3JQRA

Crystal structure of the h286l mutant of ferredoxin-nadp+ reductase from plasmodium falciparum
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
312
structure length
256
Chain Sequence
b'NFINLYTVKNPLKCKIVDKINLVRPNSPNEVYHLEINHNGLFKYLEGHTCGIIPYYRCARLYSISSSNNMENLSVAIKIHKYEQTNYGYCSGFIKNLKINDDIYLTGAHGYFNLPNDAIQKNTNFIFIATGTGISPYISFLKKLFAYSNYTGYITIYYGVYNEDSILYLNELEYFQKMYPNNINIHYVFSYKQNSDATSFYVQDEIYKRKTEFLNLFNNYKCELYICGLKSIRYKVMDILKSHDEKKKKRVHVEVY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferredoxin NADP reductase
molecule tags Oxidoreductase
source organism Plasmodium falciparum
publication title Plasmodium falciparum ferredoxin-NADP+ reductase His286 plays a dual role in NADP(H) binding and catalysis
pubmed doi rcsb
total genus 79
structure length 256
sequence length 312
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2009-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3jqrA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 3jqrA02
3OZWA 2BV3A 1YJWB 1W35A 3VO1A 3CCUB 3W5VA 1KQSB 1EP1B 1F60A 2EFGA 3W2IA 4M4SA 1FNMA 2BVNA 2VNIA 1QVFB 4TMZA 4YAFA 3MCAA 3V76A 4M1KA 3JQPA 2B7BA 1KK1A 2BM0A 3U6BA 4K1XA 3ZZTA 1VQ9B 1W2BB 3W2EA 2QMUA 2BN4A 1QGAA 1KK0A 3AGQA 1KRHA 2GQFA 2BPOA 4RCZA 5DSZA 3A1FA 1IB0A 1EXMA 3J81k 2C78A 1E63A 4DQKA 1N0VC 3WNBA 3QFRA 1IJEA 1EFCA 1KC8D 1FNBA 1R5NA 3VMFA 2RC5A 4M2LA 4UAJA 1YHQB 4LBVA 4YAWA 1YITB 3AVXA 4TMWA 2B5OA 1R5BA 1KD1D 1QGZA 1CNEA 4PC3A 3W2HA 1W87A 2VNHA 4AF7A 4Y9RA 2X3UA 2B7CA 3OW2B 1H85A 1YI2B 1E62A 3CCJB 4RJLA 1QFJA 1NDHA 1I7PA 4PC6A 1VQOB 1OB2A 3CCVB 1F20A 3ZC3A 1YJ9B 1TUIA 3PENA 1TTTA 3VNUA 3ZBTA 3W5HA 1QUEA 2CRVA 5GV7A 1YIJB 4Y7CA 1J9ZA 3CD6B 3CC7B 5TV2A 3WY9A 3AVVA 4B44A 4PC1A 3G71B 4FK8A 4TN1A 5GV8A 1GJRA 4RD6A 4ZCLA 3FPKA 4HE5A 2ZITA 3LO8A 1B23P 4C0SA 4MYUA 3CRZA 4LBYA 3WNCA 4P6VF 4LBZA 4PC7A 4EH1A 3VNVA 2AHOA 2XEXA 4J0QA 3CC4B 1ZM4A 1FDRA 1KJZA 1Q82D 1U2RA 4LC0A 1OB5A 1ZM2A 3WXMA 4ACAA 2OK7A 1G7RA 1KK3A 3ES9A 1K8AD 3LVBA 4G1BA 2QEXB 4Q7JB 4PC2A 1JA0A 1AMOA 3QE2A 1NJID 4IW3B 2D74A 1EWYA 1DDIA 2VZLA 1QVGB 4ZGQB 3CCLB 4P3YA 3CCMB 4DQLA 3B82A 3E1YE 1QFYA 3CXCB 2QN6A 1DDGA 4ZCIA 1D2EA 4M0LA 2XNJA 3SJZA 4TMXA 4B48A 2OTJB 3W5UA 5EMNA 1DARA 3JQQA 1FNCA 4HE6A 2NPFA 1W34A 3OZVA 3B8HA 1E64A 4B43A 4BPRA 3CMEB 1OGIA 4RCYA 3I55B 2CNDA 5KSWB 4ZCMA 4YAUA 4ZV4A 2BM1A 1VQ4B 4QFMA 1VQPB 3AVWA 2YWEA 3WNDA 3ZZUA 3W2GA 2OK8A 1CQXA 1VQKB 2QTZA 5TR9A 1BJKA 4PGOA 1TVCA 1D8TA 5TY0A 1VQ8B 1XB2A 1GAQA 4B3XA 1S72B 1R5OA 4F7DA 1AIPA 3OZUA 3P26A 3ZBUA 3QSYA 2VYQA 4B4DA 2DEUA 2OTLB 2RC6A 4H9GA 1ZM9A 4ZGNB 4LBWA 1N0UA 3CCQB 3MHPA 1G7TA 3WBKA 1VQ7B 1QGYA 1TLLA 3P27A 3B78A 2EIXA 3U6KA 4ACBA 3AVTA 4RD1A 1JNYA 1H42A 2QTLA 2YWFA 1Q81D 4FWTA 2DERA 4N3GA 1BX1A 4RD2A 3W2FA 5AN9A 1K73D 4TMTA 3MMPA 3LYUA 3OJXA 2DCUA 1KK2A 4AF6A 1EP3B 1YJNB 1JB9A 3AGPA 2QA4B 2PIAA 1DG1G 1KTVA 4Y9UA 1VQ6B 3VO2A 3LRXA 1OGJA 2HDNB 1D1NA 1GAWA 4B47A 1GVHA 1QX4A 3CPWB 3CC2B 2GPJA 3CCRB 2VNJA 4RD3A 5THXA 2DY1A 1VQLB 3CCSB 3G4SB 1K9MD 3QFSA 1ELOA 1G7CA 4YAOA 3CB4A 1FRNA 1BX0A 4U9UA 1XE1A 1Q86D 1SKQA 1ZM3A 5HXBA 1M90D 2BGJA 3AVYA 1GR1A 4C43A 4QHYA 2BF4A 4R71A 1ZUNB 3ZZ0A 2YWGA 1CNFA 4RD0A 1EFUA 3G6EB 2BMWA 2BSAA 3CMAB 4FN5A 5FA6A 2J7KA 2C77A 4AC9A 3OJWA 1M1KD 1G7SA 1FRQA 2R6HA 4WQMA 3U2QA 4NBSA 1JJ2B 2PMDA 4MYTA 5H5JA 1IJFA 4RD4A 4YALA 1QH0A 5JBQA 4YHBA 1S0UA 2E1RA 2BGIA 1VQMB 2XNCA 4M53A 1A8PA 1N8RD 3CCEB 3WYAA 1FNDA 1B2RA 1VQ5B 1WDTA 3JQRA 1QFZA 1EP2B 1GO2A 3WBJA 1QUFA 1QG0A 1JA1A 3FJOA 2HMAA 3AVUA 2FX3A 3QFCA 1Q7YD 3CW2A 3QFTA 1EFTA 4N3NA 2DETA 1UMKA 2VNKA 3I56B 3I1FA 1BQEA 4NCNA 2HCJB 5H59A 1VQNB 4G5GA 3E20A 2QDXA 4G1VA 1SM4A 2PLFA 2YWHA 1HA3A 4TMVA
chains in the Genus database with same CATH superfamily
4P4SA 2OA0A 1NJ1A 4A4DA 4I50F 1T6YA 3CCUB 2FW9A 4U7JA 2VZ9A 1PV4A 2I2WA 3HZOA 3KT8A 2NZYA 3WOHA 4CG1A 4MW0A 3RLIA 2ZUDA 1DJLA 2CK3D 2FR8C 2OYRA 3OO1A 4XWAA 1ECJA 3AKEA 821PA 3KJIA 3OAAA 1V4BA 3OEHD 4IZOA 1EAYA 2B30A 2DBYA 2Q28A 3DZJA 1ZRHA 4BAZA 1M6YA 2GRUA 2QP9X 2REQB 2Z2XA 3MC1A 4PSKA 3DKVA 2R6R1 5JS6A 4BZWA 2JAPA 3IBTA 4GI5A 3AHHA 2QSYA 5EHIA 2Q0QA 1O6FA 2JIRA 2P40A 2OWEA 4XLAA 1CS4C 2D5AA 1BCRA 1X0VA 4KXFB 4KWEA 4UVGA 4WGFA 4L5AA 1SK9A 1NVKA 2H4ZA 3G5TA 4FFOA 1DVRA 1EUCB 4R9SA 3E7PA 4CIWA 2I4IA 3WDSA 2XDQA 3ZK8A 1VQ9B 3SNKA 4PRKA 3WKEA 3W5JA 2Y1OA 4WXMA 5ENZA 2F1KA 1DPGA 1HSZA 1EFAA 2YY7A 4P31A 4Y67A 5BPHA 2C4WA 1PFWA 3QUBA 1C1YA 1JG7A 1N3YA 1ZZEA 3E9MA 2FTKE 3GRRA 2CB0A 5J4HA 1WUYA 5JS1A 2PFKA 4DCUA 2EWWA 2J3JA 2JF0A 3QMMA 3ZCRA 3AESA 3NAGA 1IB0A 2CMGA 3ZXIA 2JK1A 2YX1A 4E5KA 1SCDA 3BXEA 3MB5A 1FVHA 2C7GA 3I8SA 1Y6JA 4MUAA 4Q4HA 4BMSA 1RYHA 3ON5A 1SXJB 3AKDA 5LQAA 5JMPA 5CIWA 2WB2A 3PGA1 3KZKA 1H5UA 3L7AA 3L7LA 1JXQA 3OU7A 4LN1A 1A5TA 2ZIEA 3HWWA 4MVJM 2FSFA 5JLAA 2J0UB 4XONA 4LBVA 1NNLA 2IHKA 1WV0A 1Z3IX 1UK8A 4DXDA 1SCKA 2XMSA 4DM7A 1RXYA 4N0MA 3D8NA 1SBTA 3JSXA 4OK5A 4UJ3A 4DUYB 4MV6A 3V8BA 1RAFA 2G6BA 2QGNA 5EZSA 1DBQA 4GX5A 2ADOA 2RHHA 2VG8A 4TXJA 3SPXA 5EVJA 2BI7A 4FFVA 4BNNA 4EZIA 2H06A 3OMLA 4J49A 1NHWA 1YI1A 1VKOA 1Q7CA 1ORWA 3FVQA 2ZWAA 2E1PA 2EZ4A 3JR7A 4MGZR 4NQRA 4D0LB 5KTTA 3THXB 3ADBA 8MHTA 4LY9A 2FWPA 2VJDA 3SC4A 5HCUA 3IR5A 1NDHA 3GX1A 4GZ5A 3UBMA 4GE3A 2QD5A 4PZDA 2GZ1A 5FOXA 4RTKA 2GBLA 2OSBA 2C0CA 3JD2A 1OB2A 1HGXA 2HK7A 3C1TA 4NWIA 1Z0IA 4YJGB 2OCPA 1JGTA 1PSWA 2Z4SA 1ATZA 3QTBA 3K5HA 5BSEA 5JZBA 2VDWA 2J3HA 1V37A 4RWEA 4C6SA 4AY5A 5B12A 1G5HA 5EXTA 2J6IA 2WM2A 3TAUA 5CEJA 1YS4A 3FTDA 1E58A 3PQ6A 3U1TA 2D4AA 1V11B 1HI9A 3NHLA 3BOSA 1NMQA 2HRBA 5CPBA 1QGOA 2AJDA 3ZBTA 2FQQA 4CN9A 1EGAA 1E5VA 3LQ1A 2DUWA 1TZ2A 4PLGA 5EJ2A 4NIMA 3VKVA 4C4RA 3C97A 2AZMA 2PZLA 3FPHA 4LSMA 4XN0A 1J2RA 3IOCA 1NKVA 4L08A 4YR9A 2B3DA 1OSNA 2ZQ5A 3FOAA 1R1DA 3GA5A 3HCEA 4J29A 4UTXA 4QSHA 5K0TA 1L8AA 2V74B 2VHUA 3G0OA 3NV9A 4OL0A 2CUTA 2GBPA 1LVGA 2B2XA 3HU3A 5BSTA 3RI3A 4D4LA 3KNZA 4UEKA 2PKYX 3VAZA 1F6DA 5SZJA 1CY1A 4V0MA 3O4VA 4MYDA 4W8GA 4A0GA 1OJ7A 3KXLA 4X7BA 4FOLA 1YRLA 4TTPA 2P3LA 3HR4A 1VJSA 1OYYA 3A1UA 2EP5A 2XJ4A 3OLQA 4GSLA 1N36B 1DKMA 3GP3A 2E48A 4O4JA 5GV8A 2NADA 3RSFA 4Z0PA 1XELA 1E94E 1ISRA 1GPNA 2X4IA 4OQFA 3G9UA 4D9EA 3KR0A 4F38A 2PS1A 1NKSA 4OJTA 2O2ZA 2CSUA 1Q3TA 2PZKA 2W4QA 1GCOA 1I2DA 3JASB 3K94A 4MVJF 3AFGA 2JEZA 3FKSA 3G8BA 4C0SA 4TXLA 4IDEA 1WXDA 1YHZA 4X8OA 4MYUA 2NT3A 5EPUA 1QCCA 1WP4A 4LBYA 4MWTA 1KEEB 3UMVA 1M0TA 5I9NA 4ZDWA 4UFOA 1SPBS 1OYOA 2QAJA 3SXPA 1R6AA 2IEDA 5JH7A 4QOGA 5LQCA 1I7NA 4KHPB 2ZJZA 2CGEA 2NLOA 3JATB 1K86A 4Z7QB 5E95A 1ZN7A 5DNCA 1Z4PX 4OYLA 16PKA 1II8B 1QDLB 3M6FA 3V7YA 3ZNPA 1QYVA 1LDGA 3FLAA 5EJGA 3E5HA 1L9KA 1U28C 4TLMB 3QVGB 4ZI7A 1HLDA 2NU9B 3T5AA 2BAGA 1WU8A 4IM7A 4LOLA 4OFZA 2EKPA 3MCZA 3T1VA 2I62A 3BWEA 5A89A 4HADA 4HFJA 1KMCA 1RLIA 2FPUA 2ZYGA 2DR0A 4MI3A 3UTCA 4I9UA 3D4IA 1US8A 2TRSB 5AVKA 3WXBA 4RTLA 3BWDD 3WXMA 1RMTA 3G82C 4B8YA 3SDZA 4HLCA 1G7RA 2QRUA 1I4EB 2J3MA 3I09A 3KUUA 4KJZA 4KNVA 1TD1A 4N6OA 3EK2A 3TPCA 4ARZA 3BMQA 3ESCA 1GKIA 3AERA 4EZBA 4DG5A 5A04A 1RRKA 5JZMA 1JBQA 1ORVA 1KGDA 4Y1EA 1AA9A 1RJ9A 2CBGA 2H4JA 2ZSBA 4URWR 5CM8B 4BP3A 5DM1A 2B25A 5CT6A 2V7PA 2AXNA 1QCYA 4HZUA 2ZDGA 3II6X 3NKVA 2KBEA 3KZNA 2XWQA 1MQ9A 1XTZA 1ZGJA 1NBMD 3D7NA 4I9HA 4RVUA 5AI4A 3SIRA 3KQHA 4B0OA 3E3NA 2QN6A 5BWCA 1F7VA 3F8TA 2HX1A 4G1FA 4OQMA 4QUJA 4BB5A 2LZ0A 3DV0A 2Q3MA 4MS4B 4JI7B 3VKGA 1PJTA 4KUEA 3V8RA 3UAXA 4RXUA 3HJGA 4EATA 4EJ6A 3FPPA 1DCFA 4OATA 3CTAA 4AJOA 4CQNA 2B4QA 1E1QA 2ON6A 3CZPA 3FPEA 2TMKA 3RRZA 5C18A 4E7OA 2POQX 3P9IA 5SYNA 2XMRA 1NQVA 5JCJA 1RVDA 1SD5A 1Z74A 2PS9A 2VK1A 1TYZA 3AP3A 3SF0A 4JQCA 1HDYA 5I7HA 3NNNA 1IBRA 2IXBA 1N3IA 1GNVA 1XXLA 1WP6A 1OV6A 2QRKA 1OGIA 3FOBA 3LKVA 5CA1B 4YRNA 4NOKA 2IHJA 5BVGA 1UOOA 1IB6A 3GA7A 3C14C 3AFHA 3JYLA 2W6IA 2Q6OA 3N5CA 4OBXA 4I3GA 3WICA 3EWIA 1S4MA 1U2GC 4KVGA 2IX3A 1PNRA 2ENWA 2ZB7A 4RZIA 3ABOB 4WY8A 2J08A 4X9XA 5JNSA 4BRSA 2FZLA 1G20E 1WMSA 4EPWA 1FDIA 1QYCA 3ACCA 3LCMA 3BGIA 3ZWBA 1FXWA 4HUQB 4M60A 1VLLA 2PJDA 1YE3A 2Z1MA 3D59A 4D3FA 3TOCA 1M1XB 4DVJA 1WQ4A 3MWEB 5TNXA 5B7GA 1V0EA 3ZZUA 3ZCXA 4B3DA 1TRKA 4UTZA 5JADA 5CM2Z 3TDNA 2YQ4A 4JYPA 3S1AB 4BVGA 3T94A 2WJPA 4YRKA 2ZKLA 3P5BA 2HLPA 3FRJA 5IH3A 4RKFA 4QFCA 1CQXA 1P17A 1F0KA 1WHSA 2MHCA 3G8AA 3VX4A 3EGXB 4C76A 2QTZA 5HOQA 1ICEA 2WE7A 4O25A 4U8GA 2R62A 2XWPA 4KN6A 1JHZA 2X40A 5M2QA 1TQ6A 1MX9A 2CBXA 3KYDA 3UB2A 1N3BA 4ENWA 1DHRA 1BJKA 1GKLA 1NY5A 4XFJA 3G0IA 4DC0A 4JVNA 1RPAA 4JI0B 1SC4A 2EBFX 5GIOE 2NZVG 1WOPA 3BFKA 4TUYA 2ZATA 1ZR2A 2HBQA 1OKKA 1MOPA 2P4HX 1Q1QA 3IVGA 1DIAA 1SXJD 2DKFA 4KV7A 1ZAYA 1GAQA 1ZNWA 2YWRA 2BFWA 3OJCA 1R5OA 2QRHA 3B6IA 3PE3A 1TCVA 2VPTA 3X2FA 1R4NB 4MJLA 3V1NA 5JDCA 3GEDA 1Y1TA 1VLZA 4PG5A 5CITA 3S2IA 5FEMA 3HVKA 3PA2A 5LLTA 4YLYA 4RWZA 4C89A 2VYQA 1J2YA 3M8KA 4OGWA 1Q74A 2F8TA 5FO1A 2GKOA 2MWMA 2ZI5A 2OTLB 4KV9A 2OFXA 2XCSB 3EPHA 2XH8A 4BO3A 3IAS1 5AW4A 1VZ3A 3RVRA 1GZ6A 4LBWA 5L51A 2VRBA 4FPXA 1U8UA 3NEJA 3O4HA 3WBKA 4OHPA 4BEBA 3HY3A 3S2UA 4A2PA 4D1YA 4GUAA 4BE7B 2V4DA 4GIBA 1FUKA 4JVOA 1RI1A 3B6JA 4M99A 5I9TA 1GQYA 4M76B 2YFKA 3Q3GE 4CLHA 2RI1A 5EIEA 1MAHA 4Z4RA 2C29D 3I01M 2MINA 1B76A 4CKYA 4D79A 5I51A 1E3XA 1SQGA 5F4OA 3DZBA 4BO4A 5BNWA 1NE2A 3HVJA 4B17A 2W6JA 1EK6A 3KPJA 3NV7A 2HU7A 2A35A 1YR2A 2YWFA 1N2CB 2V45A 4PINA 5B6JA 4OXQA 2JLYA 2PUCA 3FTPA 4I1OA 4FMCF 1YCGA 2CL5A 2IPXA 3H4MA 4ENSA 1BX1A 1WD7A 6REQA 5JSZB 5U4XA 4E31A 1PV1A 2I2CA 5C1IA 1XQ1A 1U1GA 3DO8A 3Q85A 1RJDA 3K09A 3PHIA 2GEVA 1OWLA 4LXQA 5AKXA 3GCWA 4DR4B 4F8JA 4DOMA 2BLLA 5TDHA 4BP9A 4L5YA 5L4LA 2BTQA 1BTOA 1UDXA 3GBVA 3TX6A 4V0QA 2DTEA 3W7AA 4D4KA 1N57A 2ZJ1A 3LK6A 3PVSA 3QFFA 4D0NA 3CUVA 4TVOA 2W83A 1A9QA 4B47A 2ZJ0A 4ZOLB 3TBHA 4LDQA 5JDIC 3CPWB 5TQ2B 1KJIA 3O90A 4GXQA 2ZYTX 4LPSA 3QU4A 4MVYA 4AY2A 4CL0A 5LZ4A 1ABEA 2P9YA 5LA6F 3ROTA 4EQ6A 1SCQA 1VPTA 1XQ6A 1WKVA 3R2JA 4OMCA 1SA0B 2Q6KA 2AUNA 1ZC3A 4R68A 1A3CA 1NFFA 1NX9A 1C7JA 5MDHA 4YJ2B 1G7CA 1LGYA 5EIOA 5K3OA 2H2GA 4YAOA 1PJRA 2C5SA 3RKRA 2V8BA 3BSWA 1HETA 3MGCA 1A69A 1VCMA 5TQJA 1E4EB 4MUFA 2VLBA 4IO1A 5C8VA 3HBAA 3DEHA 5AHXA 3PA6A 4A6PA 1TC2A 2H54A 2ODAA 2QV7A 4D25A 3Q8KA 1KWGA 1OH5A 4AWBA 3KWJA 1XE1A 7REQA 3L02A 3BXHA 3PL5A 1VOTA 3WLIA 1N9KA 4S1TA 4DLTA 2CLLB 2W2KA 3B5JA 2XMDA 4EKIA 5FAXA 5JEEA 3N2KB 1M67A 5DGIA 2XITA 3GLFE 3BF8A 1QB8A 4CLOB 3EDYA 2DHQA 5JISA 2RH5A 4C01A 3SQLA 5FNVF 3E81A 4K6KA 1PUJA 1ZUNB 3D0RA 3NDJA 4DJ5X 4WK2B 5EMMA 8ADHA 2X7XA 3VPBA 1POWA 2PCLA 1P45A 3RWMB 1YBVA 2BELA 2EW1A 2ADMA 3KL4A 2QSZA 2EKQA 2R8XA 2R6ZA 2RGNC 3CBQA 3EIEA 5IC5A 1EP9A 5IN4A 1U1IA 4MDYA 2JA1A 3ZD9A 4JVLA 3S27A 3DAOA 1W9MA 3CMAB 1EUDB 1GV1A 1CULC 3NO4A 5FA6A 1Z73A 4OP2A 4TLLB 3PHJA 1XJ5A 5A6SB 4GOKA 3AJAA 2C7VA 1X1EA 1VSUA 2CFTA 4K88A 3MWFA 3L1UA 1ZVVA 3ESXA 2PXXA 4Y6QA 3I5XA 1LC3A 3IR7A 3KJEA 2W90A 3A4LA 2JDID 4E3WA 2C5GA 3IT3A 3PXUA 3NIBA 3BQ9A 3C3AA 3DWFA 2AC2A 1UDWA 4ZQEA 1UQUA 3LPMA 2H7XA 3A1TA 4D3ZA 1A1VA 2Z2JA 3AMVA 3ET4A 1W6RA 3W0LB 1S0UA 3D8UA 4BGEA 4R7GA 2UYOA 5TC4A 1CUJA 4G23A 2HMUA 3JWJA 2AR7A 2D5LA 3QBTA 4IS2A 4JYMA 1JWBB 4MUYA 5JUWA 5K0FA 1MEOA 3SI7A 4MR9A 3SJBA 3INYA 4DCGA 2GTPA 5J59A 4Z4CA 1I5EA 1CUAA 4ZQCB 3T7EA 4OI2A 4R3NA 2ZE5A 3R6WA 5T64A 4J16C 4MICA 1R4ZA 2O06A 4DJFC 3P2JA 2AFVA 1M5TA 3JATA 3TZLA 1GO2A 3P8ZA 4RA6B 4OPSA 5JO0A 3DDUA 4LXUA 3NHSA 3F7MA 1NATA 5DM2A 2J31A 3WADA 4RJ2A 2IP4A 2JBHA 4EIWA 4PGMA 1YDFA 3W05A 1LDEA 3BREA 1XPJA 2ACWA 4RBNA 3H2KA 1PT5A 1XL1A 2YN0A 2NQTA 3C6YA 4URZR 5DX1A 2HSZA 1QFMA 5IN5A 1ZSNA 4AMZA 4FNGA 2VHXA 4XQCA 4OA8A 3VPGA 1S2GA 5JRZA 3BL5A 2XVYA 4B9EA 1CC1S 2XUDA 4YP6A 4TTRA 3HUTA 4FYHA 3ACBA 3G8YA 3PR2B 4GOLD 3AONB 4QSMA 1VFPA 1YA6A 3D26A 1QZXA 4EPXA 2ZIFA 1KJ9A 2HCTA 3NANA 5F3RA 4EF4A 2BTEA 1G0NA 2P4UA 3LBAA 1H6AA 4PAOA 2WD9A 1AK9A 3BD9A 3AI1A 3PGLA 4R05A 5DVZA 2WSBA 2QN8A 3DNPA 4QXRA 5ALNA 3C3EA 2WTMA 5TE9A 3WO1A 4FFDA 3LMKA 4HVCA 4ZU3A 3TQSA 1E9RA 5FFMA 1EP1B 3DOOA 3P2EA 5FKJA 1UBGA 1YJ8A 4LJLA 1H1LA 1Y9ZA 3RUPA 1X1BA 2CB9A 4M9XA 5EXEA 8ABPA 1HOXA 4ZVUA 2V31A 1FQKA 1K9VF 4Z8XA 1P61B 5GVRA 3THOA 3NYWA 1S01A 1AKMA 4PQFA 2PLNA 3WK7A 4LFCB 1JLKA 1KZYC 4K9KA 3RSQA 5J2TB 2PL9A 1I3LA 3G88A 1NY6A 1EWVA 3RK4A 1DXYA 1MV8A 3QEAZ 1X3LA 4Z4VA 5KDLA 1C1XB 4LOJA 4TL9A 4RHYA 3V8EA 2ZBFA 5IC6A 4YQFA 5JVDA 5H8WA 4FCCA 2YH2A 1GP2A 2XKBA 1CBUA 2I7TA 3T8YA 1FQOA 2GBCA 1Y6FA 3PDHA 1H3NA 4C7MA 1IHXA 1NXOA 4ZAGA 4W9MC 4M9SA 1WSWA 1TO6A 2E4WA 1ZRMA 5AD1A 3I04M 2FMHA 1RI4A 1O95A 3SC6A 3C4QA 4F4UA 3HB0A 4RL6A 3JSAA 4RCZA 4M7RA 2OKCA 1A2QA 1Z16A 4FGZA 4JBHA 1PDVA 1TF7A 1WEKA 3JR3A 1FLNA 2DSNA 4M0MA 4FCVA 2FPGB 3CPHA 1E2MA 3I6ZA 3DMFA 5F7JA 2GZSA 3REGA 3TLJA 3V4LA 3MBIA 1D09A 4G84A 4CTJA 2MIIA 5ALHA 2FAXA 4KQ2A 3OZGA 3WNBA 5B4TA 3Q39A 1HNWB 2CXPA 2YJNA 4JLDA 2WYIA 3UOGA 5IWAB 3FDZB 3PXCX 2XDWA 4GC5A 4KI7A 1BG6A 4L9RA 4QPNA 4QWMA 4UAVA 5KBYA 3N0XA 1WVMA 1RWMA 3MWEA 5TT0A 1L7MA 2C9YA 1PQPA 1HFJA 1OFIA 1I3KA 3GFBA 4KQ1A 3BEDA 1A8IA 4EUHA 4M2LA 1QPBA 4DUPA 3WGGA 1M6VB 4QYMA 4BVHA 2JAWA 1VRCA 4LHYA 5KC8A 5DHAA 4X61A 4DY4A 2WKPA 3P9KA 1SB8A 4LV5B 1FP6A 1P72A 2QRVA 3R0JA 5MN5A 4BTLA 1KJQA 5TS3A 3EGCA 4E4RA 3WLFA 4R01A 4S1PA 5JXHA 4JC4A 6ADHA 2EW2A 4Z4EA 1IAQA 1TJPB 1H8HD 5FUWA 2HK6A 5B6PA 3TXXA 2PIDA 1DIGA 2D7JA 2VRNA 3TGPA 4BCBA 4R2LA 1ZNZA 3JQ7B 1SELA 1QLWA 4RVFA 2A1UA 5AKKA 2AWOA 3F5DA 4PC6A 3LT1A 4G24A 4A2QA 1WXFA 3UF0A 3VSCA 1FMCA 1L4NA 2HDWA 1VKJA 1KFBB 4R8SA 2B83A 2VXOA 4PCVA 2D59A 1I2BA 1UXOA 4EI7A 3FPGA 2GZMA 4QUZA 3BCUA 3MUFA 4KXQA 4BZXA 4DLKA 1TU3A 2ZTUA 2ZYIA 4BQEA 4BNFA 4EMUA 5L46A 5JDCC 3SYRA 3L0BA 1JLLB 1A5BB 4II2A 3UJBA 1B0ZA 4FYYA 1V8BA 1WZNA 2XTZA 2ZVPX 1L1QA 5EUMA 1S7GA 2F1JA 3TZKA 1V26A 2VDPB 4FQ8A 2JPDA 5GV7A 1AO0A 5NULA 1M34E 3SICE 1EXVA 2YVLA 2YFHA 1C7EA 3AHIA 1C9MA 1IZ9A 5ABPA 3VU3A 4F9FA 4GR5A 3CPXA 5JFOA 5EJMA 5JXWA 3O8BA 3M6VA 2IF2A 1NXSA 1YL6A 5IUKC 1Z37A 1MB0A 4ZVQA 4EABA 4CF3A 1JEAA 2UYYA 1NF8A 4FHCA 5LOVA 4EJ2A 1OTXA 1XMVA 2PFGA 3DF9A 1CZUA 2O7NA 4IJMA 3L1IA 2AOTA 4J03A 2ZL5A 1IHOA 3FYUB 4TS3A 4ZP1A 2OBYA 3VR3A 2IPAB 1J0DA 2Z4RA 2ZSFA 4G5QA 4AROA 4HN2A 3K70B 3IPAA 1WDLA 4RD6A 1ZHHA 5FT9A 4CM6A 5BN4B 5F2EA 2VJMB 3FVTA 3AOEC 4OQXA 1LLDA 4FI3F 4GRIA 4ER7A 1N6LA 5KNDD 2XYPA 4KO2S 2IYRA 2JJMA 3BL8A 4NZYA 4YJKA 5LM3A 3CNOA 1Z0KA 2P79A 4L9AA 4P82A 2MU1A 4QPCA 5SZHB 1M8PA 3SR4A 5JT1A 5L95A 2JDIA 2ZR7A 5KREA 1Y8QA 2DHDA 5TMEA 2FZGA 1YMUA 4KN8A 3P4XA 4TMYA 1XC7A 2EFDB 5IT9A 3B1XA 3F98A 3EJWA 4GXNA 4G0ZA 2OQRA 3M4JA 1ZD4A 2GCGA 5D3MA 1Q91A 5LNK1 4LGVA 3K6KA 2Q2OA 3TD6A 2QMYA 5GJCA 1PGPA 1DRKA 2XEXA 5HP4A 4EVSA 2ZSHA 4JYCA 3RT1A 2ZZGA 2I99A 2PYIA 4AJHA 2DR2A 1YZGA 3OF2A 1UOPA 4KQMA 1S4QA 2AK2A 1ZH6A 4JHLA 1HQDA 2DWUA 1TA9A 3MINB 4X1IA 4U5QA 3UJ7A 2XUAA 3WFZA 2FSPA 5A4DA 4TVBA 1XLTA 3AJEA 1DAGA 1Q1NA 1YAHA 1KSGA 5BSGA 1M66A 2IIQA 4PVDA 4L2IB 3F7TA 4PYLA 2I03A 3EWNA 4MWGA 4B3CA 1P4RA 3DZ8A 2WQZA 2OBMA 1NXWA 3CR8A 3GLFA 4AJNA 1RXEA 3CZQA 5FYQA 2D1QA 3D6NB 4RPBA 3NPAA 1JIKA 2CE7A 4XGNA 3A11A 3SKVA 2RHDA 1A5ZA 1XALA 1P7WA 2EZ8A 4W1RA 3IHLA 1ZUNA 4QHTA 2IU4A 4MGIR 3AU8A 4E5VA 3HEMA 4I6GA 4QTUB 4P3YA 5DHPA 3TECE 3CCMB 3ZGLA 1MXFA 3HP4A 3GN2A 3C3BA 4M37A 5LXTA 3EG5A 2QHXA 4PGFA 1XXHA 1G1AA 2QQ5A 3CZCA 5CR9A 4E2WA 5FUBA 4GOXA 3SOPA 4O2AB 3GJZA 1FW8A 4E6PA 1UBCA 3O9VA 3HJHA 2J3DA 3NM4A 1ZMOA 1XLUA 4QRHA 5CRIA 2H1FA 2A59A 3EG9A 4LAFA 3CKYA 3DVLA 2FSIA 2PRJA 2I7XA 3FOEC 5FLKA 2B8WA 5HBRA 3JQDA 3E35A 1YOBA 4JUDX 5TF0A 5H02A 2QN3A 1BKYA 1R0RE 1E9BA 1WDKA 2F64A 3O4RA 4PO8A 1P0PA 2RK3A 1U65A 2GRAA 3ILVA 3IUYA 3LXXA 3IEUA 3NCTA 3O47A 4EKEA 4IKOA 1COZA 2CHFA 1C81A 1O54A 3M89A 4DCSA 2C2HA 1ABFA 5KZMB 3A06A 2C7RA 1IVYA 2NTJA 3NIGB 2OFOA 3AJ9A 2P9ZA 4GNRA 4ZCSA 3PQCA 2YJZA 5EXPA 1TYAE 5SICE 2NTNA 4AX8A 4B84A 4V2UA 4TX1A 5A3VA 1NUHA 2WWHA 4QJ4A 2C3MA 2Z5VA 1GN9A 2UZIR 2XCOA 4DVGA 3U4AA 5BNZA 1ZHOA 1TM2A 4JUAA 3KUDA 4NG4A 3G5AA 2BM1A 2VH2A 3FOZA 1YJ5A 2YKGA 4AKHA 3LIIA 1FUIA 5IAGA 4KNYA 5LJLA 3CO5A 1N9ZA 1KKUA 2B5VA 1U3TA 2EX1A 3N28A 4MMXB 5HYVA 4EX6A 4BVKA 1FSPA 4D8XA 4QG3A 1OILA 4XUEA 1PQWA 4F6RA 3HKDB 3LXRA 3RS8A 1JSXA 4DL9A 1JBKA 3UAYA 3COWA 2AN9A 3GJQA 3KHKA 5AM0A 3IBFA 4DSNA 4YR7A 3RJ9A 3CB2A 1I2MA 3HYTA 3KSZO 3CJRA 4IIFA 3BWXA 3U7RA 4BASA 2J9YB 1QAMA 3T3PB 1ILWA 2PL5A 4MQBA 4W9NA 2XIJA 4XPZA 3SBXA 4XVCA 5M34A 1IHYA 1RWNA 2FHSA 4OTZA 3IKTA 4TMFA 2WP0A 3AYZB 4FBMA 4CM9A 3DFFA 3DFMA 3PYXA 1VQ8B 3CNEA 3SXUB 2NACA 1ZMXA 2P1ZA 1DOHA 4I4TF 4WT7A 5CVCA 3OD1A 4UQPA 4HZGA 4D4JA 3H5AA 3M5WA 1R6DA 4NXMB 3I6QA 3JVDA 2DY0A 1KI4A 2V7UA 3VH4A 3FUCA 2FY8A 4H6PA 3I2YX 5FJJA 1AKTA 2B1IA 1HE8B 1DQSA 4B4DA 1WSRA 2Z08A 2NUTA 2IYEA 4KO1S 2YHAA 4KUHA 4LJAA 2IPLA 4JLBA 3QBEA 3TF5A 3GIRA 1LFDB 4PIMA 3ASZA 4ZEXA 2XUPA 4WJLA 3LZCA 1NYRA 3A37A 2IEZA 1L9XA 3GEEA 2IFTA 2C9BA 4YCBA 1X39A 1JKJA 1HNZB 2EV9A 1X6VA 5J35A 5DPMA 1IPHA 3PNSA 1JTFA 3VHRA 1U98A 3ZHBA 3SIWA 3EZ6A 1DT3A 2OB2A 3C8HA 4A91A 3H9GA 2A67A 5G0UA 2P5UA 1S2NA 3D0OA 4E32A 2FMFA 1WCWA 4Z3DA 3DFZA 4QUDA 5FBWB 5EESA 3T3HA 2ZUCA 3TTSA 2HF8A 2AZ4A 1BS2A 1JIIA 1A8SA 4H7DA 3LE8A 3LL7A 4URHA 1ZK3A 1X15A 3T3GA 1SG9A 1TJNA 2XEDA 2AVDA 2DERA 2LP4Y 4QXOA 1KE1A 4N3GA 1ZG3A 2OM2A 2QRNA 1PJSA 1DCMA 2R47A 3F6BX 4HRYA 5DGXA 1Q2XA 1WIWA 3DG9A 3IDQA 2JD0A 5DGTA 3GT0A 3PQEA 2JHAA 4GBGA 1WWKA 1P7PA 4H0FA 4PAMA 4Y1RB 1K73D 2IA5A 5DULA 2QQFA 2C9MA 5COBA 3FWZA 3UMGA 3BE5A 4BLTA 4MQLA 1L5MA 1L4EA 3TQIA 3K6SA 5F3WB 1TXGA 3N59A 4X85A 2XXAA 3A9VA 3K6RA 2Q1TA 3OCJA 2BM8A 4G5RA 4GKVA 1E9VA 4LECA 2WV7A 2PIAA 2XGMA 4YRMA 4MEBA 3AF3A 5LMZA 4HNTA 2EZTA 4EPYA 2OORC 3OMXA 1D2GA 4BO8A 1DAFA 3OCWA 3HKEA 3FUTA 2Q07A 1QTNA 5DB4A 4LX0A 3UK7A 3WWOA 5L6LB 2H3EA 3L7NA 4OM8A 4DBZA 5HJ5A 5THXA 2GM4A 4M86A 3W4IA 3A25A 1VJCA 1PLKA 3L84A 4EDFA 4HL6A 1FLDA 1CCWA 2H65A 5KKCA 1LPBB 3G6WA 1PK9A 3T35A 3KZMA 3TZ6A 4XOPA 1Y1RA 4AMYA 3NXKA 4K9SA 4DEVA 4M1OA 3F74A 3NORA 1L5VA 4ATNA 5JC1A 2QM0A 1WKBA 1VRVA 1Z7WA 3TIXB 1P62B 2NV2B 5ESXA 3HVHA 3QLUA 1CJCA 2Q6IA 1XD2B 1FZTA 2ZSEA 1YC5A 2NZJA 1QIGA 1RSZA 1W1IA 1WZCA 3EW7A 4IHKA 4LWQA 4NBLA 4OL9A 5IARA 3NOQA 3VOBA 2Q4DA 2G17A 3RAGA 2Q27A 1D4ZA 4GX2A 4CM4B 3PCXA 1Z2EA 5ETJA 4WNCA 1YACA 4TUYF 3GD5A 3I58A 2ZR0A 2WWWA 2AH5A 2W6PA 4GZMA 3EPPA 1P0CA 2XGJA 4FXUA 4WCFC 2CL0X 2JLRA 3MJEA 1NXQA 3PHLA 1V16B 2GKSA 3CFYA 3GGGA 3OX4A 3RVKA 1IMJA 4TMKA 1OZAA 4RTPA 4QTZA 1N5IA 1M2GA 1M1NB 1U0TA 2X4LA 1WCYA 3HH8A 4RS4A 5CIQA 2LCQA 5DBOA 2R1ZA 5KAPA 3BMXA 4LK3A 2NO7A 1U0NA 1YB4A 1Z6QA 4LYJA 2QROA 1AOXA 2OUIA 1YOVB 5B3JA 3IT0A 5DE3A 4B6GA 4BYMA 3HNRA 2R6HA 5K4HA 4KPEC 2BFBB 1U8EA 1DKRA 4G5SA 5CLGA 3FFXA 4PS0A 2ZRNA 4U2CA 3EAFA 2EGGA 4QPZA 3SQXA 1LFAA 3HCCA 3I8XA 1O0SA 2QRJA 3P9RA 3ZWOA 4F8EA 1QONA 4UULA 4F96A 1PR3A 2C07A 2BGUA 3GJ5A 2LIPA 4GVXA 1GPUA 1ZGCA 4P7JA 2PT7A 3NWOA 2Y93A 3CX8A 4OAPA 4X1YB 4Y2XA 2P3OA 1D2CA 3F3MA 5CLLA 3TGWA 1HYGA 3VOSA 3OY7A 5GTDA 2V5AA 1P1CA 4UZUA 1JQLB 3A3KA 4DIOA 2CVOA 3I2HA 4MINA 1CJVC 1QFSA 2QM8A 5AVYA 4UM5A 3BCDA 3KZCA 4FSDA 4HUJA 3KK0A 4C0BA 4RTOA 3DWEX 1T5LA 4Q02A 1TIPA 3U7HB 3HFJA 5KMGB 1S02A 3TZEA 4A15A 4J0KA 1GG9A 1GQOA 1Z82A 2QORA 2AI2A 5AJXA 3U4QA 2NU6A 1TUBA 1Z08A 4HIZA 5EE1A 1U1EA 4E5SA 5CCBA 1COWD 3HCRA 3P9YA 4E33A 1IQUA 1A8UA 3EFBA 1M2EA 1OJLA 2ZP1A 4QICA 5CJPA 3CURA 5JAOA 1XRSB 1G8PA 1U8FO 1IONA 2DJ5A 2ZE7A 3TW4A 1NMXA 1T1RA 2Z04A 3F8SA 5FTWA 5HUJA 3I5MA 2HGSA 1XLTC 2YJ3A 2NSJA 4NHEA 3MS2A 4AF8A 2IHNA 1JA9A 3I56B 4J1QA 3WL5A 1YBHA 1UMDB 1BFKA 1C1DB 2F1MA 2ZTMA 2XT6A 1VQNB 2BHRA 4KQWA 4MVJD 1PR2A 4MUGA 3CRNA 4GOMD 4U9HS 2P9JA 1RWPA 4YLEA 4IIJA 3S55A 1MF7A 3VTKA 5I3CA 5ICGA 2XT0A 2ZZQA 2B2NA 3AFOA 4DLXA 4HWRA 2IRWA 3ABQB 4G4SP 2QZJA 3KAQA 3NETA 3RE1A 2VHEA 3BSFA 4IWYA 1NURA 5IBCA 3SC2B 5JS7A 2I9KA 2BEKA 1WUHS 1YU6A 2OCXA 4CF6A 4WL0A 3ZHYA 3OETA 3HEBA 2P2CA 1DKOA 4Y2SA 1HE5A 1UADA 3FX2A 4AUMA 2OAQ1 2B94A 2WI8A 4DRXA 3W1EA 2WM8A 4EHIA 5CDFE 4O2AA 1XZEA 3L1HA 2E5FA 1JLHA 2P6UA 5AQEA 4GQAA 5B2FA 5HK9A 1D2RA 5BYAA 3HS3A 3EX7C 4UTRA 4YAEA 2QW0X 5EIWA 1P1BA 3RRYA 1ENPA 4MWCA 4MS3B 1JEJA 1DRJA 3JQPA 3EULA 3G5MA 2ZUTA 5E3HA 1FYDA 2E5LB 3V4RA 2E6KA 5TMPA 3LP8A 3P94A 1B7GO 3EFHA 3AVPA 4C3ZA 3NASA 2QX8A 3EMVA 2FFQA 4Y2TA 5EJAA 2VTDA 3C3JA 1SURA 3PX7A 1NQTA 4DGSA 3DE3X 1IWBB 1EB9A 4H18A 4TTIA 1SUWA 3UYKA 4OXYA 4ZHQF 2ZI7A 4ZMRA 3KSBC 1TVEA 2QM7A 2IY9A 5TIIA 3ZW9A 2V55B 4PAWA 2H7CA 4YAGA 3OU2A 1QQ5A 1HFWA 2YUTA 4XLCA 2XA2A 2KHZA 2ZZFA 2HXGA 2XADA 3VR3D 4M88A 1G8YA 2W71A 2ZYVX 3BGSA 1KWKA 3ZQJA 3E9CA 1DUVG 3JQFA 1P5ZB 1U11A 3A1FA 3T5PA 3FGNA 1S7CA 1BXZA 2HXSA 4Q12A 1PK8A 3LX8A 3I62A 3TTYA 1G2IA 4ARZB 1CG6A 1Z2CA 3S40A 4MIKA 4RQUA 3LQ4A 5FQNA 1L7DA 1LK5A 3I42A 5JY6A 1NU6A 1VECA 4IIHA 4YQEA 5CVVA 4NCXA 1KC8D 1PSDA 2E4ZA 3NBYC 2Y1XA 4G85A 5CAEB 3DF7A 4RIFA 5ELMA 3REQB 1KNQA 5FADA 2CV0A 3UWDA 4B71A 3VC2A 1MPXA 4XR4A 5CDTA 1YQWA 3EHDA 1PJ6A 4OQYA 1FVFA 3ICCA 3NPMA 1NFRA 2YNMA 5KNCD 1QGZA 2HZ7A 1CNEA 4PSUA 1SU4A 2OMEA 2ZT5A 5AVOA 5UKDA 1W87A 2PR7A 3SOZA 3O95A 1U7XA 4RH3A 1XLVA 1Q92A 3RFUA 1OI4A 1E2FA 3M2PA 2XRYA 4GPIB 4KL8S 1YB5A 3DLTA 3U3JA 4Y30A 1QE3A 2EKZA 2P9FA 1DBVO 3AFNA 3OC0A 3ESDA 1ADGA 3GFGA 3RUIA 3SXUA 5LQUA 3TCNA 4G4JA 1JYEA 4PO9A 3HYNA 3AB8A 3UPDA 5C3MA 1E62A 4L8FA 4U2FA 4BN5A 1F8GA 1I7PA 3S28A 2QLBA 4C2AA 1J49A 2VJQA 2IK8A 5E1DA 3D3NA 1U0HC 5A9SB 4G0VA 5J3OA 3UMRA 3WLHA 2WICA 5K8LA 2Y76A 4BEVA 4N8SA 2DLCX 1TCAA 3A0RB 2QIPA 5AVTA 4Y2VA 4AY4A 5HZMA 1ONOA 4OGFA 4OEHA 4L50A 1TUIA 1QG4A 3QUCA 5FOTA 1JSRA 2RKBA 4RIIA 2F17A 2QRZA 4O29A 4GLOA 2GN1A 1M1YB 3L7DA 1E9FA 2O0JA 2Z2ZA 1T3HA 2GEFA 1QAQA 4DNTB 2B20A 2VAVA 1LBIA 4X95A 3S1SA 4KFCA 4TWZA 3D6HA 1MVOA 1Z4OA 4Y7DA 2PUWA 2YV5A 3FLEA 2GK4A 4ARAA 2Q3EA 3W79A 4NFSA 4UMFA 3DTVD 2FV8A 4Q48A 2GB4A 4HLQB 5TGTA 1PNOA 2V6FA 3PUJA 4IEFB 4C03A 1AA6A 3CSSA 4DMLA 1I5OA 2EQBA 4FYIA 4HN4B 5LNK6 4INPA 1N75A 2IS4A 1V1RA 3H0EA 3PNMA 4IS3A 4JQYA 4QAQA 1Y3DE 3KU1A 5KSZA 3AVVA 2RONA 2RKOA 2FKNA 3SM9A 4N8EA 5JO9A 2X3FA 1MP0A 3ZDRA 4M7PA 2GD1O 4FK8A 2IPMA 4Z4HA 3EIFA 4N39A 2XBMA 3DL7A 2R5FA 1B6SA 2OO5A 4QOFA 1DXQA 4JLSA 3KXDA 1PJ5A 3QLJA 1ESCA 1G3RA 2GM9A 2RGGA 4TYPA 3OTWA 3GVCA 2OHGA 1W46A 4U5XA 1J07A 2IYAA 4CTKA 2OB1A 4EGSA 4BFCA 1A4UA 4IDCA 3OHPA 5FHQA 1PN3A 2D6FA 3WRWA 4CIDA 1OLUA 1E6KA 3KO8A 1KEPA 1K66A 5G0SA 4DT1A 2XZLA 3OPYB 4LZNA 2GPNA 3GRPA 2GS9A 4RF2A 4G7XA 4GKJB 2X2OA 1NXXA 1NC1A 2N3ZA 4WZTA 1JKXA 1E2QA 2JVKA 5IM4A 1I10A 3HO6A 1TYCA 3K35A 2YFQA 1ZM4A 2WEKA 5IT5A 1FYXA 3GPBA 4WXRA 4ZARA 4DS3A 3E1GA 1RWKA 1WMAA 2QL6A 3VAYA 2ISQA 1BO6A 1I4WA 3IDSA 1E8MA 5H1YA 2POCA 1K6IA 3B36A 3ZQ6A 1TAQA 3P4UA 1JJ7A 1R6UA 4A2WA 4BWGA 1D4OA 1FFXB 4J1NA 4K40A 4MRAA 4UHEA 4JI5B 4CM7A 3WIVA 3Q7SA 4BKQA 3HTXA 1ODFA 2WWGA 4PM4A 1N6RA 4WN3A 5JY1A 5K05A 4BMOB 2GN4A 5AKLA 1I3NA 5JVDF 2EX4A 2D3NA 4OIMA 4YJ3F 4AUNA 1XT6A 3B12A 3A8JA 1M6HA 3WJ1A 1OLXB 2VP4A 1WX1A 3GJTA 2DCMA 2VDJA 3KHTA 4YELA 3MXTA 4N76A 1NJFA 1Z4QA 4E51A 2R5NA 2VA9A 2O2XA 1DWUA 2HNKA 3EXHC 4OHYA 2H18A 3A1EA 2I2FA 2NTYC 2FPLA 2X6TA 1CP2A 4KQ6A 3MYYA 2PNFA 4RDIA 2OYSA 4KBFA 1JMKC 2VUTA 4CYMA 4N01A 5AIAA 2FR8A 3U26A 4OXXA 4U1RA 4YONB 2P11A 1S6YA 2UYCA 1Y7LA 2B92A 4O4IB 3HNPA 3LWZA 1N33B 1SBHA 1DBRA 4ZOQI 5HRCA 2YV1A 3A2NA 1YVPA 4TS9A 4ZA2A 3NGXA 3C70A 3QI2A 2P6MA 2QI9F 4IR7A 1X1TA 1PE0A 3LBNA 3OZXA 4RX1A 4V0OA 3EZ7A 4U6QA 2WMDA 5M04A 2FFHA 2R8YA 5FPYA 4J16A 2CJPA 1NA5A 2NO9A 1XKLA 2B4KA 2FVYA 3PIIA 4X20B 4Q9LA 1JHVA 4KLAA 2HQBA 3RARA 4EFMA 5EMHA 5F3DA 2C96A 2B98A 1MT3A 5KSWB 3MBKA 4HFRA 1GTJ1 1UAYA 2J3IA 4OPOA 2Q3BA 5D7NA 5L3QA 1KQGA 2QGZA 2P7IA 3IDOA 3IB3A 5HF6A 4YJ2A 1N1DA 4JWKA 4G67A 1VQ4B 3DLIA 5A3RA 3ORHA 3L9WA 5AFSA 5JYBA 3VDRA 4DA8A 2GZAA 4RQBA 4F5DA 3C3CA 1Y5RA 5LUAA 3B9BA 1Q21A 1YTUA 3V1KA 1Z15A 1D2HA 5ALGA 3TIVA 4V3BA 4D4IA 2B1JA 3AUXA 3Q7TA 4E15A 2I2BA 2QTGA 2W2PA 4H59A 1OFUX 1HNNA 2Q3FA 4YCCA 1PR9A 1O87A 4JJ4A 1X7DA 1KDRA 2QAGA 2PEZA 2YS6A 3BMNA 4G4IA 5K8VA 3ZLBA 4DYHA 3K9WA 5KVAA 1H6BA 2FEXA 5FPSA 2XTMA 5G02A 5B1SA 3ZCUA 2WG0A 3EHEA 2RH8A 4FE7A 3G7UA 5CEEA 1SRRA 1SVUA 1VJ0A 4NU8X 4RPLA 2I67A 4HB3A 4P9NA 3FNFA 3OTQA 5EWMA 2YJGA 2HRDA 1JR3A 1CERA 3H65A 4G0MA 3WLMA 1NRJB 1M2OB 5EHQA 3ZVRA 1ONSA 3PC8A 4REQA 4IDPA 2WWYA 4EG8A 3ODGA 2PLWA 3L93A 1WEHA 1QH9A 2Q8QA 3KSAC 4YNBA 4JBLA 4ROXA 3FWNA 4YJFB 1W4BA 5F78A 2AEEA 2RB5A 3C41J 3VR4H 2WM9B 3F73A 1NVDA 4AG6A 1KC3A 2Z1DA 5KNBA 1JALA 3CUSA 4GYWA 4IFEA 1DFGA 2OXIA 4GMGA 5G0WA 4XM2A 4IIJF 1DKLA 2J6CA 4EVQA 1NSYA 3FDFA 4K9RA 5BR8B 1G16A 2AXQA 3H9EO 4H9GA 1ZOIA 1Y9DA 4PHGA 1J90A 2BE7A 1CDOA 4O2BF 1ZD3A 3D31A 1G6OA 1H0RA 5TVGA 4DGQA 4MS1A 1JRLA 1F8UA 2A1TS 1KDOA 3VVMA 4BLSA 4E4YA 2CJYA 1LLCA 1IUKA 1F1JA 1Y7HA 1P73A 1QV6A 4YQYA 4D2IA 1T15A 4M3NA 5AH0A 4UATA 3P27A 5IAOA 2FGJA 1U3WA 1KSFX 2GAOA 2JJ2D 2ZYHA 3IHWA 1SIOA 2N46A 1SOUA 1N5DA 4O4LF 4YUXA 2KJQA 1Y6RA 1JNYA 1EWRA 1K8RA 2D1SA 4AZ3A 1K75A 1T8SA 2GYVA 3L7BA 1AQ6A 5JMOA 3LQQA 4WDQA 3RAJA 2I1QA 4B6FA 1Y3CE 4BBZA 5IYNA 1MHTA 4QPPA 2YRWA 1V2GA 2ZB4A 1TO2E 3VJLA 3OSUA 2IXGA 2UZ1B 1RWVA 1Y4ZA 1NBIA 4JLAA 4O4HA 4BRWA 2VPZA 4TKZA 3ZY5A 4B6EA 4JJ8A 1Z6AA 4FGLA 4LQCA 3URMA 1Z17A 5CTAA 1T4CA 2CZGA 1P77A 2ZIAA 3A27A 1EHIA 2OV6A 1D0SA 2X1VA 1VPEA 3HJCA 1QS0B 4HXFB 3BXZA 2O3TA 3NTUA 1E0AA 4QDXA 4AP5A 3N58A 2RAPA 1C4WA 3GLHB 2AFHB 4IKEA 5CAEA 2UZ0A 4AF6A 4V1CA 3RBXA 3EZ9A 1PKEA 1UBJS 2P35A 4Q16A 1KPIA 3WIBA 2Q29A 2R60A 4YV0A 1IPEA 2VQDA 4ESVA 4OP7A 1OGJA 3BN3A 2HDNB 2EWVA 3SIPA 1BEZA 2MDTA 3EGDB 3IEPA 4D6PA 2WZQA 3KT3A 4NBRA 4A8JB 4R98A 4E5NA 4IV5A 4RHCA 2G0TA 2FP3A 2YINC 2ZPTX 1W25A 1ZOOA 3QPBA 3WQSB 4B35A 4K9LA 4XVHA 3OPMA 3QKIA 4LTNA 4BU1A 1VCOA 4GH5A 4XN3A 1VE7A 4NZPA 4RZQA 2QMOA 2BLNA 3NQ41 4N6NA 4B8ZA 4GGOA 1EEHA 4XE5A 1J09A 4NOJA 2X3YA 3NFRA 5D86A 1T0BA 4QBFA 4S0XA 3FF1A 1Z4NA 5JVDB 4Z3OA 1V6AA 1NMSA 3IB6A 5LDHA 1P5RA 3L0OA 4CGZA 1WPCA 1R6XA 3TR6A 2ALJA 2VJKA 5H81A 3HDJA 3K1AA 2B1RA 1XNGA 3OM9A 4ZVRA 2H1LA 1KDZA 1M7GA 3FD8A 4TWJA 4W5NA 1VIMA 3BMQB 4QU0A 3RGWS 3OFSA 3U7EB 3VKHA 5I45A 3CLUC 3IX7A 2VPQA 5AO9A 2FF5A 5F4BA 2C57A 4XQ0A 2KW5A 1HH4A 1XTSA 2XW6A 3FPFA 3UWOA 1SXJC 3QWFA 4CODB 1E1NA 5C4IA 1MAAA 221PA 1CNFA 1MABB 1XTJA 1HUQA 2O52A 3GNSA 1JR3D 3LUKA 3QXSA 4Y8VA 1RZUA 3D6JA 4FR2A 3UA3A 5CG1A 3LQRA 1SKMA 3FPBA 1U0EA 4PBRA 5B64A 1C14A 1DX4A 4QQRA 4TS1A 1CEEA 3GROA 4R31A 2WILA 1UJ5A 2O8VA 1A0OA 5AJHA 4C1BA 2BRUC 4P7FA 4WXEA 5TB5A 2C54A 4I6JA 4JP5A 4ARSA 3TLEA 7GPBA 1A9ZA 1ZLYA 1ISGA 1FRQA 1ST3A 1O5IA 2BZGA 2JLXA 4G0UA 2JFBA 5HMLA 2CY0A 1JJ2B 1MMFB 2JIDA 4QO8A 4TL7A 4XJSA 1RE1A 4B0PA 5KNBD 4M87A 5DM70 2CHQA 4FCTA 1Y6ZA 3RROA 4PHHA 4AN1A 3QF4A 4WBXC 1EHCA 4AURA 2WKQA 1CUZA 3TUJC 4IUDS 2PL1A 4UNIA 5FFNA 3C1OA 2MSCB 1RLUA 4I5EA 1U0FA 3LYLA 3NKLA 1PZXA 2ZL6A 2HLNA 2EAUA 4FC6A 1Q0PA 3O75A 1WORA 2GXUA 4R1TA 5EE3A 3VJMA 3A2KA 2A0YA 3ZE7A 3DLBA 4OI0A 4OKNA 3LKDA 1DIHA 3T7CA 2G76A 2QUAA 1NSFA 1XIVA 2F00A 4MOWA 1ID1A 4GX0A 4L3VA 1GUBA 1DPFA 1ENOA 3O73A 4P3KA 3TBKA 2X8KA 4MI6A 4F9EA 4D5GA 5HZHA 1E92A 3GBSA 2AC7A 4MPTA 4ZJUA 4TOIA 1UXGA 4IX9A 4MARA 3EF0A 3GC6A 4KREA 2XKAA 1PJBA 3FYSA 4I7EA 3RAEC 4BGVA 3CW2A 1VMEA 3IDZA 4TSRA 3AJDA 4QFBA 2ZWMA 3ZV5A 2H1OA 2QYOA 2XGOA 5IKOA 3IKJA 5K4GA 3B1FA 4JDUA 1BKSB 2FSVC 4M9RA 1FFHA 1VSTA 1U2DA 1U0OC 2ZEJA 1HQCA 1QG2A 2P75A 5ITWA 5LVAA 1D07A 3S1AA 1ITZA 2JJ1A 1BJRE 2G1AA 4OYRA 4J3NA 3M6IA 3RVBA 2Z56A 4HDOB 4OI4A 4MGHA 5IT4A 3EEYA 1LBSA 5EMLA 2Z5LA 1XHEA 1XZKA 1VJTA 1B1AA 1GDDA 3NEPX 5JNRA 1Z9BA 1B26A 4LF8B 2FW6A 3IA7A 4RK7A 1EKXA 1KP9A 2V7QD 3I64A 4N7BA 5DBIA 5B3JC 4XFDA 1XN1A 3H2YA 4QUIA 1M6WA 4WI1A 4FFMA 5IVDA 4HGPA 1W35A 1KBOA 1SXGA 3U3DA 1CWUA 1XDWA 2ZREA 4ITUA 2FRVA 5FWXA 4UASA 3FTEA 3GLIE 2PGJA 4PYMA 2XUQA 3DS8A 3RW9A 4WLVA 4WZAB 5GONB 5JAQA 3RRJA 4PE5B 4BGUA 5KTPA 3KL9A 3KETA 1JX6A 1QWOA 1NRKA 1WA5A 4YTEA 1QNLA 4YAJA 3GOQA 4NEQA 3WP1B 1CDZA 2BE9A 4UCWA 3K8YA 3KAPA 3BGDA 2ZWPA 5KHOC 4QU5A 1G18A 3MLAA 3U6BA 3MTDA 1U3UA 1GL9B 5J63A 1FMTA 2BRUA 2A0XA 5D8DA 1N8SA 1QBKC 2VZ0A 3BL6A 2ABWA 2AVNA 1C4KA 2B69A 3BRSA 4Q6WA 4P84A 5DTJA 4EF6A 5DLEA 4DA4A 1A5AB 1QO7A 1P2DA 1QIHA 2C4NA 4HDCA 1W2BB 2J4CA 4XH9B 3CCCA 5D1NA 3TX2A 1X1DA 1D6MA 3I2GA 1PKXA 3W2EA 3ZPNA 1USUA 2G28A 1Q22A 3N0WA 4Y6PA 2OP0A 5KOHB 3BT7A 1O4VA 3ULKA 3MZ0A 1NDUA 3TRHA 4AZ0A 2C5BA 1C3XA 3MEQA 1Q0SA 1J8MF 4XIJA 4DUGD 1QJCA 3QUTA 2O2CA 1XL0A 4IVRA 4WOCA 4XDZA 4C08A 2JIOA 4WV3A 1A2KC 3AY3A 4WVLA 5HOEA 5JZ9A 5DGDA 3LWDA 1EK5A 5G4KA 2QLFA 1NR7A 2XV1A 3DMPA 3KE9A 3QWIA 2JJQA 3CE9A 1CIVA 4RESA 4WOPA 4F2DA 3JTEA 1A76A 2R25B 3MS7A 1I3CA 3VO8A 5HVNA 2O5VA 2I76A 2QUBA 3KWLA 1E5XA 4OM7A 2ZU0C 2EYQA 1ECLA 3EVAA 3EZ2A 5EQJB 4TKLA 5REQA 2VYVD 5AHRA 4HNAA 3TSAA 3PUKA 4ONEA 1CUEA 4JLPA 5DMXA 3LLSA 3RTDA 3KOWA 2CNNA 5DN9A 1DMSA 3Q8WA 3RUHA 5JD3A 3B13B 4JC8A 4RDXA 4GZLA 4ERNA 2V0GA 5FR2A 2ZI9A 4WN9B 4EJSB 4HG2A 1KD1D 1AD2A 3L2OB 3SG0A 1N5JA 3O8DA 4PO1A 3A14A 2WSIA 2WTXA 3DE2X 4XWOA 5KEIA 4BMCA 2QZ4A 1M8GA 1I0IA 1FQWA 1DKUA 3WB1A 3ZX4A 3EDMA 1LSSA 3TRKA 5JI3E 4UC0A 1JXOA 4MHOA 3VYRB 2AMJA 4CMEC 5HQ3A 3NHJA 1LV7A 3E2IA 1RXIA 2I78A 2NW6A 1WOSA 3ISVA 4HJRA 3PD7A 1W94A 3OUUA 3TNJA 1QIMA 1UANA 2F9LA 2ZTHA 1LI7A 2GZHA 2O59A 2W6CX 3KQTA 4GZ3A 1OI3A 1K92A 3IKLA 1F12A 3OZTA 1CQZA 2CN1A 1L5YA 5H7XA 3WRYC 4DQDA 4UXJA 3MB8A 1A98A 3HABA 3DAYA 1IHDA 3RS9A 4CKZA 1B8VA 3I04A 4Z4QA 3TFOA 4Y6RA 5BO5A 3L6BA 3A05A 1OWNA 4MZDA 4XL9A 2QTTA 3PUNA 2VYCA 1JQ5A 2BFOA 2V0CA 5LBIA 4F97A 1PDWA 1P1RA 1OAAA 2DUMA 3QG1A 4E11A 1JHXA 2RGAA 1GITA 5GAJA 1IY9A 4LYFA 2BSQA 3VH3A 5BWOA 3RNLA 2IYFA 3CZ5A 4R1PA 3SZLA 2VBCA 1FDSA 2WU3A 3CZMA 5FWYB 3MJVA 1QH1A 1DNPA 1KORA 2ORYA 3OJEA 4FI3C 4MEJA 3U3RA 3UJ3X 5KOYA 2EFCB 3ZDXB 5JJ5A 3N8NA 3DBHA 4J0GA 2Z43A 3NEYA 3IE1A 3C8UA 3S70A 1HLFA 1UWVA 2D13A 2X4DA 2MSLA 3G71B 1BXRA 3BBLA 3NTRA 3UHFA 4B5LA 1J5EB 4NXNB 2EJBA 1ORTA 4DYDA 3K16A 4EGFA 3QUAA 1GJRA 1RMYA 5DLPA 2ISSD 4C0KA 2ZZMA 3FSGA 2VQ6A 5LL6P 5CBPB 2YY6A 1BD3A 4OXNA 4LTDA 3T4UA 1U9IC 4GM1A 4RFVA 4ZCLA 2FK8A 2I1VB 4HE5A 1ZL0A 2YICA 5AUNB 1P2UA 3D8RA 3GV0A 4N65A 4RKYA 1I2CA 5JXGA 1NNEA 3K70D 2GCPA 1XWIA 4NMMA 4MUEA 1SUCA 3UK2A 10MHA 3SSAA 2YW2A 4LEIA 1SU7A 5JG7A 4QFDA 3WLAA 3HSYA 2WTUA 3JQEA 4EH1A 4PSDA 4WESB 3A7DA 2B61A 3VNVA 4Z4ZA 3W2TA 1L4KA 1GQQA 2YASA 3R5TA 1IHPA 4RTSA 4DV0B 3W4JA 3WMGA 3T1QA 1UD4A 4NJEB 3L0CA 4F4FA 3TNFA 3V8QA 4EL5A 1W30A 4O2AF 1U0RA 3D3WA 1T3ZA 3FNGA 4LTMA 3LH5A 4HY3A 4UXIA 3JAWA 3PDWA 4IDDA 2X6XA 4HGZA 3VQTA 3VR6D 5IWCA 3UYLA 4Q3BA 4C7OB 2NU8B 1E3SA 1NGSA 4AWXA 4JB8A 2HHJA 3LVFO 3ADCA 3KLMX 1KK3A 4JKYA 1QFXA 3ZH9B 3CN9A 2CV2A 3WQBA 1RKQA 1QC5A 4RY0A 1H94A 4B4OA 1RKUA 3ONWA 1UZAA 2B21A 3KS9A 2WG2A 4IOKA 5EP2A 2ZDHA 5GONF 3W8FA 3X1YA 3OC6A 2AQKA 4ZHQA 3QOYA 1PZHA 3WB0A 4ND7A 2QAGC 2ATEA 5EYPB 3T7IA 2Q3HA 5CYGA 4GF5A 1D04A 3IR6A 2QS9A 1KS9A 3NKFA 3S8YA 3GZJA 4Q9DA 4DCOA 1SKBA 4ZHSA 5DHQA 2B34A 2CNLA 3M4YA 2IYUA 5FNVB 1YRAA 1VB5A 4G9EA 3UJDA 5IULC 2HQOA 1YS6A 5LLDA 4ENQA 3N75A 3O3CA 5CX4A 1BWPA 4D9HA 1AJEA 2CYCA 4R6WA 3TLCA 1BDBA 4PCUA 3ZD8A 1T2FA 1ZNYA 4EHLA 1IQ0A 2AD1A 2E5WA 2W8ZA 3R6JA 1TJ4A 1NRIA 4NLLA 3UMMA 3O8QB 5EFZA 2Q5QA 1ZGGA 5ER6A 4BX8A 1ZD5A 2I8CA 3LGSA 5HXAA 4A16A 1E6LA 3R40A 1MB4A 4U7HA 3W9BA 1GXSA 2HREA 3T5TA 5FWDA 4MKGA 3RYIA 2H4WA 5F9FA 1ND6A 2QX6A 1H5QA 3KTAA 1E2IA 2C7QA 2IL1A 2PS3A 3NOVA 1L7PA 2W7TA 1JYFA 4RKEA 3ETEA 1DBSA 1I4TD 3KPUA 2G80A 1P60A 1ORDA 2EJVA 4Q9IA 3RSLA 4ENTA 5JASA 4B3RB 2PSHA 3P9NA 1V39A 1DC3A 1SQ5A 1XFDA 4URVR 1ZCBA 3JQAD 1KARA 3RQSA 3WWYA 1QF9A 3ROZA 2YYZA 4DR3B 4P3PA 4EY7A 5FWNA 1EBUA 4ZV4A 2AFHE 3H2IA 2W2TA 3V9PA 4QOJA 4KXXA 2J7PD 1KYXA 3QWHA 4S1VA 2ZXFA 6CHYA 4OVKA 3VTZA 1SQ0A 3JRNA 3D9QX 3PR3A 2X2EA 1TMOA 3RK1A 3R0QA 1NB0A 1LUAA 3RVPA 3V1YA 4HMOA 3WGZA 3ZJYA 4XORA 2FPKA 3DL0A 4DK0A 1E3ZA 2REBA 3C45A 6LDHA 4QQKA 4GDFA 1Q0RA 2Q6VA 5H0IA 2HSEA 4OHWA 4NJOA 2J59A 5LYJB 3PXDA 1G20B 1F5NA 1P1JA 2FFAA 3NHRA 2G1JA 3CUKA 4AZTA 3HV2A 4QEKA 2OILA 2VBUA 1Q7TA 1MJFA 2YNMC 1FB5A 3T1OA 3U7QA 1ILEA 4KXVA 4KR3A 3K1YA 3PX3A 3CF6R 2QT0A 5A5FA 1JFLA 3NE5B 1U1DA 4PPGA 1KMQA 1KEWA 13PKA 1AB5A 2XBUA 3WK8A 2OTCA 1T5DX 1S72B 2PMBA 4ALLA 4V1CI 4KUGA 3ZNQA 2QTMA 3OZEA 3PKJA 3L0ZA 4YRQA 2HQSA 5DW0A 1IE3A 4UDOA 3K9FC 1E6WA 3I72A 2G71A 1P3Y1 3PQ7A 2WJAA 2PX5A 4GSYA 2ZVJA 4K9MA 4NRDA 4I1YA 4OQNA 4RK5A 5K6RA 3CKMA 2UUPA 4EPVA 2CEAA 2ODEA 4GW3A 2PANA 1YJQA 2QAIA 3LXMA 3CLSC 3O31A 4O6VA 4JSTA 1YKGA 1EX7A 1EG2A 2JAHA 2P9CA 4LWZA 4CR8A 4D56A 4ZCRA 1JZQA 3KZ1E 5A02A 1GLNA 1XGKA 3HLTA 3KKEA 4OCZA 1TLLA 5CXQA 3LUCA 3GEIA 1LNQA 2R1TA 1QOQB 2ECQA 2PKWA 3PWZA 1NXPA 1JZSA 3VNBA 2IUTA 1KO5A 1Z7BA 4D43A 4LJ8A 1Y1PA 3K0AB 3VZCA 4L57A 4L28A 1JQAA 3ESRA 2J3LA 2OBTA 2DU8A 2Q41A 2GBFA 2QTBA 4TKUB 2QQGA 1TLFA 4ZT2A 3P9PA 4P2GA 3DEKA 3KLOA 1CRLA 1IULA 1PW5A 3LBHA 1KY5A 3DLCA 3QI7A 5JXIA 5L8VA 1V7CA 1RQGA 3PE4A 4LRWA 3L06A 3BTOA 1NQ5A 3Q2OA 3CSUA 2FR1A 2CJWB 4RU1A 2PE5A 3T1HB 1B73A 5B53A 3TR0A 2IEIA 3UHAA 4BWYA 2VHYA 2VDNB 4RNCA 5BN4A 4ER5A 1LBQA 1ZK1A 3VUFA 3V4ZA 1AKWA 5BSVA 3MMSA 3RSGA 3GUUA 7MDHA 4LDAA 2XUGA 4EKNB 4EJSA 1RQ7A 4FONA 2XOXA 4EG4A 3U4DA 5H4GA 1GVHA 1LD3A 4XOTA 2CLOB 2QP4A 3BWVA 2GPJA 1G66A 4WCFB 3KEFA 1JT9A 2IYVA 2OR3A 1A95A 4WZKA 1GADO 1PWZA 1DX6A 1Y3HA 1ZSVA 3RFVA 4C05A 2GZ3A 2HV8A 1IN1A 2I3BA 1O0CA 1C0KA 3DFUA 2P41A 3AB3A 1ELOA 3WYEA 4ZGBA 2W6ID 3MJ4A 3V2IA 3VHQA 5CK4A 1XKTA 4H0CA 1VKZA 2MSDB 1XP8A 3L49A 3ZBQA 1CY2A 3H9UA 1E1YA 2V65A 1QO0D 2MSWA 2NXCA 3D7LA 4V24A 3RCBA 2FLKA 3C4VA 2F43B 3C43A 3GP8A 4DMMA 2FI1A 1XSEA 4G01B 2OM6A 5A0VA 3T3OA 2Q0XA 1G8JA 1L5WA 3KPWA 3HPRA 2XECA 5ILGA 2FCRA 4H4DA 4K28A 3ESYA 4BJ3A 2ZCUA 4PFKA 3E7DA 1VL6A 1T2AA 1FLVA 1VBKA 2ZXUA 3HU2A 2BH2A 4S24A 1J8FA 2BFMA 4UTVA 3UWKA 1J99A 1DE0A 2HR1A 3L4BA 2HAEA 1T2VA 4ALNA 1RJGA 1YB2A 4D8WA 4KIUA 4RSRA 4IFIA 1DQNA 3SD7A 1P4SA 4WH0A 1VZ2A 4JLOA 4L0QA 4MWZA 4UPEA 3ESAA 3PUMA 3FTNA 3EVCA 7ABPA 4EMSA 2C0QA 1KP3A 1RABA 5I4KA 5JROA 2A3NA 2E7ZA 4J3JA 3REQA 3EXHA 4PG6A 5I4BA 2VHCA 4YI5A 1QVVA 3L41A 3OJWA 4C4TA 2BFFA 2FW1A 3K5PA 5K6AC 1BXRB 2ZCJA 1Z56C 1AVTA 3KTFA 1FYEA 3MD9A 3JD3A 4Q93A 3ZU4A 3FWHA 4DAEA 5FLXA 3HDGA 4I5GA 3KIPA 2A9QA 4CMCA 1SG6A 4O59O 1PYOA 2H5JA 1QH0A 5JBQA 3G2MA 3CISA 3K0CC 2XQIA 3OG9A 4JZKA 5AI8A 1N6OA 5FTMA 3B1VA 1MXHA 3VJRA 2OBBA 2W9XA 2Y1EA 1XJ0A 3O91A 4JA0A 4OQDA 4MTCA 3RDPA 3SJAA 5A0TA 4AX4A 3GT7A 3EF3A 2P1DA 1R4AA 3GP5A 1HFKA 1MGPA 1FMJA 3RBVA 2G67A 1IU9A 1NPYA 3Q9UA 4NC9A 4RF3A 4MH0R 1QIDA 2OHXA 4XD7D 4YP0A 2M6KA 4I8IA 2VDOB 1R37A 3QA9A 2BSXA 3E9ZA 3ZD6A 1KQ3A 3ZCSA 1Z0FA 1NUAA 2X7JA 3DEZA 5C37A 1VSVA 2L69A 2PBRA 2XD4A 3LGXA 1JR2A 2GAJA 3JYQA 3K9HA 3QJ5A 4OSPA 3HEAA 1R50A 3G0GA 3P0RA 4WFJA 4FIDA 3QK7A 1X0XA 2FR0A 2NPIA 3J7AC 3HA5A 4XX0B 4XZ3A 4BVFA 2FSHA 5HW0A 3U5TA 2FZEA 1S2IA 1BNCA 2QVXX 4DC9A 5IG2A 1E4OA 4R1MA 3P0FA 2BFEB 3H0CA 1JAZA 5FORA 1CF9A 3UQZA 1KXJA 4M89A 4C7OA 1VCNA 1ZOLA 3OT1A 3TFWA 3QVOA 2WZDA 3GJXC 4XDHA 2B3TA 3ZW7A 1RPZA 2A4KA 4IWNA 3UT0A 1E60A 1C9DB 3KB8A 3Q72A 3EA0A 3WK4A 1FA9A 1HDIA 4AULA 3TIFA 3QE3A 3W90A 1P44A 4J2HA 3UT5B 2ZS9A 1VL8A 2IH4A 2O4UX 5KYKA 2BFDB 5EE0A 2H2IA 2LWIA 1ZISA 3ORQA 4ZHQB 3V55A 3WNQA 4F2GA 5FA8A 3GFSA 4ZC1A 1BHQ1 3QLVA 5LFAA 1F60A 1INLA 2M2IA 2D06A 2DM6A 1XX6A 1DAMA 4KLRA 4ZALA 3EUAA 1IRIA 1M1YE 4XTCS 2NSHA 4MTLA 3DHNA 4ZYVA 4KSBA 4AECA 2XCTB 1Y34E 1Z8FA 2QVLA 4LF9B 4TKMA 2C4UA 3VXKA 2GYYA 5D5PA 1BEUB 3IODA 3O7MA 5F4JA 1PGQA 3D0KA 1YHNA 4LHZA 4KCGA 3BFXA 3V00A 4XKWA 1P29A 4C3OB 1MW8X 1BRMA 3DQZA 2O5EA 1IMOA 2H51A 2PY6A 4LYHA 4IGKA 4I3HA 3KWMA 4DT1B 3ASTA 1F2DA 2N47A 2VDMB 2LW7A 5DGCA 4HWSA 2R2GA 1O5TA 2JZOA 4HVAA 4XVUA 3WRXA 4B3IA 2TS1A 2Y92A 1Z83A 2Q3LA 4IDFA 4P8RA 3VSEA 3ZV4A 4BX9A 5BMVA 5KJ1A 3TKAA 2FOLA 1ZQ1A 2AG8A 1Z0JA 1YONA 2REQA 3GRZA 4PRZA 4PPYA 3KYJB 3LOQA 3H42B 3EC2A 3HUFA 1YL5A 2ETVA 3OCCA 1N78A 1YZ3A 2QMUA 2ATIA 4JY7A 5FNZA 3S5UA 2C9CA 4CU5A 4WBNF 5EXSA 3VR5A 3HAGA 4X6YA 4G1CA 1L6IA 2NAPA 4P3OA 3TVDA 1KZ6A 2V9CA 4WZLA 4H77A 3I61A 2JRLA 4Z0TA 1NRXA 3WKCA 5IJ9A 4FTWA 4Q1DA 1JFFB 1FP2A 4Z54A 2F3RA 2I4NA 1KJJA 1TTHA 3E5RA 3V4PB 2PXCA 1M8KA 3GN1A 2BFNA 4Y1RA 2JFWA 3ASPA 2C2ZA 2W6JD 3G49A 1IJEA 1CUHA 2HH9A 3BAZA 2Q1SA 3DFKA 1K89A 3E7FA 2HUPA 3LF2A 1XCJA 3P0IA 4PXAA 4XEUA 1FNBA 3FSRA 3Q7PA 4HAXA 4JYBA 2PU5A 4N0PA 3T0FA 1E7QA 3FSEA 3MTQA 3ORFA 1Q1GA 4JEUA 2QE7D 2FQ1A 3SS9X 3MILA 4R1UA 2EQAA 2M5SA 2UVDA 2XD9A 4MULA 1HE1C 1U9ZA 3G2IA 5GOZA 4ESEA 5IM5A 4CR7A 4LOIA 2QXUA 3U48A 4QUHA 3LA8A 1NJGA 3JARA 1JMYA 3RODA 5IPFA 4RJJA 4ZOLF 4BNDB 2PPVA 2ZJOA 5HZAA 3E8SA 3QFHA 4GLBA 4UMEA 5FHRA 5LUBA 3OZRA 3QEKA 1LQTA 4HKTA 4R54A 2J0UA 3ED5A 3INNA 1U7UA 2WLTA 4URFA 4ENPA 3KJHA 4HAWA 3L5OA 1JU9A 2F6RA 4IRXA 4AK9A 3GT3A 3QMWA 4CKCA 1H8HA 1L5FA 3TLYA 3ER9A 5K8JB 3WWCA 1DX9A 3LX4A 2PD4A 1OLOA 3ME5A 4GP6A 2XUOA 4UTPA 4RDKA 1N08A 4U63A 5A2GA 1ZP6A 2Q4BA 3NUGA 3KUCA 2JH8A 5C1BA 5JEDA 4L51A 2B99A 2WFLB 1RYYA 3WLOA 1H5NA 1YJ9B 2HJ9A 3ZWVA 1K6XA 4CF7A 1RRVA 2HDOA 2OV3A 3AUYA 3GI1A 3RB8A 3UMFA 1N2JA 2JH3A 5JCJD 3CVWA 4I6EA 1YUBA 3V1MA 4J0JA 3M4ZA 3JY6A 4ASUA 2XCQA 4L3WA 4R1SA 3TYXA 3UJCA 4AN4A 5B5SA 1W85B 4X7EA 1QKKA 3QW4B 3JW8A 1YVDA 1II0A 2BP7A 1L7VC 1B43A 4L73A 2VJOA 2GASA 4KPYA 5TPWA 2CXUA 2QSUA 1W5AA 1KZ7B 2D54A 3G2JA 4OGLA 4IDNA 2BGTA 1E9AA 3FVRA 1ZK2A 4CKXA 4CM8B 2HSGA 4X84A 2OV8A 3ETLA 2ZRIA 1YS7A 4UU7A 2FZKA 4MI1A 5ALVA 1XDZA 4RHUA 4Z2YA 2SKCA 3K70C 1PJCA 2XDAA 1TK2A 1UFRA 1K7XB 1OX5A 2J9GA 4OMFG 1G59A 4B3JA 3HCDA 1Z39A 3WTBA 2CJWA 1Z6PA 3MFYA 4CT5A 1KU6A 3JQ9A 3Q1LA 4KGXA 4DARA 2V7GA 4PF1A 3L8MA 4MB0A 3PIDA 4YJHA 3BORA 4NOMA 1SCBA 1M2OA 1AS0A 4FHEA 3FIUA 3OA0A 4BNHA 1KI7A 4REQB 3TKYA 3IRUA 4FCWA 2DWPA 2I4MA 3CUWA 2GN6A 3HP7A 5CT4A 2PTHA 1V1JA 1X2BA 2WD8A 4Q0MA 3FNRA 3NHBA 1WDMA 2OVBA 4QYTA 3AF4A 4ZKEA 4P12A 5DOVA 1HMYA 3WNVA 4YUWA 1V7ZA 4ZVVA 3QE4A 1XMOB 1MO3A 4PLVA 1JUDA 5K8CA 2NU6B 2WVGA 3F96A 3GFVA 3IP7A 4DLVA 1FE8A 1BN7A 2NTVA 1D1PA 2ID8A 5G41A 1WSVA 4I4IA 1XQ9A 4N9QA 3I4CA 1GG5A 1YRYE 1SHJA 3L1KA 3OOSA 3OT5A 4G36A 4HGYA 5EZ6B 3T95A 3OIVA 1QH8B 1AXGA 2JCXA 3KKZA 3HSSA 3TL3A 3ZYZA 5BNTA 2XI4A 4MCIA 4UDNA 3OY2A 2ZAIA 3ZY2A 4BRUA 1F8FA 5IDWA 1YD7A 1K0FA 4L4XA 1UMDA 4WMLA 2O2DA 5DCUA 2JLVA 2CF4A 4GLJA 5DYWA 3TQOA 1Y8AA 3O26A 3RFFA 1YKSA 2C3OA 2BHTA 4IDGA 1KQFA 3BRCA 2PV0A 4HHEA 5CB8A 4FM9A 2B9EA 3M4XA 4C9BA 1L4FA 1PVDA 1E3MA 2CMKA 5FFFA 3WYBA 4ZGQB 2FUEA 1M0EA 3EIWA 1DQYA 2NVWA 3STUA 4A3SA 4D98A 1IEQA 4YT8A 4UCQA 3RIHA 1MC4A 2ZI4A 3R3VA 3PFHA 2VT3A 3AERB 1F0PA 2HUNA 3HI6A 3A9TA 1QS0A 1QFYA 1QU2A 1TU0A 4M1ZA 4YRZA 3ZDQA 3GLHA 2WA2A 2Y0DA 3IMFA 4YRFA 1XCGB 3MLEA 1ECGA 5B4UA 2RGRA 5BRNA 1PS0A 3R9XB 4IV8A 2C98A 2XNJA 1KMIY 5CG2A 3GPDG 4HWPA 4UW9A 2W43A 1RQ2A 3T4PA 1DEXA 4B48A 2AC4A 2OTJB 3SR3A 1ONNA 3DOIA 3HO8A 4Z9FA 4HRVA 3RIMA 3L4BC 3E05A 4G2TA 4A8JA 5AP9A 4PHFA 4PS1A 4XGIA 4ZKDA 2XLCA 1LPSA 3H8VA 2OZPA 2OOKA 3B52X 3JQQA 4KIJA 1PVOA 2PXHA 1NTRA 1UD6A 3KC2A 4L78A 5E7IA 4MQ5A 1GRRA 1W34A 1N3LA 1KFJB 1KXZA 4P35A 4W5HA 4J90A 1Y7TA 3AVOA 3QYJA 1ZH0A 2IIBA 5F5LA 1CQIB 2AJCA 5LB2A 3VR0A 4IBOA 3LUBA 4NZNA 2DFKB 2PGLA 2P4SA 3EGIA 3RGGA 4CIBA 2CNDA 2CD9A 5JZSA 4IFTA 3PHHA 2XXBA 2B35A 4PQEA 3WBBA 3ER6A 3B3FA 4FDUA 3R77A 2QUZA 1WCIB 2C3PA 1T0HB 4WJKB 4HD8A 1FU4A 4XLFA 1NLUA 2HI0A 2C2OA 4ICIA 3BULA 1HEYA 1F8YA 2PPLA 3K0FB 5JECA 2GERA 4KYVA 1JR3E 1Q1EA 5I5GA 4A5OA 4QDTA 4CLRA 3A9RA 3RABA 4UKDA 2FW0A 3NALA 1UUFA 1ZIPA 3RYHA 2QTFA 1IY2A 2H1CA 1P2BA 2ACEA 5J5VA 3FJYA 1IWPB 2IYZA 2X9GA 3FPCA 4HUQA 1GQFA 5BV2P 1J7JA 2P5SA 3GUYA 4RS3A 2GI4A 2XCUA 4Q37A 2H11A 1BOOA 4YC7A 4PZEA 4X92A 4MSUA 5MFPA 4MWEA 2KBFA 3Q1KA 3V6LA 1GRQA 2ZJAA 3FMFA 5FBZA 1X1RA 4DZTA 4K6OA 1KDVA 2EIHA 3TPFA 1RM0A 5TY0A 2QT9A 3CX4A 1P39A 2ANCA 3ORSA 4IJ6A 4L4YA 4YFVA 4AKSA 4CMKA 5TMBA 3MF4A 3DEYX 2C8LA 4FYVA 1TW2A 4XSHA 3AEQB 1ZX1A 2P0EA 1AM4D 3WGQA 3OZUA 1BS9A 2ZM6B 1L5SA 3K0KA 4RY9A 2PSSA 2WIGA 1J1ZA 1UBFA 4TUYB 4DMGA 1IZZA 4HBGA 1R7RA 4DY6A 1V7PC 2EG9A 2M1XA 3URKA 1GGEA 3DC7A 4EM6A 2X8LA 4LRUA 4YXWA 3D8SA 1KA9H 4ZGNB 4HYTA 1C3JA 3UQYS 4AXBA 2X1LA 2C03A 2Z57A 1PS8A 4Q47A 3TUZC 1Z62A 4E13A 1T6XA 5HWSA 3I9NA 4CIYA 3O1IC 2ZBVA 4P3NA 5LYYA 3LFUA 1GKUB 5LD2C 1Y37A 1CZOA 4ZVTA 3GGCA 4MR7A 4F3YA 1M1UA 4PLFA 2EIXA 1L1EA 3D43A 1YK0A 4P6YA 1J6UA 2OV2A 2V3WA 5I8ZA 4EAAA 3PFFA 2D0DA 2GNPA 4FHDA 1HYBA 2IQIA 4YRGA 5HUQA 1F7UA 2I91A 2EZ9A 1V9CA 2FVXA 2JAQA 1WZEA 3DV2A 4G0OA 4Z86A 5BQPA 4ETNA 2RGWA 4U6NA 2DFPA 2ZK7A 2HSDA 4RIEA 5ILOA 3ETCA 2G63A 5H70A 4DG9A 1DAHA 3BDIA 1O94C 4P25A 3EFOB 4JVMA 3OJLA 1NW7A 5GZ3A 1W8IA 5A4KA 1W48A 2K6GA 4R8RA 1MA3A 4PQRA 4BMNA 1W47A 5CYFA 5KJFA 1EWQA 3EDCA 3WWZA 4AKTA 4XD7A 5I9MA 3FNEA 3RM3A 2E82A 1X9HA 5B3AA 3QVLA 2CCKA 6REQB 1Z6YA 1QCDA 1E1KA 1OE0A 5COAA 3KKLA 4BZQA 1KTVA 2CDAA 4Q7QA 1NN1A 2FZ4A 2QUIA 3AK4A 4PYJA 4LF7B 4CEIB 5CA0B 4OX9B 2B8JA 4ZAWA 3FPLA 3NC0C 1UBHS 4M8SA 4MR8B 5T57A 4CUJA 2GN9A 3ZY4A 3THYB 4L7VA 4YO7A 2WTBA 2J5XA 3FYTA 4OJNA 4R0NA 2PU7A 2ZJ8A 4U7WA 4DR5B 5SYAA 3EIUA 3AFMA 3D7KA 4IJVA 3W8DA 4A7PA 1KI1A 1KAOA 3HB4X 4M7OA 3H5OA 4XOUA 4DSUA 1AHHA 5JNLA 4JI4B 3AKCA 3TSZA 1GTSA 1IOVA 1U0BB 2QRMA 1FMLA 4KQHA 4LI3X 1A04A 3QVXA 3GLIB 3JVIA 1H22A 2N1BA 3FNQA 3FCOA 3GVXA 4WE3A 3VYVA 4B3MB 4N3AA 2XZDA 3CLUD 4UNPA 5AKIA 4TSKA 3H86A 3MCTA 4X8MA 3ICPA 4RGBA 3DP9A 5AOCA 3HVIA 4TKOB 5IBPA 2LD4A 4RV5A 3D5QA 5ITVA 1EE1A 1OH6A 3D2BA 1HBJA 4YP7A 1FP4A 2HYIC 4JKOA 3RAFC 3L92A 5J4YA 5JSHA 4QO7A 1DRWA 3GMTA 1JV2B 4P34A 4RANA 4RL4A 2O8DB 2J9RA 3EOAI 3TMYA 3HE3A 3DVSX 4NU0A 3NCHA 3GFQA 1FP1D 1NE7A 3I5YA 4M21A 5G3YA 2W6NA 1XAHA 3P0EA 2E3JA 1ZWKA 1XYVA 1SD2A 4BFYA