3JQXA

Crystal structure of clostridium histolyticum colh collagenase collagen binding domain 3 at 2.2 angstrom resolution in the presence of calcium and cadmium
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
117
structure length
117
Chain Sequence
YPIGTEKEPNNSKETASGPIVPGIPVSGTIENTSDQDYFYFDVITPGEVKIDINKLGYGGATWVVYDENNNAVSYATDDGQNLSGKFKADKPGRYYIHLYMFNGSYMPYRINIEGSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Comparison of ColH and ColG Collagen-Binding Domains from Clostridium histolyticum.
pubmed doi rcsb
source organism Clostridium histolyticum
molecule tags Cell adhesion
molecule keywords ColH protein
total genus 23
structure length 117
sequence length 117
chains with identical sequence B, C
ec nomenclature ec 3.4.24.3: Microbial collagenase.
pdb deposition date 2009-09-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.380 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3jqxA00
4HPKB 1NQJA 3DF0A 5SV5A 1KFXL 2QFEA 1WMFA 3BOWA 3JQXA 4DY3A 1DF0A 1QXPA 3JQWA 4DXZA 2XVKA 1KFUL 2O8OA 1WMDA 4I3GA 5FAXA 4DY5A 2XVGA 3AFGA 1WMEA 1NQDA 4HPKA 1U5IA 4G9SB 5FBZA 2XVLA 2LUWA 4DZGA
chains in the Genus database with same CATH superfamily
1R092 4QPGB 4PLMA 5LA1A 2HWE2 2JICA 1RVF2 3WSOA 4QD2A 4AQ6A 3VBHA 2WNVC 3HD8B 3USSA 2IZWA 3I2OA 1FOD1 2AENA 3PURA 4E4DX 4KU8A 1MZEA 1PGW1 5F8PA 3TNPB 2VMHA 1QIQA 2Z42A 1HQLA 1R091 2MHFA 5DAXA 4P5HA 3AXDA 2A71A 3CDZB 4FO9A 3K51A 4TYSA 3WD5A 1YCIA 1AR61 4N9HA 5CZKA 1PZ7A 3OG2A 4LBMA 2FCTA 3S6PA 4YW4A 4Q4X2 1BBT2 2GNTA 4XQDA 3WDXA 2ZS6B 4YW5A 4YSFA 2PHUA 1N47A 1IS3A 2QTWB 2RM21 3AKTA 1RUJ1 5FMBA 3SNMA 1NAEA 2ORZA 2BYVE 5FKCA 1Y43B 5FUNA 3U78A 2AC1A 3RZHA 4Q4X1 1XNTA 3THTA 5FZGA 3WQ7A 5BNOB 1PMJX 4UFJA 2HBTA 1UW8A 4XJ9A 4QPIC 3RYKA 3LWCA 2FMYA 3AFGA 3H8OA 1WCQA 2WAOA 1O5UA 2XKOA 4QQ2A 3M3OA 1ASJ2 3BGAA 3HPNA 2YPJA 3BUCA 1NY71 3VZJA 4HPKA 1JOPA 2D6KA 2WSUA 3C2UA 5KXDA 1DHKB 4A45A 5I0SA 5J48A 5L36A 5LBFA 1W3VA 4XZUG 1MEC2 3NJYA 3WG3A 4WM7A 1EYBA 4QQPA 2PHXA 5FPXA 1TME3 1FOD2 1UYXA 4ORFA 5HPOA 2HWC2 1AL23 2WLPA 1VALA 2B42B 3POGA 1Y7BA 1OH3A 1UKRA 3G6JB 1AR81 5F5QA 3ZYJB 2GN3A 1JYWA 2OQ7A 2DFCA 1DYPA 2W9XA 3U75A 4KWKA 5CKMA 3IWZA 1AYM3 5F7UA 3E5QA 4CDXB 2YROA 1TME1 1KQRA 4IV1C 3J8F2 3M3QA 3VN4A 4UFKA 1TVGA 1W8UA 2VL4A 4XEZA 1SACA 3ZFFC 1IG3A 1OBNA 4XFGA 3V64A 2R041 3AKPA 2XVLA 1LGNA 3W21A 2BOIA 2X10A 1GZWA 2XJSA 1ZZCA 1CPMA 3FLRA 1W0PA 1ENXA 5DAVA 3T1LA 1C8NA 3ZDSA 3L2YA 1RUH1 3JCIA 4JX0A 2WIIB 3ZSMA 1OOPB 4HZFA 4LMFA 4O65A 3UT0A 4AEJA 5IYYA 2W08A 2CYFA 4B4QA 3N9MA 5I91A 4BWOA 4XPVA 1RUNA 1NLRA 1QKQA 4XFBA 4AQTA 5EIYB 1BJQA 2R16A 2ZAHA 2ZJCA 4MGZE 4BPZA 4PIZA 3VDAA 2IXKA 5HXMA 1T2XA 1IKPA 1MEC3 3WG1A 1UO9A 2A5ZA 4LITA 5M0TA 3Q8AA 1CAUA 2XWBB 1JI6A 1SLCA 3RI8A 5BNNC 1BKZA 4CCJA 4LTAA 3SHRA 3WR0A 5IFTA 1RUOA 5JXHA 1VBD2 1TMF2 4EZ4A 1QOSA 1BMV2 3AMNA 3U1XA 1N1VA 2L9LA 5HV0A 1W05A 1SFYA 3O1VA 4JCKA 4P00B 2XB6C 1POV3 2XUMA 3PUHA 2VO5A 4FTSA 1C1FA 4NPRA 3VBOB 2FDHA 4PI2A 1YQ8A 3SCHA 3WW2A 3WDYA 5DG1A 4BMEA 4IEZA 1UOJA 5FZ4A 1S0GA 3K4AA 1BBT3 5D8AB 1HQWA 2EA7A 1Z78A 4RQPA 1NQJA 3ZXLA 2Y6GA 4LPLA 3A23A 1S0DA 1UY3A 5LBEA 3WNNA 2GNDA 1S2KA 2ADDA 4ZKTB 4XAAA 4M3CE 1ULOA 2XJRA 3GHMA 5JSOA 2VXJA 1JYNA 1HB1A 2UURA 4CUAA 4UFHA 3J9SA 3H3LA 3LEMA 3R05A 1ODNA 4AQ2A 2YMZA 2Z4FA 2VMCA 3IDBB 1KJRA 5FOJB 5A6YA 3R4DB 1N3QA 2P2KA 1NOVA 5FP9A 1NG0A 4Q0UA 3VBSC 5C3RA 4Z2WA 4CDUC 2JXAA 2PMWB 1B35A 3H1YA 1GOHA 2ZGRA 3IT8A 4ZU4A 1W8TA 2RR11 3MF9A 2YG0A 5C8CC 1OKOA 1AR72 1GANA 4YZ2A 4QDSA 1C28A 1KDMA 1VBA2 1UY2A 1YEWA 3FWEA 1POV0 2MEV3 3RZGA 4IEWA 4D69A 3VBRC 4LBQB 1PIV1 2VCMA 2BWAA 4XMAA 5DPNA 3TBDA 3NNLA 1CJDA 2AGSA 2D6OX 4X6QB 5CIRA 4R4ZA 1Q8QA 5JWPA 5GZEA 2R0FA 2D6LX 1ND2A 3KV4A 4OUEA 2XLFA 4COZA 5E1RA 3X29B 1X9TA 1D0HA 1JZ4A 3EHKA 3I3QA 2YDEA 3ZYRA 3BTZA 1I3HA 2R49A 4Y4RA 5CYYA 5EPAA 3UKNA 3CMGA 1F2NA 3DL3A 2W91A 4N43B 2ZEXA 1NCQB 4QB2A 4LIVA 2CV6A 3GNEA 1Q3EA 2YBPA 3BPSA 3LA3A 3LFMA 4X8NA 2KA3A 5L9BA 5SV5A 5J96B 4XF0A 3ZPOA 2GDFA 3OEBA 2J42A 4Q0QA 4MSVA 1G7YA 3O1PA 3PUAA 2A6XA 2Q1MA 5FZ1A 3VKNA 1S0JA 3O0VA 4R4XA 1A78A 4LBNA 5EV7A 1RUE1 2ZEZA 1W2AX 1COV1 1H2MA 4OVEA 4COUA 1ZBE1 4AHXA 2GC0A 4F3JA 3MIEA 1A34A 1JMUB 3N9QA 2HKXA 1GR3A 3FC0A 2ZGNA 3GF6A 3OBZA 4N53B 3FLTA 4HVQA 1ZA7A 1AR63 5BNPB 4LUKA 1QJX3 1QQP2 4IESA 3RPQA 4OZXA 1W6MB 4HN0A 4BLJA 1ZVFA 1AX0A 4EWEA 4Z92B 1DG6A 2BUKA 3E6DA 4LLOA 3T09A 5C33A 1GYKA 2WZR2 1VPHA 1X8MA 4HLTA 4I02A 4LBQD 3OJBA 2ZGQA 3O0WA 4DY3A 1E57A 2WDBA 3N7MA 3VKLA 2WS91 5L9VA 3UJOA 5BUVA 4BZ4A 2ENRA 3RZJA 1X7NA 4FXGB 5FZIA 3UJQA 1YQ5A 1O3SA 3SQOA 2BERA 2D93A 3N9OA 3ES1A 3WG2A 5T3NA 5AC92 4E27A 4Q4W1 4RA0A 2G19A 1HB4A 2XLGA 2PTMA 3SEPA 3PUIA 4Q27A 1PO11 3KT7A 5DUVA 1DQ0A 3PL0A 2LS6A 1VBC3 3FUQA 1QXJA 4GKYA 2QBXA 5GLZA 3WP3A 4CXYA 4BQXA 2Y60A 1W03A 5GLUA 1MS3A 1J1LA 4GMP1 1N1SA 5CFCC 2N7GA 3JBG2 5T52A 1Y4WA 2QQWA 2D6PA 3ACLA 4NMIA 2JWPA 1S2EA 2XWJB 3ZKYA 1APNA 5HI0A 1ZZ9A 1RUJ3 2AEYA 1GBGA 1UKGA 3ACIA 1YIFA 4CUCA 4Q8KA 4E4SA 3S30A 5DUWA 4NRMA 1YJKA 4WM8C 3RMXA 1C5HA 1ZZ7A 2NM1A 5KC5A 1CAVA 1O91A 2YXSA 3LPGA 5K0UC 2Q30A 2YHJA 5C7GA 2VOWA 3GDBA 5ACA2 1MQTC 3BU7A 5A3NA 4DO0A 3K75B 5BNOA 4AE2A 1TNRA 5BY5A 1HB3A 1LRHA 4AGRA 4NO4A 2VQTA 3WOGA 4JGYB 4GA9A 4Q5OA 4RHV2 3WY6A 4FCAA 4AEKA 3HT1A 5B2GB 5IK8A 3GYDA 3CNAA 2Z79A 4O9EA 3HR9A 4RFT0 4P9GA 3SKVA 4WVWA 5L19A 4JHZA 3N7LA 3RGBA 2VMDA 2D44A 4LKDA 2W92A 4AOCA 2CAVA 5EP9A 3SKJE 3VDDC 5EXOA 1G9BA 4QX3A 1SLLA 3A0KA 3I2GA 4LE4A 1VP6A 2AACA 3WP4A 1NT0A 4F83A 3RFRA 1PMHX 5E16A 1U12A 3GBWA 3WQBA 4E4HA 2C0ZA 2EAAA 1GOFA 1T6GC 5IK4A 3GCXA 2JDUA 1RHI2 5T5PA 4B8EA 1RUD3 1UZVA 2GNMA 4BIFA 2JDPA 3MV11 1RTVA 1JHNA 5FZ7A 4XFFA 2UY8A 1ZBA1 3NSTA 5KHHA 3S57A 4LORA 4RQPB 1NKGA 1UOFA 1E5RA 3JD71 5CA6A 3IM0A 1REDA 3ZIWA 4GWIA 1VB2A 1NA1C 2CDOA 4IEPA 4PI0A 2GH8A 3WVJA 1K45A 4EE2A 2DUOA 2CWSA 3BTXA 3M7AA 1QNWA 1VE0A 5D1IA 1ASJ3 1JOBA 1FNZA 4NIAA 3NNFA 2B4KA 5F3CA 3ZFGB 1B09A 4DFSA 5FZBA 1CJPA 1ZBE2 4CUBA 3U4XA 4P5YA 5BNNB 1ULGA 4NPMA 4A7KA 5DZEA 4YM0A 4LO8A 1BYHA 4LA2A 2RDRA 1N3PA 3E5XA 2CU5A 3J7LA 4DXSA 2WNVA 4N7UA 4K7JA 2O8OA 1VBE3 1VLNA 3ZPYA 3ZXEA 3CZUA 1CGPA 4R9DA 3AKRA 4AHYA 4AW7A 4CRQA 4UXAA 4PLNA 1WMEA 3WP6A 2UWBA 2Y26A 4XDQA 1XXNA 1H9PA 4BHPA 4CEWB 1GOGA 4PIXA 4YW1A 1X82A 1W8ZA 3ZM8A 4M0HA 3MBWA 2D3SA 1OQDA 4MHRA 2W87A 3DN7A 5AFBA 5C70A 5I93A 2JD9A 4AFDA 3UGHA 5FWJA 2E7AA 1C8M1 3KQRA 1CN1A 3RMYA 3CF6E 4MXVA 5A33B 2Z69A 1ASJ1 5J09A 1RB8G 4AG4A 2VZ3A 3LAGA 2OKXA 4LK6A 1WZXA 4E2QA 3H9AA 3AZXA 1PVC3 2K0GA 3ZYBA 2RMU3 5DXDA 5FZDA 2FCVA 3IAQA 4KQ7A 4YVSC 2DTWA 1JS9A 4Y5SA 1OFSA 5HV4A 1TEIA 1RUF3 1RUC3 1Y9MA 3MYXA 5FCCA 1Z0HA 2BEOA 3WF1A 1KEXA 3AMQA 1US3A 3U07A 2XL9A 1WLCA 1CVNA 2JB4A 2LW8A 4WBBA 1F8VA 1IPKA 5F5IA 1NCRA 4IQPA 4LO7A 4CCNA 1UPSA 2Z5WA 5EJZB 3ZFEB 4BIOA 1ULFA 1D2SA 1WWYA 2IXJA 1XB9A 4HK9A 4QU1A 1XNDA 1AXKA 3KLSA 3W59A 2OUHA 5C3QA 4YG0A 4GULA 4BQWA 1W6QB 4CU8A 4OI2A 1W99A 3Q9OA 1UXZA 2OZJA 4LBLA 1MS5A 2WQZC 4GAZA 3H0OA 4OULA 5AFEA 1AXYA 1UPIA 4JDNA 4K40A 3ZXAC 4OQ8A 1E5IA 5A1FA 3R4UA 2VUAA 4Y5Z0 3K48A 5FZ3A 1EAH1 1L7LA 1QJU3 2X05A 4M4PA 2H6BA 2GP5A 2XBO1 4JVAA 4XXPA 3VBUC 3HJRA 1S0EA 4N90A 4AK3A 4CDQA 3BOWA 4JRAA 4NHYA 4W4ZA 4OCTA 5KHGA 2GC1A 3UL2A 1H8VA 1NX9A 2WFF1 3T2QA 4J1WA 1QNYA 1W2UA 3WDTA 2YU2A 3P6BA 4XBLA 1IOAA 1JW6A 2VZ1A 4PCRA 3POIA 1YRZA 4ZPIA 1UYYA 3UK9A 3IB3A 1ZZ8A 3LEGA 4XW3A 3WEZA 2W0XA 1QWRA 2F4LA 2GZWA 4IEUA 4FP3A 2RDNA 3VD7A 2MNGA 2ZACA 1AL0G 1C8M3 4YVSA 4FP2A 1VRH1 2QDNA 2XH6A 2RR12 2VTXJ 3WZ1A 3ASIA 2TBVA 5DUXA 1W8FA 4D7TA 5EYYA 2YGMA 1V0AA 1XBFA 2I74A 2PHWA 3M2MA 1ENRA 1MQTA 1LOEA 1PM7A 2DCTA 3AP9A 4GKXA 3E97A 1LEMA 4HSLA 3ZFFA 5F1RA 3C8XA 1RUF1 4BDVB 3I3EA 3WUDA 1LHNA 3H3UA 5FTTC 1UQXA 5GLWA 4N7IA 1ZZBA 4QX0A 1TME2 1FOD3 3T30A 3WXPA 1L3JA 1ALYA 1NCRB 2WRAA 3TN91 3CJIC 1D4M2 2YFUA 1DGWX 5LZ6A 4RS5A 1Z7S3 4JKLA 4FQZA 3WG4A 2GP3A 1OD3A 3ELNA 3HWJA 2A6YA 2R7EB 3VDBA 4EWAA 1KFXL 1NLSA 1VMJA 1R082 2HWF2 2RM23 4DEVA 2W3JA 5C4WB 5C6CA 4YNIA 4KG0A 5FLJA 3WCRA 1YI7A 3BOPA 2LM3A 4Y26A 4RGGA 1BEV2 1GQHA 4QPIB 3HOBA 3HN3A 1EV11 5CFDA 4YFZA 1PHMA 1YQ6A 2XBO3 1LULA 2NYYA 4U36A 2WABA 5IUQA 2XL7A 3RVHA 3I59A 4CXXA 2I07B 1UZWA 1OLQA 1RUI1 4JKKA 1SQ4A 1WW4A 2XQRA 1CAWA 4WM8B 3S7IA 5IATA 5F37A 2ZGMA 1V00A 1FNYA 1HN1A 3AMMA 1DGLA 1SBFA 4XFAA 4QKFA 5A7PA 4XXAA 5A80A 1UYPA 4CXWA 3T1MA 5KHJA 5LA2A 4Z1VA 3F2ZA 3EB7A 4P14A 3ZYHA 5FKBA 4RS5B 1S0FA 3RWNA 1GNHA 4KWLA 2E26A 4ISQA 1GQGA 4CP0A 1XE0A 3S0MA 4QT6A 1JTZX 3WF3A 2BFUS 2ZHNA 2Y8KA 4EN0A 4Q0PA 2V4AA 1UMHA 1VRH3 3ACGA 3DV8A 3T0BA 1LOAA 1MS8A 1LOFC 1OHFA 3AVSA 5E6HA 2R063 4KI5M 3NKTA 3ZFFB 5LCWL 2VMEA 1W2NA 1W9SA 1MPXA 1UMIA 2PA7A 1WCSA 5IAVA 3T2PA 4UBHA 2W1QA 2VUCA 4LHLA 5CNAA 4ZONA 5F2WA 3GZAA 5T54A 2JG8C 1VRBA 1XOYA 3NL1A 4MO3M 3B3QE 3SH4A 1DBNA 4CEYC 5KC6A 3RG0A 4PLOA 1I5PA 1JODA 2JG9A 4IE7A 4QDQA 1ULEA 1PVC1 1W2OA 5FP8A 5LBCA 3DCQA 4B1MA 5GZGA 5KR7A 5APAA 1CIYA 4MXWA 1K12A 5KXBA 4QX5A 5FO7B 2HWD1 4CPBD 1O5LA 2B45X 4BQ2A 2IXLA 3JB4C 3MDPA 4IGPA 3V56A 3AKQA 4XFHA 3VZKA 2P34A 4QX1A 2RHPA 4GH4C 5I8SA 1CZSA 1EPWA 2WNUA 3J8F1 5A1AA 4RSUA 4GMP3 4XUNA 4AEDB 1RUJ2 1TMF1 4L8QA 4BQ5A 2EICA 3ZXDA 5LB6A 3PHMA 1UIJA 3LB9A 4LHNA 3ZO0B 5BXXA 1DYKA 5LK5A 2P1BA 4BMBA 1STMA 3JD73 5DZGA 1OMIA 2O14A 3PMSA 1FV2A 1KS5A 2D5FA 5DQ0A 4L97A 4YWAA 2IXCA 3CHXA 4IE4A 3R0RA 4H55A 1VBA1 5DAWA 1PK6C 3B02A 3I3DA 3D0SA 1UL9A 3AC0A 1POV1 3POYA 3WT3A 4A6SA 3KD4A 3MO4A 2BVVA 2R062 2WWSA 4AAPA 1NYWA 5F5AA 1BZWA 4BQ1A 3VL8A 1KITA 2BQPA 3IDAA 1YO8A 4XHXA 5A7WA 1VBA3 3CJXA 4FTEA 1NXMA 1W6NA 3FBYA 1JUHA 4K1ZA 4DUWA 3DGTA 4AHWA 2RS33 1LECA 2VMIA 2YPDA 3OGSA 1I1EA 3KV9A 2Q1FA 2PXJA 2R0HA 2R32A 3T0AA 5FY5A 3UESA 1KDKA 4HONA 5FJKA 5E89A 3VZOA 4OHYA 4P9XA 4UOJA 2DTYA 5G05L 5K8SA 4QXKA 3SCFA 1V6IA 3N9PA 1AX2A 4XDPA 5CFCA 2PHLA 2WNUB 2EIGA 4D7SA 4WVZA 2A7AA 5IT6A 1ZBA2 3WQ0A 1TNFA 5C9AA 3WF4A 2JDNA 4IGQA 4KH9A 4HVRA 4E8DA 4J6GA 3HVDA 2RJKA 4MH0E 4YGBA 1YFXA 3VL9A 2ZGSA 3CKHA 3OEAA 3MPPG 3ZLIA 4XQWA 4CDWA 4DB5A 1K5MA 1JN2P 3VBSB 1U5YA 1XU1A 1YLLA 1RUH3 4IXLA 4PDWC 4QM9A 4QPWA 1JZ2A 5FXZA 1JYXA 3HNYM 2OZ6A 5FBZA 3WDWA 1HN0A 2FDJA 3VHNA 2XXZA 1VAMA 3OPTA 4GH4A 2ZGTA 4DZGA 2HEYF 5FZ9A 1YFWA 4RFRB 4CU7A 5DAPA 3U4SA 1H30A 3POJA 5DABA 5BNOC 3O1SA 1J1TA 3SH5A 2ZX4A 4CP2A 5AVPA 1GUIA 5CAZA 3HMYA 2DVGA 1KFUL 3POEA 3TRSB 3SMHA 2XJVA 1WLTA 4GB32 4ITCA 2JDAA 4MVTA 5A3UA 1LGBA 2WZPP 1F5JA 4L92A 2WYSA 4Y1XA 4AFCA 4QKNA 3OYWA 4MHUA 2VGDA 5I0TA 3PVEA 1JYTA 2WT2A 2E33A 4NHKA 2J1SA 4WM7B 3LOBA 4NHLA 1W6MA 2RS11 4HG6B 1XJAA 1NCQC 3B69A 3SISA 5C9AB 4FAHA 1PGL2 1GSLA 4BE3A 1I5ZA 3M3EA 2JX9A 4NHMA 3AYAA 4MADA 5FZ8A 1LODA 3BN6A 5T50A 2QNKA 3LA2A 3PU8A 5C3SA 2VQ0A 3MIHA 1QGLA 1S1AA 3AZYA 4Y1UA 2K9ZA 3NV2A 4ZU5A 4PQQA 4PBOA 3RYRA 4BK4A 4DUXA 1DP0A 1W9WA 1E5HA 2TNFA 4NOTA 3NJVA 5FPVA 4MGQA 1PIV3 3O12A 5JOYA 4D94A 3IDEA 5HCHA 3I4IA 5D8AC 3ZFGA 4DS0A 1F31A 5IVBA 2Y33A 1NLQA 4UWDA 1UCXA 1IS6A 4UFMA 5FYSA 1ZREA 4K9SA 4GJYA 1JHJA 2BJSA 1OOPC 4K1YA 4Q29A 4XMIA 2HH9A 2JIJA 5CKNA 1DQ6A 2P3KA 1ZZ6A 3LF7A 3NV1A 4HK8A 5FZ0A 3C7EA 2VTXA 4LBQA 1ONAA 1IG0A 1A8MA 1QDOA 4CTEA 4D3WA 1UF2C 3UGGA 1OF4A 2D7FA 4FPLA 4IGOA 3CLPA 4Y1ZA 1YFYA 2VCCA 4L2NA 1SBDA 2BU9A 1SLBA 4AFAA 1FXZA 4CCLA 4OZOA 5DDJ1 3VBFA 4QQLA 2XG3A 3D0JA 2PYTA 3WF2A 1WLWA 5IK7A 5F32A 1EY2A 1JOJA 1OFNA 3ILRA 4S2FA 2DUPA 4R9AA 5A7SA 3TYJA 5KHKA 2QZ3A 2UWAA 2VQAA 3FHIB 1DYOA 1Z7S1 2VULA 1HV1A 5C4WC 1W0NA 4ES8A 2XBO2 2OVUA 1CONA 1J3PA 2GN7A 4QGLA 4ZY9A 3EBRA 3AFKA 4UT5A 3JBG3 4V1PA 3SH3A 3QCWA 1X9PA 4QX7A 4YZ1A 2RS13 2PHTA 5KXCA 1ZBA3 4K6BA 4LQRA 1LKNA 1VBC2 4H7LA 4S2DA 1FATA 4L9BA 2AREA 2RG4A 4AFBA 3THPA 1RUG3 3FFQA 1NXD1 5AVAA 4JTOA 2VOTA 3C7FA 3POSA 1H2LA 2DVDA 1QJEA 5FPZA 3AL5A 3SLIA 2HLEA 3KVAA 4MGIE 1WMFA 4ONUA 4QHOA 5JPMB 2HWE1 2O1QA 1DQ2A 4LHKA 4V2VA 4BH9A 4B29A 1I9RA 4XCAA 2WUHA 1C5IA 2HJIA 2YBSA 3PIJA 1GLHA 4NRPA 4I0BA 1F5FA 2QQKA 1OOPA 4FOYA 1GZTA 2XJPA 5L9RA 2HWE3 2BRTA 5IWFA 2WFF3 3D4KA 2V5DA 2MEV2 2ET1A 1ACCA 4KGQA 4G9SB 1FMD3 4NWWA 4XE9A 4N53C 3HQUA 5FY7A 1W8OA 1HRI1 1LENA 3TN92 3U10A 4JQTA 1MZFA 3WW3A 5BNPC 2XQXA 5IFPA 4FT8A 4CEYB 1Z7S2 4QPIA 1F4AA 3FBMA 2JD4A 4HKWA 4AYUA 2FZ1A 1AHSA 2CGNA 1HRI3 3H1WA 4MGYE 4FTBA 5IJRA 4YARA 1NA1A 1R64A 3VKOA 3HBZA 2ZX2A 3KB5A 4CCOA 1NA1B 1RL3A 2RDSA 1JZ5A 2YC2A 3ROUA 3H8RA 1AX1A 1NUKA 2EVXA 3I2HA 4NHXA 1ND3A 2QZ2A 4LKSA 2BDRA 2VG9A 4GH4B 3OUIA 4OHVA 2XJTA 2EALA 3IDCB 3KS7A 4RR3C 2FDIA 4JHTA 1S0BA 1PNFA 4U2AA 3RZZA 1BHGA 3MF6A 3MICA 4N43C 3WINE 3MHZA 3ILFA 4LO5B 4OMDA 1UYZA 1URXA 3I3MA 1SG3A 2QQPA 4AGGA 1UY4A 3OCPA 2VZQA 4TLFA 4L0PA 5DG2A 1PIV2 3LCPA 5DZFA 5FP7A 4MYEA 4FVVA 5CFCB 3A21A 5GKAC 2R1DA 3VBHC 1HJFA 5A32A 1E5SA 5ABJB 3I2IA 1GMMA 4XF9A 2EIEA 3JU9A 1NQDA 2PLV2 3JXSA 5FIXA 2DU0A 4NN0A 1GNZA 5EQUA 4SLIA 2EIDA 2IVJA 3NQHA 2HWF1 4L11A 1M06G 1DIWA 1W8NA 5FZKA 4Q0VA 3HIFA 4CUGA 4ASKA 2KD7A 2DUQA 3ETPA 3DPRC 2Q1ZB 4XF1A 1RVF3 1BLZA 5JIUA 1OH4A 2HYXA 1CX4A 3JUUA 4FPYA 2BNMA 1COV3 2P3IA 4GZ9A 4HSJA 2WNUC 5IAXA 1RUG1 2OX0A 4MGKE 4IDZA 5EJ1B 4LULA 4Q2FA 2VNGA 3MGUA 1SBEA 1ULCA 2E9QA 2HWD3 4HETA 1OT5A 4PIYA 3WNOA 2V09A 3UV9A 1SDWA 1ST8A 3BIEA 1LNSA 3ETQA 2IUWA 4BOWA 4E2GA 2WJSA 2ZMKA 1RUD1 3WNXA 1MS1A 1O8SA 1HDKA 3AVRA 4INDA 5H9PA 1GP5A 2HWB2 4LT5A 1AVBA 2CY6A 2YBKA 1HKDA 4COVA 2FZ2A 2VCBA 2VTFA 3POWA 5E8AA 3BI3A 1Y3TA 4PBPA 1GICA 5EFUA 1CWPA 1AYN1 1LGCA 4E4ZA 1AR92 3VBOA 4GWJA 3LPFA 1F15A 2H6CA 1DQ4A 1REEA 3KHBA 5FZCA 3B00A 2UY9A 4KBZA 1JH5A 1NZIA 4UFIA 4ZXEA 5A3MA 5I0RA 3RZLA 5FDBA 3F95A 4QGMA 4RN5A 4TTGA 3BPZA 2V72A 2W1SA 1HIXA 2PQSA 4ASMB 2V4VA 2VE1A 3ZR5A 4B7EA 5FYMA 5A70A 2XDVA 1GWLA 3ME2A 2ZPXA 3VZMA 4D8MA 5C71A 1V9U3 5IVVA 3TEYA 3LFIA 1OA4A 5FK7A 1H2KA 4XYXA 2CL2A 4FOVA 5C9AC 1OUSA 1LJ7A 4GXLA 1OI6A 2W95A 2RS53 2WSVA 4MXWB 3I2JA 4CCDA 2JE9A 1KD7A 4NIGA 4ZS2A 3PVBB 4XVHA 3GZTB 4XHBA 1QJU2 4YVWA 2Z2SB 1DCSA 3MIDA 3BTAA 4PDWA 5FLHA 4Y22B 2VU9A 2Y34A 2W5FA 4RR3A 4W6YA 5FUPA 4EN7B 3D3AA 2Y6LA 5J98B 3NJXA 2W1WA 1H1AA 3IIIA 4DEQA 2RV9A 2P3JA 4P08A 4Q4Y3 5FZOA 3OGGA 1L7QA 3AMPA 2ADEA 2OIIA 2D40A 2VMFA 2RE9A 4CEWC 2FBEA 2OPKA 5LRRA 1NZCA 1IQDC 3A4UA 1PZ8A 4IL7A 2J7MA 1H2NA 4Y20B 4CCMA 2B7YA 2CGOA 3FHQA 5GZFA 1RJ8A 3LSDA 4GJZA 4RGKA 2OXBA 3J4UH 3PNAA 4UW5A 2C1FA 3NNGA 4URAA 2FDFA 2ZCWA 3PUQA 1LOFA 2HWC1 4LK7A 4Q4W3 3TB0A 4I01A 1DQ5A 2EXHA 4XJUA 1S55A 2VECA 4LLFA 4AEMA 4TZDA 4QB6A 5BYNA 3OPWA 5FXVA 1GZ9A 4OHWA 3AZZA 3KCXA 2XPJA 1H6XA 4GQ7A 4S2HA 3W58A 2J1RA 5GJ6A 3WDUA 3A22A 5JMCA 4GB33 5FMOS 1LHWA 5LA0A 4OLLA 1WA4A 1FYUA 2VNVA 4P9IA 2WO2A 4XUOA 3KV6A 1DZTA 4LIUA 2VUJA 3CU7A 4QX8A 1S4CA 1OA3A 4C90A 1CD3G 4DPNA 2D98A 4HT1T 4FQ4A 1XYNA 3ZYIB 2VCAA 4WV8A 5BNQA 4AXOA 2QUOA 1XNAA 4N53A 1IHMA 5IK5A 2A3WA 2J1TA 5I8TA 1VBB1 3I8TA 1G6NA 5CB7A 2ZGUA 1PO13 3AYCA 1ZA4A 3MV01 5EYXA 4Q4X3 1F4HA 5IVFA 1H0BA 4CU9A 4UAPA 2Q8EA 1IS5A 4Z82A 1QHDA 4YW6A 3RRDA 4ISRA 1QDCA 2ZBJA 3TEZA 3W5MA 4JKMA 2WA4A 1EV13 1FPN2 2GH2A 1JU3A 2PFWA 4RHV3 4LHSA 1G9FA 2QDRA 2QQNA 5FMDA 3M70A 1K5MB 3VBSA 5KHIA 3WUCA 3IAPA 5FMOL 1VAKA 4HKLA 2O0OA 5A7WB 3TAYA 3WNMA 5T55A 5LRSA 3MW3A 4CE8A 1AYM1 2Y0IA 2WR9A 2XUEA 2GALA 2DFBA 2GMPA 4C0HA 3MLLA 1W39A 2DU1A 3KF3A 2K46A 2HWB3 1WCKA 1GNYA 1AL21 1X36A 3KM5A 3RI9A 2GC3A 5A6QA 3C3VA 3VBFC 5JMOA 2GAUA 1XSRA 1CR7A 4NJ4A 3UKVA 1V6LA 1CAVB 2NMOA 3THDA 2BZDA 4KWJA 3PUSA 2LRPA 3QACA 3UGFA 2OT7A 1O4YA 2ES3A 4OI4A 5EJ3A 3HEIA 4BA6A 3TEXA 2YC4A 3PVNA 4K8FA 4LO6B 5KXEA 3GM8A 4Q1PA 4UI9L 4W65A 1W9TA 4FPKA 3PJYA 4UW3A 2EXJA 4B4PA 1WKYA 4PJYA 3LZZA 2ZMLA 1H9WA 3LDBA 3NO8A 5JOZA 3PTRB 2HEVF 4RL7A 3TNQA 2ZTNA 1TMF3 4LJHA 2RDQA 4KGGA 3OUHA 2C4XA 5HBAA 5FY9A 1WW6A 2D5HA 2VNOA 3LD8A 3WQ1A 2VZVA 3OGVA 1CIWA 1OXCA 3WP5A 1PGSA 1Q8PA 1H4GA 5JCTA 1AUYA 3KCCA 3GJAA 4HVOA 3DYMA 4PHZA 3B9CA 2KXLA 3LIHA 1BK0A 4HMZA 3V65A 4YLZA 3VBUB 3USUB 5B4NA 2IVIB 5JZGB 3IZOA 1AR91 3RS6A 4BXSV 3A0NA 2KR2A 3K4ZA 1OURA 1RUH2 4MX3A 2BGPA 4YW3A 5F3GA 3VD9A 5HCBA 5C5UA 3OD0A 3NMBA 2A6ZA 2Q8CA 3EO6A 5IVYA 3ZSLA 3MIGA 5JR2A 3AMHA 5FQ0A 4OI0A 3ON7A 4QM8A 1ZRIA 4V2WA 3O1MA 2IFWA 1P8JA 1WA6X 3P5BA 4IEQA 4LR4A 1IS4A 4TLGA 2QQVA 2ZHMA 3VHOA 2IFRA 3PVOA 3IKWA 2YGLA 3DUIA 1TZOA 2ARAA 4I09A 2J1AA 2WZR3 1UNBA 2GU9A 4KNCA 4DRRA 4OI1A 3ACFA 2VZOA 2H0VA 2H0BA 2CDPA 2OPWA 1S2BA 2DBIA 2DV9A 3FZ3A 2E7QA 4NROA 5FYBA 3R6SA 4BXFA 4HBNA 5HCAA 1MVQA 3L9JT 3AX4A 4N43A 3JZVA 3O1OA 3K77A 1S0IA 1W06A 1QEXA 3T0DA 3NNJA 1YHFA 4XF4A 4AI1A 1U5IA 4PDWB 3S7EA 3J7NA 1IPSA 3LQCA 2DYCA 4BU2A 4WM8A 1JZ3A 3FL7A 1XNBA 4AR2A 4XIKA 1QJY3 2R071 2WAAA 2HYKA 1R1A2 5FZ6A 1IZ3A 1QXRA 2Q5TA 4YM3A 5L7OB 4JAAA 1W2TA 4TXWA 5CFDB 5FOBB 3T2OA 1W28A 2HBUA 1D7PM 2WN2A 2JIGA 1PX3A 2W2IA 1PVXA 1AXZA 1H1MA 3ZXJA 4XURA 3MW4A 2P5BA 5BNNA 1OA2A 5LATA 2MEV1 2XVGA 2X5IA 1CZTA 1OKQA 3M3IA 3MZHA 2VH9A 1EP0A 1AR73 2P4EA 1G9CA 2VZPA 1O3RA 1VBE1 3H7YA 2LTNA 1HXS2 1RXGA 2VBBA 4EV0A 1JZ6A 1ZM1A 1GP4A 2VW0A 5K9YA 1GFF2 4HXCA 3ZXGA 5FY8A 4JV4A 4IE0A 4TSVA 3UNPA 3TEWA 1I6XA 4Y1YA 4DXRA 3KQ4B 5CVRA 1VBE2 2OUJA 4LKEA 1SFNA 1SMVA 1U5XA 3IN9A 4CDWB 2E6VA 3OSDA 1J3RA 5K4LA 4B1LA 4Q0SA 3BCWA 4IETA 4RS5C 3VDCA 3K3OA 3CQOA 1UZZA 1V6OA 3NRUA 5A3TA 1PK6B 2P3YA 1W6PA 4M0NA 4ATFA 1XSQA 2ERFA 1J58A 3AZVA 1HRV1 1CAXB 1QU0A 4Z07A 3NAPC 1ND3C 1W90A 1PGW2 2R6QA 1RINA 2WZR1 4QXHA 1QJY2 3GGLA 3VV1A 3FFZA 2F4PA 3KSCA 3ATGA 1QJZA 4QGNA 1ZRDA 5SV8A 5FLIA 4LE3A 3NVCA 3HQXA 5A7QA 3URFA 4WVVA 3U11A 4BISA 3GXUA 4I0AA 1BEV3 4P9JA 4ARXA 2W46A 4YPJA 3AKSA 5J36A 4CZSA 3V0AB 2A3XA 2B9UA 4JDOA 1LEDA 4IW3A 4QHZA 4IEVA 3RJ2X 4CYDA 2R043 3ZYPA 3ZSEA 1BEV1 1VB4A 2WS93 3LDKA 1AR93 1PMIA 2J22A 2PHFA 2WA3A 4GWMA 4LOTA 1KJLA 4AEDC 1DGRA 2BGOA 3CO2A 4AEDA 1XC6A 4A7YA 1ND2C 1PGL1 1K42A 4CCCA 4A4AA 1Q8OA 2F17A 2MPFA 3DXUA 1IPJA 1MS4A 2JECA 1QMJA 3CIHA 1OVSA 4CVUA 2JJ6A 1QJFA 1HJGA 3MIFA 4ES9A 3TOJA 5LA9A 4F7ZA 2RS51 4P02B 2JDKA 2P6CA 5LWBA 1BVP1 4OFGA 5A6XA 4A7ZA 2ZX3A 2QQJA 3ZYGA 1VBD3 4FPJA 4UW4A 4K20A 1GU3A 3NWKA 5JSPA 2WZEA 1B35C 1BK1A 2VOXA 1WD3A 3AP7A 4E9KA 2ZXQA 4XFIA 3E6CC 1VBB3 1WW5A 4FPHA 1BQPA 4ASLA 1MVEA 3OGJA 3E6BA 1HB2A 2GMEA 3UYJA 1OPMA 1W9YA 2E63A 1WCUA 3POBA 4WZCA 4Q4V1 4G3YC 4EN9B 3WHTA 4UFLA 1UMZA 1SLTA 2RS31 5ANQA 1GKBA 2O8QA 4C0BA 1Y9QA 4TWTA 5FY4A 2X5IC 4DXZA 4M3CA 2V5YA 2ZKLA 4BCUA 2CSGA 5FR3A 3H1MA 2XHKA 4Q4W2 4XZPA 1TE1B 1X33A 3WNLA 1XU2A 3DYPA 4DMIA 4EYUA 4O9GA 2D6NA 1DQ1A 2HWB1 5GLVA 2W68A 3KT4A 4Y24A 5FREA 2ET7A 1V6MA 5JOXA 1QJX2 1QQP3 2EIBA 2WC2A 3I54A 1RUC1 3O1TA 3VGIA 3ZN4A 2WFF2 3R4SA 3JBG1 4BLIA 5JDBA 1O3TA 1U0AA 1O3QA 1UX6A 1HW5A 3I59B 2NP0A 5FP4A 3OY8B 1V6NA 2WNVB 5I8YA 4K8RB 5CG8A 1X8EA 2G9FA 2C9AA 4EZHA 1JZ7A 1ZYBA 3B94A 3J7MA 3VHRA 1QH6A 1O7FA 3OBTA 3THCA 3OUJA 2Q4SA 4BJ0A 5AC93 4NR1A 4OYUA 5FYCA 1LHUA 1RMU1 1OQEA 2W1UA 4AVTA 3LEIA 4RR3B 1YYNA 3A7QA 1DZRA 1DU3D 4WM7C 5FXWA 3FJSA 4IE6A 1PM4A 4Q4V2 2JENA 3GHNA 2Y6FA 3MUY1 1MZ6A 3B7MA 5EWSA 3QH6A 4FFHA 1H8TA 2IWGB 4WZFA 4FOQA 2PELA 3SEEA 1SPPB 4CDUA 3Q8CA 5FPBA 4AI3A 1ZRRA 1V9U1 4I3PA 5JZGA 4QQHA 4M4RA 3S5AA 4IV1A 5D21A 5JZGC 3VBHB 3WNKA 1OPOA 3GBFA 4QDRA 5ABJC 3EQEA 2VR4A 1AR82 2C26A 3N7KA 1O4ZA 4DIQA 1W9FA 3OD4A 3ZR6A 4KL1A 2JG8A 1QY4A 4A6OA 3ZYFA 4B3NA 4YW2A 1OD5A 3ZX7A 1Q5OA 2WNOA 3AP4A 2TEPA 4JGZB 2I2SA 3GZEA 3BYWA 1F35A 1H8TB 1ZRCA 3GBGA 2FCUA 4YZ3A 2JDHA 1GV9A 2VMGA 2PLV3 4YZ5A 3AZWA 3AXEA 4L99A 5CKQA 1AJOA 1Q43A 2YB7A 3M1HA 4J1XA 4YFWA 1RUF2 1JYIA 2ZGLA 3DPRB 3LE0A 5HXVA 3RSJA 2RR13 5T5OA 4Q4Y1 4QB1A 3ZIXA 1OUXA 5JR7B 1ODMA 3RZMA 2AH2A 1AR62 1RITA 5LEJA 5LY1A 2TUNA 4A3ZA 4P9YA 1JUIA 1X50A 1VJ2A 2BGCA 4JGYA 4DY5A 1YIPA 3ZXFA 2GNBA 1QJU1 1EAH3 4ZZ5A 2J1UA 2VNRA 3O7OA 4DNYA 5LBBA 3PMEA 1LU1A 4EJRA 2BWCA 3EXUA 4D6SA 2JDYA 4AQSA 2YUEA 1AYM2 2DWRA 1XRUA 3LDRA 3DECA 1R1A3 3MLKA 1C3HA 4CP9B 1TG7A 1CZVA 1UD1A 5LW9A 3CZJA 5BPXA 5TSWA 2XHNA 1KXGA 2VZTA 4NAOA 4P9LA 4BK5A 5DMYA 3B93A 5F5CA 5H9QA 4EN8B 2VVDA 1RUC2 5CADA 1NY72 3N36A 5F2SA 3SITA 2ZX0A 4MUVA 4BYYA 1CAUB 2C9KA 4OUSA 2Q8DA 3ZMOA 4BM8A 4B7KA 2IXHA 4NVPA 4QPYA 4BQ3A 3D8CA 5JPNB 1W6OB 3OYWB 4HL0A 5CBLA 4F8AA 4XILA 2ZMNA 3JD72 1GP6A 5BV6A 5T5JA 4W50A 4Y3OA 4NAMA 1DDLA 4Z2AA 5BNPA 3ES4A 1AF9A 3NV3A 5FYZA 3KVBA 1RGSA 1JU4A 4NIHA 1EUUA 4JRLA 2A1XA 4NPLA 3ZKUA 2NPIA 5JI9A 3RQ0A 1GZCA 2JG9C 1YQCA 3ZN6B 4C8DA 2C5DA 4XBNA 5FYHA 2QQLA 4QKBA 2XVKA 2OA2A 4WVMB 4NIIA 1RHI1 4LBKA 4A3XA 4HFSA 3FHAA 2VPVA 4WVMA 2ZAAA 1UXXX 2DCKA 2ID4A 1UAIA 4YVWC 3T4HB 1VRH2 2RJ2A 1FI2A 1ND3B 2B5HA 2QQMA 1RVF1 2WWJA 2Q8OA 5FRAA 2KM2A 1RUE3 1JXNA 2VBPA 4CPBA 2IC1A 3MLJA 1UY1A 1R081 1GWKA 3VB9A 5CISA 3CL1A 3ECQA 5JAXA 1R1ZA 2ZOEB 3FX3A 4QPGC 4M00A 1VIWB 3EMRA 4UF0B 2FDKA 4QKDA 3H3ZA 1FX5A 3QOPA 1R1A1 4A2UA 3ORJA 1W6OA 1D4VB 1W8HA 2WLQA 1WD4A 3JQWA 4MZUA 1PVC2 2NMNA 4M3CF 1WMXA 4I3GA 1MS9A 3IIAA 4IUGA 2B46X 2SBAA 2UYAA 4AVSA 4XF3A 3N9NA 5FZOB 1LESA 3W9AA 1LAJA 1UZ0A 1XQNA 4EROA 4NWVA 1NCQA 3AJZA 5FFOC 3CJIA 3E5UA 1QJX1 3N35A 4QMAA 3ZMNA 1AR83 1ZX5A 3MEPA 1UOGA 3BKZA 4FPFA 3BVCA 2QQOA 4GWNA 1ND2B 2JDMA 2CGPA 5C8CB 1XYPA 3OPZA 4LBOA 3FE5A 1SLIA 2A6WA 3AYEA 1D4M1 1DZQA 2F6BA 2QFEA 2YC0A 2YZ4A 2DCZA 2ZABA 2AZ5A 4AL9A 3AM2A 3ZN5A 1AL22 2DVFA 4IV3C 4H7MA 5A3OA 1S0CA 2ETEA 4X6RB 4XTPA 4W8JA 1D4M3 1XYOA 1RIRA 1WMDA 4QAWA 3WCSA 3AL6A 3EJKA 4J25A 4M01A 4AF9A 5J3UA 1VBB2 3PLQA 2B8MA 4LNVA 1WCDJ 2BP6A 4LO4B 1RUE2 5D8AA 4AI8A 1B35B 5GZCA 4AVVA 2HWC3 2XOMA 1K5MC 3SXWA 4AAXA 1DGWA 1SEFA 2EXKA 4XFCA 4ZHNA 3PDQA 1FPN1 1UOBA 1SCRA 4YM1A 2VVEA 2Y6JA 3HQRA 3QLQA 4FBFA 2PAMA 3U0ZA 1QQP1 1PX4A 5C8CA 1FMD1 5F3IA 2WO7A 5ANNA 1O4TA 4Y5TA 2VZRA 2E51A 4PF1A 5EHDA 3BB6A 1IKQA 1MEC1 3C7HA 2Y38A 3ZOIA 2X5IB 2W47A 4O7XA 4CCKA 4E2SA 4QPGA 3M3CA 5C8WA 4I0WB 1QF3A 3QD6A 3NJZA 1G8WA 2A6VA 2XKPA 3LKJA 2JDZA 4IV1B 3LIGA 4AVBA 5H9RA 5AC91 4Y1VA 4OQ9A 1YWKA 3RWKX 3C7OA 4FI9A 1RJ7A 4CDUB 4YYOA 4DINB 3U37A 2X53S 2YU1A 2RMU2 1CX1A 1C8M2 3N3HA 3BIWE 1UU4A 2LALA 3VD5A 2BV4A 1ZNPA 4MGSA 4QHBA 5F3EA 4CDQC 3PTYA 5A1LA 5A3WA 3KT1A 3MFAA 4Q26A 3WLUA 1UY0A 4XETA 2XONA 1VMHA 4JDMA 1MZ5A 2R30A 2WO3A 4CU6A 5C5TA 3I2DA 3KZ4C 5KBFA 2VOVA 4FFGA 4YGCA 5FY0A 5GALA 4YG3A 2E32A 3WW1A 5I0DA 2AUYA 1RC6A 5G04L 1G9DA 5FV3A 5J37A 1GZWB 2ZGPA 3LSEA 3ZSKA 2JKXA 4HN1A 2VD7A 5D2AA 1RMU3 2WNEA 5FZFA 4RYDA 5FBJA 2YFZA 5FZHA 4OUMA 3OBRA 4CA9A 4I2OA 1PNGA 1REFA 5IHRA 2ARBA 3ZXKA 2X09A 4RGAA 4AI0A 1T6BX 2AEZA 2IXIA 1HX6A 5DDJ3 1OF3A 2PHRA 2RVAA 3AP5A 1PO21 3RJRA 3U14A 4MGTA 3JQXA 1V6JA 1LU2A 3S5QA 4YRDA 2G1MA 2BNOA 3N7JA 5LEKA 2EF6A 4AVCA 2HWD2 1PO22 3VD4A 3N9LA 1FAYA 1OVPA 5JXGA 3NV4A 4ET7A 1RXFA 1HRV2 3VBOC 5IW0A 5LK7B 1O59A 3KCYA 3V0BA 1SZBA 2ZEWA 3WDVA 3WX5A 1F9KA 2LROA 3AK0A 2ZX1A 2HEWF 4DUVA 1XPWA 5K0UB 4XQ4A 2JE7A 2WQ8A 4LEJA 2VZUA 1RUI2 2NLRA 3DF0A 3Q8EA 4IEXA 3ABZA 4KMQA 5I0UA 3SC7X 2XGXA 1G86A 3G7DA 1MR5A 1MACA 1O8PA 3RYPA 4CP9A 1LTEA 1US2A 1QXPA 3E1F1 4JQRA 4CEYA 2D97A 1JYCA 4DOUA 3LGRA 2D6MA 4GD4A 4IEOA 1FMD2 4FXKB 2DURA 5C3OA 4NUBA 1HXS1 3H50A 3W20A 2D43A 5ACA1 3WF0A 4EQVA 1WBLA 5C3PA 2RJLA 2DCJA 5FYIA 1RMU2 1R093 2AYHA 2WYFA 2VBDA 3K3NA 3VDDB 4ZZ8A 1BCXA 3OGRA 1VAVA 4AVAA 4NRQA 2WT1A 1SDDB 1ENQA 4MV2A 2YY1A 5DDJ2 5A7NA 1Y9GA 2BNNA 2PHDA 3ILNA 4N9IA 4H3WA 3EYPA 1VR3A 5J1XA 4HANA 2GC2A 2XR4A 3VBRA 4B4RA 2ZGKA 1KGYA 2B9VA 3WW4A 3BALA 4PQ9A 5F9TA 1A3KA 3K46A 4R52A 2CTVA 2ILMA 2R072 3POFA 3VBRB 5FMCA 1N1TA 1AR71 1LOGA 1VMFA 2Y6KA 4R8HA 1XNCA 2PAEA 2VM9A 4N8MA 5FAXA 3HBKA 4IEYA 1W6NB 2NQYA 1RUD2 1XE8A 4ARYA 1UU5A 4QQOA 4XAEA 1CQ9A 2B39A 1PK6A 2BFUL 2ARCA 2WKKA 1KRIA 3WNPA 1OLMA 1W6QA 4O61A 4YW7A 3DKWA 3MIBA 2WN3A 5JVVA 2E31A 3VDDA 3C7GA 2VC9A 2ZZQA 2G9ZA 2XJQA 3CBNA 3DPRA 2PN5A 4YGEA 2R1BA 4YG6A 3VKMA 3Q8FA 3HN1A 3T3YA 1HLCA 5JXJA 5JXIA 4LBJA 1J84A 1SPPA 1VBD1 3ENRA 3I2FA 1HXS3 3BODA 4JGYC 3OTFA 1YXWA 2QE3A 2R042 3NKGA 2JG9B 4Y4YA 2ATFA 2FDGA 1WW7A 5FYYA 1ZBE3 5FPLA 2BBVA 1W6PB 3VBFB 1LB2A 4DRVA 1OSGA 5K0UA 1GQPA 2W39A 2VXRA 1PO12 4ZS3A 1MS0A 1OQ1A 3V0BB 3GCWA 3NAPA 4S2GA 1KS4A 2ZKNA 5K7PA 5FP3A 3GALA 1ULPA 4GIQA 5CU1A 5GM0A 2C6SA 4UBGA 1COV2 2BBAA 3ACHA 3J7HA 3I97A 1NE6A 1D0GA 1HV0A 4XJZA 4H14A 5FY1A 3M4FA 4CP1A 2G4IA 4KG8A 2XMLA 1POQA 4LOSA 4GB31 3FLPA 4D7YA 4EWDA 4XOGA 2QVSB 5JUVA 3HT2A 3IMNA 3UKTA 2UWCA 3K4DA 3RZKA 4R9CA 5DUUA 3HAGA 1YQ2A 4JTNA 4BQ4A 2K2SA 3W5NA 4FPGA 1SHWB 4QU2A 3Q8BA 4CCEA 5FJHA 4E8CA 4M3CB 5L7OA 4FOWA 1ENSA 3L2HA 4XACA 1FV3A 4Y20A 4I30A 3DYOA 5IVCA 3O14A 4UF0A 1HQNA 4ZXKA 5CG9A 4X8PA 3QBQA 2UU8A 3MPBA 5JI7A 5FUIA 1J59A 1HRV3 4QWNA 1JYVA 2EXIA 5C4WA 2QJVA 2ZGOA 3GZUC 4UYBA 3IPVA 3VZNA 3ZFEC 4AI9A 2DCYA 3IPVB 3KMHA 2OYZA 2A3YA 4IV3B 5F39A 1J3QA 1W04A 3KV5A 2A70A 2CWMA 1RUI3 2VY0A 5F6KA 3GJBA 3B01A 3O5SA 2J1EA 4AGVA 1J83A 4AWDA 4AHZA 1W0OA 2X8KA 5L73A 3OBAA 3M8LA 1FT9A 2VJXA 4LXLA 3I49A 5FK8A 2X29A 1O6UA 2ZHLA 3MI8A 3USUA 3VZLA 3ZN6A 3O1RA 3MUZ1 2J1VA 4MOAA 2BW8A 2SLIA 1C57A 4FFIA 2FD8A 1L7RA 2VUDA 3AYDA 1MQTB 1JBCA 4Q1RA 2ZA9A 1WGPA 5ISLA 1SLAA 5FPAA 2HWF3 3K2OA 4CDXA 1YC61 2A75A 3TN93 2R061 1H6YA 4Q4Y2 4CDXC 3OB8A 1W8WA 4BQYA 3P3PA 4YVSB 1IQAA 2A73B 4GALA 4OHXA 4Q4V3 4XUTA 3ITQA 1RUG2 1HRI2 4H2AA 5CEHA 1QJY1 2R073 4URTA 1CESA 4XCBA 1YFUA 3NAPB 3LOIA 1RHI3 4JC1A 5FYVA 2P6HA 1DFQA 3SCGA 5KWRA 2Y6HA 4LA3A 2VVFA 1WUVA 1BXHA 2WT0A 1PZ9A 1Q8VA 2BOJA 4FFFA 2LUWA 2QQIA 2YV8A 3NNMA 1K5JA 1AJKA 1C4RA 1LR5A 2QCSB 2NZ9A 4GMP0 4XABA 1A6CA 4HPKB 1M4WA 4XJ8A 5A7OA 3VLBB 5L7OC 3FUOA 4CSWA 4CDQB 5CFDC 2CNAA 1WBFA 3O0XA 4FPCA 3LEKA 2UYBA 1XE7A 3NW4A 1H4HA 4HKOA 4FAGA 5DN2A 3IBMA 4ZU7A 5FO9B 4DXTA 2DDUA 3UETA 4RQPC 5FZLA 2YYOA 5FZAA 1Q56A 2AR6A 4XBQA 2ZHKA 5LASA 3T4VA 5ACA3 3P1IA 4BB3A 5HCFA 4A42A 3ZDVA 3JB8A 3V0AA 4Z8BA 4XIOA 2EAKA 3VKFC 5ERLA 5FWEA 1VBC1 4XUPA 1DLCA 2E53A 4XJAA 1EUTA 1NCRC 3I3BA 3CEWA 1IGOA 3CJIB 4COYA 3AB0A 4OHZA 3WV6A 4KBBA 3AP6A 3FMGA 1YJLA 3ZFGC 2VOKA 1UU6A 2VAUA 4CDWC 2DVAA 2OW4A 1LHOA 3B9IA 1BVVA 3VHPA 4LUMA 3VD3A 4QXBA 3MFCA 4Q8LA 2WWUA 4KWUA 4RD7A 3N4MA 1UX7A 3AJYA 3KHCA 2RS52 4ATEA 5J7MA 2ZEYA 3INAA 1DLLA 5H9SA 1H1IA 3D5OA 1CAXA 4P9WA 1OLRA 1SFPA 2ZZJA 4K3UA 2E7TA 5A32B 2W94A 2Q0AA 2WQ4A 3T08A 4A44A 4QXCA 2C24A 5ABJA 1XNKA 5FO8B 2FMDA 2BTVC 3KGZA 1R083 2RM22 4XTMA 5DAQA 3H7JA 4R9BA 3KWVA 1QOTA 1V70A 4NE9A 2OS2A 2I45A 2RS12 2GMMA 1YI9A 2PQQA 3RDIA 5IVJA 4AFMA 4JZRA 2DF7A 1TQ5A 2NN8A 2WFPA 1BMV1 3PIGA 4AI2A 3DKQA 2RMU1 3ZFEA 1UWWA 4YM2A 4IE5A 3MW2A 3VUOA 4HOOA 2FHRA 2XLAA 4YGDA 3OF1A 2D3PA 2P37A 1DF0A 1WLDA 3PJQA 4W6WA 2ORXA 3ST7A 4COWA 4OMCA 2VZSA 2D3RA 4W6XA 1ZRFA 1CPNA 2JE8A 4IV3A 4META 2WZ8A 4MG2A 3T2TA 5FYTA 2VW2A 4CEWA 2DBNA 1N3OA 1QOOA 5F6LB 1C1LA 1NE4A 1D2QA 3P3NA 5FPUA 3D82A 4D0QA 5IVEA 2G9GA 1UZYA 1EAH2 3OY8A 4TN7A 1LHVA 2VQUA 5A3LA 5GZDA 1AYN2 5A3PA 5A33A 4AZZA 2BPA2 5JLVA 4IERA 1YNAA 1V6KA 2PAKA 2WO1A 5EZWA 2WINB 4QX2A 3DXTA 4FPEA 1RYYA 4XDOA 5FZMA 3LA7A 1YUDA 5JIAA 3TWIA 4DQAA 5JSRA 3RNSA 5FZEA 4C1WA 2GSYA 2FQPA 1ULDA 4UW6A 2W52A 2OQ6A 4KU7A 2QKDA 2WBKA 3J8F3 3ZSJA 2P17A 4D6QA 4XUQA 1SCSA 4C91A 4NIDA 2PLV1 1LOBA 3H8XA 4RHV1 1QH7A 2RS32 1EV12 1CAWB 1FPN3 3B5LB 2XJUA 3KGLA 4K21A 3HNMA 3O1UA 4YZ4A 1LCLA 2Y64A 3I2KA 3HNBM 3ALQA 3BU0A 3H42B 3IMMA 2Y0OA 5B4XA 1OC1A 3PU3A 1PO23 2JKBA 1AZDA 3APBA 1LOCA 1N1YA 1Q8SA 4PF5A 3D6EA 1GWMA 2CAUA 3I7DA 4XJWA 3VBUA 1K3IA 5T5LA 4Y33A 2JB8A 1OLME 5A6ZA 2ARXA 4PT6A 3DEMA 1G9AA 5FQ0B 4MLOA 4Y22A 4SBVA 4EN6B 3BTYA 2CHHA 5E88A 1JZ8A 4YVWB 4A41A 4C1XA 1V9U2 4LKFA 1UIKA 5GLTA 2QQUA 3QH7A 4FPOB 5JOWA 2WL1A 2WS92 2BVBA 1BBT1 1U5ZA 4XC9A 4JGZA 2DVBA 3ZVXA 4FSJA 5FXXA 5LY2A 3FN9A 1AYN3 3J26N 4JGZC 1DGRN 1UN1A 1A8DA 3H8UA 2JG8B 1H8TC 2V73A 3KF5A 3WHUA 4D6RA 3OOXA 1W3XA 2VW1A 2JEMA 1EPZA 5FYUA 4G4FA
chains in the Genus database with same CATH topology
1R092 4QPGB 4PLMA 2HWE2 2JICA 1RVF2 4QD2A 4AQ6A 3VBHA 2WNVC 3HD8B 3USSA 2IZWA 1FOD1 2AENA 4E4DX 4KU8A 1MZEA 1PGW1 3TNPB 2VMHA 2Z42A 1HQLA 1R091 2MHFA 4P5HA 3AXDA 2A71A 4FO9A 3K51A 4TYSA 3WD5A 1YCIA 1AR61 4N9HA 1PZ7A 4LBMA 3S6PA 4YW4A 4Q4X2 1BBT2 2GNTA 4XQDA 3WDXA 2ZS6B 4YW5A 4YSFA 2PHUA 1N47A 1IS3A 2RM21 3AKTA 1RUJ1 3SNMA 2BYVE 1Y43B 4Q4X1 3THTA 3WQ7A 5BNOB 1UW8A 4XJ9A 4QPIC 3RYKA 3LWCA 2FMYA 3AFGA 1O5UA 2XKOA 4QQ2A 3M3OA 1ASJ2 2YPJA 1NY71 3VZJA 4HPKA 2D6KA 2WSUA 3C2UA 5KXDA 1DHKB 5I0SA 5J48A 5L36A 1MEC2 3WG3A 4WM7A 1EYBA 4QQPA 2PHXA 5FPXA 1TME3 1FOD2 4ORFA 2HWC2 1AL23 2WLPA 1VALA 2B42B 1Y7BA 1UKRA 3G6JB 1AR81 5F5QA 3ZYJB 2GN3A 2DFCA 1DYPA 4KWKA 3IWZA 1AYM3 3E5QA 4CDXB 2YROA 1TME1 1KQRA 4IV1C 3J8F2 3M3QA 3VN4A 4XEZA 1SACA 3ZFFC 4XFGA 3V64A 2R041 3AKPA 2XVLA 1LGNA 2XJSA 1GZWA 1ZZCA 1CPMA 3FLRA 1W0PA 1ENXA 3T1LA 1C8NA 3ZDSA 3L2YA 1RUH1 3JCIA 2WIIB 3ZSMA 1OOPB 4HZFA 4AEJA 2W08A 2CYFA 4B4QA 5I91A 4BWOA 4XPVA 1NLRA 1QKQA 4XFBA 4AQTA 1BJQA 2R16A 2ZAHA 2ZJCA 4MGZE 4BPZA 4PIZA 2IXKA 1IKPA 1MEC3 3WG1A 2A5ZA 1CAUA 2XWBB 1SLCA 3RI8A 5BNNC 1RUOA 1BKZA 4LTAA 3SHRA 3WR0A 1VBD2 1TMF2 1QOSA 1BMV2 3AMNA 1N1VA 1SFYA 4JCKA 2XB6C 1POV3 2XUMA 4FTSA 1C1FA 4NPRA 3VBOB 3SCHA 3WW2A 3WDYA 5DG1A 4BMEA 4IEZA 1S0GA 1BBT3 5D8AB 1HQWA 2EA7A 1Z78A 4RQPA 1NQJA 3ZXLA 1S0DA 2GNDA 1S2KA 4ZKTB 4M3CE 2XJRA 3GHMA 5JSOA 2UURA 4AQ2A 3J9SA 3R05A 2YMZA 3IDBB 1KJRA 5FOJB 3R4DB 1N3QA 2P2KA 1NOVA 1NG0A 4Q0UA 3VBSC 4Z2WA 4CDUC 2JXAA 1B35A 3H1YA 2ZGRA 3IT8A 4ZU4A 2RR11 3MF9A 5C8CC 1AR72 1GANA 4YZ2A 1C28A 1KDMA 1VBA2 3FWEA 1POV0 2MEV3 4IEWA 4D69A 3VBRC 4LBQB 1PIV1 2BWAA 4XMAA 3TBDA 1CJDA 2AGSA 2D6OX 4X6QB 5CIRA 4R4ZA 1Q8QA 5JWPA 5GZEA 2R0FA 2D6LX 1ND2A 2XLFA 4COZA 5E1RA 3X29B 1D0HA 3EHKA 2YDEA 3ZYRA 1I3HA 2R49A 3UKNA 4N43B 1F2NA 3DL3A 1NCQB 2CV6A 3GNEA 1Q3EA 4X8NA 3LA3A 5J96B 2KA3A 5SV5A 4XF0A 2GDFA 4Q0QA 4MSVA 1G7YA 2A6XA 2Q1MA 3VKNA 1S0JA 3O0VA 4R4XA 1A78A 4LBNA 5EV7A 1RUE1 1COV1 1H2MA 4OVEA 4COUA 1ZBE1 4AHXA 2GC0A 4F3JA 3MIEA 2HKXA 1GR3A 3FC0A 2ZGNA 3GF6A 4N53B 3FLTA 4HVQA 1AR63 5BNPB 4LUKA 1QJX3 1QQP2 4IESA 3RPQA 4OZXA 1W6MB 4HN0A 4BLJA 1ZVFA 1AX0A 4EWEA 4Z92B 1DG6A 2BUKA 3E6DA 4LLOA 5C33A 1GYKA 2WZR2 1X8MA 4HLTA 4I02A 4LBQD 3OJBA 2ZGQA 3O0WA 4DY3A 1E57A 3N7MA 3VKLA 2WS91 3UJOA 5BUVA 4BZ4A 2ENRA 1X7NA 4FXGB 3UJQA 1O3SA 2D93A 3WG2A 3ES1A 5AC92 5T3NA 4E27A 4Q4W1 4RA0A 2XLGA 2PTMA 4Q27A 1PO11 3KT7A 5DUVA 1DQ0A 1VBC3 3FUQA 1QXJA 4GKYA 5GLZA 3WP3A 5GLUA 1MS3A 1J1LA 4GMP1 1N1SA 5CFCC 2N7GA 3JBG2 5T52A 2D6PA 3ACLA 2XWJB 1APNA 5HI0A 1ZZ9A 1RUJ3 1GBGA 1UKGA 1YIFA 4Q8KA 4E4SA 3S30A 5DUWA 1YJKA 4WM8C 3RMXA 1C5HA 1ZZ7A 2NM1A 5KC5A 1CAVA 1O91A 2YXSA 5K0UC 2Q30A 2YHJA 2VOWA 5ACA2 1MQTC 3BU7A 5BNOA 5BY5A 4AE2A 1TNRA 1LRHA 4AGRA 4NO4A 3WOGA 4JGYB 4GA9A 4RHV2 3WY6A 4AEKA 4FCAA 5B2GB 3HT1A 3GYDA 3CNAA 2Z79A 4O9EA 3HR9A 4RFT0 4P9GA 4WVWA 5L19A 3N7LA 2D44A 2CAVA 3VDDC 5EXOA 1G9BA 1SLLA 3A0KA 3WP4A 4LE4A 1VP6A 4F83A 5E16A 1U12A 3GBWA 2C0ZA 2EAAA 1T6GC 5IK4A 1RHI2 5T5PA 4B8EA 1RUD3 2GNMA 4BIFA 1RTVA 1JHNA 4XFFA 2UY8A 1ZBA1 3NSTA 5KHHA 4RQPB 5CA6A 3JD71 3IM0A 1REDA 3ZIWA 1VB2A 1NA1C 4IEPA 3WVJA 2GH8A 2DUOA 2CWSA 3M7AA 1QNWA 5D1IA 1ASJ3 1FNZA 3ZFGB 1B09A 4DFSA 1CJPA 1ZBE2 3U4XA 5BNNB 1ULGA 4A7KA 5DZEA 4YM0A 4LO8A 1BYHA 4LA2A 1N3PA 3E5XA 2WNVA 4N7UA 4K7JA 2O8OA 1VBE3 1VLNA 3ZPYA 3ZXEA 1CGPA 4R9DA 3AKRA 4AHYA 4AW7A 4CRQA 4UXAA 4PLNA 1WMEA 3WP6A 2UWBA 2Y26A 4XDQA 1XXNA 1H9PA 4BHPA 4CEWB 4PIXA 4YW1A 1X82A 4M0HA 2D3SA 1OQDA 5AFBA 3DN7A 5I93A 4AFDA 2E7AA 1C8M1 3KQRA 1CN1A 3RMYA 3CF6E 4MXVA 5A33B 2Z69A 1ASJ1 5J09A 1RB8G 4AG4A 3LAGA 4E2QA 3H9AA 3AZXA 1PVC3 2K0GA 2RMU3 5DXDA 4KQ7A 4YVSC 2DTWA 1OFSA 1TEIA 1RUF3 1RUC3 3MYXA 5FCCA 1Z0HA 2BEOA 3AMQA 3U07A 2XL9A 1WLCA 1CVNA 4WBBA 1F8VA 1IPKA 1NCRA 4IQPA 4LO7A 1UPSA 2Z5WA 3ZFEB 4BIOA 1ULFA 1D2SA 2IXJA 4HK9A 1XNDA 1AXKA 3KLSA 3W59A 2OUHA 4YG0A 4GULA 1W6QB 4OI2A 3Q9OA 2OZJA 4LBLA 1MS5A 2WQZC 3H0OA 4OULA 5AFEA 1AXYA 1UPIA 4JDNA 4K40A 3ZXAC 3R4UA 2VUAA 4Y5Z0 3K48A 1EAH1 1QJU3 2H6BA 2XBO1 4JVAA 4XXPA 3VBUC 4N90A 1S0EA 4AK3A 4CDQA 3BOWA 4JRAA 5KHGA 2GC1A 3UL2A 1H8VA 2WFF1 4J1WA 1QNYA 1W2UA 3WDTA 4XBLA 1IOAA 1JW6A 4PCRA 3UK9A 1YRZA 1ZZ8A 4XW3A 2W0XA 1QWRA 2GZWA 4IEUA 4FP3A 2MNGA 2ZACA 1AL0G 1C8M3 4YVSA 4FP2A 1VRH1 2QDNA 2XH6A 2RR12 3WZ1A 3ASIA 2TBVA 5DUXA 4D7TA 5EYYA 2YGMA 2I74A 2PHWA 3M2MA 1ENRA 1MQTA 1LOEA 1PM7A 2DCTA 3AP9A 4GKXA 3E97A 1LEMA 4HSLA 3ZFFA 5F1RA 1RUF1 3WUDA 1LHNA 3H3UA 5FTTC 5GLWA 4N7IA 1ZZBA 1TME2 1FOD3 3WXPA 1L3JA 1ALYA 1NCRB 3TN91 3CJIC 1D4M2 1DGWX 4RS5A 1Z7S3 3WG4A 4FQZA 3ELNA 3HWJA 2A6YA 4EWAA 1KFXL 1NLSA 2HWF2 1R082 2RM23 5C6CA 5IK8A 5C4WB 4YNIA 4KG0A 5FLJA 3WCRA 1YI7A 3BOPA 2LM3A 4Y26A 4RGGA 1BEV2 1GQHA 4QPIB 1EV11 5CFDA 4YFZA 1PHMA 2XBO3 4U36A 1LULA 2NYYA 5IUQA 2XL7A 3I59A 2I07B 1OLQA 1RUI1 1SQ4A 1WW4A 4WM8B 1CAWA 3S7IA 2ZGMA 1V00A 1FNYA 3AMMA 1DGLA 1SBFA 4XFAA 4XXAA 3T1MA 5KHJA 4Z1VA 4P14A 4RS5B 1S0FA 3RWNA 1GNHA 4KWLA 4ISQA 1GQGA 4CP0A 3S0MA 4QT6A 1JTZX 2BFUS 2ZHNA 4EN0A 4Q0PA 1VRH3 3DV8A 1LOAA 1MS8A 1LOFC 1OHFA 2R063 3NKTA 3ZFFB 2PA7A 1WCSA 4UBHA 4LHLA 5CNAA 3GZAA 5T54A 2JG8C 3NL1A 3B3QE 3SH4A 1DBNA 4CEYC 5KC6A 3RG0A 4PLOA 2JG9A 1ULEA 1PVC1 5GZGA 4MXWA 5KXBA 4QX5A 5FO7B 2HWD1 1O5LA 2B45X 2IXLA 3JB4C 3MDPA 3V56A 3AKQA 4XFHA 3VZKA 2P34A 2RHPA 4GH4C 5I8SA 1EPWA 2WNUA 3J8F1 4RSUA 4GMP3 4AEDB 1RUJ2 1TMF1 4L8QA 3ZXDA 3PHMA 1UIJA 3LB9A 4LHNA 3ZO0B 5BXXA 1DYKA 5LK5A 4BMBA 3JD73 5DZGA 1OMIA 3PMSA 1FV2A 1KS5A 2D5FA 4L97A 2IXCA 3R0RA 4H55A 1VBA1 1PK6C 3B02A 3D0SA 1UL9A 3POYA 1POV1 3WT3A 3KD4A 2BVVA 2R062 2WWSA 1NYWA 4BQ1A 1BZWA 3VL8A 1KITA 2BQPA 1YO8A 4XHXA 4FTEA 1VBA3 3CJXA 1NXMA 1W6NA 3FBYA 1JUHA 4K1ZA 3DGTA 4AHWA 2RS33 1LECA 2VMIA 1I1EA 2R0HA 2R32A 1KDKA 3VZOA 5E89A 4OHYA 4P9XA 2DTYA 5K8SA 4QXKA 3SCFA 1V6IA 1AX2A 5CFCA 2PHLA 2WNUB 2EIGA 4D7SA 4WVZA 2A7AA 5IT6A 1ZBA2 3WQ0A 1TNFA 5C9AA 4KH9A 4HVRA 4J6GA 2RJKA 4MH0E 4YGBA 1YFXA 3VL9A 2ZGSA 3MPPG 4XQWA 4CDWA 4DB5A 1K5MA 1JN2P 3VBSB 1U5YA 1XU1A 1YLLA 1RUH3 4IXLA 4PDWC 4QM9A 3WDWA 2OZ6A 5FBZA 3VHNA 1VAMA 4GH4A 4DZGA 2ZGTA 2HEYF 1YFWA 1H30A 5BNOC 1J1TA 3SH5A 2ZX4A 4CP2A 5AVPA 5CAZA 3HMYA 2DVGA 1KFUL 3TRSB 3SMHA 2XJVA 1WLTA 4GB32 4ITCA 4MVTA 1LGBA 2WZPP 1F5JA 4L92A 4Y1XA 4AFCA 3OYWA 2VGDA 5I0TA 3PVEA 2WT2A 4NHKA 4WM7B 3LOBA 4NHLA 1W6MA 2RS11 1NCQC 3B69A 3SISA 5C9AB 4FAHA 1PGL2 1GSLA 4BE3A 1I5ZA 3M3EA 2JX9A 4NHMA 3AYAA 1LODA 5T50A 2QNKA 3LA2A 2VQ0A 3MIHA 1QGLA 1S1AA 3AZYA 4Y1UA 2K9ZA 3NV2A 4ZU5A 3RYRA 4PBOA 2TNFA 4NOTA 1PIV3 3O12A 5JOYA 4D94A 3IDEA 3I4IA 5D8AC 3ZFGA 4DS0A 1F31A 1UCXA 1IS6A 1ZREA 4K9SA 1OOPC 4K1YA 4Q29A 4XMIA 1DQ6A 2P3KA 1ZZ6A 3NV1A 4HK8A 4LBQA 1ONAA 1A8MA 1QDOA 4CTEA 4D3WA 1UF2C 2D7FA 4FPLA 4Y1ZA 3CLPA 1YFYA 4L2NA 1SBDA 1SLBA 4AFAA 1FXZA 5DDJ1 3VBFA 4QQLA 2XG3A 3D0JA 2PYTA 1WLWA 5IK7A 1EY2A 1JOJA 1OFNA 3ILRA 4S2FA 2DUPA 4R9AA 3TYJA 5KHKA 2QZ3A 2UWAA 2VQAA 3FHIB 1Z7S1 2VULA 1HV1A 5C4WC 4ES8A 2XBO2 2OVUA 1CONA 1J3PA 2GN7A 4QGLA 3EBRA 3AFKA 3JBG3 4V1PA 3SH3A 3QCWA 4YZ1A 2RS13 2PHTA 5KXCA 1ZBA3 4K6BA 1LKNA 1VBC2 4H7LA 4S2DA 1FATA 4L9BA 2AREA 4AFBA 3THPA 1RUG3 3FFQA 1NXD1 5AVAA 4JTOA 3POSA 1H2LA 2DVDA 5FPZA 3SLIA 4MGIE 1WMFA 4ONUA 5JPMB 2HWE1 2O1QA 1DQ2A 4LHKA 4BH9A 4B29A 1I9RA 1C5IA 2HJIA 1GLHA 4I0BA 1F5FA 1OOPA 4FOYA 2XJPA 2HWE3 2WFF3 3D4KA 2MEV2 2ET1A 4KGQA 4G9SB 1FMD3 4NWWA 4XE9A 4N53C 3TN92 3WW3A 1LENA 1HRI1 5BNPC 3U10A 1MZFA 4FT8A 4CEYB 1Z7S2 4QPIA 3FBMA 2JD4A 4HKWA 4AYUA 2FZ1A 1AHSA 2CGNA 1HRI3 3H1WA 4MGYE 4FTBA 4YARA 1NA1A 3VKOA 3HBZA 2ZX2A 3KB5A 1NA1B 1RL3A 3ROUA 1AX1A 2EVXA 1ND3A 2QZ2A 2VG9A 4GH4B 4OHVA 2XJTA 2EALA 3IDCB 3KS7A 4RR3C 1S0BA 1PNFA 4U2AA 3RZZA 3MF6A 3MICA 4N43C 3WINE 3ILFA 4LO5B 1URXA 2QQPA 4AGGA 3OCPA 4TLFA 5DG2A 1PIV2 3LCPA 5DZFA 4MYEA 4FVVA 5CFCB 5GKAC 2R1DA 3VBHC 5A32A 5ABJB 4XF9A 3JU9A 1NQDA 2PLV2 2DU0A 4NN0A 1GNZA 4SLIA 2HWF1 4L11A 1M06G 1DIWA 4Q0VA 3HIFA 2DUQA 3DPRC 2Q1ZB 4XF1A 1RVF3 5JIUA 1CX4A 3JUUA 4FPYA 2BNMA 1COV3 2P3IA 4HSJA 2WNUC 1RUG1 4MGKE 4LULA 4Q2FA 2VNGA 3MGUA 1SBEA 1ULCA 2E9QA 2HWD3 4HETA 4PIYA 2V09A 3UV9A 1SDWA 3ETQA 4BOWA 4E2GA 2WJSA 2ZMKA 1RUD1 3WNXA 1MS1A 1HDKA 4INDA 5H9PA 2HWB2 4LT5A 1AVBA 2CY6A 1HKDA 4COVA 2FZ2A 3POWA 5E8AA 1Y3TA 4PBPA 1GICA 5EFUA 1AYN1 1LGCA 4E4ZA 1AR92 3VBOA 2H6CA 1DQ4A 1REEA 3B00A 2UY9A 5A3MA 1JH5A 5I0RA 5FDBA 4QGMA 3BPZA 1HIXA 4ASMB 4B7EA 3ME2A 2ZPXA 3VZMA 1V9U3 1OA4A 1H2KA 4XYXA 2CL2A 4FOVA 5C9AC 1LJ7A 4GXLA 1OI6A 2WSVA 2RS53 4MXWB 2JE9A 1KD7A 3PVBB 3GZTB 4XHBA 1QJU2 4YVWA 2Z2SB 3MIDA 3BTAA 4PDWA 5FLHA 4Y22B 2VU9A 4RR3A 4W6YA 4EN7B 5J98B 1H1AA 2P3JA 4Q4Y3 3OGGA 3AMPA 2D40A 2OIIA 4CEWC 2RE9A 2FBEA 2OPKA 5LRRA 1NZCA 3A4UA 1PZ8A 4IL7A 1H2NA 4Y20B 2B7YA 2CGOA 5GZFA 1RJ8A 3LSDA 3PNAA 3J4UH 4UW5A 2C1FA 2ZCWA 3TB0A 1LOFA 2HWC1 4Q4W3 4I01A 1DQ5A 2EXHA 4XJUA 1S55A 2VECA 4LLFA 4AEMA 4TZDA 5BYNA 1GZ9A 4OHWA 3AZZA 3KCXA 2XPJA 5JMCA 4GQ7A 4S2HA 3W58A 5GJ6A 3WDUA 4GB33 5FMOS 1LHWA 4OLLA 1WA4A 1FYUA 4P9IA 1DZTA 2VUJA 3CU7A 1OA3A 4C90A 1CD3G 4DPNA 2D98A 4HT1T 4FQ4A 1XYNA 3ZYIB 4WV8A 5BNQA 4AXOA 2QUOA 5IK5A 4N53A 1IHMA 1JYIA 2A3WA 5I8TA 1VBB1 3I8TA 1G6NA 5CB7A 2ZGUA 1PO13 3AYCA 1ZA4A 5EYXA 4Q4X3 1H0BA 1IS5A 4Z82A 1QHDA 3RRDA 4ISRA 1QDCA 2ZBJA 2WA4A 1EV13 1FPN2 2GH2A 2PFWA 4RHV3 1G9FA 2QDRA 3M70A 1K5MB 3VBSA 5KHIA 3WUCA 5FMOL 1VAKA 4HKLA 2O0OA 3TAYA 5LRSA 5T55A 3MW3A 1AYM1 2Y0IA 4C0HA 2GALA 2DFBA 2GMPA 3MLLA 1W39A 2DU1A 2HWB3 1WCKA 1AL21 1X36A 3KM5A 3RI9A 2GC3A 3C3VA 3VBFC 2GAUA 1CR7A 3UKVA 1V6LA 1CAVB 2NMOA 4KWJA 3QACA 1O4YA 2ES3A 4OI4A 5EJ3A 4BA6A 3PVNA 4K8FA 4LO6B 5KXEA 4Q1PA 4W65A 4FPKA 3PJYA 4UW3A 2EXJA 4B4PA 4PJYA 3LZZA 2ZMLA 1H9WA 5JOZA 3NO8A 2HEVF 4RL7A 3TNQA 2ZTNA 1TMF3 4KGGA 5HBAA 1WW6A 2D5HA 2VNOA 3WQ1A 1CIWA 3WP5A 1PGSA 1Q8PA 1H4GA 5JCTA 1AUYA 3KCCA 4HVOA 3B9CA 2KXLA 4HMZA 3V65A 4YLZA 3VBUB 3USUB 5JZGB 1AR91 3RS6A 3A0NA 1RUH2 4MX3A 4YW3A 5HCBA 3OD0A 2A6ZA 3EO6A 3ZSLA 3MIGA 3AMHA 5FQ0A 4OI0A 4QM8A 2IFWA 4IEQA 4LR4A 1IS4A 2ZHMA 3VHOA 2IFRA 3PVOA 3IKWA 2YGLA 3DUIA 4I09A 2WZR3 2GU9A 4KNCA 4DRRA 4OI1A 2H0VA 2H0BA 1S2BA 2DV9A 3FZ3A 3R6SA 2E7QA 4HBNA 5HCAA 1MVQA 3L9JT 3AX4A 4N43A 3JZVA 1S0IA 1YHFA 4XF4A 4AI1A 1U5IA 4PDWB 3S7EA 2DYCA 4WM8A 1XNBA 4XIKA 1QJY3 2R071 2HYKA 1R1A2 1IZ3A 1QXRA 2Q5TA 4YM3A 5L7OB 4JAAA 5CFDB 5FOBB 1PVXA 1AXZA 1H1MA 3ZXJA 3MW4A 5BNNA 1OA2A 2MEV1 2XVGA 2X5IA 1OKQA 3M3IA 3MZHA 2VH9A 1EP0A 1AR73 1G9CA 1O3RA 1VBE1 3H7YA 2LTNA 1HXS2 4EV0A 1ZM1A 5K9YA 2VW0A 1GFF2 3ZXGA 4JV4A 4TSVA 1I6XA 4Y1YA 5CVRA 1VBE2 2OUJA 1SFNA 1SMVA 1U5XA 3IN9A 4CDWB 2E6VA 1J3RA 4Q0SA 3BCWA 4IETA 4RS5C 1UZZA 1V6OA 1PK6B 1W6PA 4M0NA 4ATFA 2ERFA 1J58A 3AZVA 1HRV1 1CAXB 1QU0A 4Z07A 3NAPC 1ND3C 1PGW2 2R6QA 1RINA 2WZR1 1QJY2 3VV1A 3FFZA 2F4PA 3KSCA 3ATGA 1QJZA 4QGNA 1ZRDA 5SV8A 5FLIA 4LE3A 3NVCA 3HQXA 3URFA 4WVVA 3U11A 4I0AA 1BEV3 4P9JA 3AKSA 5J36A 4CZSA 3V0AB 2A3XA 2B9UA 4JDOA 1LEDA 4IEVA 3RJ2X 4CYDA 2R043 3ZYPA 3ZSEA 1BEV1 1VB4A 2WS93 1AR93 1PMIA 2PHFA 2WA3A 4GWMA 4AEDC 1KJLA 1DGRA 3CO2A 4AEDA 4A7YA 1ND2C 1PGL1 1Q8OA 2MPFA 1IPJA 1MS4A 2JECA 1QMJA 2JJ6A 3MIFA 4ES9A 3TOJA 4F7ZA 2RS51 1BVP1 4OFGA 4A7ZA 2ZX3A 3ZYGA 1VBD3 4FPJA 4UW4A 4K20A 3NWKA 5JSPA 1B35C 1BK1A 2VOXA 1WD3A 3AP7A 4E9KA 3E6CC 4XFIA 1VBB3 1WW5A 4FPHA 1BQPA 4ASLA 1MVEA 3OGJA 3E6BA 2GMEA 1OPMA 2E63A 4WZCA 4Q4V1 4G3YC 4EN9B 3WHTA 1UMZA 1SLTA 2RS31 1GKBA 2O8QA 4C0BA 1Y9QA 4TWTA 2X5IC 4DXZA 4M3CA 2V5YA 2ZKLA 4BCUA 3H1MA 2XHKA 4Q4W2 4XZPA 1TE1B 1X33A 1XU2A 4DMIA 4O9GA 2D6NA 1DQ1A 2HWB1 5GLVA 2W68A 3KT4A 4Y24A 5FREA 2ET7A 1V6MA 5JOXA 1QJX2 1QQP3 2WC2A 3I54A 1RUC1 3VGIA 3ZN4A 2WFF2 3R4SA 3JBG1 4BLIA 5JDBA 1O3TA 1U0AA 1O3QA 1UX6A 1HW5A 3I59B 2NP0A 3OY8B 1V6NA 2WNVB 5I8YA 5CG8A 1X8EA 2C9AA 2G9FA 1ZYBA 3B94A 3VHRA 1QH6A 1O7FA 3OBTA 5AC93 2Q4SA 4NR1A 1LHUA 1RMU1 1OQEA 4AVTA 4RR3B 1YYNA 1DZRA 1DU3D 4WM7C 3FJSA 4Q4V2 2JENA 3GHNA 1MZ6A 3B7MA 5EWSA 3QH6A 1H8TA 2IWGB 4WZFA 4FOQA 2PELA 4CDUA 4AI3A 5JZGA 1ZRRA 1V9U1 4I3PA 4QQHA 4IV1A 5JZGC 3VBHB 1OPOA 3GBFA 5ABJC 3EQEA 1AR82 3N7KA 1O4ZA 3OD4A 4KL1A 2JG8A 1QY4A 4B3NA 4YW2A 1OD5A 3ZX7A 1Q5OA 3AP4A 2TEPA 4JGZB 2I2SA 1H8TB 1ZRCA 3GBGA 4YZ3A 2VMGA 1GV9A 4YZ5A 2PLV3 3AZWA 3AXEA 4L99A 1AJOA 1Q43A 3M1HA 4J1XA 4YFWA 1RUF2 2ZGLA 3DPRB 5HXVA 3RSJA 2RR13 5T5OA 4Q4Y1 3ZIXA 5JR7B 2AH2A 1AR62 1RITA 5LEJA 2TUNA 4P9YA 1JUIA 1X50A 1VJ2A 2BGCA 4JGYA 4DY5A 1YIPA 3ZXFA 2GNBA 1QJU1 1EAH3 2VNRA 3O7OA 4DNYA 3PMEA 1LU1A 4EJRA 2BWCA 3EXUA 4AQSA 2YUEA 1AYM2 2DWRA 1XRUA 1R1A3 3MLKA 1C3HA 1UD1A 5BPXA 5TSWA 1KXGA 4P9LA 3B93A 5H9QA 4EN8B 2VVDA 1RUC2 5CADA 1NY72 3N36A 3SITA 2ZX0A 4MUVA 4BYYA 1CAUB 4OUSA 4BM8A 3ZMOA 4B7KA 2IXHA 4NVPA 4QPYA 3D8CA 5JPNB 1W6OB 3OYWB 4HL0A 5CBLA 4F8AA 4XILA 2ZMNA 3JD72 5BV6A 5T5JA 1DDLA 5BNPA 3ES4A 1AF9A 3NV3A 1RGSA 4JRLA 5JI9A 2NPIA 3RQ0A 1GZCA 2JG9C 3ZN6B 2C5DA 4XBNA 2XVKA 2OA2A 4WVMB 1RHI1 4LBKA 4A3XA 4HFSA 2VPVA 4WVMA 2ZAAA 2DCKA 4YVWC 1UAIA 1VRH2 1FI2A 1ND3B 2B5HA 1RVF1 2Q8OA 5FRAA 2KM2A 1RUE3 1JXNA 2IC1A 3MLJA 1R081 5JAXA 3CL1A 3ECQA 1R1ZA 2ZOEB 3FX3A 4QPGC 4M00A 1VIWB 3H3ZA 1FX5A 3QOPA 1R1A1 4A2UA 1W6OA 1D4VB 2WLQA 1WD4A 3JQWA 4MZUA 1PVC2 2NMNA 4M3CF 4I3GA 1MS9A 3IIAA 2B46X 2SBAA 2UYAA 4AVSA 4XF3A 1LESA 3W9AA 4EROA 1XQNA 4NWVA 1NCQA 3AJZA 5FFOC 3CJIA 3E5UA 1QJX1 3N35A 4QMAA 3ZMNA 1AR83 1ZX5A 3MEPA 4FPFA 4GWNA 1ND2B 2CGPA 5C8CB 1XYPA 3OPZA 4LBOA 3FE5A 1SLIA 2A6WA 3AYEA 1D4M1 1DZQA 2F6BA 2QFEA 2YZ4A 2ZABA 2DCZA 2YC0A 2AZ5A 3AM2A 3ZN5A 1AL22 2DVFA 4IV3C 4H7MA 1S0CA 2ETEA 4X6RB 4XTPA 1D4M3 1XYOA 1RIRA 1WMDA 3WCSA 3EJKA 4M01A 4AF9A 5J3UA 1VBB2 3PLQA 2B8MA 4LNVA 1WCDJ 4LO4B 1RUE2 5D8AA 4AI8A 1B35B 5GZCA 4AVVA 2HWC3 1K5MC 3SXWA 1DGWA 1SEFA 2EXKA 4XFCA 1FPN1 4YM1A 1SCRA 4FBFA 2VVEA 3U0ZA 3QLQA 2PAMA 1QQP1 5C8CA 1FMD1 1O4TA 2E51A 3BB6A 1IKQA 1MEC1 2Y38A 2X5IB 4E2SA 4QPGA 3M3CA 5C8WA 4I0WB 1QF3A 3QD6A 3NJZA 1G8WA 2A6VA 2XKPA