3JQXA

Crystal structure of clostridium histolyticum colh collagenase collagen binding domain 3 at 2.2 angstrom resolution in the presence of calcium and cadmium
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
117
structure length
117
Chain Sequence
YPIGTEKEPNNSKETASGPIVPGIPVSGTIENTSDQDYFYFDVITPGEVKIDINKLGYGGATWVVYDENNNAVSYATDDGQNLSGKFKADKPGRYYIHLYMFNGSYMPYRINIEGSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Comparison of ColH and ColG Collagen-Binding Domains from Clostridium histolyticum.
pubmed doi rcsb
molecule keywords ColH protein
source organism Clostridium histolyticum
molecule tags Cell adhesion
total genus 23
structure length 117
sequence length 117
chains with identical sequence B, C
ec nomenclature ec 3.4.24.3: Microbial collagenase.
pdb deposition date 2009-09-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.380 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3jqxA00
1U5IA 5FBZA 4DXZA 3JQXA 4I3GA 1NQJA 1NQDA 3BOWA 1WMEA 3AFGA 2QFEA 4DY5A 5FAXA 5SV5A 1WMDA 2XVKA 4HPKB 2LUWA 1WMFA 1KFUL 1DF0A 3DF0A 2XVLA 1KFXL 4G9SB 4DZGA 2XVGA 4HPKA 3JQWA 4DY3A 1QXPA 2O8OA
chains in the Genus database with same CATH superfamily
1AXZA 4OI2A 2VOTA 4B1LA 1UYXA 3N9OA 3KLSA 5DG1A 2CV6A 5FPUA 3ZFEA 1G9DA 1W2AX 3K51A 2HWB3 2YFZA 3CO2A 1R64A 2W9XA 3DUIA 4XF9A 1RUG2 5L9BA 1TME2 3KGZA 3MDPA 3VBOB 5KHGA 1X36A 2VTXJ 3SKVA 1NAEA 3DL3A 2W1WA 4KBZA 2MPFA 3RZKA 2RM22 5FZ4A 3AZVA 3ZXLA 3OOXA 1LTEA 1WA4A 1Z78A 3LB9A 4GB31 4WVVA 4DOUA 2HWC3 1U5ZA 1CIWA 3O1SA 3I3BA 1LCLA 1O59A 3PMEA 3PUAA 2PHUA 3POYA 4PIYA 2ZAAA 1FMD3 2QKDA 4QKDA 1D4M3 3KCXA 3DPRC 1UQXA 3EB7A 1R091 4XBLA 3WDYA 5FYZA 1AR82 2VUCA 4OUSA 1CGPA 3SKJE 1O4ZA 1W06A 1YFXA 2WWUA 5CFDB 4XYXA 2WO7A 2VQ0A 1RL3A 2BFUL 3O0XA 4QX7A 2VR4A 3LE0A 4G4FA 3GALA 2CWMA 4QWNA 3VL9A 1GQHA 3BIEA 1NKGA 1QMJA 3ON7A 3KV6A 2QE3A 2A6VA 2UY9A 2B5HA 3PJQA 4IE5A 4CCNA 5LEKA 1G9BA 2AENA 3VHOA 2PHTA 3HVDA 4LE4A 5DDJ1 3RFRA 1PNFA 1VBE3 1HQWA 2P17A 3HIFA 5DZEA 1N3PA 1XYNA 1SCSA 2BVBA 5A7WA 4OHXA 4JRAA 4QT6A 4TXWA 1ODMA 2B42B 1V6MA 4IERA 4OCTA 4RR3C 2ID4A 2R32A 2I45A 1F5FA 2O0OA 4NIGA 1YQCA 2WYFA 2XKPA 2ZEYA 1BEV1 3WSOA 3ACHA 2TEPA 3NKTA 3C7OA 3NMBA 4ARYA 1G9CA 2JDMA 4M4PA 3H3UA 3WW3A 3EJKA 1IQDC 1KGYA 3DF0A 1NXMA 5CISA 5IVBA 4JAAA 1XNCA 1YUDA 1YIPA 3WXPA 5A6YA 5A7PA 2W47A 2WN2A 1HN0A 4HVRA 2R1DA 2VL4A 1RUI3 4YARA 4NPMA 3LDBA 3U4XA 3ZSEA 3AK0A 2JG9B 4MXVA 2A73B 1QDOA 4TZDA 1W9WA 1GP4A 3HNYM 1ND2A 2R073 1MQTB 1F4AA 4XJAA 1NYWA 4N43C 3T09A 2DF7A 4A7KA 1W6OB 2QFEA 4CEYA 5C33A 4CUBA 3N7LA 1NCQB 5A6XA 4WZFA 4HG6B 2ERFA 3N9QA 1HKDA 5C3OA 3MGUA 3V0AA 2LUWA 2R042 4XFHA 1OH4A 3LF7A 3E5XA 1W6PA 2FMYA 1F31A 3ZFGC 4AQ6A 4WM7A 2GNMA 1WBFA 3S30A 3VBHC 3D82A 4NIIA 5F3IA 3IT8A 1VBC3 2XJRA 2BWCA 2X10A 2E9QA 3H3ZA 3UK9A 1ASJ2 1SACA 4LITA 2WZR2 3PURA 1LGBA 4QX8A 1GQGA 5CA6A 4XUPA 2BNMA 3W58A 2ZGUA 3VUOA 2QZ3A 2ARAA 3S7IA 1GWMA 1RHI3 1OQDA 2IXLA 4M3CE 2YBPA 2R0HA 4OHYA 2J1SA 2KXLA 1QXRA 2WBKA 5FBJA 3WDWA 1APNA 3ZYFA 1OLMA 2BBAA 2RE9A 4JGYC 1R1A2 3M3CA 2B8MA 4JGZB 4XMIA 3VGIA 1BZWA 1W8ZA 1UY4A 2GP3A 2OT7A 3CBNA 1HJFA 4Q5OA 3V64A 1JUIA 4BMEA 1ZBE2 5FZOB 2IVJA 1HRV3 4J6GA 1LGNA 4HN0A 3WW4A 3HR9A 2O1QA 4MHRA 2VZTA 4FPKA 4LUKA 5E1RA 5F39A 3FHIB 3K75B 1SLTA 1FOD1 1OLQA 4AFCA 1RUJ1 1XOYA 2QQUA 2WO2A 2OXBA 3KT4A 4IEOA 5FZ1A 3VD7A 5LK7B 3O1OA 1I9RA 2GP5A 4N53C 2A6XA 5T5OA 1RUC1 4NHXA 3GBWA 4OHZA 4XFFA 3T2OA 1LB2A 1ZZ9A 4V2WA 1UO9A 3AP4A 3IDCB 4XACA 1ZRIA 3WQ7A 4PCRA 1ZBA2 5LA1A 5F5CA 4KQ7A 1CAWB 1WMXA 2WSUA 1Q8SA 2X09A 4LLFA 5GZFA 5BNNA 2NN8A 3N7MA 1YJKA 3J7HA 4QPYA 1XNDA 5JMCA 4B4PA 1LHUA 4CEWB 1ND3B 1YRZA 3ST7A 1B35C 1WZXA 3P3NA 1J58A 4D6QA 2Q1ZB 1NOVA 1OD5A 1JZ6A 2Q0AA 2XUMA 2OW4A 4XJWA 5FZEA 5FV3A 5ABJB 2BOJA 3G6JB 4UFIA 3MZHA 2R061 2Z5WA 3CJIB 3UGGA 4ZU4A 4BMBA 1OUSA 1CQ9A 4IEVA 4UBHA 3LWCA 4OLLA 2DYCA 4N90A 5DABA 1HW5A 5FLJA 3AYCA 4QX0A 5JPMB 3IAPA 2VQAA 2ZGLA 1OC1A 5IFPA 1Y3TA 2W52A 3SXWA 1CAUB 3OYWA 1ULOA 1RUE1 2RMU1 4JKMA 1PK6A 4F83A 4UF0B 5HXVA 5L7OA 1WCKA 4HLTA 4GH4B 4LNVA 2YDEA 4D6SA 5GM0A 4Q0SA 3VBSB 1W90A 3MIDA 1N3QA 4FFFA 4YW1A 2XJQA 1REFA 3TEZA 4PHZA 3DYOA 2Y6GA 4CDQB 3KT7A 4PDWC 4RQPA 3UKVA 1S2KA 2YB7A 1E5IA 2HWE2 2FDKA 3WOGA 3A0KA 2PHRA 2YMZA 5KXEA 1HDKA 3WCRA 4K6BA 5EWSA 1N3OA 2NYYA 2PHLA 3WY6A 5IFTA 1LKNA 1IG3A 1JZ3A 1YHFA 5FZ8A 3POBA 4BIOA 4MGZE 2Q1MA 5FYSA 3PVOA 2W39A 2WLPA 1J1LA 4NWVA 2VCMA 2JKXA 1J83A 3TYJA 3TEWA 2VMDA 2WN3A 4UYBA 1RMU3 3INAA 3FMGA 4HZFA 3BPSA 3MW2A 1FAYA 3OB8A 2VAUA 1GBGA 4H3WA 3VBOA 4OHVA 4Q8KA 2BFUS 3NNJA 5KHJA 4YVWB 1BBT1 1ZYBA 3GBGA 4CU7A 2OUJA 3USSA 4AEKA 4FFHA 5H9PA 3ZXJA 3MFCA 1ZZBA 3AXDA 3O0WA 4IEZA 2J1RA 3EHKA 3K48A 1H2KA 2DCZA 1A34A 1HLCA 4MLOA 2Y0IA 2XBO2 5C9AC 1PO21 2WQZC 3N3HA 1QHDA 4P9LA 2VD7A 1S2EA 3MO4A 3MEPA 2RS52 3UJOA 2E26A 2WZPP 5F5IA 4R9CA 2B46X 5CFDA 3I3EA 2YUEA 5B4XA 3QCWA 1TME1 1QJX3 5FOJB 2DCKA 3JUUA 1DIWA 5GLUA 2J1UA 4CCJA 5J96B 2RM21 5JXIA 1XSRA 5I0RA 3WQ1A 4FTBA 4XQWA 5C4WC 2CGNA 4UBGA 2ZEWA 1SLLA 2VBPA 4I02A 5C70A 3LKJA 3MF6A 2R49A 2QQJA 2DVBA 1PVC2 2I74A 3LFMA 4KWJA 4LLOA 5FZIA 1V00A 1VBA3 2AGSA 2YU1A 4EZHA 2EIEA 3AX4A 3HBZA 3VZNA 4JKLA 4GZ9A 2D3PA 4LO8A 3OG2A 4BLJA 2A6ZA 5BNQA 1O5LA 3PVBB 2E31A 4RYDA 2HWF2 5FXXA 2GC0A 1VPHA 4WM8B 4JX0A 2ETEA 3SHRA 4EYUA 3Q8AA 1Y9QA 3ZYGA 3SITA 3C8XA 5F7UA 1QQP3 2YXSA 1AX0A 3JCIA 1QWRA 1HB1A 4MH0E 3E6DA 4QKFA 4FPLA 2VY0A 1JW6A 1ZA4A 4LO7A 5FP3A 4UFLA 2GNTA 4LEJA 5AC92 1CAXB 1C1FA 1POV3 3JD72 3M8LA 4JGYA 4EWDA 3BODA 5JVVA 2PQSA 1JH5A 2FDIA 1W0NA 1J84A 2IXJA 5KBFA 1COV2 4AFMA 1CN1A 2VOWA 1XU2A 3OUIA 3JQXA 4ATFA 1JZ7A 5FZBA 1NCQA 4ITCA 4QXCA 3GHMA 2BUKA 4XAAA 1REDA 4XILA 1CX1A 1GZTA 3PLQA 3I2IA 5GLVA 4YM0A 1ULPA 3SLIA 1XSQA 1WMDA 5A3WA 3ROUA 5J7MA 1XNTA 2D93A 2ZGOA 4N9IA 4ZS2A 4E8CA 1AUYA 3PL0A 4DNYA 3RZHA 1Q8PA 3IN9A 3VHNA 5KXDA 5LCWL 2SBAA 1H0BA 2PMWB 1TQ5A 3LQCA 3OPWA 4BCUA 1QJU3 1MS9A 1URXA 2XWJB 4QGLA 4AEDC 4CP2A 5FPXA 1ULEA 4I30A 2CGOA 3EYPA 3H1YA 3MIBA 2Q8DA 1GWLA 3R4DB 1I3HA 2XB6C 3HQRA 3NRUA 4BQYA 1QKQA 2ZXQA 1CONA 2D7FA 1GMMA 3AFGA 1RUH3 1PGW2 1HQNA 1PX4A 4IEUA 4AQTA 3WP5A 1QJFA 2R041 1AJOA 5GALA 4QD2A 5IVEA 2XH6A 4JGZA 5FP9A 3WNPA 3ZM8A 4HONA 4MGTA 2WC2A 3B5LB 2D98A 2RJ2A 1LOBA 1Y4WA 3CMGA 3AMMA 1OOPB 3GXUA 3PU3A 1UU5A 4COWA 4K20A 1ASJ1 3NV1A 2WZR1 4FPYA 2HKXA 4HPKA 3MBWA 4I2OA 1LULA 5KHHA 5FXZA 3T3YA 1WW7A 2VBDA 1FT9A 4LO6B 4M3CB 1XE8A 1BQPA 2KD7A 2Y6HA 3PHMA 5CKQA 2JDUA 4C91A 4CTEA 1PGL2 4ZY9A 1LODA 2VU9A 3THPA 4CPBD 1S0DA 5FMCA 3AYDA 4N7UA 1MS1A 2SLIA 2WNUC 1R1A1 4IEWA 3T1LA 4CXWA 4Z2WA 4YM2A 4MV2A 2C26A 4AHXA 1FNYA 1ZBE1 3ENRA 3N4MA 1V6JA 1LU1A 3WNNA 1ND3A 1LU2A 2WINB 3C7FA 3LA2A 2UU8A 5FO7B 3APBA 3TB0A 5ERLA 5GZDA 3FN9A 2E6VA 4NIAA 2ZGPA 3VD3A 3FUOA 3HWJA 2X29A 3MW3A 2J1AA 2UYAA 5ABJA 4RFRB 5K0UB 2YROA 1CD3G 3AVRA 3P5BA 3NJXA 4YSFA 3CJIA 4DXTA 3MFAA 5DDJ2 1E5SA 1QOOA 4BQ1A 4FO9A 4LHKA 4TTGA 5CKNA 3SNMA 3IDAA 5FIXA 5GZEA 1BKZA 1ZBA1 3WDXA 1LHVA 2VECA 3I97A 4HKOA 5A1AA 3DKWA 3PJYA 1SLIA 4COZA 1S0FA 5L9VA 2ORXA 1AR93 1DGLA 2GC1A 3ZDVA 1S0EA 3AVSA 2FHRA 3ACIA 2D6OX 4LO4B 4Z8BA 2EXJA 2IWGB 3RSJA 2CU5A 1UY1A 3WV6A 4ARXA 2C24A 4QQLA 2GZWA 2QQLA 2VMIA 4UF0A 5AFEA 3G7DA 3GF6A 3LA3A 4QXKA 5E16A 3AJYA 2ZKNA 1UX7A 2HWD3 3M3QA 3KCYA 4AI2A 4CE8A 2WFF3 3VBSA 3BGAA 1U5IA 1CPMA 1DBNA 3ZFEC 1EV12 2FMDA 4JVAA 1S1AA 2JKBA 1XQNA 2DUOA 1SEFA 2W08A 4CDQA 2DUPA 4IE6A 1IZ3A 1IPKA 3C7GA 3HEIA 3M3IA 3M7AA 4PIZA 5TSWA 2C1FA 5IVVA 3KV4A 1SDDB 2NQYA 4COVA 2VW1A 3KMHA 4Y1YA 4NAMA 1LEDA 4Y5SA 2JB4A 3T4HB 2E53A 1K3IA 4D0QA 4OZOA 2V09A 3MW4A 2VCAA 3SISA 1AX1A 2PLV2 1GQPA 2WABA 4GWJA 2O8QA 4TLGA 5EP9A 5GJ6A 1HJGA 4FVVA 1W6QB 3MIEA 5HCAA 2CWSA 5FOBB 3HBKA 4LJHA 3WEZA 4YG3A 1RJ7A 1LESA 4NJ4A 1Y9MA 4CCOA 2IZWA 5I0SA 2HWE1 4YVWA 5F2SA 5FP8A 1LGCA 2GMPA 5FLHA 4EN9B 2PFWA 4DUXA 5FYBA 4URAA 4AHZA 1FX5A 4CU8A 5KWRA 2FDHA 4XDQA 3RVHA 2Y60A 2LROA 4UAPA 5T5LA 4KGQA 1WMFA 4QQOA 3EBRA 2H0VA 3BU7A 5EIYB 4ATEA 2N7GA 3OGGA 4IW3A 2VMHA 2A1XA 2P6CA 3DYPA 1E5HA 4PBOA 4FP2A 5A7QA 3ZXKA 4LBQD 2ES3A 1X9TA 1IHMA 4FFGA 1YCIA 3UYJA 2GNDA 3ZR5A 1AYN3 2WA4A 4CU9A 5SV8A 4XJ8A 1UL9A 4UT5A 2NPIA 4Y1VA 3SEEA 5SV5A 4EWAA 1VMFA 2ZEXA 5FWJA 5IK4A 1EP0A 4AI0A 3KHCA 2C0ZA 3TRSB 1SZBA 1TMF2 2C9KA 4ONUA 1R083 1KJLA 1SBDA 2XBO1 4Q4X1 4QPGB 5DAQA 2D44A 3PDQA 5EJ1B 1OA3A 3NL1A 4QDSA 1FMD2 3ZXGA 3L2YA 5ACA2 3HQXA 3ABZA 1HRI1 5FP4A 3H8UA 2LS6A 5FYHA 1WD4A 2YC4A 4OULA 1YWKA 2WZ8A 4BQ5A 2JE9A 2JX9A 1S0BA 4CEYC 1WA6X 3OBAA 4WM8A 5IAVA 3MHZA 1CESA 1J1TA 1H1AA 1G9FA 1WD3A 2CTVA 3C7HA 4GB33 1VRH3 1ZRCA 4L8QA 1WCUA 4LTAA 4LE3A 2Q8CA 1TNFA 4BU2A 1POQA 1NE4A 4WV8A 4XEZA 1CAXA 2R062 2ZGMA 4L92A 1UYPA 5F5QA 1PVC1 2JDPA 1QIQA 2ZHKA 3OCPA 4WZCA 4Q4Y2 1QU0A 1VBE2 1VRBA 2A3XA 1UXXX 4OHWA 3H1MA 1ULDA 1UZ0A 3WDUA 3POWA 3SCGA 2ARCA 3CF6E 4AK3A 1P8JA 2ZA9A 5FR3A 1HQLA 3K77A 2QDNA 5LASA 3TEXA 5BNPB 4AI3A 3MUZ1 4Y22B 1AZDA 1UZVA 1YFWA 2UYBA 3BKZA 5FUPA 4FPCA 1MACA 2CY6A 2ZS6B 3WNMA 3ZOIA 5A3NA 4QKBA 5I0UA 5AC91 3BCWA 3AZWA 1K5MB 3JD71 1MEC3 4CZSA 3THTA 1ODNA 4HFSA 2RDSA 1VIWB 4LBQB 4NRQA 1G7YA 1X33A 1R1ZA 2RR11 3VZOA 2OQ6A 1D0HA 2P3IA 1COV1 3WZ1A 2FZ1A 3KS7A 4P9WA 1OHFA 1NZIA 1F9KA 2R072 2HEVF 2H0BA 4LKEA 2OS2A 4IV1B 3WP4A 2MNGA 3C2UA 1YNAA 3LEKA 1VBB2 4HSJA 1IS3A 3K2OA 2JD9A 1JUHA 2VZSA 3WNXA 4I0AA 4EN8B 4GULA 5JOWA 4FSJA 4ZU7A 3NJZA 5FYUA 3N35A 5DZFA 4RD7A 4XCBA 2K2SA 4NMIA 4NOTA 4YZ3A 5BNNC 2BVVA 1DGRN 5FP7A 5J3UA 5FREA 1VB4A 1WW5A 2RS33 4CSWA 1NA1B 5T50A 1W9YA 4BIFA 2RHPA 3T0BA 4D3WA 3TNQA 2ZHLA 2YZ4A 3HQUA 1GNHA 1BBT2 1DHKB 4M3CA 5LA9A 5K8SA 4E4DX 3LPFA 3MIGA 2ORZA 4HXCA 1AJKA 5JZGB 1UAIA 3WG1A 5JAXA 1PGW1 2WT1A 3N9PA 3LEIA 1XNKA 3LD8A 4QXBA 2BYVE 2DTYA 5JPNB 4XQ4A 1PO22 3ES1A 4NIDA 3VZLA 1N47A 5A33A 3AL6A 5KR7A 2GH8A 3LIGA 3NWKA 2WNVB 4AAPA 2IXHA 2F4LA 5FZ0A 2UURA 5JI9A 1RUF3 4A4AA 3FHAA 1HB4A 4UFMA 2BP6A 2PQQA 4ASKA 1S2BA 4YFZA 4ISQA 5FCCA 2WO3A 2VNVA 1VP6A 1HXS1 1MZFA 1QXJA 2XLGA 3RI8A 5C3RA 1PK6C 3GHNA 1HIXA 2ARXA 2B45X 5L7OC 1JYCA 1U5XA 3MICA 5K0UA 5IK7A 2DU0A 3UKNA 2XPJA 2GNBA 1UW8A 2E7QA 3GBFA 1DGWX 3JBG1 1YQ8A 1JYWA 1PGL1 4DRVA 4Y20B 5EQUA 3ZXAC 2VZUA 4QDRA 3HNMA 4QB1A 1YQ5A 2E51A 2QQMA 2Y6LA 4Q8LA 1LECA 3H9AA 4D7YA 2DU1A 2P3KA 2Q5TA 2ZABA 2YFUA 2HBTA 4AI9A 1ENXA 4BQ4A 3IZOA 4RQPC 3UL2A 4AGRA 3PTRB 5A7SA 5FY4A 1IGOA 4XURA 4E27A 1YYNA 1VAMA 1BYHA 1RUJ3 4URTA 1VR3A 3LIHA 1W2OA 3Q8EA 4MGQA 3WT3A 3FC0A 3GNEA 2CDOA 3VHPA 1PHMA 4GMP3 1RUC3 3ZN4A 5C8WA 1OVSA 1S55A 2Q30A 1Z0HA 1X82A 4QHZA 2C5DA 1CX4A 2ZOEB 2XG3A 3NNMA 4NO4A 1JZ8A 4HKLA 4DO0A 1GZ9A 2VZ3A 4L2NA 4C8DA 4S2GA 3VBOC 4KWUA 1V9U3 2PXJA 2IXCA 1ST8A 4GQ7A 1AR62 1AHSA 1BVVA 2Q1FA 3VDAA 1O4YA 4COUA 4E4HA 5FZAA 2BQPA 5C6CA 4XUOA 2OZJA 3NAPB 1F2NA 5GLTA 5FZ7A 1W6QA 5T3NA 4S2FA 2V4VA 2VULA 4FT8A 1CR7A 2DURA 2VGDA 4ES8A 5CFCA 3TN93 2VW0A 1EV11 3RYRA 4A42A 1W04A 2JB8A 4GKYA 4M3CF 4A41A 5CFDC 3MLKA 5FJKA 4W50A 3AM2A 4DPNA 2B9VA 5GLWA 1YFYA 2YGMA 3EMRA 3O12A 4RGAA 5EZWA 2XUEA 1PMHX 4D69A 1G8WA 2BDRA 4ZPIA 3EXUA 5I93A 1RUE3 1UWWA 1YO8A 2RMU3 5C5UA 2V72A 5A32A 3VV1A 1D7PM 2AEYA 3I2FA 2PLV1 4YRDA 1POV0 2PHXA 4IE4A 2UWAA 5JXJA 2EA7A 3FFZA 3PIGA 4CP9A 1RXGA 1S0CA 2ZGRA 3KCCA 3IMNA 5C8CB 5LW9A 2MEV3 3KD4A 1KS4A 4ASMB 4EE2A 2YHJA 5BNOB 3OSDA 4A3ZA 1EUUA 4Z07A 1VBD3 2VC9A 1RMU2 2ADEA 2I07B 2ENRA 1QNWA 2ZJCA 4RS5B 4LKSA 4FOYA 3KV5A 1UMIA 2PYTA 3RI9A 1L3JA 2V4AA 5T5JA 3WNOA 1DQ6A 5CU1A 1DZRA 3W21A 3BOPA 2A6YA 4RL7A 1WUVA 2ZTNA 1NLRA 3POFA 4QPGA 3T08A 4FOWA 4XXAA 1Q8QA 2W92A 3AXEA 1TE1B 4R4XA 2YGLA 2VMEA 4CCKA 1YJLA 1DFQA 1XBFA 2EVXA 3CQOA 3HN3A 3CIHA 1REEA 1MQTC 3RZZA 4BK5A 4OVEA 4OI4A 2HWB1 1NCQC 5F6KA 1D4VB 1AVBA 1U0AA 3WNLA 5BUVA 3B00A 5HBAA 5EYXA 5FY8A 4A7ZA 4JQTA 4LO5B 1WBLA 1QJX2 1SBEA 5KC6A 4BA6A 2VZRA 3U37A 3OBTA 2VQTA 3VBUB 2OX0A 3WUDA 3N7JA 1C5IA 4YVSB 3R0RA 5T54A 3KGLA 4AAXA 3J8F2 1KD7A 1TMF1 2GC2A 4XHBA 4BLIA 5FMOL 1DDLA 5HCBA 3WG3A 1RITA 2WS93 2DFBA 4JDMA 5BPXA 4EN6B 5LWBA 1W0OA 1FMD1 3NQHA 5ACA1 4LBOA 5F37A 1KDMA 4YG6A 5FYIA 1L7QA 4WVMB 1RUG3 2WUHA 4XF1A 1K12A 2AYHA 1ZZ8A 2KR2A 3PU8A 2Y38A 4P9IA 2V5DA 3F95A 2RM23 2DVDA 4R4ZA 4U36A 4XFIA 3WP6A 2QCSB 2B9UA 5F9TA 5BNPA 2PA7A 4ORFA 1NLQA 4Y22A 2GN3A 5KC5A 5HCHA 1N1YA 4JGZC 3VB9A 1RYYA 3PUIA 1UMHA 4Q4Y1 3K4AA 1SPPB 1VBE1 1GUIA 1X8EA 2W87A 3N9LA 3LPGA 4LBQA 1AR83 4P02B 1H8TB 4AQSA 4DIQA 3U14A 2AH2A 5GKAC 2VZOA 3NW4A 2VVDA 2XLAA 3HNBM 4X6RB 2VO5A 1PMJX 4NE9A 4UW6A 4QKNA 4IV1A 4OMCA 2WIIB 3OBRA 2GSYA 4P9XA 3DN7A 3I3QA 1I5PA 4XETA 5FBZA 5CAZA 5A6ZA 5DN2A 5JOZA 2ZZJA 1QJY2 2EIDA 4I09A 3VN4A 3I3DA 4RHV2 3K3OA 1DYPA 1DQ1A 1UN1A 2W5FA 1GR3A 3BYWA 4W8JA 1KJRA 4CEWC 1ND3C 1RUI1 1IQAA 3U11A 5HXMA 4NVPA 5FMBA 4PT6A 4QXHA 1NX9A 4WVZA 2Q4SA 1W8HA 3U1XA 3WG4A 2QQPA 2VNGA 2JECA 3VKOA 4B8EA 4Y5TA 1T2XA 5I91A 1W2UA 1ZA7A 2NZ9A 4SLIA 3FE5A 5FO9B 1ULCA 2R071 3WX5A 5JZGA 5ABJC 1RUOA 4BZ4A 5KHIA 3O7OA 5ANNA 2F6BA 1VBB1 3CJIC 3ZLIA 4A3XA 5LB6A 3RWNA 4QPIB 1LOCA 4LKFA 5DUXA 4FPEA 3LZZA 2Y8KA 4CCMA 4OFGA 2D3SA 3WP3A 1STMA 3M3EA 5IVFA 4EWEA 5JOXA 4E2GA 2WNVA 4JDNA 1H2LA 3CZJA 3ZYJB 4LK6A 2OVUA 1XXNA 5BYNA 3NKGA 3HT2A 3J7MA 2FBEA 1OVPA 1VBC1 1LOEA 3LEMA 4XFGA 5EHDA 5DUWA 2P2KA 4FXKB 3HT1A 1XE7A 1W8FA 2HEYF 1JYIA 4HK8A 1QGLA 1KFUL 3IB3A 4GH4C 3TNPB 3O1UA 3OEBA 3VBSC 4MGSA 2W94A 2YYOA 4WVWA 4CDXB 4YW3A 2R043 2VVEA 4NUBA 5F3EA 2Z4FA 4GALA 4IESA 2DVAA 4IEPA 1FPN2 4Q4X2 4CDQC 4ISRA 1SLCA 2DTWA 4ZKTB 5GZGA 1HRI2 4XUNA 2K46A 2WZR3 3HD8B 4M0HA 3KVBA 2LTNA 3VZMA 4FAGA 4LBKA 4JCKA 4YFWA 1GFF2 2FDGA 4EROA 2NLRA 3DXTA 4K8FA 5E88A 4AI1A 2RJLA 1K5JA 2TNFA 1F4HA 2DCYA 5IVJA 1ZRFA 1AX2A 4IE0A 5FKCA 3ZKUA 2Z69A 1R1A3 4XHXA 3K46A 3VBFB 4XTPA 2K9ZA 1W9TA 5IATA 3CEWA 2QVSB 3FJSA 1OLME 3USUB 3WW1A 4QX3A 1C5HA 4LPLA 5JXGA 2AC1A 1V6IA 4K8RB 3ZVXA 4BE3A 4FQZA 4YVWC 3POGA 2VXJA 4QHBA 5FYTA 1WMEA 5FTTC 1NY72 3BIWE 1KRIA 3AZXA 2ZMLA 1AL22 3GDBA 5LRSA 2A75A 1TG7A 3MF9A 4DEQA 5FWEA 2YBSA 1X8MA 4DY5A 5FDBA 2IXIA 3NAPA 3ZFFB 4XUQA 4UFHA 1GLHA 3V0BB 3FFQA 4ZHNA 3ILFA 2D43A 5DAVA 1UPSA 4AVAA 1WKYA 1AYM2 3BI3A 1UOJA 5FK8A 3D0SA 1WW4A 2VTXA 2ZX3A 1ZBA3 3WDTA 3C7EA 4AZZA 2UY8A 3I7DA 3ETPA 3IDBB 1SLBA 4JTNA 5A6QA 5HV0A 1TZOA 4Q4W3 1RVF3 1NCRB 2JG9A 2MHFA 2RR12 4NHLA 1ULGA 3VKMA 3W9AA 2Q8OA 1OSGA 1MQTA 1AR61 3BTZA 1IOAA 1DU3D 3AKRA 4LHLA 1W6OA 3C3VA 5CB7A 3ILRA 1GP6A 3H8RA 4GWNA 1Z7S2 1JBCA 1JODA 1UF2C 2P34A 3KT1A 3RYKA 1ZX5A 1H9PA 4Q4V2 4E4ZA 4KH9A 4X8NA 5C8CA 2BBVA 3HOBA 3IIIA 2A5ZA 3DGTA 2JENA 5BNOA 3GYDA 1BMV1 2XL7A 3GM8A 3MLLA 3RJRA 4YZ1A 5M0TA 3NNLA 4WM8C 4YGEA 3RZMA 4RS5A 3TWIA 1FYUA 4YLZA 2VNRA 2DWRA 1SHWB 4COYA 3DCQA 2F17A 5C3SA 4BHPA 1GOHA 1HN1A 2X5IB 4KG8A 2C6SA 2G9FA 3VDDB 4IV3B 4TLFA 3OD0A 4FQ4A 3SH5A 3ZPYA 1O3QA 5EPAA 4IEQA 1GANA 4Y4RA 5FMOS 4F8AA 1A6CA 3WVJA 1YFUA 3VKFC 4BK4A 1OKQA 2GAUA 3FWEA 5FUIA 4XVHA 5J98B 3LAGA 5IJRA 3B94A 2PAMA 5FZOA 2NM1A 2JDZA 4K9SA 4R8HA 2ZGSA 2A3WA 4GD4A 2HWE3 1RMU1 1SFYA 2RS13 3LSEA 3MIFA 3B9IA 2BNNA 3AKQA 4HMZA 1Y9GA 1AYN2 1OBNA 4Z82A 5JR7B 3BTXA 1GOGA 1H8VA 1HXS2 2GMEA 3WDVA 2GC3A 4W6WA 2K0GA 1VAVA 4L97A 4LQRA 4UW3A 1IS4A 5FZKA 2ZAHA 3B69A 4Y26A 4YVSA 3VBUA 1EUTA 3R4UA 1OKOA 3J7LA 4EN7B 3JBG2 4PJYA 4KG0A 3T2TA 2ZMNA 1XYPA 4HN1A 4K40A 5EYYA 2BJSA 3AZYA 2QNKA 4IEXA 3SH3A 3ZIXA 5LEJA 1TEIA 3KWVA 4LT5A 1CAWA 1FATA 1PZ8A 1UD1A 3E6BA 4WVMA 3VBRB 1OFSA 3OGJA 4YPJA 3HAGA 4P9JA 2E7TA 5F3CA 1JI6A 4P9YA 3U78A 3N9NA 2FDJA 4QB2A 4H7LA 4F7ZA 1PIV3 2ARBA 4CEWA 1PVXA 4ET7A 4GKXA 2QQNA 4L0PA 4LHSA 3WLUA 5EFUA 1D0GA 4DRRA 1YQ6A 3A0NA 4V1PA 1QJX1 1CVNA 4QDQA 2AEZA 2YBKA 4AVSA 1JZ4A 2O8OA 1PO12 3ME2A 4RSUA 2Y6JA 3CJXA 1H6XA 5D1IA 1OF3A 2KA3A 3J8F1 5DAXA 2L9LA 1W9SA 1OOPC 5BV6A 1AF9A 5D8AB 3POJA 1SPPA 5CZKA 4B29A 2RS53 1A8MA 2WT2A 1H8TA 5JCTA 1RUD3 3KHBA 5H9SA 3IWZA 3KQ4B 2ZZQA 3AP9A 4LKDA 4FFIA 4LXLA 1AR72 3QD6A 1EAH3 5IHRA 4JZRA 1CAUA 1NZCA 3PNAA 3CKHA 4AF9A 4M01A 4XJUA 2VZPA 4GH4A 3WNKA 5DQ0A 2VOKA 1PVC3 5FPZA 3ZX7A 4YWAA 4C1WA 4DXRA 3UNPA 4YGDA 2UWCA 5IVCA 1LJ7A 2VOVA 4BH9A 4W6YA 1V0AA 3P1IA 1QEXA 3TOJA 4XOGA 1C8M2 1POV1 1FI2A 1CZTA 3RZGA 2WQ8A 4QPWA 2XJUA 2HWF3 1YI7A 2O14A 5JWPA 4GWIA 2W68A 2ET1A 2ZGQA 2VCBA 4CP1A 3K4ZA 4KU7A 4H2AA 3Q8CA 4GMP0 4QX2A 1JOJA 5K0UC 4QU1A 1WCDJ 2ZCWA 4G9SB 4RGGA 3N7KA 4CDUB 4QPIA 4KWKA 4NIHA 4FP3A 4YW4A 5JSPA 5FYVA 5LY1A 4OI1A 3AP7A 1QJY1 4Y4YA 3ZSKA 5AC93 4RHV1 4NN0A 5HCFA 5BY5A 4CXYA 3O1MA 3JD73 3QLQA 4N8MA 4E9KA 2W2IA 3A23A 3BOWA 3WR0A 4AEJA 5ISLA 3ZYIB 3BUCA 5G04L 1DG6A 2OUHA 4IE7A 1COV3 2H6BA 5C7GA 2RS32 1MVEA 1QJU1 4MZUA 5IUQA 5JUVA 2ZGTA 4NHYA 4Q2FA 2A71A 1YC61 4CDXA 4DEVA 3KZ4C 2EICA 1CWPA 4LBLA 1C1LA 4B7KA 1O3RA 1XU1A 3IMMA 4FAHA 1GICA 1QOTA 1A3KA 1KFXL 1DZTA 2XGXA 3LDRA 3N36A 4N7IA 1RUH1 1ONAA 2PAKA 2Y0OA 1Q43A 2VW2A 2D6KA 1Q3EA 4O65A 2XOMA 5BXXA 4Y1ZA 3BPZA 3L9JT 5DAWA 4FOQA 2JDAA 1KEXA 1W8TA 3LOIA 3I2OA 3DECA 1XC6A 4K21A 4PQQA 4XE9A 3FLRA 4Z92B 2HWB2 2DBNA 2XHKA 2D97A 3SCFA 3ZO0B 1RUF2 2ZGKA 4L11A 3WCSA 3RS6A 3POEA 1H6YA 1N1TA 1ND2B 1W6MB 4B1MA 3RZJA 4JHTA 5AFBA 3E5QA 2JXAA 3DYMA 4DQAA 2WQ4A 2JE7A 3T4VA 3SEPA 3VBFA 5CFCC 4ZU5A 4BISA 3O1RA 3FZ3A 2HWC2 1MR5A 2XVLA 3USUA 3JB8A 1CZVA 1FPN1 1UOGA 3OEAA 1IS6A 3FL7A 4XZUG 2VUDA 4WM7B 4UXAA 1D4M2 2JG8B 2YY1A 5IWFA 4Q29A 5A3TA 1JZ2A 2A7AA 2H6CA 2YU2A 4FOVA 3URFA 4IGOA 4UW4A 3WHTA 4QU2A 4QX1A 3I2GA 2VUJA 4AG4A 3ZFFA 3H1WA 4I3PA 3W20A 3NV3A 3RGBA 2FCTA 5EV7A 4AQ2A 4BB3A 3V0BA 5FPBA 3ZSJA 1PM7A 1C57A 2DCTA 2X05A 3PIJA 4CCEA 1MZEA 3FBYA 3M1HA 5JI7A 5DZGA 1SG3A 2ZMKA 1S4CA 4AXOA 3O0VA 1H1MA 1HV1A 3H8XA 1WLWA 2WNOA 1NXD1 5F2WA 1SFPA 2HLEA 3VKLA 1R093 5A3MA 4LIVA 5A3PA 1NCRA 3O1PA 3B3QE 2BTVC 3Q8FA 3OPZA 5CADA 4Y1XA 3AP6A 1Q56A 1NY71 1UKRA 4Z2AA 2WRAA 1AL21 3NSTA 4YG0A 4O61A 4C1XA 1AR91 4ZZ5A 4HANA 4Y33A 4DB5A 1IKQA 2WAOA 2WKKA 2VNOA 3OD4A 2XR4A 3SCHA 4QPGC 2VVFA 1W8NA 5A7NA 1W99A 2GN7A 4BXSV 4XFBA 2WL1A 5E89A 4D6RA 5DDJ3 2BU9A 3MV11 1AYM1 3D0JA 5APAA 2WFF1 3LEGA 3FLPA 2IUWA 1MZ6A 1ZVFA 3TN92 5K7PA 3ZSMA 2P1BA 3BALA 5I8SA 1RUI2 4R9AA 1UYYA 3T1MA 2PAEA 1J3RA 5FMDA 3WD5A 4CDWB 2X5IA 3MV01 3VDDA 1ACCA 1BEV3 4IV3A 5FZCA 1S0GA 4UWDA 4XPVA 5J37A 1NG0A 3JU9A 2GU9A 1Z7S1 2J7MA 4BQ3A 4MX3A 1EYBA 2R30A 1ZZ7A 4FI9A 1WLCA 1WGPA 4KU8A 4CUGA 4DMIA 4Q4V1 4ZXEA 1EV13 1H30A 3UJQA 4AE2A 3E5UA 4M00A 3IIAA 3NJYA 2FCVA 3SMHA 1JZ5A 4DFSA 3RRDA 2E32A 1OOPA 2MEV2 3ILNA 3GZAA 4EZ4A 1JYVA 2CYFA 3AMHA 1XJAA 1UKGA 4LULA 1LOFC 3PUSA 4MHUA 2EXIA 3OY8B 1VBC2 5A1FA 2DUQA 5LZ6A 3PUQA 1W0PA 2ATFA 1YQ2A 1BK0A 3N9MA 5BNPC 3AMQA 4O7XA 1JS9A 3E97A 3IM0A 5J48A 2B4KA 1JTZX 1VMHA 1DQ2A 2QQOA 4PF5A 2J1VA 4QGMA 1RHI2 3P6BA 5IK8A 1E5RA 2QQVA 3VLBB 1K5MC 2Y64A 4XZPA 4GXLA 1JHNA 2OKXA 3KM5A 1WW6A 4A6SA 1NLSA 3VBRA 2VZQA 4XMAA 1VAKA 4W6XA 2XMLA 4YW5A 4F3JA 2Y6KA 1RINA 1RGSA 2GALA 2ZKLA 3I2JA 1HRV2 3DPRB 1CJDA 3JB4C 1W8UA 2VZVA 3K4DA 1AXKA 4IV1C 4YW6A 4AVCA 4KMQA 1AYN1 2QZ2A 1RIRA 4QQ2A 1HX6A 3RDIA 4FBFA 4Q0PA 4LA3A 1UU4A 1D2QA 1DQ0A 5FZMA 1ALYA 1DGRA 5FPVA 1JMUB 3IDEA 3MPPG 1OLRA 2G1MA 3H8OA 4JQRA 2WFPA 5D8AA 2VBBA 5FRAA 3POIA 2B39A 2XDVA 1R081 5HPOA 4AI8A 1OA4A 2JDHA 5A1LA 5KHKA 1NA1C 2C9AA 2WS92 3EQEA 4UFJA 1X7NA 5C3QA 2HEWF 1OF4A 2LRPA 4HETA 1VMJA 1JU4A 4YYOA 1FOD3 5JZGC 4ZONA 2WSVA 3VD4A 3U07A 3OGRA 1O91A 4LBJA 3WHUA 4RR3B 5A70A 4M0NA 4NRPA 4Q26A 1X9PA 1PO11 4O9EA 1TMF3 1VRH1 4B4QA 2UWBA 2Y34A 1QY4A 2D5HA 3I59B 4XC9A 2WLQA 4L99A 5FQ0B 4MYEA 3RJ2X 3ZXFA 2WNVC 3FX3A 4AVTA 3WINE 4HVQA 5ACA3 3QH7A 2Y33A 3E6CC 4K3UA 3AFKA 4LOTA 1B09A 5LBEA 3GJBA 3A21A 1W39A 3O5SA 4M4RA 4WBBA 4MOAA 3NNFA 1HB3A 3FBMA 5A3OA 3THCA 1UZYA 4IQPA 4AYUA 5FAXA 3U0ZA 5FYYA 1YI9A 1AR71 4S2DA 2AR6A 2XKOA 4CDUA 1I1EA 3PTYA 3VDBA 1DF0A 3I2KA 4G3YC 4LMFA 4N43B 1F35A 2WYSA 2CGPA 3ZKYA 4MG2A 2R063 4CPBA 3LOBA 1XRUA 2EXKA 5FFOC 4MADA 4AL9A 5JR2A 5CG8A 4Q4Y3 4CRQA 1BMV2 2QQKA 1C8M1 4I3GA 1NQJA 3ZFGB 1MEC1 1MS3A 4O9GA 3ZYRA 1EPZA 1RJ8A 5EXOA 3S57A 1BXHA 1H4HA 4XAEA 3VBHB 3ETQA 4QGNA 1OFNA 1VLNA 2W91A 4XF3A 5C5TA 2W3JA 2E33A 3OPTA 3I49A 5CBLA 1DP0A 3IPVB 4GWMA 5FZLA 3KV9A 4OI0A 5FPLA 5HV4A 2ZX0A 1MS5A 4MGKE 2DCJA 3VD5A 4C90A 3ATGA 2R6QA 3I8TA 3UGHA 1DYOA 4BQ2A 5I8TA 2JD4A 2BV4A 2FDFA 4AR2A 4JGYB 3CU7A 2VXRA 4N9HA 4YZ4A 4BPZA 2XJTA 4SBVA 1XPWA 4NWWA 3NAPC 1W6MA 2GMMA 2RS31 3LSDA 4J25A 3WUCA 1BHGA 2V73A 2DDUA 3CLPA 3NVCA 4BJ0A 1VBB3 4NPLA 1W2NA 2BNOA 1OI6A 3OJBA 3OUJA 1GU3A 2IFRA 1GV9A 1RC6A 1V6OA 4AOCA 3I3MA 5LBCA 2DVFA 4HT1T 1GNYA 5GZCA 1FNZA 4INDA 4KL1A 4YGCA 5KXCA 2WWSA 5G05L 1FV2A 1G86A 4N53B 1DLLA 2JG8A 2JG9C 1SQ4A 5DXDA 3U75A 5AVAA 1T6BX 3TBDA 4Q0VA 1IPSA 2CAVA 3ITQA 4GA9A 2DVGA 3I4IA 4Y1UA 4YW2A 2ZEZA 5FY1A 3WG2A 4BWOA 1Y43B 2E7AA 1BBT3 1O6UA 1RUF1 2VOXA 4PI0A 1J59A 3RPQA 4X6QB 4RFT0 3L2HA 2HYXA 2PHDA 3BTAA 3MLJA 3B9CA 5A80A 4BM8A 4CYDA 5C8CC 4QQPA 4DS0A 1BK1A 1CAVB 1PO23 1ZREA 1B35B 2HWC1 1UY3A 5BNOC 2OA2A 5DMYA 5FZGA 3H3LA 5FY7A 2GH2A 2EAKA 2W46A 1LNSA 4P08A 3ZYBA 2WWJA 2VTFA 1S0JA 4FPGA 4RS5C 4XJZA 1D4M1 1VBA2 1YEWA 2PHWA 1TME3 1W05A 2YPJA 4D7TA 4OQ8A 1LOFA 4LHNA 2WJSA 3VL8A 4L9BA 1LHWA 4HPKB 2RJKA 1PMIA 1LHOA 2R7EB 1ENRA 3JXSA 3ZN6B 2DBIA 4CA9A 1C8NA 1MPXA 1MS8A 4YW7A 1JU3A 2BGCA 1IS5A 2QQWA 2PN5A 4GMP1 4Q1PA 4D94A 3SH4A 3AKPA 5LBBA 1QQP2 5CG9A 3B02A 4R52A 1K5MA 1W9FA 1ZRRA 2ZPXA 4P5YA 1GNZA 1WCQA 4GAZA 1OPMA 4ZS3A 1C28A 1D2SA 4CDWA 4Q4W2 1RVF2 2EF6A 1TNRA 1V9U1 3W5NA 1UXZA 4FPJA 3H50A 3VBUC 4AGGA 4BQXA 4LR4A 2CHHA 4YVSC 3WF1A 3D3AA 4PDWB 3LCPA 5F1RA 2RDNA 3RWKX 4KGGA 1KQRA 1GP5A 2QQIA 4ZZ8A 1JYTA 3SQOA 3S0MA 4KWLA 3ECQA 4RA0A 1KXGA 3RNSA 4AVVA 1GWKA 2BOIA 4Q1RA 5FZ9A 5IVYA 3B93A 3UV9A 5JOYA 1YLLA 3TN91 1G9AA 4PBPA 4CUAA 4GIQA 1HV0A 1OH3A 2G4IA 3D4KA 2LM3A 3OY8A 3QACA 4QM8A 1PNGA 3GCXA 3AKTA 1AR63 1KDKA 1NA1A 1ENQA 2J1EA 1DYKA 3O14A 5IAXA 2ZHMA 2KM2A 1QJU2 5K9YA 1F8VA 5FZFA 5JIUA 1OQ1A 1I5ZA 1LAJA 4XIKA 1WLTA 1QJEA 3QOPA 2ZBJA 2TBVA 1RUH2 2CNAA 2XWBB 1GYKA 4A45A 1H8TC 2AUYA 3S5QA 3O1TA 1OQEA 4AHYA 4Q0UA 5KXBA 1XE0A 2MEV1 3AC0A 4FCAA 5C9AB 1L7LA 1JOPA 4JKKA 2CSGA 2D5FA 2XHNA 1QNYA 2VZ1A 3DPRA 4W4ZA 2CDPA 1F5JA 1VBD1 1YXWA 4U2AA 2JIGA 2RS12 1N1VA 2F4PA 4BQWA 3WF2A 2XJPA 5CVRA 4XF4A 2NMOA 1CPNA 3RMYA 4XXPA 4KI5M 4R9BA 4ZXKA 3GGLA 4IXLA 2JWPA 4Y20A 4FTSA 1RHI1 4CU6A 1XNAA 3R6SA 3ACLA 3POSA 1LRHA 1H9WA 3NNGA 4PQ9A 2IFWA 2WT0A 3AP5A 5C4WB 5B2GB 1PM4A 2HBUA 3AB0A 1QOSA 3LDKA 4JTOA 5FO8B 3CZUA 2V5YA 1ASJ3 1W8OA 2WAAA 4OUEA 4K1ZA 5T52A 4MVTA 4XIOA 3H7YA 1HRV1 3E1F1 4IL7A 2OPKA 2FCUA 5JSRA 2R16A 2G9GA 4Y5Z0 3UKTA 1PIV2 3ZXEA 4JRLA 4RR3A 4QPIC 2WR9A 4AFDA 4PLOA 5FYCA 4NHKA 4E2SA 1PGSA 3AJZA 1CIYA 2VMFA 3I59A 5FQ0A 1GZCA 3M4FA 1EY2A 5CKMA 4XFAA 4XJ9A 3KF5A 4AW7A 1W3XA 1PX3A 5A3UA 3A22A 1ZBE3 2WS91 3LA7A 4Y3OA 5L36A 5A7OA 2QTWB 3M2MA 3MUY1 2W1UA 2TUNA 2WZEA 2XONA 2BGOA 1O8PA 5D2AA 1W6NB 5CEHA 1UZZA 1RUD2 3J4UH 1RUG1 4IGQA 4CDXC 1AR92 1AL0G 2VUAA 1UZWA 1RTVA 2BGPA 2XVKA 3R05A 4XUTA 3RG0A 1EAH2 4TN7A 4N43A 4QAWA 3J8F3 2J22A 3ZIWA 3WQBA 2B7YA 4CXXA 4A7YA 2HWD2 4Q27A 4QM9A 2WFF2 1S0IA 4TWTA 3ZN5A 4Q0QA 2X8KA 1ULFA 1VE0A 3PUHA 3BU0A 3ZFGA 4BOWA 4CVUA 5FZ3A 2D6MA 4TSVA 3FHQA 3VBHA 2VMGA 1MS0A 4OUMA 1AR81 5GLZA 3NO8A 5JXHA 1ZZCA 2D40A 4GJZA 4NAOA 3CNAA 3UESA 4CCLA 2EALA 4MXWB 1NT0A 2HJIA 3U10A 1M4WA 3IPVA 3VBFC 4AEDB 2WA3A 4HBNA 5J36A 3F2ZA 1BCXA 3KVAA 4MO3M 5IYYA 3I2DA 2D6LX 3BTYA 1U5YA 4YZ5A 2QBXA 4RGKA 1BVP1 2BZDA 4P9GA 5JSOA 2ZX4A 1HB2A 4LUMA 4C0BA 1GZWB 2P3JA 2QJVA 4MSVA 4UOJA 2XXZA 2ILMA 4W65A 5I0TA 1JOBA 3S5AA 3ZFFC 4NHMA 4FPOB 3GZUC 4DUVA 1DLCA 3GZTB 4B4RA 3PVEA 2YV8A 1IKPA 1J3PA 3THDA 1V70A 2BERA 3A4UA 4YNIA 5H9QA 3V65A 3VDCA 5E8AA 4YZ2A 1JYXA 4H55A 1QJY3 1XYOA 4RHV3 5D21A 4XABA 2AREA 1UYZA 2ET7A 4N53A 3TEYA 1NCRC 2PHFA 4UFKA 3ELNA 3UGFA 1WWYA 1UIKA 2EIGA 3WF3A 2WNUB 3S6PA 1O4TA 1U12A 4FXGB 4IUGA 1PZ9A 1OPOA 3AZZA 4EN0A 1VJ2A 3PVNA 3LGRA 3ACGA 1XNBA 4XDPA 2JDNA 5C71A 4KNCA 2EXHA 5F3GA 3T2PA 4Y24A 3IBMA 3VD9A 1CAVA 4XQDA 1B35A 1L7RA 2X53S 2E63A 1LOAA 1GOFA 2JICA 4I01A 3J26N 5F32A 4PF1A 2DFCA 1O3SA 5H9RA 1UPIA 3HJRA 1R082 3Q8BA 4JDOA 3ZPOA 3RZLA 3H7JA 1N1SA 1UY0A 3ALQA 1RXFA 4BDVB 1O8SA 2X5IC 3KB5A 1O5UA 3VDDC 1LEMA 4IV3C 1DQ4A 3ZSLA 1SFNA 1C4RA 2P3YA 1JN2P 1LOGA 3KSCA 2BWAA 5IW0A 3SC7X 1MVQA 3ZMOA 2JIJA 1Q8VA 3D5OA 4S2HA 4AHWA 5JLVA 2XQRA 5FPAA 1SLAA 3ZN6A 4EV0A 4K7JA 1C3HA 4E2QA 2CL2A 5FY0A 1Q8OA 2PELA 1DZQA 3OUHA 1VRH2 4GB32 4QB6A 3W5MA 1BLZA 3T2QA 1BJQA 1FPN3 1X50A 2XBO3 3NV4A 4Q4X3 5JIAA 4DINB 3FUQA 4B7EA 5F8PA 1UOBA 4J1WA 1HRI3 1QH7A 2G19A 1QDCA 5A33B 2XLFA 3MIHA 1R092 1VBA1 2D3RA 2XJSA 1QJZA 3T30A 3ZFEB 3ORJA 2EIBA 2NMNA 4MUVA 5FYMA 2D6NA 1JHJA 4PDWA 5DG2A 2ZHNA 2OZ6A 3M70A 4V2VA 4A2UA 5IK5A 4HKWA 1UOFA 4MGYE 4D7SA 5T5PA 3AKSA 1J3QA 1G6NA 1UX6A 1ENSA 2RV9A 1OUXA 1MZ5A 2JJ6A 3VBRC 1QQP1 1DCSA 4NR1A 2BW8A 5K4LA 5EJ3A 3B01A 1H2MA 1FV3A 2W1SA 3OF1A 4MGIE 5B4NA 1MEC2 2P4EA 3MYXA 1AL23 3FLTA 4Q4W1 1OD3A 1RVF1 3AMNA 3QH6A 3AL5A 3ZYPA 3CL1A 2VE1A 4H7MA 4LIUA 3JZVA 1BEV2 1WCSA 1H1IA 1LR5A 1O7FA 3AYEA 3PMSA 5FY9A 4EQVA 5D8AC 2WDBA 3LFIA 1AYM3 3OGVA 4LBMA 1UCXA 1W8WA 4OMDA 2OQ7A 3RQ0A 1NE6A 3BN6A 1NUKA 2JE8A 2P6HA 4PLNA 1GSLA 5DPNA 4AEMA 2EAAA 1NQDA 1PZ7A 5C9AA 2YC2A 2VPVA 3J9SA 1UMZA 2RR13 4P00B 1W28A 4CCCA 1ZM1A 5A7WB 4HSLA 4CUCA 1V6KA 4YM1A 5LATA 1FXZA 2QUOA 1ZRDA 4LK7A 3VHRA 4IGPA 1Z7S3 1CZSA 2ADDA 4IEYA 3A7QA 4XCAA 3DKQA 1OURA 5FJHA 4EJRA 5LA0A 4A44A 4Q4V3 5FZHA 1GKBA 2W95A 3DV8A 4BXFA 2R1BA 1W03A 3VZKA 2A6WA 3J7NA 1WLDA 2ZACA 4JC1A 1US2A 2ZGNA 4X8PA 5C4WA 3T0AA 3ZDSA 2LALA 5CFCB 3I54A 2FD8A 1Y7BA 1US3A 1IPJA 5LBFA 4AFAA 5LA2A 3P3PA 3IKWA 5FKBA 2IXKA 4ES9A 1TVGA 3VKNA 5EJZB 5A3LA 4CDUC 2RS11 2VM9A 4FTEA 2R0FA 3ZMNA 4DXSA 2BRTA 4XF0A 4C0HA 2LW8A 4XW3A 5JDBA 2Y26A 3TAYA 4CEYB 1VB2A 1H2NA 4Z1VA 3O1VA 5A32B 1W2TA 2I2SA 2JEMA 3HN1A 4HVOA 2J1TA 2RVAA 1EPWA 5CNAA 3I2HA 2IVIB 3WQ0A 4AFBA 3V0AB 2W0XA 4R9DA 1W6PB 2OPWA 4LORA 4NPRA 5E6HA 4CP9B 4DY3A 1RUNA 1K42A 1DGWA 1OT5A 2A3YA 3HPNA 1QXPA 1W6NA 1XB9A 4TYSA 5F5AA 3ASIA 4B3NA 3VZJA 2RDRA 4JHZA 3CDZB 2FQPA 3H0OA 2YPDA 1AXYA 2W1QA 3KF3A 1HXS3 4J1XA 4UI9L 3WF0A 1FOD2 1PIV1 3ZR6A 1JXNA 2XL9A 1RUJ2 5FZ6A 5J09A 2AACA 3WW2A 3JBG3 4K1YA 5FY5A 3ES4A 4JV4A 4PLMA 1DQ5A 2JDKA 1RUC2 1SMVA 3GCWA 3HMYA 4XBNA 2HH9A 4A6OA 2FZ2A 4DUWA 1A8DA 1QH6A 2NP0A 2OIIA 1H4GA 3NV2A 4FPHA 1LHNA 4PI2A 4E8DA 3OTFA 2A70A 3MPBA 2Z42A 5CYYA 5FLIA 2RS51 2AZ5A 3EO6A 4HOOA 3D8CA 1ND2C 1UIJA 4P14A 1OXCA 2HYKA 5HI0A 1IG0A 2ZX1A 4PIXA 1RUD1 5LK5A 1V9U2 4MXWA 4OQ9A 2ZX2A 1W3VA 2VH9A 3QBQA 5FUNA 1JYNA 4AEDA 1KITA 1PO13 2Z79A 4IDZA 1EAH1 4AWDA 3S7EA 4XTMA 2RDQA 1LENA 4BYYA 5LY2A 4WM7C 5F6LB 2JG8C 2HWD1 1F15A 3DXUA 4QX5A 2VMCA 4AVBA 3H42B 1GZWA 2IC1A 2VQUA 4DZGA 2XVGA 4NRMA 3OGSA 3Q9OA 4P5HA 1K45A 1I6XA 2PTMA 1YIFA 5DUVA 5LRRA 3AMPA 4XFCA 1V6LA 1VALA 2HWF1 2Z2SB 5ANQA 2VJXA 1AR73 4H14A 5BNNB 3V56A 5L19A 3U4SA 3AYAA 3W59A 4DXZA 5J1XA 3B7MA 3T0DA 1RUE2 2RMU2 2BEOA 4GJYA 5I0DA 2XQXA 1Q5OA 2QDRA 4CCDA 3K3NA 4UW5A 3BVCA 3NJVA 5AVPA 1SBFA 2VCCA 1RB8G 1C8M3 4I0WB 3CHXA 5FK7A 5DUUA 5FZDA 2C4XA 1KS5A 2WNUA 4XBQA 1V6NA 4QQHA 2J42A 2P5BA 1UU6A 1UNBA 4QMAA 1VBD2 1ZNPA 3OBZA 4XDOA 5DAPA 3GZEA 4D8MA 4HK9A 3UETA 3ZXDA 4CP0A 4QHOA 3UT0A 4YGBA 2GDFA 5FXVA 2G9ZA 2Y6FA 3RMXA 2PLV3 5L9RA 5I8YA 4ASLA 3R4SA 3D6EA 3ZYHA 4E4SA 4HL0A 3OYWB 5FXWA 1M06G 3DEMA 2WO1A 1PK6B 1OMIA 1O3TA 4I0BA 5L7OB 1T6GC 1CJPA 5CIRA 2D6PA 2VG9A 2WNEA 2JDYA 4LBNA 4CDWC 3IAQA 5IT6A 3ACFA 1QF3A 2XJVA 2DV9A 5JMOA 1UY2A 1ZZ6A 3M3OA 1OA2A 4LOSA 5C3PA 3BB6A 3WF4A 4RN5A 1SDWA 4META 4NROA 2BPA2 4RQPB 1E57A 4KBBA 2YC0A 4LA2A 3RYPA 2YG0A 2OYZA 4FPFA 2P37A 2RG4A 3GJAA 1MS4A 3X29B 1SCRA 2CAUA 3KQRA 4IETA 3JQWA 2Q8EA 4AGVA 5T55A 4YM3A 5L73A 1A78A 3MI8A 4OZXA 4OYUA
chains in the Genus database with same CATH topology
1AXZA 4OI2A 3KLSA 5DG1A 2CV6A 3ZFEA 1G9DA 3K51A 2HWB3 3CO2A 3DUIA 4XF9A 1RUG2 1TME2 3KGZA 3MDPA 3VBOB 5KHGA 1X36A 3DL3A 2MPFA 2RM22 3ZXLA 3AZVA 1LTEA 1WA4A 1Z78A 3LB9A 4GB31 4WVVA 4DOUA 2HWC3 1U5ZA 1CIWA 1LCLA 3PMEA 3POYA 2PHUA 4PIYA 2ZAAA 1FMD3 2QKDA 1D4M3 3KCXA 3DPRC 1R091 4XBLA 3WDYA 1AR82 4OUSA 1CGPA 1O4ZA 1YFXA 5CFDB 4XYXA 2VQ0A 1RL3A 2BFUL 3O0XA 4G4FA 3GALA 2CWMA 3VL9A 1GQHA 1QMJA 2QE3A 2A6VA 2UY9A 2B5HA 3PJQA 5LEKA 1G9BA 2AENA 3VHOA 2PHTA 4LE4A 5DDJ1 2P17A 1PNFA 1HQWA 1VBE3 3HIFA 5DZEA 1N3PA 1XYNA 1SCSA 2BVBA 4OHXA 4JRAA 4QT6A 2B42B 1V6MA 4IERA 4RR3C 2R32A 2I45A 1F5FA 2O0OA 2XKPA 1BEV1 2TEPA 3NKTA 1G9CA 3WW3A 3H3UA 3EJKA 3DF0A 1NXMA 4JAAA 1XNCA 1YUDA 1YIPA 3WXPA 4HVRA 2R1DA 1RUI3 4YARA 3U4XA 3ZSEA 3AK0A 2JG9B 4MXVA 2A73B 1QDOA 4TZDA 1ND2A 2R073 1MQTB 4XJAA 1NYWA 4N43C 5C33A 2DF7A 4A7KA 1W6OB 2QFEA 4CEYA 3N7LA 1NCQB 4WZFA 2ERFA 1HKDA 3MGUA 3V0AA 2LUWA 2R042 4XFHA 3E5XA 1W6PA 2FMYA 1F31A 3ZFGC 4AQ6A 4WM7A 2GNMA 1WBFA 3S30A 3VBHC 3D82A 3IT8A 1VBC3 2XJRA 2BWCA 2E9QA 3H3ZA 3UK9A 1ASJ2 1SACA 2WZR2 1LGBA 1GQGA 5CA6A 2BNMA 3W58A 2ZGUA 3VUOA 2QZ3A 3S7IA 4M3CE 1RHI3 1OQDA 2IXLA 4OHYA 2R0HA 2KXLA 1QXRA 3WDWA 1APNA 2RE9A 4JGYC 1R1A2 3M3CA 2B8MA 4JGZB 4XMIA 3VGIA 1BZWA 3V64A 4BMEA 1JUIA 1ZBE2 1HRV3 4J6GA 1LGNA 4HN0A 3WW4A 3HR9A 2O1QA 4FPKA 4LUKA 5E1RA 3FHIB 1SLTA 1FOD1 1OLQA 4AFCA 1RUJ1 5LK7B 3KT4A 4IEOA 1I9RA 4N53C 2A6XA 5T5OA 1RUC1 3GBWA 4OHZA 4XFFA 1LB2A 1ZZ9A 3AP4A 3IDCB 3WQ7A 4PCRA 1ZBA2 4KQ7A 1CAWB 2WSUA 1Q8SA 4LLFA 5GZFA 5BNNA 2NN8A 3N7MA 1YJKA 4QPYA 1XNDA 5JMCA 4B4PA 1LHUA 4CEWB 1ND3B 1YRZA 3ST7A 1B35C 3P3NA 1J58A 2Q1ZB 1NOVA 1OD5A 2Q0AA 2XUMA 2OW4A 4XJWA 5ABJB 3G6JB 3MZHA 2R061 2Z5WA 3CJIB 4ZU4A 4BMBA 1CQ9A 4IEVA 4UBHA 3LWCA 4OLLA 2DYCA 4N90A 1HW5A 5FLJA 3AYCA 5JPMB 2VQAA 2ZGLA 1Y3TA 2W52A 3SXWA 1CAUB 3OYWA 1RUE1 2RMU1 1PK6A 4F83A 5HXVA 5L7OA 1WCKA 4HLTA 4GH4B 4LNVA 2YDEA 5GM0A 4Q0SA 3VBSB 3MIDA 1N3QA 4YW1A 2XJQA 1REFA 4CDQB 3KT7A 4PDWC 4RQPA 3UKVA 1S2KA 2HWE2 3WOGA 3A0KA 2PHRA 2YMZA 5KXEA 1HDKA 3WCRA 4K6BA 5EWSA 1N3OA 2NYYA 2PHLA 3WY6A 1LKNA 1YHFA 4BIOA 4MGZE 2Q1MA 3PVOA 2W39A 2WLPA 1J1LA 4NWVA 3TYJA 1RMU3 3INAA 3FMGA 4HZFA 3MW2A 1FAYA 4H3WA 1GBGA 3VBOA 4OHVA 4Q8KA 2BFUS 5KHJA 4YVWB 1BBT1 1ZYBA 3GBGA 2OUJA 3USSA 4AEKA 5H9PA 3ZXJA 3MFCA 1ZZBA 3AXDA 3O0WA 4IEZA 3EHKA 3K48A 1H2KA 2DCZA 1HLCA 4MLOA 2Y0IA 2XBO2 5C9AC 1PO21 2WQZC 3N3HA 1QHDA 4P9LA 3MEPA 2RS52 3UJOA 2WZPP 4R9CA 2B46X 5CFDA 2YUEA 3QCWA 1TME1 1QJX3 5FOJB 2DCKA 3JUUA 1DIWA 5GLUA 5J96B 2RM21 5I0RA 3WQ1A 4FTBA 4XQWA 5C4WC 2CGNA 4UBGA 1SLLA 4I02A 3LKJA 3MF6A 2R49A 2DVBA 1PVC2 2I74A 4LLOA 4KWJA 1V00A 1VBA3 2AGSA 3AX4A 3HBZA 3VZNA 2D3PA 4LO8A 4BLJA 2A6ZA 5BNQA 1O5LA 3PVBB 2HWF2 2GC0A 4WM8B 2ETEA 3SHRA 1Y9QA 3ZYGA 3SITA 1QQP3 2YXSA 1AX0A 3JCIA 1QWRA 4MH0E 3E6DA 4FPLA 2VY0A 1JW6A 1ZA4A 4LO7A 5AC92 2GNTA 4LEJA 1CAXB 1C1FA 1POV3 3JD72 3M8LA 4JGYA 4EWDA 3BODA 5JVVA 1JH5A 2IXJA 1COV2 4AFMA 1CN1A 2VOWA 1XU2A 4ATFA 3JQXA 1NCQA 4ITCA 3GHMA 2BUKA 4XILA 1REDA 3PLQA 5GLVA 4YM0A 3SLIA 5J7MA 1WMDA 3ROUA 2D93A 2ZGOA 4N9IA 1AUYA 4DNYA 1Q8PA 3IN9A 3VHNA 5KXDA 2SBAA 1H0BA 1TQ5A 4BCUA 1QJU3 1MS9A 1URXA 2XWJB 4QGLA 4AEDC 4CP2A 5FPXA 1ULEA 4I30A 2CGOA 3H1YA 3MIBA 5KBFA 3R4DB 1I3HA 2XB6C 1QKQA 1CONA 2D7FA 3AFGA 1RUH3 1PGW2 1HQNA 4IEUA 4AQTA 3WP5A 2R041 1AJOA 5GALA 4QD2A 2XH6A 4JGZA 2WC2A 3B5LB 2D98A 1LOBA 3AMMA 1OOPB 1UU5A 4COWA 4K20A 1ASJ1 3NV1A 2WZR1 4FPYA 2HKXA 4HPKA 4I2OA 1LULA 5KHHA 1WW7A 1FT9A 4LO6B 4M3CB 1XE8A 1BQPA 3PHMA 4C91A 4CTEA 1PGL2 1LODA 2VU9A 3THPA 1S0DA 3AYDA 4N7UA 1MS1A 2SLIA 2WNUC 1R1A1 4IEWA 3T1LA 4Z2WA 4YM2A 4MV2A 4AHXA 1FNYA 1ZBE1 3ENRA 3N4MA 1V6JA 1LU1A 1ND3A 1LU2A 2WINB 3LA2A 5FO7B 2UU8A 3TB0A 3APBA 5GZDA 2E6VA 2ZGPA 3FUOA 3HWJA 2X29A 3MW3A 2UYAA 5ABJA 5K0UB 2YROA 1CD3G 4YSFA 3CJIA 3MFAA 5DDJ2 1QOOA 4BQ1A 4FO9A 4LHKA 3SNMA 5GZEA 1BKZA 1ZBA1 3WDXA 1LHVA 2VECA 4HKOA 3DKWA 3PJYA 1SLIA 4COZA 1S0FA 1AR93 1DGLA 2GC1A 1S0EA 2FHRA 4LO4B 2D6OX 4Z8BA 2EXJA 2IWGB 3RSJA 3WV6A 4QQLA 2GZWA 2VMIA 5AFEA 3G7DA 3GF6A 3LA3A 4QXKA 5E16A 3AJYA 2ZKNA 2HWD3 3M3QA 4AI2A 3KCYA 2WFF3 3VBSA 1U5IA 1CPMA 1DBNA 3ZFEC 1EV12 2FMDA 4JVAA 1S1AA 2JKBA 1XQNA 2DUOA 1SEFA 2W08A 4CDQA 2DUPA 1IZ3A 1IPKA 3M3IA 3M7AA 4PIZA 5TSWA 2C1FA 4COVA 2NQYA 2VW1A 3KMHA 4Y1YA 1LEDA 2E53A 2V09A 3MW4A 3SISA 1AX1A 2PLV2 2O8QA 5GJ6A 4FVVA 1W6QB 3MIEA 5HCAA 2CWSA 5FOBB 4YG3A 1RJ7A 1LESA 2IZWA 5I0SA 2HWE1 4YVWA 1LGCA 2GMPA 5FLHA 4EN9B 2PFWA 4AHZA 1FX5A 5KWRA 4XDQA 5T5LA 4KGQA 1WMFA 4QQOA 3EBRA 2H0VA 3BU7A 4ATEA 2N7GA 3OGGA 2VMHA 4PBOA 4FP2A 3ZXKA 4LBQD 2ES3A 1IHMA 1YCIA 2GNDA 1AYN3 2WA4A 5SV8A 4XJ8A 1UL9A 2NPIA 4Y1VA 4EWAA 5SV5A 5IK4A 1EP0A 4AI0A 2C0ZA 3TRSB 1TMF2 4ONUA 1R083 1KJLA 1SBDA 2XBO1 4Q4X1 4QPGB 2D44A 1OA3A 3NL1A 1FMD2 3ZXGA 3L2YA 5ACA2 3HQXA 1HRI1 3H8UA 1WD4A 4OULA 1YWKA 2JE9A 2JX9A 1S0BA 4CEYC 4WM8A 1CESA 1J1TA 1H1AA 1G9FA 1WD3A 2CTVA 4GB33 1VRH3 1ZRCA 4L8QA 4LTAA 4LE3A 1TNFA 1NE4A 4WV8A 4XEZA 1CAXA 2R062 2ZGMA 4L92A 5F5QA 1PVC1 2ZHKA 4WZCA 3OCPA 4Q4Y2 1QU0A 1VBE2 2A3XA 4OHWA 3H1MA 1ULDA 3WDUA 3POWA 3SCGA 3CF6E 4AK3A 2ZA9A 1HQLA 2QDNA 5BNPB 4AI3A 4Y22B 1AZDA 1YFWA 2UYBA 4FPCA 1MACA 2CY6A 2ZS6B 5I0UA 5AC91 3BCWA 3AZWA 1K5MB 3JD71 1MEC3 4CZSA 3THTA 4HFSA 1VIWB 4LBQB 1G7YA 1X33A 1R1ZA 2RR11 3VZOA 1D0HA 2P3IA 1COV1 3WZ1A 2FZ1A 3KS7A 4P9WA 1OHFA 1F9KA 2R072 2HEVF 2H0BA 3WP4A 4IV1B 2MNGA 3C2UA 1YNAA 1VBB2 4HSJA 1IS3A 1JUHA 3WNXA 4I0AA 4EN8B 4GULA 5JOWA 4FSJA 4ZU7A 3NJZA 3N35A 5DZFA 4RD7A 2K2SA 4NOTA 4YZ3A 5BNNC 2BVVA 1DGRN 5J3UA 5FREA 1VB4A 1WW5A 2RS33 1NA1B 5T50A 4BIFA 2RHPA 4D3WA 3TNQA 2ZHLA 2YZ4A 1GNHA 1BBT2 1DHKB 4M3CA 5K8SA 4E4DX 3MIGA 5JZGB 1AJKA 1UAIA 3WG1A 5JAXA 1PGW1 2WT1A 1XNKA 2BYVE 2DTYA 5JPNB 4XQ4A 1PO22 3ES1A 3VZLA 1N47A 5A33A 2GH8A 3NWKA 2WNVB 2IXHA 2UURA 5JI9A 1RUF3 2PQQA 1S2BA 4YFZA 4ISQA 5FCCA 1VP6A 1HXS1 1MZFA 1QXJA 2XLGA 3RI8A 1PK6C 3GHNA 1HIXA 2ARXA 2B45X 5L7OC 1JYCA 1U5XA 3MICA 5K0UA 5IK7A 2DU0A 3UKNA 2XPJA 2GNBA 1UW8A 2E7QA 3GBFA 1DGWX 3JBG1 1PGL1 4DRVA 4Y20B 3ZXAC 2E51A 4Q8LA 1LECA 3H9AA 4D7YA 2DU1A 2P3KA 2Q5TA 2ZABA 1ENXA 4RQPC 3UL2A 4AGRA 1IGOA 4E27A 1YYNA 1VAMA 1BYHA 1RUJ3 4URTA 1VR3A 3WT3A 3FC0A 3GNEA 3VHPA 1PHMA 4GMP3 1RUC3 3ZN4A 5C8WA 1S55A 2Q30A 1Z0HA 1X82A 2C5DA 1CX4A 2ZOEB 2XG3A 4NO4A 4HKLA 1GZ9A 4L2NA 4S2GA 3VBOC 1V9U3 2IXCA 4GQ7A 1AR62 1AHSA 1BVVA 1O4YA 4COUA 2BQPA 5C6CA 2OZJA 3NAPB 1F2NA 5GLTA 1W6QA 5T3NA 4S2FA 2VULA 4FT8A 1CR7A 2DURA 2VGDA 4ES8A 5CFCA 3TN93 2VW0A 1EV11 3RYRA 4GKYA 4M3CF 5CFDC 3MLKA 4DPNA 3AM2A 5GLWA 1YFYA 2YGMA 3O12A 4RGAA 5EZWA 4D69A 1G8WA 3EXUA 5I93A 1RUE3 1YO8A 2RMU3 5A32A 3VV1A 4YRDA 2PLV1 1POV0 2PHXA 2UWAA 2EA7A 3FFZA 2ZGRA 1S0CA 3KCCA 5C8CB 3IMNA 2MEV3 3KD4A 1KS4A 4ASMB 2YHJA 5BNOB 4Z07A 1VBD3 1RMU2 2I07B 2ENRA 1QNWA 2ZJCA 4RS5B 4FOYA 2PYTA 3RI9A 1L3JA 5T5JA 1DQ6A 5CU1A 1DZRA 3BOPA 2A6YA 4RL7A 1WUVA 2ZTNA 1NLRA 4QPGA 4FOWA 4XXAA 1Q8QA 3AXEA 1TE1B 4R4XA 2YGLA 1YJLA 1DFQA 2EVXA 1REEA 1MQTC 3RZZA 4OVEA 4OI4A 2HWB1 1NCQC 5F6KA 1D4VB 1AVBA 1U0AA 5BUVA 3B00A 5HBAA 5EYXA 4A7ZA 4LO5B 1WBLA 1QJX2 1SBEA 5KC6A 4BA6A 3OBTA 3VBUB 3WUDA 3N7JA 1C5IA 4YVSB 3R0RA 5T54A 3KGLA 4DQAA 3J8F2 1KD7A 1TMF1 2GC2A 4XHBA 4BLIA 5FMOL 1DDLA 5HCBA 3WG3A 1RITA 2WS93 2DFBA 4JDMA 5BPXA 4EN6B 1W0OA 1FMD1 5ACA1 4LBOA 1KDMA 4YG6A 4WVMB 1RUG3 4XF1A 2AYHA 1ZZ8A 2Y38A 4P9IA 4XFIA 2RM23 2DVDA 4R4ZA 4U36A 3WP6A 2QCSB 2B9UA 5F9TA 5BNPA 2PA7A 4ORFA 4Y22A 5KC5A 2GN3A 1N1YA 4JGZC 4Q4Y1 4LBQA 1X8EA 1VBE1 4AQSA 1AR83 1H8TB 2AH2A 5GKAC 3NW4A 2VVDA 2XLAA 4X6RB 4UW6A 4IV1A 2WIIB 3OBRA 2GSYA 4P9XA 3DN7A 4XETA 5FBZA 5CAZA 5JOZA 2ZZJA 1QJY2 3VN4A 4I09A 4RHV2 1DYPA 1DQ1A 1UN1A 1GR3A 1KJRA 4CEWC 1ND3C 1RUI1 1IQAA 3U11A 4NVPA 4FTEA 3WG4A 4WVZA 2Q4SA 2QQPA 2VNGA 2JECA 3VKOA 4B8EA 5I91A 1W2UA 2NZ9A 4SLIA 5FO9B 3FE5A 1ULCA 2R071 3WX5A 5JZGA 5ABJC 1RUOA 4BZ4A 5KHIA 3O7OA 2F6BA 1VBB1 3CJIC 4A3XA 3RWNA 4QPIB 1LOCA 5DUXA 4FPEA 3LZZA 4OFGA 2D3SA 3WP3A 3M3EA 4EWEA 5JOXA 4E2GA 2WNVA 4JDNA 1H2LA 3ZYJB 2OVUA 1XXNA 5BYNA 3NKGA 3HT2A 2FBEA 1VBC1 1LOEA 4XFGA 5DUWA 2P2KA 4FXKB 3HT1A 1XE7A 2HEYF 1JYIA 4HK8A 1QGLA 1KFUL 4GH4C 3TNPB 3VBSC 4WVWA 4CDXB 2YYOA 4YW3A 2R043 2VVEA 4GALA 4IESA 2DVAA 4IEPA 1FPN2 4Q4X2 4CDQC 4ISRA 1SLCA 2DTWA 4ZKTB 5GZGA 1HRI2 2WZR3 3HD8B 4M0HA 3VZMA 4FAGA 2LTNA 4LBKA 4JCKA 4YFWA 1GFF2 4EROA 2NLRA 4K8FA 5E88A 4AI1A 2RJLA 2TNFA 2DCYA 1ZRFA 1AX2A 2Z69A 1R1A3 4XHXA 3VBFB 4XTPA 2K9ZA 3CEWA 2QVSB 3FJSA 3USUB 3WW1A 1C5HA 1V6IA 3ZVXA 4BE3A 4FQZA 4YVWC 4QHBA 1WMEA 5FTTC 1NY72 3BIWE 1KRIA 3AZXA 2ZMLA 1AL22 5LRSA 2A75A 3MF9A 5FDBA 1X8MA 4DY5A 2IXIA 3NAPA 3ZFFB 1GLHA 3V0BB 3FFQA 3ILFA 2D43A 1UPSA 4AVAA 1AYM2 3D0SA 1WW4A 2ZX3A 1ZBA3 3WDTA 2UY8A 3I7DA 3IDBB 4JTNA 1SLBA 4Q4W3 2JG9A 1RVF3 1NCRB 2MHFA 2RR12 4NHLA 1ULGA 3VKMA 3W9AA 2Q8OA 1OSGA 1MQTA 1AR61 1IOAA 1DU3D 3AKRA 4LHLA 1W6OA 3C3VA 5CB7A 3ILRA 4GWNA 1Z7S2 1JBCA 1UF2C 2P34A 3KT1A 3RYKA 1ZX5A 1H9PA 4Q4V2 4E4ZA 4KH9A 4X8NA 5C8CA 2BBVA 2A5ZA 3DGTA 2JENA 5BNOA 3GYDA 1BMV1 2XL7A 3RJRA 3MLLA 4YZ1A 4WM8C 4YGEA 4RS5A 3TWIA 1FYUA 4YLZA 2VNRA 2DWRA 4COYA 4BHPA 2X5IB 4KG8A 2G9FA 3VDDB 4IV3B 4TLFA 3OD0A 4FQ4A 3SH5A 3ZPYA 1O3QA 4F8AA 4IEQA 1GANA 5FMOS 1A6CA 3WVJA 1YFUA 3VKFC 1OKQA 2GAUA 3FWEA 5J98B 3LAGA 3B94A 2PAMA 2NM1A 2JDZA 4K9SA 4R8HA 2ZGSA 2A3WA 2HWE3 1RMU1 1SFYA 2RS13 3LSEA 3MIFA 3B9IA 2BNNA 3AKQA 4HMZA 1AYN2 4Z82A 5JR7B 1H8VA 1HXS2 2GMEA 3WDVA 2GC3A 4W6WA 2K0GA 1VAVA 4L97A 4UW3A 3VBUA 1IS4A 2ZAHA 3B69A 4Y26A 4YVSA 3R4UA 4EN7B 3JBG2 4PJYA 4KG0A 3T2TA 2ZMNA 1XYPA 4HN1A 4K40A 5EYYA 4IEXA 3AZYA 2QNKA 3SH3A 3ZIXA 5LEJA 1TEIA 4LT5A 1CAWA 1FATA 1PZ8A 1UD1A 3E6BA 4WVMA 3VBRB 1OFSA 3OGJA 3HAGA 4P9JA 2E7TA 4P9YA 4H7LA 4F7ZA 1PIV3 2ARBA 4CEWA 1PVXA 4GKXA 3WLUA 5EFUA 1D0GA 4DRRA 3A0NA 4V1PA 1QJX1 1CVNA 4AVSA 2O8OA 1PO12 3ME2A 4RSUA 3CJXA 5D1IA 2KA3A 3J8F1 1OOPC 5BV6A 1AF9A 5D8AB 4B29A 2RS53 1A8MA 2WT2A 1H8TA 5JCTA 1RUD3 5H9SA 3IWZA 2ZZQA 3AP9A 1AR72 3QD6A 1EAH3 1CAUA 1NZCA 3PNAA 4AF9A 4M01A 4XJUA 4GH4A 2VOKA 1PVC3 5FPZA 3ZX7A 4C1WA 4YGDA 2UWCA 1LJ7A 2VOVA 4BH9A 4W6YA 3TOJA 4XOGA 1C8M2 1POV1 1FI2A 2XJUA 2HWF3 1YI7A 5JWPA 2W68A 2ET1A 2ZGQA 4CP1A 4KU7A 4GMP0 1JOJA 5K0UC 1WCDJ 2ZCWA 4G9SB 4RGGA 3N7KA 4CDUB 4QPIA 4KWKA 4FP3A 4YW4A 5JSPA 4OI1A 3AP7A 1QJY1 4Y4YA 3ZSKA 5AC93 4RHV1 4NN0A 5HCFA 5BY5A 3JD73 3QLQA 4E9KA 3BOWA 3WR0A 4AEJA 3ZYIB 1DG6A 2OUHA 1COV3 2H6BA 2RS32 1MVEA 1QJU1 4MZUA 5IUQA 2ZGTA 4Q2FA 2A71A 4CDXA 3KZ4C 4LBLA 1C1LA 4B7KA 1O3RA 1XU1A 4FAHA 1GICA 1QOTA 1A3KA 1KFXL 1DZTA 2XGXA 3N36A 4N7IA 1RUH1 2PAKA 1ONAA 2Y0OA 2VW2A 1Q43A 2D6KA 1Q3EA 5BXXA 4Y1ZA 3BPZA 3L9JT 4FOQA 3LOIA 4K21A 4XE9A 3FLRA 4Z92B 2HWB2 2XHKA 3ZO0B 2D97A 3SCFA 1RUF2 2ZGKA 4L11A 3WCSA 3RS6A 1N1TA 1ND2B 1W6MB 5AFBA 3E5QA 2JXAA 2WQ4A 2JE7A 5CFCC 3VBFA 4ZU5A 3FZ3A 2HWC2 1MR5A 2XVLA 3USUA 3JB8A 1FPN1 1IS6A 4WM7B 4UXAA 1D4M2 2JG8B 2YY1A 4Q29A 2A7AA 2H6CA 4FOVA 3URFA 4UW4A 3WHTA 4QU2A 2VUJA 4AG4A 3ZFFA 3H1WA 4I3PA 4AQ2A 3NV3A 3V0BA 5EV7A 3ZSJA 1PM7A 1C57A 2DCTA 1MZEA 3FBYA 3M1HA 5JI7A 5DZGA 4AXOA 2ZMKA 3O0VA 1H1MA 1HV1A 1WLWA 1NXD1 3VKLA 1R093 5A3MA 1NCRA 3B3QE 2BTVC 3OPZA 5CADA 4Y1XA 3AP6A 1Q56A 1NY71 1UKRA 4YG0A 1AL21 3NSTA 4C1XA 1AR91 4HANA 4DB5A 1IKQA 2WKKA 2VNOA 3OD4A 3SCHA 4QPGC 2VVFA 2GN7A 4XFBA 2WL1A 5E89A 5DDJ3 1AYM1 3D0JA 2WFF1 3FLPA 1MZ6A 1ZVFA 3TN92 5K7PA 3ZSMA 3BALA 5I8SA 1RUI2 4R9AA 3T1MA 2PAEA 1J3RA 3WD5A 4CDWB 2X5IA 3VDDA 4IV3A 1BEV3 1S0GA 4XPVA 5J37A 1NG0A 3JU9A 2GU9A 1Z7S1 4MX3A 1EYBA 2R30A 1ZZ7A 4DMIA 1WLCA 1WGPA 4KU8A 4Q4V1 4AE2A 1EV13 1H30A 3UJQA 3E5UA 4M00A 3IIAA 3SMHA 4DFSA 3RRDA 1OOPA 2MEV2 3ILNA 3GZAA 2CYFA 3AMHA 1UKGA 4LULA 1LOFC 2EXIA 3OY8B 1VBC2 2DUQA 1W0PA 2ATFA 5BNPC 3AMQA 3E97A 3IM0A 5J48A 4PF5A 1JTZX 1DQ2A 4QGMA 1RHI2 5IK8A 3VLBB 1K5MC 4XZPA 4GXLA 1JHNA 3KM5A 1WW6A 1NLSA 3VBRA 4XMAA 1VAKA 4W6XA 4YW5A 4F3JA 1RINA 1RGSA 2GALA 2ZKLA 1HRV2 3DPRB 1CJDA 3JB4C 4IV1C 4AVCA 1AXKA 1AYN1 2QZ2A 1RIRA 4QQ2A 1HX6A 3RDIA 4FBFA 4Q0PA 4LA3A 1UU4A 1D2QA 1DQ0A 1ALYA 1DGRA 3IDEA 3MPPG 1OLRA 4JQRA 2WFPA 5D8AA 5FRAA 2B39A 1R081 4AI8A 1OA4A 5KHKA 1NA1C 2C9AA 2WS92 3EQEA 1X7NA 2HEWF 4HETA 4YYOA 1FOD3 5JZGC 2WSVA 3U07A 1O91A 4LBJA 3WHUA 4RR3B 4M0NA 4Q26A 1PO11 4O9EA 1TMF3 1VRH1 4B4QA 2UWBA 1QY4A 2D5HA 3I59B 3RJ2X 2WLQA 4L99A 5FQ0B 4MYEA 3ZXFA 2WNVC 3FX3A 4AVTA 3WINE 4HVQA 5ACA3 3QH7A 3E6CC 4K3UA 3AFKA 1B09A 1W39A 3O5SA 4WBBA 3FBMA 1UZYA 4IQPA 4AYUA 5FAXA 3U0ZA 1YI9A 1AR71 4S2DA 2AR6A 2XKOA 4CDUA 1I1EA 3PTYA 1DF0A 4G3YC 4N43B 2CGPA 3LOBA 2R063 1XRUA 2EXKA 5FFOC 5CG8A 4Q4Y3 4CRQA 1BMV2 4I3GA 1C8M1 1NQJA 3ZFGB 1MEC1 1MS3A 4O9GA 3ZYRA 1EPZA 1RJ8A 5EXOA 1BXHA 1H4HA 3VBHB 3ETQA 4QGNA 1OFNA 1VLNA 4XF3A 5CBLA 3IPVB 4GWMA 4OI0A 2ZX0A 1MS5A 4MGKE 2DCJA 4C90A 3ATGA 2R6QA 3I8TA 5I8TA 2JD4A 4JGYB 3CU7A 2VXRA 4N9HA 4YZ4A 4BPZA 2XJTA 4SBVA 4NWWA 3NAPC 1W6MA 2GMMA 2RS31 3LSDA 3WUCA 2V73A 3CLPA 3NVCA 1VBB3 2BNOA 1OI6A 3OJBA 2IFRA 1GV9A 1RC6A 1V6OA 2DVFA 4HT1T 5GZCA 1FNZA 4INDA 4KL1A 4YGCA 5KXCA 2WWSA 1FV2A 1G86A 4N53B 1DLLA 2JG8A 2JG9C 1SQ4A 5DXDA 5AVAA 3TBDA 4Q0VA 2CAVA 4GA9A 2DVGA 3I4IA 4Y1UA 4YW2A 3WG2A 4BWOA 1Y43B 2E7AA 1BBT3 1RUF1 1J59A 2VOXA 3RPQA 4X6QB 4RFT0 3L2HA 2PHDA 3BTAA 3MLJA 3B9CA 4BM8A 4CYDA 5C8CC 4QQPA 4DS0A 1BK1A 1CAVB 1PO23 1ZREA 1B35B 2HWC1 5BNOC 2OA2A 2GH2A 2EAKA 4FPGA 1S0JA 4RS5C 4XJZA 1D4M1 1VBA2 2PHWA 1TME3 2YPJA 4D7TA 1LOFA 4LHNA 2WJSA 3VL8A 4L9BA 1LHWA 4HPKB 2RJKA 1PMIA 1LHOA 1ENRA 3ZN6B 1C8NA 1MS8A 2BGCA 1IS5A 2PN5A 4GMP1 4Q1PA 4D94A 3SH4A 3AKPA 1QQP2 5CG9A 3B02A 4R52A 1K5MA 1ZRRA 2ZPXA 1GNZA 1OPMA 1C28A 1D2SA 4CDWA 4Q4W2 1RVF2 2EF6A 1TNRA 1V9U1 4FPJA 3H50A 3VBUC 4AGGA 4LR4A 4YVSC 4PDWB 3LCPA 5F1RA 4KGGA 1KQRA 3S0MA 4KWLA 3ECQA 4RA0A 1KXGA 3RNSA 4AVVA 3UV9A 4Q1RA 3B93A 5JOYA 1YLLA 3TN91 1G9AA 4PBPA 4GIQA 1HV0A 2G4IA 3D4KA 4QM8A 2LM3A 3OY8A 3QACA 1PNGA 3AKTA 1AR63