC5A 4UBOA 4B1FA 1AB5A 3U4CA 1G5RA 2E5LB 4IFBA 4X1KB 4JYMA 4M1ZA 1SUIA 2C2KA 5ALZA 4RACA 3QOYA 4BNJA 3HNPA 5BQ3A 1MQ8B 1H22A 1NVVR 3OU2A 4RDCA 4XQFA 1B2LA 1Y9AA 2PWAA 3A26A 4GP9A 4CLDA 5I5EA 2IY8A 4DKJA 2NU6B 3K0HA 2GN2A 1HDOA 2AKAB 2ZS8A 1DJNA 4HNAB 3OZGA 1H9BA 2V3WA 4DQKA 2AHRA 3E6AA 4I55F 5IK2D 1U7WA 4MB2A 4O2BB 4P4NA 4FQ7A 5LWHA 1V96A 3QY9A 2B8TA 2CLMB 4KXLA 1SVUA 4DR5B 3ASZA 2PU7A 5DE3A 3CCMB 3L8YA 3NOVA 3KZMA 4QPJC 2J6CA 3HAGA 3GUCA 4MHSA 1UP4A 3V7UA 2QLJA 2X7XA 3TZEA 4IMJB 4X7CA 1I18A 3BC9A 1Y3CE 3EG9B 3MA0A 5FI3A 4EDHA 5KREA 2Q3EA 4TTQA 1OPXA 2JKYA 4BQQA 3QPVA 3VR6D 2V7EA 3NH9A 3K1AB 3L7AA 1RM5A 1MV5A 3HADA 2CVQA 4EAAA 1JWAB 2V96A 1FXWF 3NDBB 5HJ2A 4S05A 5JVDF 1NPTO 3CO5A 5JSQA 2YN0A 3AOGA 4QGGA 1LLQA 3BY2A 3QV2A 4MH0R 4CLXA 1U3UA 1XAJA 3NYRA 3PGKA 5CBPB 1C9NA 3TOVA 4IQ8A 2YWXA 4UXIA 1NB0A 2B1QA 3D64A 3CT6A 3CW8X 3IEIA 3JYNA 3BFVA 4MWOA 3TZ6A 5LQAA 3RYFA 1W34A 3TL3A 2DB3A 2VXOA 1GPLA 4MRMA 3OAAD 4LC1A 2IX9A 1XTKA 3IQIX 4DAEA 1KJNA 3OWXA 4JSRA 3D6NB 1GGNA 3A1FA 2GGSA 1SUEA 1XHFA 4YDQA 3RAEC 2IXGA 3BRSA 3UWPA 2Q7OE 4M0DA 3B85A 5TMBA 3D43A 5CPBA 1BHJA 3UICA 4BJHB 1Q7GA 4DJDC 1WB9A 2XXAA 1C0IA 5B58C 1U2GC 3EXAA 1AF7A 2BEKA 2C83A 4WZTA 1SEPA 1HG1A 1M2VB 5AJTA 3TDKA 3QVOA 2DUNA 2I8CA 5HF9A 3RFTA 3SE0A 1KMMA 1RQRA 2II6A 3HR8A 2OCGA 3JQFA 2AC2A 1R9GA 3LRXA 3UM9A 1OX4B 4BEBA 1I7LA 3LP8A 3QU4A 1E1RD 4Q4HA 4FJ2A 4KLAA 1XBTA 3T7IA 1LPOA 1NW3A 3AOEC 4F6CA 2J1LA 2ZJBA 2N1BA 3DJYA 1XVTA 3D6TB 2GCNA 3FVQA 3H4MA 3N86A 1JG7A 2F90A 2VDLB 3HM2A 1JQAA 3L1IA 4UE6A 2FWBA 3F7OA 3PRHA 3WQRA 2NP7A 9ATCA 2ZZMA 4HLUC 2C04A 4OLHA 4WX2B 4X45A 2JJYA 2FN7A 3WDSA 3TK1A 4DPKA 2J3JA 1RRPA 1M6VA 5F23A 2FE4A 2R86A 1J8DA 3WO0A 1AK2A 2W4MA 5A3SA 1UZNA 4JJEA 1GPMA 3E82A 3G2NA 4FZVA 3I2FA 4IICA 4LE0A 2H7CA 4EHAA 1D0VA 1VZ3A 4C4RA 4KO2S 4A0SA 2WF6A 5FOXA 4G4SP 1GKUB 1BOOA 4F5DA 4V02A 1G20A 1UJCA 4G56A 1YZHA 5EIAA 3BSFA 4XQCA 5E38A 1YXMA 3IEUA 3BXGA 4QQFA 5AKKA 3SJBA 1ZUIA 5JCXA 3STWA 4JEMA 4QTYA 2QTMA 3QKSB 4GG1A 4EP1A 4PCAA 1MVLA 3QPBA 1RYBA 1QG2A 4HGNA 3T0FA 2HNKA 4JR1A 4FN5A 2G1UA 4YASA 3WGJA 3A6FA 3FN4A 3TOCA 4F21A 1MEJA 1G8PA 1T3HA 2F3UA 2VWPA 4JL5A 5BV1A 1EVIA 2Q4RA 3GOHA 3ILXA 3W1WA 4YMLA 2JB9A 1YBHA 1D2EA 4EKNB 4HXFB 2WA1A 2IWHA 3ZGYA 2NN3C 1Z6QA 4MW2A 4BQNA 2HRRA 1U2TA 3HG7A 4FGWA 5CNMA 4LBVA 1OIVA 5BMVA 1TYDE 1VQOB 1XTTA 2RC5A 1Y37A 2BKLA 2DQ4A 1HL7A 1XCJA 2VI5A 3DFKA 5G0WA 4KDFA 4QTZA 1U8EA 5FTNA 1U8XX 4BLSA 2X6QA 2GEBA 2G9NA 1UBTS 3IMEA 3ZWPA 4HRAA 1OFHA 1PL0A 3V4LA 1IOLA 5H3CA 1W5SA 2VZ0A 3PG5A 1SZPA 3BD6A 5HMLA 4EPXA 2IOFA 1RKBA 1U0TA 2QPTA 4MVJI 1Y8RA 2R751 3D5QA 3ECAA 1M9NA 3QXXA 3E20A 2BJWA 1OMOA 4LJ6A 2BGRA 5DK6A 3CF4G 2WE7A 4Y6QA 3GIRA 2ZPAA 1FP6A 2W2MA 1I2AA 1F8XA 2P2CA 4RDXA 1JSLA 2B8EA 2V58A 4BLOA 3OPYI 1V8ZA 1ORDA 2IOQA 1QNFA 4WOPA 3OSZA 2K4MA 3N6VA 4OSPA 1CV2A 1KI1A 3G2KA 3PDWA 4JT2A 1ZK3A 3A1WA 1K9SA 4ZK6A 1ULTA 1F6WA 1KH1A 1NNUA 2FK7A 3IAM6 4GOKA 5HMMA 3SLDA 1VQ8B 1HBJA 4ZQHA 4F97A 5JO0A 4KLRA 2NT3A 3GT7A 4QYWA 1KJIA 4F86A 3E84A 3EEQA 3QKRA 4Y6OA 4C7KA 1YDMA 3MWJA 4BO1A 2VJMA 3K70C 4O8ZA 3DMRA 4ZHQB 3N6RA 3WA7A 2GD6A 3PFGA 3SJPA 4ZGQB 4K87A 3CR7A 3DKVA 1VJ0A 2JBWA 1WCV1 4NPCA 3C1TA 3JQAD 5GOTA 3W3AA 1P3Y1 3RRBA 3TXXA 2G5TA 3BA1A 3CMCO 3ZU4A 4AS1A 1Y4ZA 5P21A 5FFFA 1P0FA 2PQ2A 3G23A 2CXHA 1PSDA 4C78A 4ARCA 1XTBA 2ZPTX 1C0LA 3R6GA 4MUXA 4MWTA 3TKYA 1XI2A 4XLHA 5DLEA 4PC7A 3ASRA 5ICFA 3OM9A 1E9BA 3AESB 5GGYA 3R3WA 3WBFA 4EUKA 1XTZA 4G3XA 4JENA 3OI7A 4L7QA 5EMHA 3UKOA 2CNBA 4QG3A 1FUYB 3LPAA 2Q8QA 3PUJA 1PGPA 3LV8A 3MFQA 2WDPA 4Z0PA 1WA5A 2YBDA 4RVFA 3ZJUA 2QW8A 3NJ8A 5EN4A 4AMVA 3OO0A 5CRIA 4OJNA 5A06A 4BJ6A 2HHAA 2WT9A 2H1OA 5JQWA 1GQOA 1SQGA 4O4LF 1K63A 5F4JA 3TNJA 2GVNA 4DVGA 3OIGA 3ROMA 2R6HA 2OT3B 3UC5A 1E5XA 3HP4A 3M6LA 4U02A 2B8JA 2XT6A 3B5EA 1Y63A 1U1EA 4PFJA 4XXHA 3T7AA 1NQXA 2OGWA 3AERB 3U80A 4IDEA 5JXWA 2OZLA 2NPOA 5FR1A 4OU4A 1L7OA 2A1TR 2KM1A 1BQ4A 4IZOA 2O2ZA 1KDTA 4TTTS 1EZ1A 4EMUA 1OXXK 1IC6A 2CLEB 1C80A 1ZXXA 2J5QA 1GGMA 1W2WB 3CEJA 1SVLA 2Q2VA 4MVJP 4RPCA 1JL3A 2OBSA 4TSFD 4CL8A 1GV0A 2CT8A 1G8HA 4ZVSA 2AV6A 2HBQA 2Q4DA 1RCUA 3TB6A 5DISB 1I8TA 3NMUF 2MDTA 2FU5C 3DVAA 1VL5A 1XTVA 4NJMB 4JIMA 2UXCB 1ZKDA 4JVMA 4URHA 1MVOA 3AY0A 4URYR 5DBGA 4CM8A 1T9DA 3CU5A 1C5KA 2ZVQX 2ONZA 2FB9A 3ZUGA 1NY6A 3G2LA 5EINA 2ZWOA 3IHTA 4NJMA 3FLMA 1ADCA 4Y7DA 3KOZA 2W5UA 4CKWA 4YJGB 4B46A 3I1FA 1KFEB 1BHQ1 2ZYWX 1W75A 3QG1A 4HGQA 4CMCA 4RTNA 3Q2OA 4XR9A 1Z34A 1G5FA 1LD3A 3TE7A 3U4GA 3JD3A 3H3FA 3CUKA 1JDTA 2NTEA 1A50B 2AZTA 1ZM7A 1Z2DA 2M98A 4O6VA 4A16A 3I76A 4RPIA 1UBMS 2IZ7A 3H9CA 4J94A 2D5BA 3AF4A 1VXRA 5IVIA 3NASA 1G5QA 4COKA 4DSOA 3DOOA 1B41A 3TEFA 3EYAA 1KY3A 3ASQA 3W5AA 3TR6A 2JA2A 2O5EA 1TU3A 2W6ZA 1GGHA 2WZDA 4QSMA 4TT3D 3TLXA 3BBLA 1P74A 4ZI7F 4RDHA 3DW1X 4Q3NA 4U7HA 4CEIA 1D2RA 3LLVA 4GM0A 1LSOA 5A03A 1X38A 3HJBA 2X22A 3ONEA 3JAMA 2HUPA 3F98A 4YAUA 3N7AA 2Y1XA 2AMJA 5M5BA 1DC5A 1KZ7B 4RFVA 3K70D 2MTBA 4OAQA 4LOAA 3BIFA 2FR0A 3TL6A 3D2LA 5ALGA 3L93A 4LDZA 1TYEB 1P1FA 4Y0VA 4F4IA 2E0IA 4CKZA 3ZY2A 1GR0A 3X1XA 4P5PA 3E7XA 2GM5A 3N8IA 3RYCA 1OUMA 1KR5A 2J09A 4HVTA 4JQCA 4ZP1A 3RS5A 3A6EA 3WRYC 4YC7A 1QRDA 3DVSX 1TM5E 3T7DA 3AEKB 2DBYA 1NSTA 1NUSA 3MHPA 1V25A 2EX0A 1EP1B 1NI5A 1W88A 3LQEA 4YV1A 1C2YA 1B6GA 3JSAA 3GPCA 5BW8A 5IK2A 3PEYA 1OFUX 4P25A 1FUIA 2RK6A 2AQIA 5K51A 1ZQ9A 1E2EA 4FI3F 2LR0A 4OH1A 2VDKB 2KS6A 2TMYA 1HDGO 3OLCX 1DRVA 2YYAA 4P92A 5JCOA 1U3VA 4XGRA 1AKQA 1N7GA 1F0PA 1VHLA 2QVYX 3G2OA 3REFA 4D7AA 1I7NA 4MUNA 1PS9A 1YR2A 3CSSA 1DKPA 3G8AA 3OCXA 1BXGB 1CB0A 1S96A 5KNDH 2IY9A 1YZGA 3HB9A 3ZOKA 2XLBA 3E48A 2ID4A 3VH4A 4AZSA 2BRUA 3ANYB 3VC2A 2WG1A 3GVHA 3MTEA 3R1IA 3DLBA 3DZCA 3OD5A 3TMKA 3LC2O 5ES3A 3K6SA 3OEWA 4HSGA 3QP9A 3DDNA 2FMIA 2E4UA 1IZ9A 2WB4A 1OILA 3U4HA 2HU8A 2XAAA 2HGSA 3BTOA 1QIEA 4AJEA 2AB0A 1QDUA 3F6YA 5THQA 3RLIA 3NHLA 4FKMA 2QP4A 3HEMA 1IK6A 3HNOA 3VHLB 4DHWA 1SXPA 1WZEA 1M34A 1WSAA 2C78A 2I6TA 1YB5A 3RHTA 5LLDA 4CEHA 4I3FA 2QD2A 1JFFA 1IHUA 3U3KA 1Q0PA 4L22A 4JQYA 1Q3TA 1V45E 3L6EA 4Y98A 4XQGA 4F85A 4M1QA 1D9XA 1XWFA 2ZUBA 2IA5A 2ZYUX 3GO4A 1Q91A 2Z2KA 2YHIA 3N8HA 4H7HA 5AI6A 1ZJ6A 2IP2A 1S02A 1OQAA 2J3KA 1DKRA 2AG8A 1HLDA 2VBCA 2Y27A 2WF5A 3IP9A 3L1JA 4I5IA 1N8NA 2HLDD 3E1SA 3G5AA 4JD5A 1TCUA 3PZBA 4AF8A 1YK1A 3MWFA 2ZRHA 1R88A 3PHCA 2ZWVA 3I3SR 4R5HA 2OXIA 4AJJA 4DCGA 2XYQA 3JAKA 4ZCPA 5AXAA 2KLHA 2IHVA 1MO4A 4JS0A 4Z4YA 4JT8A 4L72A 3VR0A 3BSSA 3GXOA 3PQ5A 5HWSA 4JHXA 1IONA 1CEQA 1CG6A 2BLNA 4G0NA 2HHCA 4D0GA 4DWWA 2NV2B 1MT3A 5A8AA 3MWYW 2OQRA 1E3SA 3MS4A 4MYRA 2R6DA 3D3KA 3G2MA 5H0IA 2V6JA 3ZH9B 5TIIA 2IC5A 3GXBA 1K88A 4H59A 4UULA 2PD6A 1QK3A 2YY5A 2HWWA 3BGVA 4MZDA 2X0FA 2NQ2C 3X3HA 1GZHB 5JROA 2C61A 1QE0A 3ASUA 4HQ0A 4RF3A 3ZXSA 1VL6A 1GUDA 2EG9A 4UVDA 2AVDA 1IEQA 4BVJA 3I2YX 2VJCA 1QBGA 4N5MA 1SHJA 4BJ1A 2JLVA 2AX3A 2ARKA 3K8QA 4AO8A 3WYNA 1P80A 3GLKA 4MRSA 1J5PA 1U0NA 3FVRA 4LF8B 4DUPA 2FRXA 2WEKA 1MN6A 1ZVKA 4ZYTA 4LDQA 3GJTA 2DY1A 3H19A 3Q2IA 1MX1A 4GOLD 3T6KA 1YLOA 1WJGA 4PVDA 4C7BA 5GIOE 1RWBA 1RQNA 1P5JA 3RUAA 3V8BA 1HTBA 3LGSA 3VH2A 5IPFA 2WIGA 3ANMA 3BSWA 3LZ6A 5JSYA 4FYIA 3LM8A 3NBKA 3CZ4A 5TRDA 4DMMA 2NIPA 3D0OA 4QE3A 3LLSA 5LZ8A 4XTRA 4ON9A 1GU0A 1GCAA 3UJ9A 3FPKA 5GONA 4EPTA 1JYSA 4O5AA 3ULKA 2B34A 3BM5A 3LX5A 2Y6VA 4DJEC 5KWIA 1P4HA 1QKKA 2HRCA 4L9WA 3P9IA 3PUWA 4W1RA 5FQOA 4BU1A 2HU5A 4R1QA 3AF5A 1ZNXA 4P36A 1YRHA 1WXXA 3DMYA 3PA6A 1RAFA 3PXUA 4KAXA 1D2CA 1DUVG 3VJRA 5A2QA 4K03A 1DEXA 1D5CA 3OBIA 3GVJA 1E59A 2G0NA 2P69A 2Q0HA 4KFRA 2Z56A 4V0KA 4AI6A 3PJDA 3V1UA 3DL0A 3F8WA 1NE7A 3VQTA 3MXTA 2EOAA 1SCKA 2JFBA 4NCXA 1R4MA 4FR5A 4HUQB 4Z4EA 5AKHA 3ND6A 3CKMA 1N06A 3P9XA 1J0DA 5KTTA 4S0ZA 3ROZA 2VP2A 3ZS8A 1NMEA 2VUUA 1F60A 3PKIA 3R8CA 3ML1A 5IT5A 2CXPA 2BELA 2GDJA 4P7KA 3JQRA 1SXGA 3D4NA 4XJSA 2HK7A 4UM9D 3AEZA 2D0OB 1WHTB 2IOYA 4CQJA 3BA6A 3HWWA 3ISVA 4OBWA 4EAQA 4PINA 4DZTA 3ZHZA 2Q4BA 1Q81D 2R00A 1L8XA 4K6HA 3ZE6A 2Q49A 3QELB 1R9JA 5D01A 4BFUA 4ZICA 1DBVO 5H81A 4EYGA 4AULA 4QYXA 5IN4A 2A1UB 5KNDA 2VHYA 1HZEA 1BU5A 1RYFA 1E1NA 2DT8A 2X0DA 2OAEA 2CDRA 2FZWA 3LRPA 5K7SA 3CCUB 4W9NC 2GXUA 2VTEA 4FXUA 4NZ9A 4QFMA 3AHGA 3A2LA 2GPYA 1AQ6A 2PUDA 4RZQA 3QPAA 2ZQ5A 3KJFA 4DYVA 1DCTA 4OI1A 3GUYA 5JS7A 1GO2A 2J0VA 2LW7A 3AYZB 4RTLA 1SNYA 3CNQS 4R7GA 4M88A 1PLKA 4IDAA 1PBNA 1NTOA 4JLDA 5A9RA 1F20A 3PLRA 1ZW6A 2OILA 4AMBA 3VNBA 4EHJA 4ESHA 2J0UB 1JEYB 4MUYA 3IQFA 2RI0A 5G41A 3SC4A 1N57A 5ALUA 1Z6XA 3FGZA 1EAYA 4IMPA 3WLOA 4Q19A 2O2XA 2NT4A 4NZYA 4F1WA 5JYDA 1ANKA 1RRFA 3ICCA 4DIEA 2Y1WA 4CV0A 1OXKB 1VQNB 2CHFA 4R69A 4QTXA 1V1JA 2YOHA 2YZGA 3HUEA 5ECDA 3DEHA 5F78A 5B1SA 3ZKAA 1QIHA 1SOAA 2JEYA 4BVFA 1FSPA 3C5WP 3UTDA 4IIBA 1SURA 1B8PA 3UANA 3M82A 3KS9A 3OFJA 3CXRA 5DOZA 5REQA 1KP9A 4GNRA 3SMQA 3UK2A 4S12A 1XP5A 1VFNA 4OHRA 2GASA 4ZT5A 3SC3A 3EG5A 5EFZA 4C01A 4QDJA 5ER6A 2W2LD 3PCRB 5DNAA 4Y2XA 2VP0A 1HQYE 4Q3KA 2HYIC 2GREA 1P3JA 1GTSA 4K5QA 3C7DB 4L75A 4HB4A 4ZZ2A 1VHOA 1I0IA 3SS8A 2PLNA 3CO0S 4OI2A 4XH9B 3E70C 4HEJA 4M0KA 2XMZA 5G0VA 1QGDA 3NEAA 3UNXA 2IU3A 3GD5A 5LQNA 2AWNA 3OFNA 3PICA 2QA5A 3FOEC 3BH6A 1KDYA 1A76A 2VUTA 3A6LA 3DZBA 4NMHA 4O4HF 1K28D 2BKVA 3RF6A 4RCZA 2PZLA 1VHQA 2O59A 1VHTA 3E15A 3K0CA 4RE5A 1HEUA 2DP4E 2C8LA 2I03A 2WMNB 3PNOA 4N40A 5HM8A 1M90D 4DDUA 4I1VA 1SIUA 2I1VB 4JI5B 4OHFA 1QU2A 1BS1A 1U0FA 5AW7A 3WLIA 1YZVA 2CWDA 1EVJA 3UJCA 4H6WA 4BOYA 1DXYA 4Y6GB 3A7DA 3AJDA 5KU7A 1CERA 2FW8A 4E5SA 3HVIA 5E4JA 5L3QA 3LX4A 1CJKC 2ZKLA 4ZYLA 2XYVA 3OY2A 3G8BA 3ADBA 3E35A 3Q9UA 2BR3A 5EUBA 4BAGA 3DLAA 1Q14A 2E7ZA 4JR2A 4LYHA 3RYHA 2FUEA 4IZHA 1WMAA 1Y1PA 3GT0A 4MCAA 1QFYA 1XPOA 5A4FS 3HVRA 2IYUA 3K8OE 4OXRA 4LOJA 5KNBA 4JR0A 4F9FA 1HLGA 3W90A 2VP6A 2FDRA 1RRMA 4YIHA 1O58A 3BTUA 3C1UA 3QNUA 3INTA 5B6PA 2ZRFA 2X5JO 3ZU3A 4EK9A 1QTRA 4OP3A 4GGPA 4U7JA 4DA9A 1NYQA 3JQAB 1OW3B 3AXTA 2MU1A 2YWFA 1C7RA 2DBVO 4DDVA 1GWNA 3PC4A 4LVUA 4PO3X 4H0CA 1BW9B 3PITA 4BX9A 1C4WA 5JYEA 1KOFA 4E11A 1KP2A 1NXOA 2B5OA 1YJBA 3NB0A 1PV2A 3U81A 3R9WA 2NTVA 2FW0A 2YYSA 1NN3A 3HJRA 3KR2A 1P7PA 3DE2X 3UWKA 3ZCQA 3GRYA 4E5KA 3O8OB 1FW8A 2XUFA 4U9UA 4LCJA 5C1OA 1MHTA 4O8CA 1GIAA 5DHTA 5ALLA 3S99A 3IB3A 1XMXA 4MYUA 4OUDB 4UM8B 4PU0A 4QATA 3DAOA 1MJ5A 1O95A 1G9SA 3EXHB 3KZKA 2RKBA 2A84A 2P5YA 1JHYA 2CHGA 2R00C 2MINA 2FZ4A 3GFSA 4LHEA 1U6IA 4RVNA 1YFKA 3N5CA 4I9FA 4I9HA 2CUZA 5AHWA 1F14A 3BMOB 4DCTA 1NT2A 1TAQA 5KUTA 3ESCA 4P5EA 3KE9A 1KYWA 1NGSA 4DUGD 3O03A 1YULA 5CGZA 1IZ0A 3L46A 1E7QA 1VGQA 4JLPA 1IWPB 3G02A 5B30A 3KOXA 5JEEA 2CL6X 4TKVA 2ZRAA 4JJIA 2DUMA 3QX8A 4MKXA 3U26A 5CURA 4BZZA 1Y8ZA 2Q6KA 1FLAA 3W2IA 1CW2B 1HG0A 3QKTA 1K5PA 4UU1A 3PUYA 4RTJA 3F73A 3BNWA 3TCXB 5BVHA 3NBMA 1PJ6A 5ARCA 3TZKA 3DS8A 4TTSA 2F1KA 3WY9A 1GZVA 2RIRA 2ZAYA 4D25A 3MTBA 3Q38A 3TLGB 3IEVA 5B5SA 3EHEA 1X15A 4MVJF 1X87A 1PGJA 3AIMA 4BUZA 1ABFA 2GS9A 1NSFA 3A27A 5DV9A 5JXGA 3BK1A 3NT4A 4ZQFA 1WD7A 3WSWA 5EKXA 1G55A 3P9KA 1B3RA 5BSYA 3A37A 5AI0A 3ZJ5A 1SZDA 3MWEA 2GM4A 2A5LA 1G20E 1KJWA 1T5SA 1A7UA 1P2GA 3AR9A 4BE4A 5BV7A 1UPXA 1BWSA 2VDVE 2W42A 2AUMA 3IX7A 4X7MA 3OCYA 5EWLB 2WINI 3LBYA 3Q4GA 5CIWA 1JLKA 2D59A 2RBEA 5EE0A 1R5BA 2GJSA 3OTIA 2C7RA 1DV1A 3OFSA 3KB1A 3RHSA 4P81A 5T64A 3T1NA 3U1TA 2DOKA 1AS0A 1E4EA 4TV9B 3RV3A 1A8SA 4BNZA 2YVUA 1U3WA 3Q1KA 3F8TA 3HACA 5J2TF 1RJGA 1IEVA 1NXXA 1TUGA 4NBLA 3NG1A 1DU4A 4J2OA 1O4VA 3BMOA 3CZQA 9MHTA 5FLYA 2GZMA 3FR8A 1H9AA 3A0UA 4KUEA 3M0EA 5L46A 1JXOA 2HRZA 4FWBA 4D4GA 2IPAB 4DREA 3KCQA 1UQRA 1UXOA 2UYCA 3WWOA 1KYYA 4NCKA 1OZAA 4JBXA 3FHCB 1QQ7A 2AR0A 2PH1A 2Q3FA 1YX2A 3PS9A 2G63A 2FQWA 3JRNA 1NDQA 2R6FA 3FNFA 4FNAA 3TW0A 4YCCA 2G7ZA 2HUNA 2IDJA 4P31A 3W3ZB 3W4JA 1SUFA 5FADA 4AROA 4P1VA 1TYAE 3H5OA 3PEEA 3WWPA 2LCQA 1QIDA 2JA1A 1QYVA 1CY7A 2B78A 4MWZA 1Y6RA 2LTAA 4N0MA 2X7JA 3Q7SA 1STOA 2QLFA 1L5RA 2CNNA 3HYCA 2CNOA 3HV0A 3T34A 2IHNA 1NVMB 4X07A 5TGDA 3K71B 4AX4A 4FC7A 2VOEA 3O8QA 1CDEA 4UTNA 3OJXA 1A7KA 5T67A 1VE5A 4KQKA 2O2SA 6ADHA 4EYOA 2XQGA 5I51A 1T1RA 2EVWX 4CETA 3WKCA 1R0BA 5DO9A 1ZIYA 5LYJB 3KYIB 1SHUX 1HRDA 3VR1A 1YJAA 5C37A 2MR5A 2Q0SA 2J46A 2PMFA 2R79A 4AQYB 1R0WA 3GFRA 8ADHA 1UJ5A 1EEXB 4Q02A 2BFOA 3PE4A 2QW0X 1KORA 4FQ5A 1N5MA 5AJXA 5DLQC 3ID6C 2Z0MA 2GXSA 3GRZA 5TY0A 2ODWA 4MKRA 3VDXA 2Z30A 4IIYA 1M5TA 4X93A 1N08A 1JKMA 1I3CA 1Q50A 3GRVA 4X7FA 1K2VN 1Z45A 1R15A 2Q3DA 4RVGA 3WFZA 4DLNA 2M6SA 1WSVA 5KHOC 1A9ZA 4B6FA 4C7OA 1A9TA 3I83A 4LQ4A 4NDAA 5T5QA 4BBPA 1NUTA 3TW6A 3G1WA 3MWDA 5AKLA 4KAJA 2PS3A 3UQYS 3JYPA 1YBMA 3GAAA 1AQIA 4AIIA 3FIUA 5AHOA 1Z0FA 2Z9CA 3EBPA 2XXBA 1B0UA 1XU7A 5BNZA 3PVCA 1A8IA 1JHXA 3P2YA 3U48A 2BM1A 4FNGA 3UCXA 5JC8A 1JTEA 3REQA 2HMAA 1T5IA 3EVZA 1KXJA 5E2AA 5J1SB 1U9CA 2W6NA 2GHIA 2WKWA 2X2PA 4QASA 4Q4JB 5CB4B 1FJXA 1T1JA 4M8SA 1RJ9B 2AG0A 1ISJA 4BV3A 3F7MA 1PJBA 2AOXA 2XQFA 2CXNA 5L51A 3DCJA 1PAUA 2IXFA 4H3KB 5IJ0B 3NC4A 1X77A 3AF1A 2FEMA 3P96A 2XLCA 1DWQA 3PFIA 4MQEA 3ENNA 4Q48A 3UFXA 1QQBA 3R3HA 3GEMA 3UQZA 2AVNA 4O2RA 1W0CA 1DMSA 3WLJA 1G9TA 2V1UA 1FSSA 1T35A 3LNCA 3DMPA 2AC7A 5DS0A 3IAFA 5DMXA 1DEKA 4M1MA 3WGIA 4W63A 3KDPA 5IF9A 4XD7A 1P9WA 3CCJB 3L8EA 1EFVA 3AUYA 3CKKA 3MQ4A 3OOJA 2DCMA 4MWGA 3KG2A 5EP1A 1P4GA 2GH1A 4UDOA 5HK9A 4TKOB 4DLSA 4J4BA 4NRDA 1C7QA 1V5GA 4PFQA 1U5CA 2DH6A 2FPWA 1GPJA 1JVSA 1K5DA 1TB4A 1YE3A 3IPCA 4PAOA 3WWDA 3SEFA 2YJ3A 2H0AA 1OKKA 3G5UA 4DC1A 1WIWA 1E5QA 2PSJA 4PAQA 5LP6B 1Q44A 3CF0A 4FB5A 4RM3A 4KG7A 1KETA 4YECA 2H9AA 1KYZA 3DLCA 2QMHA 1IN8A 3VDNB 3LSYA 4BLRA 4B87A 4GIBA 3FBTA 4Q21A 4YRJA 5B3LA 3KSAC 1E9RA 3C3AA 5CFNA 1NVGA 2V7PA 3QVMA 4MW4A 3V1LA 4CTOA 1XQWA 3SQXA 1Z17A 1N5LA 2ADFA 2WP0A 5B2EA 2QN9A 2A5GA 2OBYA 3ER6A 1P39A 4JB2A 4MPPA 2X7HA 2FPGB 4UTOA 4CGYA 4HE5A 5BYBA 2IYQA 3HU3A 2GFQA 4TVSA 5AVXA 2AHOA 2ZXHA 4O1HA 1Z6AA 3ETLA 5H83A 3W77A 4F4HA 4R6WA 2PMBA 4DFDA 2FW1A 3RNLA 4XB6B 1M1NA 1OV6A 4IDDA 4MTCA 4A0QA 2ZIZA 2HREA 3O1IC 1SELA 1TCAA 4YA6A 1N3IA 4YQYA 4YRSA 4KTVE 1YVEI 2F1HA 2OZLB 1MNQA 3DNFA 3KYJB 4F6RA 5IXJA 4HI0E 5KQMA 4H18A 1KTVA 4UAVA 3OZEA 3N87A 3GUVA 2BHSA 3OKCA 1YRWA 2AJTA 4JUAA 5AUPB 3PXAA 3WXBA 4R41A 3DZGA 3CNBA 3R4CA 2HGZA 3D8RA 4U2FA 4MQMA 2KWIA 5BNFA 4O02B 2FRDC 5KNLA 2YJTD 3BKWA 2ZSUA 1E1KA 1B4DA 1KS2A 4W9MC 1O9HA 3D5TA 3TRFA 4UUPA 4C14A 2FJPA 3WK5A 1DBPA 3E9CA 1C30A 3RFCA 4BN4A 5IAOA 1XZQA 4R83A 3CCVB 4R8VA 4YO7A 2P30A 2R60A 1K98A 4JHLA 1V4BA 3O94A 3ENKA 4GAEA 4QGAA 4BNDA 3T41A 4JNCA 4AY5A 3FNBA 4HRVA 1YGPA 2PMCA 3KVNA 3LP5A 3FMIA 4BVEA 4DQUA 1KGDA 4UXJA 1VE9A 4Q1EA 1BXRA 3AHJA 4CJXA 2GZ1A 3FB1A 1W76A 3NBFA 4GKJB 4CTKA 4EHIA 4YALA 3HJHA 5LJLA 1XELA 3ZD8A 4CMKA 2YZNA 5EPOA 1WXGA 2B2CA 2FZGA 3UATA 4D3DA 3GLSA 4O4HA 5B37A 5C81A 5JBNA 3OKPA 1KMCA 4OXIA 2YZ2A 1B1AA 3SFZA 4GO1A 5HZGA 4RIIA 4JYBA 2H7VA 1I24A 1W85A 2O4CA 4IXWA 4FT2A 1ZU4A 4L9RA 4TVOA 4PRKA 4OHWA 4Q1AA 5B3AA 2GZ2A 1EPUA 1EVKA 1GD1O 4GVLA 3RC7A 2WD8A 1APBA 4HAZA 1EKXA 1UD5A 1DWOA 3PHBE 4BWVA 3U49A 5LZ9A 2VSQA 1E6CA 3G5LA 3LIIA 4L5BA 4YJ3A 3CVOA 4CL3A 5JHGB 1VRCA 1XMOB 5F98A 3PQ7A 1LW6E 1VPEA 3GFVA 2A3RA 4QQ8A 1EAMA 3ORYA 4YJ2F 3A35A 2P4EA 4YR7A 3MLAA 5KQPA 3K9WA 1IXZA 2OCXA 4CI0B 1S2GA 3U7QA 3ONYA 3L6DA 3WO1A 4Q7KA 2CB9A 2F3RA 4UHHA 4WESB 4C3VA 4YS6A 1XJCA 2OCIA 3T53B 1KZ6A 1T5TA 3MEQA 4IIXA 3U9LA 3FOZA 1QZUA 1BHO1 2QGZA 2V4UA 1M2NA 3H8WA 4WLUA 5IM4F 2ZBRA 1RZRA 2KBEA 3GEGA 4A23A 2VNHA 1CS0A 1Z62A 2I7VA 2P4SA 3H2YA 4BATA 4L27A 4UBMA 4HL6A 3V2IA 2ZT6A 3JWEA 2GN8A 1CX9B 3NUQA 4FFRA 4J0JA 1HQCA 2PX4A 2Z3WA 3WWEA 5M2QA 3PEWA 1YU9A 1WWKA 3P4UA 4QYIA 5LUAA 5C1PA 1R4NB 1RWVA 2GEFA 1LPNA 4L4ZA 4IXMA 1NMXA 2K6GA 3GMDA 4ZRMA 3AI2A 3RJMA 1N6RA 3TMYA 1TCBA 2IYWA 2XE7A 3KWMA 4G1EB 1M73E 1U8FO 4ARUA 1WW3A 4YT5A 1OYVA 4F1KA 2CVZA 2VCEA 2ZT8A 5JZ9A 4YCMA 4M55A 1JTFA 5KYWA 4DR7B 3E1KA 3DLPX 1U7OA 3L8GA 4B6PA 4UHJA 3PHLA 3B13B 1SUPA 1II9A 3R5TA 3I2KA 3MRSA 5A3JA 5BMVF 4CLOA 4GD3Q 4JLSA 1P2BA 4B4OA 3QELA 2VRWA 2Q2QA 5J2TA 1U2PA 3D3WA 4D26A 4OQEA 1ORRA 2V7VA 3FDZB 4DCUA 1RAIA 1Y1TA 5LR6A 4WY2A 2AFIB 2H9IA 5CDTA 2EW1A 4FGKA 1W5AA 4INZA 4U7PB 3G9TA 4UNRA 4GFDA 3K7EA 1JEDA 5LYYA 3V55A 3A2MA 2WRZA 1K5HA 4YPFA 4DJ5X 4HDMA 3QKUA 1OB0A 4YRDA 5A7GA 3VAAA 2XCRB 3UHPA 3DEKA 1JI3A 3TQQA 1XTJA 3ENVA 3OFND 4NMMA 1DP4A 4LF4B 3ZC3A 4GXQA 5ALYA 2F9MA 1P81A 4A26A 1F8FA 4WJLA 3MERA 2QUBA 4RESA 5C7OO 4IL5A 1ZEMA 4NBKA 4UAUA 1L9XA 3ASPA 1CCWA 2QJFA 2XUDA 1XJ0A 3L0ZA 2OGZA 3C7AA 3NC1C 3VPCA 3VYRB 4DILA 5JAZA 2AFRA 2FGJA 2GD0A 1V7CA 1ZD8A 4FBGA 6Q21A 4LHVA 1DX6A 4OGGA 2J7KA 5ELXA 3H5VA 1Y7LA 2EX1A 3AI7A 3EB9A 1ZUWA 1UPTA 4IGKA 2VDQB 3ELWA 1X70A 3BN3A 5HP4A 3BORA 3RIXA 5KTPA 1N1MA 2OBLA 4N0QA 3KFVA 1JDSA 1JF8A 1MG0A 1HLFA 5JLJA 4K8OA 3RVBA 4X91A 4QXAA 1E9AA 2FN3A 2GK3A 4A5SA 4BO8A 1AGNA 1U3TA 2QE6A 2GLUA 1ZUNA 4WMLA 5JJ5A 4JUCA 1VE1A 1U1CA 3BRQA 4N5LA 1N4AA 3W6PA 3C74A 1ZL0A 3CUSA 3COPA 4IMRA 5DM2A 2W0MA 4WLNA 3HN7A 1XZNA 1GZDA 3VSDA 2TMGA 2W9XA 4LMAA 4BMPB 3HVJA 1UPAA 4LNAA 4LYEA 2XMSA 3LS2A 4JLVA 3RT1A 3IBSA 2Z2ZA 2O2JA 5TS3A 4DWOA 5CDYA 1LJUA 4RWZA 2G1AA 3I9KA 3BL5A 2IP1A 2EFCB 1EBBA 2PUHA 1XFOA 1C1XA 3O83A 4ZU1X 5IZCC 2PJDA 1DJQA 5BT8A 3S70A 2D7CA 4FOPA 2CXQA 2NYAA 1VLVA 1P18A 1WXIA 4OMDA 4DGQA 4EY4A 1OXSC 4C05A 3CR3C 4DM3A 4E3ZA 2P9ZA 1WOYA 4LRSB 3RTGA 4R16A 3WLHA 4U7DA 1KYXA 1KQFA 1RVDA 2YHSA 4MTLA 4X54A 1AHPA 4K9SA 5AK3A 3CISA 2XBLA 1GSOA 3DDZX 2QUAA 4UOZA 5IX8A 3ETCA 2FSGA 1JBKA 1V11B 2WWTA 4DLRA 3A1SA 4LMRA 4LZAA 4PHHA 4Y1GA 3WADA 5CYPA 2IF2A 4HPWA 4OJTA 3BFXA 2IH2A 3A3NA 2JK0A 4PC1A 1CFZA 1KDPA 1W5TA 1T5LA 1TF7A 4OA5A 4R2MA 3X2EA 1FIUA 1RW4A 3CINA 3ADDA 5BSEA 1BEUB 4I9NA 4YJHA 5AI9A 4OHBA 3OZIA 5I8WA 3R6JA 1ZJZA 2CVPA 5BPHA 3CESA 4O5OA 1NE2A 1D2GA 1MGPA 1XCBA 1YQUA 2O23A 1OOEA 3RH0A 2OXTA 4HZIA 1CJBA 1FP2A 1WY5A 3B3JA 3P5BA 4MR8B 2GPBA 4R1UA 3DNMA 4JOQA 1A4IA 1XRRA 5BVGA 4RTOA 5LZ4A 4W7IA 1LBIA 1LBTA 2Q21A 4H1HA 4EFMA 1YDWA 3MGGA 1C8KA 4YEJA 2QTZA 3LDGA 3Q3VA 3UPUA 2Q9AA 5FB3A 3T8YA 4KKUA 3L49A 2Q5IA 2YV3A 3LTEA 4JIGA 2LWIA 1OBCA 4YJFB 1ECBA 4D79A 4EW2A 1WVGA 3HO8A 2XZPA 1INLA 3VR5H 3VZBA 4F93B 1D03A 4S2EA 4BVKA 1CUFA 1PZHA 5AQ1A 1SXJD 1UJ4A 1XAGA 1G59A 4ISCA 3NHBA 4H77A 5K3FA 3ZNNA 4C20A 4I50A 4EJ6A 1A2BA 4G0OA 5A04A 2FV8A 3JTEA 2OLEA 1OYWA 3ZDRA 3SKXA 4CQNA 1OH6A 1CIJA 1J07A 2B2NA 3QM1A 4TLAA 2CHQA 3WQZA 16PKA 4IUBS 1JALA 3NWBA 4TPKA 2QRHA 3LX6A 5LZ5A 5ECYA 4CMEA 1XPUA 3RWMB 1NOKA 1W8DA 2OLKA 4EABA 1FMCA 3IXMA 3K1TA 4ETWA 5KKNB 5L45A 2B7CA 3U09A 4OLBA 2F43B 1HDXA 5DXJA 3C6KA 1OCEA 4KH0A 2RH4A 3UK1A 1NIJA 5ILGA 5CG1A 4KR2A 4D44A 1IBCA 4MA5A 1LVHA 1AQLA 2G40A 1PT8A 5E95A 4QM7A 4YNBA 4R2LA 3CKYA 5PGMA 2QRGA 1VJ1A 3IOYA 1B8VA 2NO6A 3HE3A 4LDJA 3CLVA 2FYTA 1ZUNB 1G2QA 1Y6QA 2DPLA 2ORVA 4OQYA 5KVSA 3AEKA 1Z7GA 5CA0F 3ND9A 2DMRA 5BVHB 2A67A 3LIPA 1DAMA 4ZC8A 1LSSA 2J85A 3RYCB 4M38A 1SC1A 2QUJA 1U8UA 3OM1A 3FNRA 1FFXB 2ODEA 4R51A 1MIOA 5K0CA 3PWSA 1RQPA 1GOTA 4A1OA 4W5JA 2FUG1 1N9GB 2DFDA 4QQKA 4NHOA 1EFLA 3IOBA 4JOCA 1JMYA 1S8NA 2J7PA 5TEVA 4KMOA 3PDUA 2O7QA 3WK6A 2V3VA 4GSLA 4P2GA 5FA8A 3MJVA 3KAKA 4BDTA 3BWEA 1AGRA 2COEA 3LI2A 1GKLA 2AG5A 1BX1A 2BPOA 1JP7A 2BZGA 5AJVB 4PG7A 1R9NA 3V2HA 4AD8A 1NT4A 2MINB 3NETA 3ZBTA 1A8QA 1RQXA 1EK6A 2FRDA 3EUFA 2XCUA 3VPXA 1YVUA 3R9XA 3ADCA 3LH5A 4Q6WA 3A8TA 1PEDA 2PBRA 3AUUA 5F4MA 2GMWA 2X40A 3IA7A 1KFCB 1KOLA 3S68A 4CTMA 1ECFA 2QVLA 3WL4A 1UBSB 5JZSA 4KREA 4XI9A 1MB2A 2P67A 4D41A 2OHFA 3NM5A 3SP1A 3C3CA 4LXIA 1Z4JA 5E9QA 1QNLA 2FUCA 3T4UA 2OQ2A 4HWRA 1GG5A 4L0MA 1QAMA 2C88A 1GYPA 3KXPA 2P6MA 3CNLA 4NEHB 4R4JA 4S1PA 4IM7A 3CZPA 3H9UA 3TIFA 5I01A 4RHCA 4V1CI 1MUUA 4CM9A 1C1YA 3VO2A 2ECQA 1A04A 1E5LA 1F4VA 1VMEA 4LHZA 2P2DA 1R4NA 2VQFB 3QE2A 3WQHA 3NCTA 1DDOA 3DMTA 4GR5A 3OEYA 4AXBA 5KX5B 1FMLA 1W87A 2VH1A 1E2GA 1VCMA 5F4BA 5K0ZA 1QP7A 1BXRB 1OTHA 2ZE7A 2BKXA 4ZXFA 1QH0A 1L4UA 1V1RB 1XKQA 4IDCA 2ZAIA 1KOGA 3GAFA 2I3ZA 1DJMA 3IPYA 4PLFA 2X1HA 4EA8A 3LPMA 1E99A 2GZAA 2B3DA 2Z4RA 4XCQA 4MR7B 1JHMA 1F8UA 2W7TA 2B6HA 3EZ2A 3UPDA 3UTCA 1WB4A 5C1DA 2FCAA 4FZ5A 2LGJA 3T7TA 5KS2A 2VYVD 4X7BA 4XUDA 4BNVA 1KO4A 1MO2A 3ZIAA 4WZLA 1I2ZA 2GM3A 1NX6A 3MJ4A 4IJ6A 5AVZA 1KYTA 4J0IA 4LZPA 3RAFC 2H57A 5C4IA 3L84A 1DCMA 1SBIA 2F1JA 3MTQA 5JPDA 2F3PA 1N1GA 4P9NA 4Q4AB 1JDBC 2O8BA 4GQAA 1E8NA 2B1IA 2QTTA 1ZK2A 1W94A 2GCIA 2NUAA 3BWCA 2ZP1A 4HG2A 1SU8A 4NNPA 4RU1A 1VYHA 5LQKA 2GK6A 4GGMX 1XZHA 3ZWCA 3KP1A 3B1YA 1LSUA 4GP6A 3OKXA 4G5OA 4N18A 4G9BA 5C0OE 4TLDA 4DLVA 4J7CA 4WKCA 2AMFA 3S81A 1I1OA 4RF2A 1PGQA 1EUQA 5EFOA 2QX4A 3R3XA 1XA3A 2ZL6A 2WJ4A 4IO0A 4ZVLA 3HXQA 2AK3A 3G6WA 3NHRA 1BVHA 3FDIA 1UR5A 1PL6A 1E6KA 2CBXA 2BSXA 2HWKA 3M5WA 1M2HA 3A9RA 3LLCA 4ND6A 4R8SA 4UVHA 1SUDA 5DVZA 3NRJA 2C7PA 3K09C 4KKVA 5CBPA 2IQIA 3SMVA 1PVDA 5KNCH 2ZRJA 4D57A 3ZCVA 1TZBA 2ZB8A 2C5HA 4G4SO 3ETEA 1GXSB 1AU9A 1K7SN 1E1LA 4JU8A 2ZJ7A 2OYCA 1DG1G 1LLDA 1WP6A 1NRWA 3DOJA 4QG7A 3SKBA 1R74A 1QE5A 3BE5A 1VECA 4H7KA 4PW0A 4RK1A 5DHSA 4DBLE 2UYGA 5MHTA 4GYWA 3QMWA 4O4IF 2HR1A 4KN6A 5BUZA 2O54A 1T2EA 2QNBA 1R12A 2ZLBA 2ZRGA 4P5DA 1XQ6A 3EHDA 3EZ9A 3QVTA 4P86A 1JG2A 4E2XA 5LIPA 1TT7A 4ZT6A 1KIAA 4HNTA 3OE1A 4EI9A 1QPBA 2XMGA 4FWIB 3IMGA 2OMKA 3C2QA 5FI5A 5BQ5A 2ZJZA 1MABA 2XHEA 4AX8A 5C4GB 3BDAA 3HKBA 1J0BA 1TEVA 2DVMA 4E0BA 2GZHA 4BYGA 4EHNA 2YVAA 3WMWA 4PPFA 5BSXA 1L5FA 3HZHA 4EGCB 5C35A 4FFVA 3NLLA 2IHJA 3ZVLA 4ZN6A 2WTUA 2J48A 1O08A 4AZTA 5FNVB 1XZLA 3VOSA 4TYQA 4X00A 1T5DX 3WKEA 3BSYA 2M6RA 1EDDA 4NIMA 1ZK0A 1VJCA 1J5EB 5E6RB 4RA9A 1XRJA 2ZSJA 1NI4A 1NJ6A 2BTQB 4V0ME 4MQUA 2I6XA 4YJKA 3T5DA 3ZWVA 2HRQA 2D13A 2CV1A 2WMYA 3ELBA 3L0SA 1CK4A 2P3MA 1XTQA 2MSNA 3IQGX 4G0VA 4FFSA 2JJ8A 4PZDA 3D6FA 2XUKA 4KFTA 4YLEA 2F17A 1GKYA 1G8FA 1N5DA 1SUWA 3KZOA 1ZA1A 3VR4A 5CTJA 3WDLA 3TG2A 3I9JA 1UC9A 5B3JC 4QAQA 3I5YA 3E3LA 2EGHA 1UXGA 4IAOA 4OAPA 3V4OA 3OBBA 5E9JA 4HEHA 1V71A 5JFGA 4NYMQ 5LNK1 3COYA 2HM7A 4PBSA 1QAOA 4WFKA 3VSBA 3OTGA 4KSYA 5IBRA 5C7LO 1E1CA 4FFMA 4RA6B 5KYNA 1AZSC 2IZ1A 1SEVA 4HWKA 3C6MA 4B3RB 5FPYA 3T1HB 3BWVA 1Y9EA 2GM9A 4Y6PA 1OZ0A 1A4UA 1P19A 1GTL1 2H1SA 2JHPA 3F7NA 3CPEA 4L0CA 3T7SA 2WHQA 5G0SA 3STVA 4XVQA 1WDTA 3I9OA 2E9SA 3B1WA 2F3QA 2YHBA 3DZHA 5L7YA 3WTCA 3I6BA 4C0HA 5GONB 1G17A 1YASA 5F9MA 4Z1MD 4YQFA 4Q1DA 5JXHA 5KWEA 3IT2A 3ZCXA 2BEJA 4L6IA 5KI6A 4W6ZA 1WLYA 1JFLA 1QBKC 3B1JA 3EQ2A 2AUNA 4FMPA 4KGVA 8LDHA 3U13A 3HI6A 3IT0A 1PJTA 4WGGA 2VAMA 1J4AA 2B4RO 1E32A 1ZOSA 1G42A 3A1NA 1RPZA 2XUQA 1CRQA 3ZDXB 4GE0A 5FAXA 1H23A 1VIDA 3KQPA 3WQBA 4ZGWA 3OZTA 5GV8A 1M7GA 2O8FB 4KRXA 2MMCA 2IUEA 3X1MA 2JZOA 4GMFA 4YX9A 3GCXA 2C4MA 4EUNA 4D5GA 5TMPA 1DC4A 3GPBA 2OZPA 3N8GA 4Y1RA 3K53A 1EG2A 2OB2A 2PSEA 1UT5A 1JIUA 4FYJA 2P35A 4G1VA 3DHEA 2PWBA 1WCXA 5J3OA 1ZBDA 1LRKA 2EJTA 3RRYA 1IH8A 1T5EA 1NMQA 4B3BA 1PT9A 5KMGA 1VJTA 5CX4A 4XLAA 5ED0A 4R8RA 4U6QA 1N1EA 1AOXA 3C6ZA 1IL0A 3T94A 3X44A 4CMAA 4MZXA 3F3YA 4L4RA 4DM7A 4U2EA 5J4YA 4LDRA 5JVDA 2F3TA 4WNCA 1J8QA 4I5EA 3KHUA 1QH1A 3AP2A 1YA8A 3PHIA 5G53C 1RM3A 4ZD6A 6LDHA 3TKAA 2XKJE 3A2NA 3RKUA 4OKIA 4W1PA 5CVCA 3TPZA 2R66A 3D8BA 2OV6A 5F4OA 3HDGA 3SSNA 1EQ2A 1FVHA 1OWPA 2IOHA 2QSZA 1ZITA 3B3FA 3C1AA 3EF1A 3EZFA 4JBHA 5ALJA 2DTDA 5F12A 5F1OA 4BS9A 1HE8B 4MMYB 1P4RA 2FFJA 2HC9A 3IOCA 4GLLA 1D09A 4JODA 5CJPA 2O8VA 2VNJA 2OVBA 4YRNA 4C2TA 1QR6A 4BWFB 2HDHA 1PZFA 2A57A 4P80A 4X61A 4ZKDA 3GQVA 1KH3A 2HLNA 4OAOA 4ZZ1A 4ZJUA 4NDNE 2ERYA 2VDNB 4MUIA 1PFYA 3RVDA 1RLJA 5AM2A 3A6PC 1T8WA 2IYPA 1S2NA 4XLZA 4HQOA 1Y9ZA 2CK3D 1TQ8A 2V97A 2GAOA 2NUAB 5E1BA 1H5QA 3QMMA 3PFWO 2AMVA 3E9QA 4XN0A 3D4IA 4H60A 3OLZA 2H7XA 5KDDA 1UK9A 4MYHA 3OP4A 4LIPD 2H51A 2QN8A 1VKRA 1NB9A 4IBOA 4FCTA 1JQJC 1SA0B 5DNVA 3V33A 2FX3A 1LW7A 5FEUA 2DPMA 4AS2A 4C43A 1E2BA 3BIOA 2NQTA 1XQYA 3K6SB 2GK4A 4OBEA 2LUOA 4MWEA 3MGKA 4N12A 1ZMXA 2FQXA 3SM3A 1L1QA 1BXZA 1XYVA 2QJRA 2IV2X 4QRHA 1TTQB 1HE3A 2GCOB 1O6ZA 4TSKA 3LXMA 1JU9A 2NYUA 3MUNA 3I1JA 3LKBA 4MLDA 2NP6A 4ILEA 4C1BA 1NF2A 5H68A 5JANA 4MV1A 5KYGA 4R71A 3IHLA 1PGOA 4X8IA 2R47A 4KJXA 4A27A 4AJNA 2VK1A 3GVLA 4MDEA 1TMGE 3VO9A 2I3GA 1C1HA 3RUCA 3TVDA 1Y7HA 1ISMA 3QUSA 4IQ0A 3AW8A 2EKBA 3JQGA 5F35A 4YAIA 5EZYB 1SHTX 3N05A 4O0MA 4PLZA 3KXDA 3UBMA 5HKKD 2QY9A 4BFWA 3GA7A 1YSCA 2KX7A 3KXLA 2D06A 4L74A 3DT9A 1ZRNA 4LGCA 1F51E 2WF8A 3N1UA 3D3NA 3Q39A 1PLJA 3GA0A 4S0XA 5LBUA 3UJHA 4QLBA 5JZMA 2PT7A 1G18A 4BB5A 1PRYA 4M0UA 5DTRA 1J2YA 1G7CA 4XWOA 3RV4A 2PD4A 5GOZA 1VIAA 8MHTA 1Q15A 2EKDA 2FOLA 2OGSA 4DMUB 1XYYA 2N3ZA 5I7SA 3V4RA 2JRCA 3DEAA 1VHWA 3HPQA 1T36B 2QRKA 4DNFA 4YRQA 4AY4A 4URVR 4WFJA 2KHZA 2H2GA 4L5AA 1ZW1A 3DLIA 2YIVX 3H87A 4RFSB 2YV1A 3THOA 2C2HA 2Z57A 1WXQA 2C42A 4DOMA 5HUJA 5I8ZA 2YOGA 4GQBA 1R4MB 1IATA 2JS7A 4HUQA 4QT4A 3MCVA 4D4IA 5H4GA 3G79A 3BJZA 1QWSA 2JNWA 4IZIA 4OVKA 4MRRA 4MV5A 5FTMA 3BUSA 4Q47A 2C99A 1SOUA 5JMPA 3TLCA 3TS1A 3V1TC 4MVCA 1AKVA 4PAAA 2XWPA 3PXXA 1ZNZA 5TF0A 3HJTA 3RVOA 1T5OA 4R2XA 4MYCA 2VRCD 3NEPX 4YEDA 2V6BA 3ZJ4A 2EQ5A 1AC5A 3LPNA 4DWVA 3EIWA 3CC2B 3CD6B 1A7AA 1NJID 4QVGA 1VG8A 1XXHB 4BMDA 4C0LA 4DKXA 4ER6A 4UJ5A 2D3WA 3N9IA 3BC1A 3R40A 3N7UA 1OI7A 4JN6B 4MULA 3M5DA 4G25A 3SJ7A 1S3GA 1X3LA 1MKYA 4BLUA 4WN3A 1PFKA 1KQ3A 3WV4A 2V0GA 4XDHA 1A4RA 3ESQA 1RBZA 4CKWB 2AKYA 2ZBEA 4MPTA 2EX4A 1QFXA 2FEPA 1FJHA 4OK6A 5EIWA 1X7XA 2YL2A 1O87A 2WM9B 3PRYA 4QOEA 3T7KA 3DTNA 4WCFA 1EDZA 1R6VA 2HTFA 4YO8A 3SX4A 4BASA 3Q8KA 2A7QA 5HFNA 1DKQA 3TLJA 2I3BA 3L7CA 3SS7X 3TSAA 3NWEA 4NCJA 5HX7A 3CCFA 1QFZA 3MAGA 4NMWA 2XECA 1SCUA 4WZ6A 4M1OA 1TI7A 1XEAA 3M5CA 1G64A 3JVUA 3EC1A 5GZ6A 3MCZA 2OXRA 5AW9A 1KDZA 1L8LA 5CBKA 4CLRA 2FWAA 3A3GA 3NWJA 4R9NA 5ADUS 1TLTA 2W2VA 5JC1A 3VTZA 3P2MA 3VKUA 2B5WA 3LZCA 5JWHA 3W8RA 1X7ZB 4IWXA 1P9OA 3I01M 3DXFA 2PZMA 3M4XA 2EJBA 5EXPA 4EEZA 1I94B 1SOMA 1P17A 2QRZA 4MB0A 5D3MB 5C5CA 2DLNA 1CE8A 1THGA 2SCUA 5LLTA 3U16A 4PRYA 4ZZ3A 2O2HA 4GDFA 3SE7A 2VFAA 3X2FA 2FQYA 2YVLA 2WV9A 4O3FA 3N74A 5REQB 4PC6A 1GZ3A 1WSBA 3A3KA 5I7FA 4TTAA 3PE6A 2AEJA 2YX1A 5KDOA 2Q5QA 3CLKA 3JALB 2DPYA 5IJWA 2FZEA 3RFVA 1A9SA 1YS6A 3K8ZA 3WR5A 1CVIA 3R3YA 4D92A 2D4HA 3RVKA 2BGWA 4MVJE 4I1YA 4CT4B 5EJMA 2OP0A 1B0AA 1MC1A 3I01A 4J75A 4PYOA 5EHZA 3O84A 2B36A 5EP2A 1PJAA 4W8OA 2D1RA 2OO3A 2HMUA 2X1MA 4FP9A 3SVTA 1UC8A 2XH8A 1EUYA 3NAZA 1FW6A 3PGA1 1U98A 1C8BA 1OHHD 2BFCB 4KX3A 4BCBA 4CEJB 3N2LA 1EFCA 4LBYA 2RHRA 3Q3CA 4MO2A 4PZCA 1KEKA 4Q9JA 4PG6A 5AVJA 1KNXA 4J03A 4Q7EA 2IS1A 1RJWA 1M34B 1C3XA 1JLSA 3VZPA 5CEEA 1RLOA 1AGYA 1SVOA 1A1SA 1ML3A 2FPMA 4OX9B 5CT9A 3T52A 2R8RA 4B44A 1U7DA 3P4XA 3CRMA 4G0QA 1XTPA 3K72B 1J56A 3N59A 1NASA 2FFQA 2DR3A 3DPUA 3ORSA 3MIZA 4JLKA 2HF8A 4ZK2A 1ECGA 3HZRA 2X14A 1Y8QB 2E4ZA 4B0OA 2B98A 1K6IA 4CHTA 3CC7B 2B69A 4RHFA 2NO1A 3HL4A 1M10A 3B51X 4LOHA 4LRXA 3PE3A 4PO1A 1RWOA 4NYJR 1BX0A 4HUJA 1WVIA 1XR3A 4CM9D 4PQEA 2J3IA 4UU8A 4EGFA 2Q6LA 2Z9BA 2QSJA 1D2NA 4PZLA 2A3NA 1N2ZA 4ZXPA 3C8MA 2W11A 1UIRA 2B0JA 2WFLB 2WB2A 3GG9A 1YDGA 3SDSA 2W2KA 3X0DA 1A9QA 1U7TA 2BBSA 4HNSA 2V74B 4XQEA 4AVYA 1A8PA 4B31A 1PBTA 3NTRA 5BMVB 2YUTA 5JYBA 2O8BB 1VG1A 2ALJA 3P9RA 4MPRA 3S2GA 1JLMA 3I9NA 3K5HA 1RVV1 3CX8A 5DWQA 4OH7A 2YN2A 4WLOA 3VPAA 3B1ZA 4M0MA 3FWPA 1C2TA 1XUOA 4TMZA 3IP3A 5K2OA 3IAM1 2R9VA 3LY8A 3R3ZA 4YGXB 2WIJA 2VCHA 2V9ZA 1SIWA 3OO1A 4JBGA 4M9CA 4HDRA 2JI6A 1TUBB 1SH7A 3SFVA 4KPFC 1NXSA 1BFKA 1EJ0A 3R7FA 4ILKA 1JG1A 3FTQA 2NWQA 2PTGA 4MJ3A 3O8CA 1HL3A 2BT4A 3CJQA 1T15A 1VRVA 2CYCA 3NHPA 3L1UA 1GPUA 3GJ3A 5FBLB 1FDSA 2GPTA 3VU3A 3AVTA 4BKMA 4EI7A 5EJ7A 3QLVA 3FOWA 1AO0A 1M0EA 3HSYA 2GBFA 2XJ4A 4EEKA 5HPYB 1UJNA 3ZW8A 4E0FA 1TD9A 4V0SA 5HM6A 2WVGA 3ZVNA 4LVOA 5EXSA 4IOMA 4Q7JB 3GUHA 3ZCSA 1HGXA 1RJDA 1Z56C 2BGMA 2FR1A 2I76A 2NO4A 1LUAA 3H2IA 3VC7A 4H1UA 1UBRS 4LXXA 2QW1A 3VNAA 2GERA 1THZA 3EZ7A 3HCEA 3N2KB 1Y6FA 3I30X 2HJWA 4HYQA 1QANA 1N6KA 4U00A 5TQ2B 4I50F 4BRSA 6CHYA 5L9AA 1IIRA 2NOAA 2PBLA 2RH5A 3F49S 3Q0IA 4AP5A 4RWEA 4F2HA 3I5UA 5CFPA 3ZHBA 1GM5A 1ZMBA 2XPCA 3U5ZB 2BMEA 5BP7A 1BA2A 2CSUA 2OV4A 4BNWA 1K1EA 1AUXA 1Q2XA 1Q7CA 1V6CA 1UWLA 3E5MA 4DCSA 4ZZIA 1XF9A 5L3SB 1UEXC 3FZEA 4IIJF 2QT9A 5AJHA 1USKA 3UA3A 2AYYA 1KMQA 3JATA 1ZXBA 4RJ2A 4RV5A 2WKQA 3IIMA 5ALPA 4RGQA 3TQFA 4NZPA 4D97A 5AM4A 3GEIA 2Q07A 4WZZA 4HWTA 5KYVA 4EMSA 4F91B 1ODKA 1EUDA 4KBGA 5CXSA 2OQIA 3L5KA 4FX2A 2WTBA 2HSDA 1EE2A 4L4UA 4Q7LA 1B8OA 2EBHX 5GVRA 4E6EA 3ZY5A 4P7GA 2PX0A 1BO6A 4F72A 1NJGA 4K3VA 5DM70 2VHEA 3ZYZA 3HWX1 3KVOA 1V3QE 3QV1A 1T9HA 5K8IA 1UMBB 1T4CA 4F12A 4F2PA 1HKHA 3K3PA 3MTIA 3TWOA 2HXSA 2QN2A 3DE0X 3FMPB 2X8BA 3CF6R 3RSZA 3U7QB 3I62A 4CDMA 1J97A 2D1TA 4RZ3A 4E07A 1Z0UA 3H94A 2NZJA 3DZ8A 4JLMA 4Q6BA 4QBIA 3HL0A 3UMGA 4N76A 4EA6A 2W2TA 4KIUA 4OXNA 2D9RA 2FXVA 3AVQA 4M0LA 1NBME 1ZCZA 1RRCA 1VJGA 3M8KA 3VU0A 4LMPA 2V7GA 2LCFA 3K1AA 4U2CA 4C3ZA 2M32A 3QWAA 4YRGA 2X8LA 1U0EA 4XEHA 2X9GA 3DV9A 1JIKA 3G4SB 1MH9A 2QN3A 4YBRA 4Q37A 3FLBA 4Q3CA 2ZR0A 1DSSG 4FDUA 2Q5LA 3MTJA 3O92A 1VJDA 1PW7A 2EQBA 4MLZA 2GVZC 2O3JA 3L02A 2PTHA 3E81A 5BSTA 4ENUA 4OK3A 1DBRA 3F96A 5EL0A 1WPQA 2A8YA 4AKGA 1I9GA 3IUMA 2C7GA 3ZU5A 1P2TA 1PG0A 4QU8A 3WLKX 1E7YA 2QM3A 4OI4A 4TVBA 4E46A 4S35A 3ZU6A 1H1TA 4D56A 1X7DA 4WBNF 5BV2P 2NV0A 2ZIWB 2ECPA 2XBUA 1H1DA 4H6XA 2OFXA 5FFNA 4E32A 1VKHA 3PR1A 1CRLA 3SYRA 1JDZA 3V80A 2WAOA 1KEPA 4HO1X 2JGJA 4HX5A 4OOEA 1ZLXA 5TC4A 1I01A 3ZE1B 5EE9A 3OQIB 4F56A 2HT6A 1E2NA 3NFYA 1TZJA 3TIVA 5CU7A 4EO4A 2JI7A 3SDBA 5JD4A 1CJVC 3LVBA 4I4NA 3QY0A 1F2DA 3OF2A 4ROSA 2H00A 3HRKA 3DD5A 4OGFA 2O57A 3HXTA 4RUKA 1G16A 2YH2A 4JI4B 2XTJA 1EVQA 5LDDC 4FVTA 5DW3A 1C3VA 1B0PA 2BI4A 1UD6A 2EEPA 2I9PA 3NWOA 3GZJA 5IEJA 1JN0A 4GEKA 4ZOQI 1VQ4B 1AKWA 3T7EA 4JL8A 1CY1A 1GILA 1XZGA 5B7PA 1VM6A 3FWZA 1WB6A 4LSGA 5E1DA 3ONVA 5EI5A 5JS8A 3SLKA 1SCIA 1E3EA 1NURA 2EC5A 2OYRA 4AN1A 2IYOA 4WRRA 2XMRA 3ZTWA 2I1WA 3G85A 3HCWA 4OEHA 4CLHA 5C5IA 3RF7A 2VHTA 4C7XA 3T7CA 3T3HA 3MCTA 1RXVA 3ZDCA 4LFBB 1YFLA 3ZGVA 1DAKA 3TM4A 2V31A 2ZRDA 1HY3A 3K6KA 4J07A 3VJKA 1C9JA 2O2CA 3MCWA 4G5RA 1U8AA 4OREX 4AAYA 1MW8X 2DECA 5K3EA 4Y8VA 3DTYA 1T4GA 2ERXA 4Q7QA 4R1LA 1OAAA 2BBTA 3T54A 4RM2A 4F8EA 1Q7BA 1OLSB 4GXNA 5IBCA 4Z2AA 1DLJA 3FX2A 3THSA 2BGIA 4DMKA 2WFLA 4UUMA 2Q0XA 2OESA 4EELA 1S0UA 1LX6A 3MVEA 5LQUA 3UG7A 2XR1A 2GXAA 2CLFB 4RHEA 2XQVA 3A14A 4JV5B 1Z5NA 1NVDA 4HMPA 1J70A 1UBCA 4D5EA 2PUGA 1E94E 5AKYA 2O6LA 3AFNA 3FYTA 3GJQA 1BXKA 1KDOA 2BH9A 2GD2A 2QEQA 1KJYA 2HWYA 1TM1E 1L8QA 4P4UA 4MA0A 1KJQA 1BJKA 3LVQE 4KMSA 4D4JA 3QLUA 4DA4A 2OSVA 1YZQA 4JJKA 4B9EA 3E4DA 3GYGA 2VAWA 1MX3A 1H4TA 4I6JA 2FVXA 1I30A 2ZVJA 1POXA 2HEIA 4MHOA 1SMKA 2G70A 3HMKA 2H65A 3V9PA 2D7DA 3JV7A 1SD2A 1WDKA 2X1VA 3CZRA 4R5MA 4KLZA 8AT1A 2AYZA 2XRZA 3CC8A 3T9AA 1Z7WA 2A59A 2WYVA 3A70A 1OC2A 4HQ6A 4YI3A 5JAPA 4FEYA 2LD4A 2RHWA 2PUAA 1RJ9A 4EL5A 1J09A 4R9RA 3BAZA 3GEPA 3R6LA 2ESRA 3DE1X 3ZD7A 3O38A 2GO7A 4C07A 3KETA 4LAFA 2BZSA 1JEOA 2MSEB 4YJ3B 1FXSA 2QZ9A 2H1IA 3IEPA 4KH1A 5AHKA 3BB1A 2ET6A 4A0FA 1L5LA 1J99A 1X8LA 2C94A 1EEHA 2RC6A 2BFBA 1H65A 1R16A 4OYHA 4ZREA 1EG7A 4LI0A 2ZEJA 3K96A 1CY4A 1U02A 3A1UA 4FOLA 3JALA 2Y3IA 1W19A 2AR7A 2B7BA 4DLUA 5EEHA 3UO8B 4YYEA 1RJFA 1PJCA 1GTJ1 1TDJA 1TZKA 4NC9A 5DHPA 5EHNA 4B48A 1N6OA 2MWMA 5BT9A 4CM8B 4YRTA 4CV1A 1QV9A 2V9PA 3L5OA 4IV0A 4UDYX 4Y2HA 3SC2B 4MIEA 4QUKA 4GX1A 3KWJA 3SZOA 4NNOA 5DB4A 2GAFA 2PBZA 3ZZTA 1ADYA 4ZALA 4GL2A 1FDVA 5IJXA 2Q41A 5IUJC 1L7PA 4YONB 4EJFA 3FOCA 4BNMA 5CVTA 2PIAA 4D0LB 3HA2A 4JB8A 2EGUA 4GI7A 4EW1A 3CR8A 4LXUA 5IAAA 4OHVA 1XMSA 4YK7A 1RBQA 3UY4A 1OFGA 1PHRA 1KI2A 2XMCA 3IGFA 1Z3CA 4L28A 5SY9A 3K9HA 2ZM5A 1JECA 1S89A 4HB0A 4KLCA 3LUAA 5CLLA 5EGSA 5LMNB 5BXYA 3JQ9A 1Y3AA 3FAKA 4GU5A 4J43A 1GNSA 1V0FA 3MBIA 3ROKA 1K4YA 4O3MA 3E7WA 1MJHA 3QXGA 1UP6A 1YR6A 1K0UA 3MMXA 3O0TA 3L9WA 3NTUA 4N8EA 4TS3A 5FV7A 5K4HA 2UVPA 2XWQA 1LFDB 4E94A 1L1RA 2WVHA 1W4CA 5HS6A 1JXMA 1HLPA 2RH9B 2RGWA 3AYXB 3JX9A 3NBZC 4PGFA 3BMXA 3C48A 2J6BA 1DBSA 1U2RA 1NX9A 6GPBA 1N4DA 3NYQA 4LJAA 1YQEA 4AJKA 2BLLA 1A88A 2ZQZA 2OHXA 5KVCA 4AVZA 3U6BA 1M1NB 1P9NA 1G6HA 1TO6A 1DPGA 3GFQA 2Z1MA 2IXEA 4NU5A 4CU5A 3NBAA 4BV8A 1JQ5A 1YZ3A 2IXTA 2P5SA 2QTBA 1BH2A 3JZMA 2Y71A 4LECA 2BIFA 5AVUA 4F4FA 3D7MA 2CE2X 1NW9B 2QZJA 2XZLA 3T0IA 4E31A 2W2XA 3GPLA 1W73A 5BRNA 1LPPA 3EEFA 1V5WA 4Y1EA 3T5GA 1EFRD 4J0EA 4MS4A 2CXRA 1NW8A 2O05A 4A2QA 1HF3A 1K7XB 2FPPB 5LA6F 2B4QA 1Z2CA 2GCPA 2ONKA 3BAFA 4RJIA 4LK3A 2QVZX 4NYMR 3SKYA 4C2BA 3H9EO 3HA3A 3KQQA 3CCLB 3AQIA 5GZ3A 3ENZA 3S27A 5LP6A 1ISHA 3RS0A 2E1PA 1GU7A 2GSWA 4RFSA 4ZQEA 1X1DA 2AFHB 3QX9A 2VPYA 4A8JC 1U4OA 3PC2A 3VHXA 4IDFA 1QIJA 4X8OA 2PUBA 3E3AA 4KK4A 2BN4A 3WGGA 3VSCA 5J4VA 2N9UA 8ABPA 2JHFA 2ZBPA 1WEHA 4HD8A 4ND3A 1JUDA 4CN9A 1Y8QA 1CUGA 1E3DA 3ON5A 1Z6YA 3EVGA 3RIHA 1ZVJA 1I6LA 4TMVA 3AWDA 2NVUB 3ETHA 3W1EA 1QP4A 5CUQA 5CDUA 4F3TA 1NU6A 1GLGA 3AB7A 2XX3A 3U62A 4ZI3A 4RY2A 4NJEA 1RXWA 2HBZA 2XZTA 1F5SA 3F4BA 3D3JA 3NPAA 3OY7A 4K6CA 1Q17A 1EA5A 5EYPB 4GOJA 1NBHA 1H2HA 3EZ6A 3W9YA 2O1XA 3ZDFA 2XXJA 3VVBA 7REQB 4HJRA 1QGAA 4CDNA 4YV2A 4H1VA 2IGTA 1LNZA 1E4OA 1EX1A 4I5GA 2CVFA 3RQSA 4OYRA 5GAJA 5IYZA 4X66B 3CCRB 1ZA2A 3GARA 3RS9A 1GG2A 3K0BA 4QRIA 4URZR 1Z68A 2JJ1D 1I5EA 5DBOA 5LXTB 5EA2A 3ZNPA 1SKYE 4GECA 1ICIA 3D7SA 1OGIA 3F6SA 3F90A 3U4QB 1YNSA 1M2GA 1UM8A 1FFCA 1BRTA 3MF4A 5DFAA 4DNPA 3ABZA 3BTVA 3ZCTA 3LXXA 2YNMA 4GE3A 4PZ9A 5K1ZA 2QSUA 5ECGC 4P22A 3AR2A 3KRTA 1A5BB 5JNTA 1II8A 3ER9A 1TA4A 4TQGA 4XUGB 2VBSA 3MG9A 4X41A 3WA6A 2V5UA 4I7EA 3L1VA 4F45A 4B3GA 5TQ0A 1HM5A 1OTYA 1ORIA 1RYNA 1G20B 1Z39A 2FOXA 5EKTA 3R5KA 1JEAA 3FHOA 4AZVA 5AM3A 1U7PA 3G3EA 4G0UA 2GPWA 4W9RA 3RUPA 3BIXA 3LQ6A 2G1JA 1CQJA 2FW6A 2BKUA 1S1MA 4KIFA 4Z4SA 3LHIA 2W2LA 3CF4A 4J7UA 3WNVA 3HZZA 3VISA 4RSGA 3EDCA 4R1PA 3ZQKA 3D0RA 1C3JA 2A9JA 2ZBQA 1M54A 3TLZA 1PYGA 3LGXA 1I3MA 3D7KA 2PX3A 1YJWB 2I66A 2OFOA 2YDXA 3B3GA 3FF4A 4W7HA 5G3ZA 4WBXC 3VR5A 1Y4SA 1E20A 1RFLA 4N6NA 5AWFC 3SIPA 5AKEA 3T3DA 4BNTA 3B38A 4ZIRB 1JKJA 1UXKA 2J67A 2HWXA 2OR3A 5LYJA 1T13A 3RFUA 2J45A 2EZTA 2Z6AA 4IYRA 1YQ9A 1D04A 4XR4A 5H1YA 2PAFA 4IV8A 3PLNA 3HWSA 1LDGA 3I04M 4KQFA 4DN6A 2I78A 3FWKA 3DL7A 2P0YA 2RD2A 1E6LA 5GIPE 1WPCA 4L8VA 1EUZA 2HTEA 2VDWA 4QEKA 1ES9A 1PWZA 4YV7A 3QI2A 4DLKA 4IHAA 3TSCA 5IULC 1M66A 4JJ6A 5JAUA 4RQAA 3A8KA 4KR6A 3PXEA 1I4OA 4RPDA 2YJ4A 1HDIA 3KZ1E 4JP1A 5DBIA 1UF9A 1UK7A 5HQJA 4LF9B 4RD4A 4BGIA 1ZYUA 1X0VA 3DW3X 4WCDA 2QOEA 4A15A 1MAUA 1H0SA 1MOSA 1KVQA 1L6IA 4QLOA 3GWGA 3QXJA 3BULA 3WGTA 3D02A 4FGZA 1R10A 3K5PA 1KBQA 1JQKA 2PZKA 4ER7A 5FH9A 3BKXA 3GVIA 3SD7A 1BZYA 2RHJA 4MIOA 2W0SA 3C87A 2DYIA 3WYEA 5K03A 1HMPA 4J6EA 3V1MA 3ZXXA 1TD1A 1PZXA 2Y4NA 3EWIA 1IEXA 3SN6A 2CYAA 2G8NA 3D59A 4P6VF 4FYVA 4BC1A 4Y9TA 4MVWA 3A28A 3GLFA 5A2GA 3F1LA 1IBLB 4HQFA 5IJAA 2JLYA 1GQSA 1YL5A 4ZOLB 5JCJD 2W6JD 4FC6A 2E18A 3UT0A 1HUQA 1JYEA 3EGXB 2UYYA 4MJLA 4V39A 5LA6B 2AW3A 2G4CA 1PQPA 4AECA 3NC0C 3BCHA 4NOLA 3TL2A 1EK2A 5JI2E 4TXLA 3KWLA 2ZJYA 2G04A 2MSDB 3M6IA 4MSUA 3EGDA 4KBYA 4D9HA 4YY3B 4FXOA 4TWBA 1YCHA 4R1MA 2OQVA 1L4NA 3T5PA 2OTJB 1O3YA 3OZXA 4MCHA 3TE6A 1Y3IA 5ALWA 1OWOA 3AUSA 4K0KB 1UP7A 2BUBA 3FCCA 3KTFA 3ZPXA 4WERA 1PUIA 4CIAA 4INOA 5KQSA 1E0AA 4RD2A 2BGTA 1KDRA 5KOYA 1EK0A 4IHJA 3WLRA 2CHVA 4D9IA 4WKPA 3BGDA 4ASUD 3THWA 3QU9A 3ZE7A 5MN5A 3VV2A 2D7JA 3O4HA 4G65A 4B2YA 4BFTA 3IL2A 1I1NA 1FTQA 3CZMA 4QYTA 3WMRA 1EDEA 4QVKA 3GLFB 2DJ5A 2VBIA 3D6HA 1GVHA 2WTEA 5A9SB 3R8FA 3CLUD 4EB3A 1J90A 2DTXA 2CDBA 1EGVB 4UTZA 1GPYA 1QCYA 4FJ0A 4B4DA 4KI0A 5GADl 2EJWA 4EFNA 1E2JA 3BYZA 2YFYA 3E53A 4RA9B 1UFVA 3SHVA 4AKIA 2PLWA 1DO2A 2ECKA 1X8JA 2DRIA 4MARA 3KPVA 4MIYA 5AKZA 4FMDF 5T6BA 3SU8A 3W0LB 4IEEA 1SC6A 1UIMA 2REBA 2ZJ5A 3IBGA 4ND8A 5B36A 3NVKI 3AU9A 2BEVA 4KDCA 3GRAA 2FUNB 1TKBA 3LU1A 4O1MA 2CLOB 1KEEB 1DBIA 1E18A 1UJ6A 3NO4A 2QLBA 1SOWA 1KEWA 5IYWA 2X0KA 5K0NA 4ZCTA 3LC1O 3URMA 2Q6VA 4L85A 1V7QA 4LV6A 4O08A 1HE4A 3VGPA 3BPSA 1D4OA 5GP1A 4F04A 5J23A 5AVOA 2XHZA 3B9RA 1GQQA 3UMYA 3B78A 3TR5A 1QHXA 5JV5A 1H6CA 4DY6A 2PL9A 4G1MB 1H2BA 1UQUA 3GRPA 4M36A 4UQOA 2I7XA 3O0DA 3OESA 3TCNA 3TX6A 2QG4A 3GGOA 1GUBA 2IEAA 1W29A 2JIBA 2XCQA 2Y8EA 3AETA 1BA3A 1TEXA 1Y1SA 4KO1S 4XZ3A 1NPDA 3P45A 4H35A 2NW6A 2QAGB 1SQ6A 2BFFA 3HNRA 5FUBA 3BQJA 1ZWLA 2JK1A 1O6FA 1LTKA 1ZN7A 4WOBA 2DH5A 3OCWA 4XIIA 5AW6A 4ARIA 1BKSB 3H1PA 3OIFA 4YCLA 1KYIA 2JFUA 3QTLA 2VK8A 3JWPA 3D6AA 4CR6A 1H5UA 4LX0A 3W2EA 1FFSA 1JH9A 3V6LA 2ZB4A 2XRYA 3DDOA 3D0KA 5JASA 2QB5A 3KQKA 1GKKA 5KMGB 1PDWA 3L7IA 4UNPA 4E51A 3EYWA 4A36A 4JC0A 4YR9A 4D42A 3D3EA 2EF0A 2XUOA 3KZNA 4NCHA 5TGTA 4C5BA 5K0GA 3NNNA 5IXSA 1QJCA 1XZIA 2HU7A 5CLIA 4DIDA 4C6TB 5K0EA 4LF5B 3U17A 4IIJA 2RGUA 1YAHA 1USVA 2PRZA 3ZCPA 5B1EA 3QYFA 3GLIE 4J9UE 4NBWA 2Y4OA 5KCMA 4KVAA 2XCTB 3BJMA 3HU1A 3BWMA 3WOVA 1OBFO 4HLCA 4WN9A 5J35A 1VA5A 2REXB 2AJCA 2JCSA 1HTTA 1JG3A 2IFTA 3IP1A 3RS8A 4FIDA 3Q3GE 4WN9B 2KE5A 3NHSA 3ZZUA 4RTRA 2IKSA 4L8WB 2ZZFA 2Z43A 3RIYA 4CFZA 4DM4A 4ZIRA 1RIIA 1WL8A 2A6PA 4HTFA 3RKSA 3P9ZA 3TOXA 4ROXA 2WHPA 2ZTMA 3V8QA 4C6HA 1CUVA 3PNBA 4ED9A 4F5ZA 2H1VA 1SUSA 3LUDA 4K05A 1I4WA 1UM9A 1KSHA 3ZIUA 3FETA 3SHQA 3LUHA 1V7ZA 2P6RA 5CLFA 1CRPA 2IUFA 1KEUA 3HCOA 3UJ6A 3P2IA 4YCBA 2WF7A 2ZE8A 1Y5RA 1K3FA 5TVGA 5T4FA 3A1TA 4HF7A 2YJ5A 2CEKA 4ZDJA 2X0RA 1BDMA 3GYBA 1ZGCA 2CD9A 2P75A 2ZKIA 1U8TA 2OGTA 3FYSA 3EVCA 4K9DA 4TKZA 1N2IA 4IDQA 4XMYA 1MOZA 1CQZA 4PQYA 4TMKA 3RLFA 1MJGM 3L1KA 4BMXA 2QGFA 3OT1A 1LTQA 4PC2A 2Q29A 3UOWA 2IW1A 1G8AA 1NW5A 4Q7MB 5DGCA 3IVXA 4PZAA 5FTJA 5C5DA 4KMRA 4N7BA 2GNOA 1CB7A 3DKPA 2VXYA 5D6NA 4J0GA 4LZJA 3GLGB 1E64A 3AVOA 3CX3A 1N7HA 3IDOA 5JMOA 4DR1B 5KKCA 1PGNA 4BN5A 4AZWA 4R2WA 3TRDA 2NZYA 3SIRA 1IM8A 5IHPA 2HY7A 1F2UA 4ZHSA 3GJXC