3JQXA

Crystal structure of clostridium histolyticum colh collagenase collagen binding domain 3 at 2.2 angstrom resolution in the presence of calcium and cadmium
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
117
structure length
117
Chain Sequence
b'YPIGTEKEPNNSKETASGPIVPGIPVSGTIENTSDQDYFYFDVITPGEVKIDINKLGYGGATWVVYDENNNAVSYATDDGQNLSGKFKADKPGRYYIHLYMFNGSYMPYRINIEGSV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ColH protein
publication title Structural Comparison of ColH and ColG Collagen-Binding Domains from Clostridium histolyticum.
pubmed doi rcsb
source organism Clostridium histolyticum
molecule tags Cell adhesion
total genus 23
structure length 117
sequence length 117
chains with identical sequence B, C
ec nomenclature ec 3.4.24.3: Microbial collagenase.
pdb deposition date 2009-09-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.380 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3jqxA00
1WMFA 4DY3A 4DZGA 3JQWA 2O8OA 5FBZA 3JQXA 3BOWA 5FAXA 3DF0A 2QFEA 2LUWA 4G9SB 1KFUL 1NQJA 1KFXL 1WMEA 3AFGA 4HPKA 4I3GA 1DF0A 1U5IA 5SV5A 4HPKB 2XVKA 4DY5A 1WMDA 2XVGA 2XVLA 1NQDA 1QXPA 4DXZA
chains in the Genus database with same CATH superfamily
1WCDJ 1UPSA 4M4PA 3FBMA 2WLQA 4IEXA 4IL7A 3T30A 4M3CB 3ILFA 3SH5A 1W90A 1SFYA 2Z2SB 1AR93 3POBA 2QKDA 4Y20A 4BJ0A 3BYWA 1US3A 2L9LA 2ZZJA 3U10A 2GMEA 2RDQA 4IV3C 1H9WA 1PMJX 2RG4A 1WA6X 4CP0A 2ZGOA 4DFSA 3D6EA 3VDDC 2FHRA 3MO4A 1HQLA 1S2KA 5TSWA 1TMF3 2D6PA 4OHZA 3WF0A 2TUNA 1ZBA1 4YLZA 4XUOA 1QJX3 1CX4A 1S1AA 1V6OA 3VKMA 2A71A 2VQTA 5FMOS 3V65A 2CGOA 4OHVA 1SPPA 4HK8A 3WNXA 1COV2 1GFF2 2CGNA 3WP6A 4LBLA 4W6YA 3BU7A 4XC9A 3AP5A 3LSDA 3S6PA 3HMYA 4QB6A 3GCWA 4I09A 3ZR5A 5FP9A 1MS8A 1VMHA 4OVEA 4K3UA 1IQDC 2Z5WA 5FBZA 4YW4A 1WW7A 4CDWA 2A5ZA 1BMV1 1SBDA 5I8SA 3KV9A 3MIDA 1UN1A 4EN8B 1JXNA 2ZHNA 3P3PA 4QPIA 4TSVA 3ZFFB 5KHKA 2XUEA 2RM21 5FLIA 2PYTA 1YC61 4AGVA 3BALA 4COUA 3V0BA 4YNIA 1WLDA 1GOGA 2WZR1 3R4SA 3PMEA 2D6LX 5FPZA 5GKAC 4DUWA 5FY8A 3N9OA 4BQ3A 4HKWA 3ACIA 1CPNA 1UZWA 3VHOA 3TN92 1FV3A 1W9TA 2GC3A 4RR3B 3AC0A 2C0ZA 1QKQA 4Q4Y2 1DGWX 4GKXA 3WNLA 2IUWA 2A7AA 2WWUA 1QJY1 5A7PA 2BFUL 1HXS2 3K51A 1M4WA 1WKYA 2OUJA 4XUPA 5I93A 5IW0A 3LZZA 1YFUA 3B69A 4FXGB 3OUIA 4B8EA 2H0BA 1WZXA 1CAWA 2DVFA 2NN8A 1QJEA 5GALA 2G19A 5AFEA 5IVFA 5JSPA 4IESA 4D7TA 4PF5A 1WW4A 2Y8KA 3WUDA 1WWYA 1C57A 3ZM8A 1SBFA 1FI2A 4HVQA 4A3ZA 4CXYA 1W0OA 3AKPA 3AJYA 3AZYA 3I59A 4AI9A 3O1OA 2FDGA 1OLQA 1HRI3 4NPRA 5JUVA 1OLMA 2NYYA 2XBO1 3LIGA 3NO8A 4J1XA 1WCKA 3RS6A 5EZWA 1SLTA 3LEKA 3JQWA 5L7OA 4I30A 5AC92 4CDWC 3HPNA 2ZZQA 4ISRA 2VZTA 1TEIA 3GJAA 1PK6A 3MBWA 4JZRA 3HT1A 4RHV2 3WDUA 4CEWB 4F7ZA 4LEJA 5A7WB 4QPIC 1AL21 4H14A 3H8RA 3RZGA 1V6NA 2VMCA 3E97A 1S0DA 3BPZA 4OYUA 1Q43A 3INAA 5HV4A 3ILNA 1N1TA 4ITCA 5FZBA 5C33A 2V4AA 1DYOA 4DNYA 1GZWB 5LEJA 1V0AA 4CSWA 1RUC1 1NLSA 1D7PM 2ZABA 2VH9A 4E2QA 4KBBA 1R093 4MGQA 4CEYB 1GUIA 2WYFA 2MEV2 1H4GA 2UURA 4LUKA 3VDCA 3T4HB 4DXTA 1ZREA 3LEMA 4W6WA 3NNJA 2VMEA 4CDXB 4XW3A 4P5HA 1PVC3 2W1SA 3USSA 2J42A 2VZUA 4QKDA 1WLTA 2XONA 3A22A 4GMP1 4NAMA 4P9GA 1KFUL 2RS11 3IMMA 4Y33A 1O4ZA 5FBJA 5JZGB 3DCQA 1DCSA 2JG8B 3X29B 1JBCA 1NA1B 1LCLA 3HNYM 1YQ6A 5FMDA 4HANA 4BQ1A 2G1MA 3THCA 1VBA3 2W0XA 3V0BB 1ASJ2 1DP0A 4DXSA 5L73A 3PMSA 4CU8A 1C8NA 5F2WA 1RUG2 5FZ8A 4N53B 5LA2A 1KD7A 3UETA 1VALA 4PLNA 5L7OC 2VBDA 4M01A 4NPLA 3ON7A 3GM8A 1ENSA 2DU0A 1YNAA 3N3HA 1PK6C 3I97A 1GNYA 1QJU3 2DTYA 3N7MA 4P02B 3KVAA 1DG6A 2UWCA 4I0BA 1GZCA 4UF0A 4Z92B 3P1IA 5DXDA 5ACA3 1HN0A 4LR4A 2XHNA 4HKOA 3ZYRA 3V0AA 3U0ZA 4NROA 2GZWA 4QKNA 5JI7A 4BM8A 3VBOB 4K40A 2DUQA 2X10A 1M06G 4QXBA 2ZA9A 3JB8A 3DPRA 1H4HA 1KEXA 4YM1A 2HYXA 5CG8A 4PIZA 4DY5A 4LBOA 2WL1A 3LDKA 1NQDA 1RMU3 2JDAA 1W6OB 4ES8A 1MVEA 3U75A 1RC6A 1Z7S2 3U14A 4V2VA 2CGPA 3S5QA 3UV9A 1OF3A 4IEUA 1BCXA 1O59A 1LULA 1OFSA 5JIUA 1RINA 2FCUA 1LHUA 2C9AA 4LK7A 4NRMA 4XJAA 3ACLA 3BGAA 3TEWA 2WT1A 4LOSA 2D3PA 1ZYBA 1POV0 3CU7A 5DZFA 1Y9GA 1OI6A 3H1YA 2WSVA 1ZBE2 2GP3A 5LA0A 1ZZ8A 3KV6A 1NZCA 3GHNA 2DVGA 3LF7A 4P00B 3C7EA 4ZS2A 1DQ6A 1L7QA 3WDVA 4ET7A 1RUNA 4XFCA 5FYZA 3FJSA 1RUJ1 4DMIA 3K48A 4QAWA 3VZJA 2JKXA 1OA3A 1C8M1 2Y0IA 4IV1B 1SDDB 3PU3A 1BBT1 2J1AA 2RJKA 1ZBA3 3GYDA 2W91A 4P9WA 2D3RA 3SEPA 3ZX7A 1HJFA 4FPLA 5LEKA 1FNYA 1UYYA 4WVVA 4GB32 4UFMA 1OPMA 2HWD1 4LO8A 3ZKUA 3K77A 4N43B 4OHXA 3B93A 2A3WA 3LIHA 5A3PA 3I2IA 1X33A 1O3TA 3BB6A 1C4RA 1QOOA 1CZTA 2QNKA 4JVAA 4OMDA 4RGGA 2WFF2 3FZ3A 2B39A 3DPRC 4XTPA 2YC4A 1U5IA 2PQQA 4HPKB 4NHYA 3TNQA 3ZXAC 1GP6A 5FO8B 3GBGA 3WW4A 2EVXA 4GH4A 1NT0A 2IXJA 2X53S 1QJFA 3M2MA 3MIGA 4GJZA 2RM23 4GWMA 3U78A 4ASLA 1K42A 3OTFA 3ZKYA 2DUPA 2EALA 2ZGPA 3BKZA 5FRAA 2VAUA 4C91A 2WZR3 1RUE1 4PF1A 2K2SA 4NN0A 4JHZA 3FFQA 3HJRA 2GH2A 1PNFA 3KV4A 1HB2A 1TVGA 3LA2A 5IT6A 3AM2A 1A8MA 3AZVA 1HLCA 2NZ9A 4MSVA 1NZIA 2O8QA 5FK7A 2YROA 2JICA 3DV8A 1QJY3 1XNKA 4IXLA 4YYOA 3ZVXA 4QKFA 3ZDSA 1SQ4A 3AYAA 5GZGA 2IVJA 3EO6A 1BQPA 3VLBB 1O3RA 1IZ3A 3D8CA 5A33A 5LK5A 3ZYFA 4LHLA 3NJZA 4D94A 2RS52 4E2SA 2GC0A 2CNAA 5DQ0A 1JS9A 1U5YA 2VMGA 4RA0A 3PVOA 2OVUA 1PO12 5J09A 2OZ6A 3VL9A 4NHKA 1VMJA 3CO2A 4JGZC 1W0PA 4XAEA 4ZONA 1N3PA 5FMCA 3USUB 3WEZA 3A0NA 1R64A 3VBHA 3M1HA 1L3JA 2XBO3 1B35A 1VR3A 2VZSA 1N3OA 2RDSA 1XSQA 2OUHA 4HBNA 5CG9A 1BYHA 3O1MA 1FMD2 1MEC1 2XOMA 2E7QA 4XE9A 5CU1A 1YYNA 2BV4A 1W6QA 3CF6E 3HQUA 2XQRA 3HQXA 3IKWA 3KHBA 4E4SA 1WMXA 5C9AA 2EIDA 3EXUA 3BTZA 1ND2A 2PHTA 1UZVA 3JUUA 5EFUA 4EYUA 1UU5A 1S0GA 5D1IA 3ECQA 1RUC3 1ND3C 3J7LA 5CZKA 3AX4A 2FMDA 2A1XA 1QNYA 2ZGUA 4XCBA 5LA1A 2C5DA 2VNOA 5EJ1B 2AREA 1GOHA 2WR9A 2QFEA 1TG7A 4M0NA 4UBHA 5FMBA 1KJRA 3NV1A 4G3YC 1SBEA 4L8QA 5LBFA 3SNMA 3EB7A 4E9KA 4FFIA 1N47A 4GMP3 1RIRA 1C5HA 1WCUA 2RS13 2E26A 3W5MA 5A7QA 5A32B 3WXPA 3MFCA 1D0HA 4LKFA 3E1F1 4AVVA 1FX5A 2GC1A 1OOPA 4NUBA 4XF0A 1HRV1 4N9HA 5FP4A 3W20A 3AP9A 4Y1YA 2E9QA 2VTXA 3M8LA 3QACA 3VBHC 2VULA 1REEA 1B35C 1LGCA 2PLV1 2SBAA 3K4DA 1QJZA 4KGQA 2BUKA 2RV9A 5GLVA 3IAQA 1QEXA 1NCQA 1UYZA 1NLQA 5HI0A 5IVJA 3WZ1A 1JU4A 2PELA 1S0JA 3IN9A 3MI8A 2PHXA 4JRAA 4QU2A 2WFPA 4CRQA 3C7FA 1RUI2 5HXMA 2YDEA 3PUIA 3DXTA 5C9AC 3LPGA 3WF2A 4BDVB 1LEMA 1J59A 5J3UA 1AXYA 4LQRA 3RZZA 1IPKA 2WJSA 1ND2C 3THPA 2ZX3A 5FFOC 3MIBA 3AVSA 3R05A 3ZN6A 3AKSA 3MW3A 2EIBA 3NAPA 4ATEA 2RVAA 1FOD1 4MOAA 2G9GA 3I2GA 2YG0A 4INDA 4CDQB 2FDHA 4Q1PA 5T50A 1W28A 3LEIA 4PDWB 2HH9A 4KU7A 1NCRB 3JZVA 4LHKA 2GC2A 4NIIA 2Q8OA 1KITA 2VG9A 3TOJA 3LA7A 1H8TB 4ZU7A 3MDPA 5C8CB 3K3OA 1JW6A 4AI1A 2CTVA 3ZN5A 3KF5A 1HB3A 3VGIA 4UFKA 3ZFGB 1AYN1 5SV5A 4BU2A 5DAWA 1J83A 4GKYA 4JGYB 2LROA 2VOKA 3WDTA 4EROA 5BNNB 2CY6A 2X8KA 3AP4A 1RUOA 1DIWA 4LBKA 2ZS6B 1XB9A 2PHUA 1O6UA 1WBLA 2WT0A 3GDBA 3I2OA 2A6YA 1AR62 2Q30A 1HKDA 3KGZA 4QDQA 3NMBA 3PTRB 1RUJ3 2IZWA 4R9BA 1G9CA 2XLAA 1V6LA 3ALQA 1ZZ7A 5EP9A 5LWBA 4CCJA 1ENRA 1C8M3 1F35A 2YXSA 3IMNA 5EXOA 5IFTA 1BBT3 2VZ3A 4GIQA 1COV1 2CDOA 4L9BA 5I91A 4XVHA 3CZUA 3W58A 3DL3A 5HV0A 3LE0A 3PUQA 2V09A 1C1FA 2J7MA 3I3MA 2HWD3 1E5RA 3KS7A 3OB8A 3RRDA 1Z78A 3BVCA 5T55A 4E8DA 4EWAA 5FYIA 1TQ5A 4LXLA 1F5FA 3NAPC 1RUH2 2JENA 1E5SA 2YU2A 1CESA 4WZCA 3PUAA 4JKKA 5J96B 2RR12 2HLEA 4QPGA 1FAYA 5FUIA 3UKNA 5FXZA 3PIGA 1OH4A 2JDMA 1OD3A 3IPVA 4KQ7A 4U2AA 4B4PA 4Z2AA 5IFPA 5BNPA 5A70A 2KD7A 1LR5A 3OCPA 3KQ4B 4IGPA 1X8MA 2WO7A 1Q8VA 2I07B 4AFBA 1VP6A 5BUVA 5FLHA 1RUE3 1FNZA 1JMUB 3MIEA 4Q4W2 5DAPA 4Q4Y1 5DABA 4A3XA 3J7NA 3PVBB 3A0KA 2ZGMA 2I74A 3OF1A 3WQ1A 5FYHA 1HXS1 1W05A 3BCWA 3OUHA 3WDYA 1IKPA 2VOWA 3PJQA 4TXWA 4XFBA 1IKQA 2ZKNA 3IDAA 1UU4A 3WNMA 2IFRA 4MGTA 1UZYA 4AZZA 1GBGA 5EQUA 2CWMA 2PN5A 4FI9A 4JTOA 1LOAA 1H30A 1UIKA 3KT4A 5JR7B 4LOTA 4YGDA 1D4VB 1O5LA 5CBLA 2B4KA 2IXIA 3HEIA 4K21A 3O1SA 4LTAA 1YQ5A 5GZFA 3DEMA 3UYJA 1HDKA 2VL4A 3JBG2 4AFAA 5FZOA 3RMYA 1VJ2A 3BOWA 3O0XA 3WUCA 2P2KA 1MZ5A 4GD4A 3SMHA 2D5FA 5H9QA 5E16A 3VBRA 4OI0A 2BERA 2ENRA 4M0HA 5A6QA 4XURA 5AC91 1JTZX 1VBE2 4X8PA 5DAVA 2EXIA 5D8AA 4IEYA 2LM3A 4QPGC 4S2DA 2R32A 3SC7X 1MEC3 4YVWC 2QE3A 3WX5A 2R072 4AE2A 5E88A 5BNPC 1ENXA 1QQP2 2PAKA 3RG0A 1JZ6A 1ZZCA 2ADEA 2IXKA 4QQLA 5FUNA 5CADA 1AXKA 2NQYA 1WLWA 1XE7A 5HXVA 1QGLA 3WDXA 3S7EA 5FOBB 3VN4A 2YB7A 1W8HA 4OI4A 2D7FA 1PO21 2MEV1 4HG6B 2O1QA 4OUEA 3WG2A 1GLHA 2XB6C 5CFCA 1S55A 4UYBA 4Y24A 3ABZA 2AH2A 3PIJA 1BHGA 1HN1A 1U12A 1F8VA 1QWRA 4P08A 2NMNA 4DUXA 2WWJA 3VBUA 4E2GA 2ARCA 2R16A 4LBQA 4L11A 3JB4C 3KT1A 4W65A 2UYBA 2E53A 2WZ8A 3H3UA 3WNPA 4KWUA 4RS5A 4XQWA 5K9YA 1Q8SA 1HX6A 1ASJ1 1LOGA 1XNDA 5FXWA 2VZPA 4C1WA 4MX3A 3VBRC 3J7HA 3Q8AA 3RZHA 4I0WB 5DMYA 3SCFA 1RXGA 1HRV3 3MZHA 2X05A 3DYOA 1F5JA 4UW5A 3GZEA 4GWNA 1NQJA 5D8AC 2C9KA 2JDNA 1Y9MA 3OY8B 5FY0A 2PLV3 3WW1A 5FOJB 5FPLA 4N8MA 5KR7A 2KXLA 3UJQA 5KHGA 2DFCA 3AYEA 4XXAA 5I0SA 5IVCA 3NKGA 1NXMA 4QM9A 4DOUA 4YW7A 1S4CA 2P3JA 5F2SA 1J84A 5CFDB 2BNOA 4QXHA 1RHI2 2VCBA 1LAJA 1DZTA 1H1IA 2A6XA 1CQ9A 1W6MB 3LFIA 5I8TA 4PT6A 1V6KA 1VRH1 2NLRA 3OGJA 4JC1A 2OYZA 4ZY9A 1FOD3 2A70A 2PFWA 2QQMA 5JXGA 5FZ3A 5CFCC 1Z7S1 1IS4A 2PQSA 3ZXFA 3J8F2 2RS31 1ULGA 1K5MA 1GICA 2WAAA 2BRTA 4AEDA 2P3KA 5FLJA 5DUWA 1OUSA 4CCCA 3UT0A 2WNVC 2ZGLA 3N7JA 1S0EA 3O14A 3B94A 2HEWF 1BKZA 4XETA 4H2AA 2ZOEB 4RS5C 4YG6A 1X8EA 1JOPA 1AYN3 2OX0A 3AMQA 1GSLA 1OKOA 4XXPA 3TWIA 4B29A 4MXWB 3AB0A 3OUJA 2R042 4NR1A 1F31A 1JHJA 4LHNA 1C3HA 3AXEA 5DG2A 3AYDA 4URTA 4LBNA 2ZBJA 2XPJA 3MV11 4M3CE 4RD7A 1BVP1 4CXXA 4EN9B 4MGIE 3NNGA 1O4YA 4SBVA 4QU1A 4K9SA 4ZZ5A 4GB31 4BE3A 3RYRA 3VHPA 2X09A 2OIIA 5C3SA 1O3SA 4BXFA 5C5TA 4CU6A 1COV3 1ZRCA 5A7SA 3HVDA 3J4UH 1E5IA 1VBC1 3Q8CA 2Y60A 1JHNA 3VBUB 1PMHX 3UK9A 2XVLA 1JZ3A 4M3CF 3FUOA 3T2TA 4B4QA 4CDUB 4ASKA 4R4XA 2WT2A 2F17A 2Z42A 5FJHA 2A3YA 5C4WB 5I8YA 1PNGA 2O14A 1QIQA 2XDVA 5F3IA 4IEQA 1F4HA 3T08A 4Z1VA 4ZZ8A 5J36A 4QDRA 3U4SA 1GR3A 3IDEA 1PIV2 5A1AA 1REFA 5L19A 1H2LA 3IZOA 2VW1A 3E5UA 3QH7A 1FPN2 4MGYE 1K5MC 3OEBA 3WCRA 3WOGA 4AEJA 3W5NA 2J1TA 4COYA 3AFGA 3PUSA 3WSOA 4QXCA 2BTVC 2WDBA 2G9ZA 3M3IA 3GALA 5FUPA 4DB5A 5KWRA 2A3XA 5IK7A 1AR82 5A7OA 4CCLA 2GSYA 1N3QA 4Q4Y3 4N7UA 2VZVA 3H0OA 3TEYA 2ERFA 4FFFA 4FOQA 5FZFA 1HXS3 1QH7A 3JXSA 2CV6A 4PIXA 2R1BA 3CBNA 5FV3A 1GU3A 5FYBA 2R7EB 3AYCA 4HZFA 3KHCA 2H6BA 4BB3A 2VZQA 4QX0A 2WNOA 2RS51 5FZ1A 5F7UA 4ZHNA 1LU1A 4LIVA 3MF9A 3FMGA 1PO11 4CCDA 5DZEA 2Y6FA 4IE5A 1DGRN 1Y43B 2C24A 4JDOA 4P9LA 4Q1RA 4NAOA 3VD7A 3GNEA 3M3QA 4PBPA 4YG0A 1SLBA 3IAPA 4AOCA 2VBBA 2WAOA 1UYPA 2BJSA 5FO9B 1BEV3 2P4EA 3WQBA 2XWBB 5AC93 4W8JA 1UZZA 1FMD1 3AKQA 5E6HA 2ZX2A 4BQ5A 3AJZA 5AVPA 2DU1A 4AQ2A 2P6CA 1RL3A 1XNBA 3MV01 4IEZA 4D3WA 4FOVA 5JWPA 2YPJA 4YW2A 4XILA 3B00A 3DN7A 2P3IA 4UW3A 4IV3B 2DF7A 3O0VA 1ULOA 3DKQA 4ZU5A 3DUIA 1SDWA 1PO23 2MEV3 3VDDB 5A80A 3ZXKA 3CHXA 3L2YA 4LUMA 5C70A 2O0OA 2P5BA 5A3LA 3NNFA 3VUOA 3GZTB 4LNVA 4CCOA 2HWB1 1RUD1 2CHHA 2BEOA 4LA3A 2WA3A 5J1XA 4CP9B 1CJPA 4XOGA 3FLPA 3UGGA 4NRQA 2XL7A 3RZKA 2VU9A 3RNSA 2OS2A 1HJGA 2BFUS 4LK6A 1W3XA 1DQ2A 2BVBA 4LJHA 4CUCA 4QHZA 2EAAA 2J22A 3LPFA 1QU0A 4IE7A 3GZUC 3IDCB 4UW6A 2C26A 4GALA 4YW5A 2A6VA 4AW7A 2QZ3A 1LU2A 3MW4A 1CAUB 4L2NA 3LSEA 4LITA 5LRSA 5BNOA 4CUBA 3HD8B 4O9EA 4OZXA 3NV3A 4YZ3A 2E7TA 1POV1 5HBAA 1W8UA 4C1XA 2DCKA 1PGW1 3VDBA 5JCTA 4K8RB 1ZRIA 3PL0A 4Q8LA 1W8TA 5FZIA 2YBPA 4C90A 3GHMA 2ZXQA 4QB1A 1UQXA 3HT2A 1ZZ6A 3BTYA 1WCQA 4Y1VA 2JDPA 4BLJA 4Y20B 4JV4A 4QGNA 4YG3A 2D98A 1HQNA 1SMVA 2I2SA 1MVQA 3T0DA 1QDOA 2WSUA 4ARYA 1VRH3 3VD3A 2GN7A 2E33A 4MG2A 1H8VA 1UX6A 4W6XA 2B5HA 2V5DA 1MQTA 1Z7S3 2WIIB 3CMGA 3HN1A 3WF3A 4AAPA 3NQHA 3POEA 1UKGA 1H0BA 3TEZA 2RS33 4FPOB 1OHFA 3CDZB 4NIDA 1DQ0A 1UIJA 3PJYA 1QXPA 3ZSLA 3IIAA 5CISA 1TMF2 1D2QA 3WF1A 4IERA 1SPPB 1KS5A 4WBBA 3T2PA 4A41A 1H1AA 2IFWA 2GNMA 4A6OA 4BQ4A 1IPJA 3AZWA 3J7MA 3KT7A 1UCXA 3VZKA 3PURA 3WNOA 4ZXKA 1JU3A 1DLCA 4J1WA 4R9DA 3QCWA 2VQAA 4WM8A 5FPXA 5JXJA 3SEEA 1G9AA 4YZ4A 4CDWB 4AFMA 3WF4A 2ARBA 4KU8A 1W8FA 1UOGA 2D3SA 2W39A 4QM8A 5BNOC 4XBLA 4XFFA 1DF0A 1N1SA 3FL7A 3KZ4C 4IE4A 4QPIB 5IK8A 5K7PA 2D93A 2GN3A 3O1RA 2XVKA 4BYYA 4GB33 2UWBA 1D2SA 1WMDA 4IE0A 4P5YA 1ACCA 4FTEA 4Y22A 5F39A 2UY9A 1VBC3 2J1UA 4QQHA 4Q0PA 1EP0A 4JKLA 4YFWA 5GZCA 4CXWA 1AR71 3VBSA 1CZVA 4E4HA 3AKTA 5LK7B 2BGOA 1JH5A 3LEGA 3MIHA 5A3NA 2RDNA 2RR11 1W6PA 3WP3A 4O61A 4AHYA 1OA2A 4BIFA 5KBFA 3GXUA 2IC1A 4LO5B 4MGKE 3LWCA 4KGGA 4FBFA 4PJYA 1MQTC 1TE1B 1OQ1A 4C8DA 1G86A 3NVCA 1CAWB 2ARAA 2VTXJ 1UMZA 1XYPA 4PQQA 3TNPB 2YC0A 3SKJE 3O1VA 4Q4W1 3ME2A 1JODA 5D2AA 5FZ0A 3RJ2X 4CYDA 4XJ8A 3ZR6A 1KDMA 5FZDA 5J7MA 2YC2A 1LHOA 1JZ8A 4YFZA 3IIIA 2D44A 4XBQA 2Q1ZB 3I59B 2R061 2HWE2 5F5IA 4OCTA 1JI6A 4YGBA 2ILMA 1W2OA 1LB2A 5ERLA 5T5PA 4WM8C 5L7OB 5HCHA 4L0PA 3ORJA 2HWF1 3ZYIB 2XKOA 1LOFA 2ZAAA 4XF3A 1PK6B 3HBZA 4XACA 1G8WA 3JBG1 5JMCA 3QBQA 1AHSA 5FXVA 1O8PA 4XCAA 2RS53 4ZXEA 4NIAA 2ZHMA 5JVVA 2E51A 3H3ZA 3RDIA 2CSGA 1G7YA 1VIWB 1PO13 4XFIA 4AFDA 5FZAA 3C7HA 1NLRA 2B9VA 4RN5A 1I5PA 2VMHA 1US2A 5LBEA 5LASA 5BXXA 1GMMA 3VBSC 4CCMA 1N1VA 2ZGNA 4URAA 4AFCA 4QX8A 3GCXA 3T4VA 4OULA 4BISA 3D4KA 5LW9A 2ORXA 4AQ6A 5FK8A 1OF4A 4QB2A 1QY4A 1FMD3 5C6CA 2GAUA 1R092 2R071 3EMRA 1PX3A 1CAXA 3U11A 3AZXA 2FMYA 1QQP1 2QQIA 4JGZA 4KWLA 2WBKA 1FT9A 1GZ9A 3DF0A 1EAH1 2UY8A 3I49A 3MIFA 5F5AA 3GZAA 3WQ0A 2Y6GA 3H50A 2ET7A 1DGLA 5AVAA 4NHMA 4I3GA 4KG0A 3BIWE 1X9PA 3BTAA 4SLIA 4KG8A 1RVF2 1URXA 4NWVA 3OBAA 3HAGA 4JCKA 4OQ9A 3N36A 1H6XA 4QX7A 2WNUA 2HJIA 1JZ5A 1PZ7A 1VBA2 2JDZA 2XXZA 5JMOA 1EV12 1BK1A 2EIGA 4YZ1A 4A44A 2BNMA 3RMXA 1LOFC 1YI7A 3R6SA 1Y7BA 3SISA 3VHNA 3O1UA 1RUD3 2HWB3 3M70A 1ND3A 4UF0B 1AVBA 4AGRA 4OHYA 4CP2A 3U4XA 4HMZA 2WINB 3FBYA 4Q29A 5FQ0A 2ZEXA 3V0AB 4BHPA 2P6HA 1GQHA 1W9YA 3EQEA 1UMIA 3O12A 1VAMA 4PI2A 4YW1A 2VVEA 5FPBA 2V73A 5ACA2 2QBXA 4B7EA 1UY0A 1NE4A 1VAKA 2PHWA 4I01A 4BK4A 3DPRB 4HOOA 3AMPA 2GMMA 1GNHA 4Q27A 3LFMA 4D8MA 2ZX4A 5EYYA 1Y9QA 1POV3 4X6RB 3RWKX 1QMJA 3KM5A 4QX5A 5J48A 4BLIA 4KI5M 4UBGA 1ULCA 1RHI1 3N9PA 2EIEA 3A23A 3FC0A 5LY1A 1A6CA 3C7GA 3OG2A 1CPMA 2ZEYA 4Q2FA 3AZZA 4AQTA 2CU5A 4I02A 4QX1A 2AZ5A 1LECA 1W8OA 3NJYA 4S2GA 3VZNA 5JOWA 3OD0A 3IWZA 2WNUC 2BU9A 1AL23 2AR6A 1CR7A 3CNAA 4AF9A 5K0UA 1OVSA 2XHKA 3ZDVA 5A1LA 3O5SA 4Q4V1 2RMU1 1BVVA 5FWJA 5DDJ2 1JZ4A 2R6QA 1NY72 1RJ7A 2RDRA 1W6NA 1UWWA 4R4ZA 3TB0A 1Z0HA 2E32A 4HN0A 1KDKA 4DO0A 4Q8KA 3VBFA 3JD72 4YW6A 4RYDA 1RXFA 2DV9A 2QQJA 2VZ1A 2IVIB 4IEVA 4AEMA 4DEQA 3POSA 1D4M1 2WS92 3C8XA 3W9AA 5JSOA 1AYM2 2QQNA 4JTNA 2ZEWA 4RSUA 4AHWA 2P3YA 5GM0A 1OFNA 4IUGA 4PCRA 3WP4A 2WQ4A 1V9U1 3ATGA 4GH4B 1CZSA 2HBUA 3E6CC 5CB7A 3C2UA 1W2NA 4MHUA 3LOIA 1BMV2 4D6SA 1W03A 3RYKA 2ET1A 2QQOA 3LD8A 3NSTA 5GZEA 4RQPA 3TAYA 1AUYA 2QQUA 2BP6A 2PTMA 2IWGB 3G7DA 1LHWA 4K6BA 1SLAA 4Q0SA 5F8PA 5FWEA 2VY0A 1CONA 4YW3A 4JX0A 5ANQA 5LBCA 3NNLA 1S0CA 3NV4A 2WZR2 1AR73 4BPZA 1GZTA 4XQ4A 1SG3A 2K0GA 2XJPA 1LOBA 1E5HA 3I2JA 1H1MA 1EPWA 1Y3TA 2RR13 2VCCA 2NM1A 3L9JT 4CPBA 4XFGA 5K4LA 2VM9A 2OT7A 5L9VA 1FPN1 2JB4A 5K0UC 3ZYJB 1HW5A 5I0UA 3MGUA 2VOVA 2VVFA 2ZHKA 5KXDA 4WM7A 3PNAA 1AX2A 2FDIA 1QJY2 2H6CA 1GWMA 2HWC1 5A33B 1LKNA 1R1ZA 4Q0QA 5C5UA 1I6XA 1MZFA 1UOFA 1WMFA 2MNGA 3D0SA 3IBMA 5EYXA 2QQPA 1AR81 4Q4W3 4ISQA 3T1LA 4CPBD 3VBFC 4CCNA 1AJOA 3B5LB 3OGVA 1CIYA 5DPNA 1N1YA 2BGPA 3O0WA 4MVTA 2E31A 2R063 1GQGA 3MW2A 1YQCA 5CAZA 1ODMA 3VBHB 4N90A 1PZ8A 1B35B 5JSRA 2D97A 5CA6A 2HWF3 1ZZBA 4Q0UA 1OBNA 1TNFA 2XBO2 3GBFA 1UX7A 1W6QB 2OPWA 3ENRA 3JBG3 4IEOA 1UY4A 5C9AB 4GAZA 3EBRA 4NRPA 2XLGA 3K75B 3GF6A 1DYKA 1ND2B 4L92A 4BOWA 4DXZA 1A8DA 4OI1A 2EXJA 5IAXA 2VXRA 4RQPC 1PVXA 2XH6A 2XKPA 4KH9A 1LTEA 5G04L 4BCUA 4YGCA 4PQ9A 3B02A 4QGLA 1SCRA 1STMA 1CIWA 3Q8FA 4DS0A 3H1MA 4QQ2A 4XJUA 2GU9A 1RUC2 1GP5A 1KQRA 3VKNA 2VC9A 2VNVA 1TME2 3E5QA 3ZLIA 2R073 1DQ4A 5FZHA 1QQP3 4WM7C 3RWNA 1EAH3 1ZRRA 3E6BA 5DN2A 3MHZA 4BXSV 3CLPA 2RE9A 4FQZA 4HKLA 4AK3A 1ST8A 3NV2A 2JECA 2VNGA 5CYYA 4YVWA 4O65A 1LENA 1OOPB 3GJBA 2XR4A 2O8OA 4W4ZA 4Y1UA 2AUYA 1WLCA 4TN7A 1DQ5A 2D40A 3SHRA 1VLNA 3BN6A 2Q4SA 1A78A 4JRLA 3TN91 4AVBA 3ACHA 1NCQB 1AX0A 3RQ0A 1NG0A 4XZUG 3WHUA 1DLLA 1RITA 2NP0A 1DYPA 5C3QA 2UWAA 3H7YA 3SH3A 4I2OA 3E5XA 2WO3A 5K8SA 4HT1T 2W1WA 1F2NA 1UNBA 2XJQA 2XLFA 4UW4A 4CCKA 3NJVA 3ZN6B 1OD5A 4XF4A 2JKBA 3NAPB 4XF1A 4S2FA 3E6DA 5C71A 2VQ0A 4P9XA 1NUKA 3WLUA 4AQSA 5LA9A 3OEAA 1UY2A 2YY1A 4QMAA 4XBNA 4YVSA 4H3WA 3ZXGA 4Y5SA 2N7GA 2X5IA 2VECA 4DPNA 1KGYA 1YRZA 1R1A2 1LOCA 1PHMA 1CD3G 2BNNA 3UGFA 3WR0A 1KFXL 4EZHA 4Y1XA 1H6YA 2B42B 2IXCA 1PM7A 1APNA 1RHI3 2ADDA 2B46X 3OGSA 4RHV1 4E8CA 2P17A 3GGLA 4LBJA 5DAXA 1PX4A 3H8UA 3N7LA 3VD5A 3MFAA 2BQPA 2GNBA 1J3QA 1YI9A 5FP8A 1WUVA 3AVRA 4NHLA 4BZ4A 4CUGA 3ZO0B 1NYWA 1EPZA 3ACFA 3BI3A 4FOWA 3FN9A 2E6VA 4COVA 2MPFA 4D0QA 4XMAA 2JX9A 4Q4V3 2RMU3 5FZEA 2VUCA 5E1RA 5FY7A 3ZFEA 1UY1A 1V6JA 2Y0OA 2ZJCA 3R0RA 4XABA 1RUJ2 4DXRA 1CAVA 2W46A 2WNEA 4BK5A 1X7NA 1C8M2 2KM2A 2EICA 3POJA 2YGLA 3T09A 3WHTA 3ZSJA 1DZRA 3FLRA 1Q8QA 1YFYA 4GJYA 2VR4A 3SLIA 4FAHA 1DU3D 5BNQA 4UFIA 3T1MA 2HWD2 4AL9A 4WZFA 4A4AA 5CKNA 2I45A 1D4M3 4FPKA 3S5AA 5IAVA 2WNVA 2Q8DA 2LALA 4R8HA 2ZMLA 1IS5A 1DGWA 2QQLA 4FAGA 1ONAA 2AENA 3AL6A 4QPGB 5FCCA 4TYSA 4YVSC 1JOJA 5ANNA 4YVWB 4A6SA 3IPVB 1ULFA 2X5IC 1QNWA 1V9U3 5BNPB 1JYIA 1W9SA 3POIA 1RUG1 2AC1A 4R52A 2FBEA 3FE5A 4K1YA 3CJIA 4AG4A 4LBQD 2Y6KA 4G9SB 2K46A 4P9YA 4ES9A 4Y3OA 1SACA 1YLLA 2VXJA 3I2KA 2IXHA 3RFRA 3VL8A 4LKDA 1RUE2 1ZNPA 2W87A 4LULA 1MZ6A 1YWKA 3BPSA 5LB6A 1D0GA 1JZ7A 2YFZA 1F15A 4WVMA 1SFPA 5BPXA 1X36A 4NE9A 5L36A 2PHFA 3FHQA 2H0VA 2JWPA 3NWKA 1OQDA 5FZMA 1VMFA 5M0TA 1FPN3 4Z82A 2OQ7A 1UOBA 2JEMA 2PHLA 4OUSA 2HWC3 3CIHA 3NJXA 3ZFEC 1MS9A 5FZOB 3I7DA 3C3VA 2WYSA 3HN3A 2E63A 1AR83 5GLUA 2HWE1 1PZ9A 2LUWA 4BQWA 3VBRB 4AWDA 5EJZB 1QOSA 4QGMA 1CN1A 3IB3A 5BYNA 5EHDA 3I4IA 5ABJA 5D8AB 4OMCA 3DGTA 5LY2A 4EN6B 2XUMA 2VOXA 4WVZA 3T3YA 2EXKA 2JG9C 1S0IA 1F4AA 3QD6A 5FXXA 1XJAA 2TEPA 3MPPG 4FTSA 4IGQA 1ZBE1 5GLWA 1IS6A 4YZ5A 4LE3A 4M3CA 1W06A 5FTTC 3ES1A 1AF9A 2PHDA 3URFA 1B09A 1RB8G 2PHRA 1I5ZA 2YBKA 3VKOA 1MEC2 5B2GB 3CJIC 4XF9A 3AKRA 4QXKA 1SEFA 1YQ2A 2J1SA 1T2XA 3MYXA 1XYNA 3ETQA 2D43A 2CYFA 2PAEA 3BODA 5CFCB 5H9PA 3C7OA 3WINE 4UXAA 2R49A 2WRAA 5GLTA 3KV5A 3APBA 1QXRA 1R082 2WN2A 4A2UA 4EWEA 3H8OA 4EQVA 1WGPA 1MACA 4AYUA 3LOBA 4FPGA 1J3RA 1J3PA 1G9BA 2FD8A 4XFHA 1C5IA 1QH6A 2W95A 2R0HA 4LBQB 2WFF1 3A7QA 3J9SA 2FCVA 4LKSA 2YHJA 1RVF1 2Z79A 1H2KA 4RS5B 3ZOIA 3UKTA 5A6YA 5JAXA 3MPBA 1OUXA 3WD5A 1MS5A 1SLIA 3TRSB 3IM0A 4LLFA 4QHBA 4LO4B 5D21A 1EV11 1LRHA 1PGSA 3RVHA 2XJTA 3ZFFA 2OZJA 1REDA 4CUAA 4FFHA 2ZX0A 4NVPA 4XMIA 1QDCA 3DKWA 5F3GA 1K45A 1O8SA 4MZUA 5ABJC 1UPIA 4FPFA 3TN93 2VD7A 1IG3A 5F3CA 1OKQA 2QVSB 1IQAA 3SCGA 5FZ9A 5B4NA 1YQ8A 4KMQA 1VBD2 4IETA 2PLV2 2ZGKA 2ZEZA 3VKLA 4RR3A 4H7LA 3AFKA 1QHDA 1JUIA 2C4XA 3ZSMA 1W0NA 1QXJA 2A73B 4AHZA 2YYOA 4CVUA 5F1RA 1C28A 4YM2A 4LT5A 2YZ4A 3G6JB 4XYXA 4KBZA 1K3IA 2WA4A 2JDUA 4LIUA 2Y26A 5FZLA 4IDZA 1VBB2 3OOXA 2WO1A 5FYUA 3BOPA 1W8WA 3D5OA 5T5LA 1FOD2 1K5MB 4Q0VA 4AHXA 4XDQA 4AEDB 2ZGRA 3ETPA 3K4AA 5IATA 1W04A 2W9XA 4LBMA 1C1LA 4RFT0 1JYVA 5AFBA 4LO7A 1QOTA 4DEVA 2C1FA 4OQ8A 4RHV3 4RGKA 4RFRB 1W9WA 2LW8A 4HETA 5DUUA 5ISLA 5GLZA 3F2ZA 2JJ6A 1NAEA 2AACA 5FYMA 2GALA 3D82A 4CEWA 1AYN2 4ATFA 2VVDA 3AMHA 1V6MA 4LKEA 1W2UA 5DDJ1 5A7WA 4R9CA 4RGAA 1FV2A 4XFAA 3ZFFC 2WZEA 4B4RA 3BIEA 1NY71 2ID4A 4YRDA 4DRRA 4EZ4A 4F83A 3T0BA 5JOXA 4LE4A 2RHPA 4DRVA 1WMEA 3OBZA 1S2EA 1NXD1 1V6IA 1XNTA 4PLOA 5FZKA 1GZWA 3JD71 3SQOA 3ZXJA 5FO7B 2OQ6A 2XQXA 4RR3C 4IEWA 3OGRA 5IVVA 2WS91 5FMOL 5H9RA 4AI8A 4CEYA 3AP6A 1AYM1 2P34A 3ELNA 2Q1FA 1MS0A 3L2HA 1LHNA 2FDKA 2VGDA 4Z07A 3B9CA 5F3EA 4CDXA 4E4DX 1K5JA 4Q4X2 2TNFA 2ZX1A 4HVRA 5C3OA 4QKBA 2J1RA 4UFHA 2ZACA 3VZOA 1S0FA 3I3QA 1P8JA 4AVSA 5JZGA 1ASJ3 2ARXA 2XJSA 3H1WA 1JZ2A 2JG8A 2Q0AA 3EYPA 1NA1A 3F95A 1RUG3 1G9FA 3ZYPA 1TNRA 1H2MA 3WG3A 4CP1A 5C3PA 2QQWA 3OBTA 2BWCA 4MXVA 2PA7A 5A7NA 4N53A 1O91A 4UFLA 4QHOA 5IWFA 2JXAA 3VKFC 3OPZA 1RUI1 5JI9A 4HFSA 3V56A 4FCAA 1Y4WA 1UMHA 4GXLA 4WVWA 3THDA 1W2TA 1YJKA 4FPHA 4G4FA 1ZM1A 4CEWC 3OPTA 1OXCA 1RUF2 2Q8CA 3W59A 4C0HA 2D6KA 1HQWA 3POWA 3I3EA 1EY2A 4YPJA 2JE8A 3RI9A 5EV7A 2DYCA 2VZRA 1YUDA 4XZPA 3VBOA 1V00A 3KQRA 4FVVA 4L99A 4UT5A 5IUQA 3WW3A 1UYXA 1UD1A 4XHBA 3BUCA 1AR92 2HEVF 1OA4A 5APAA 4BQXA 4AAXA 1KJLA 2HWE3 1UXXX 2W2IA 3D3AA 3Q8EA 4LO6B 1VB4A 2QUOA 1W6OA 4J25A 4CEYC 1U5ZA 4J6GA 2WQ8A 1YJLA 1O3QA 4XQDA 1CJDA 5T3NA 4CZSA 4CDXC 5IK4A 2VMIA 1BEV2 1GQPA 1QJX2 5KXCA 5FY4A 4AR2A 1JYCA 5C3RA 5C7GA 4FFGA 1ZBE3 1OLME 5HCFA 3ZIWA 5JZGC 4A7ZA 5FY5A 3CJXA 5A3UA 3FHAA 2JG8C 3FWEA 1AR61 1NA1C 3KF3A 2QDNA 3W21A 4EE2A 1HB1A 2JDKA 4FPJA 3B7MA 1XRUA 5FZ4A 3KD4A 3PUHA 4IQPA 4E4ZA 4N53C 5FP7A 4NO4A 4Y4YA 2OPKA 4IV1A 1TME1 3I54A 1ALYA 3KMHA 1PO22 4JQRA 5GJ6A 3U1XA 4XJ9A 1G9DA 2B45X 3S0MA 2DCTA 3SXWA 4BA6A 2P37A 5FZGA 1UKRA 4N43A 1MPXA 1RUH1 3HNBM 2A75A 3K46A 2WFF3 2ATFA 3TYJA 3VBOC 1A34A 3AMNA 1OC1A 4UFJA 4AEKA 1RVF3 2VNRA 5GZDA 2CL2A 4AGGA 5KXBA 2J1VA 5LRRA 3AXDA 3ST7A 4H55A 4F3JA 1W39A 3R4UA 4AVAA 2C6SA 1XPWA 3UL2A 4HPKA 1FYUA 4EWDA 1BLZA 5CKQA 5CVRA 2MHFA 3H42B 4X8NA 1EV13 1W99A 3MLLA 2DBNA 5BNOB 3M4FA 4AI3A 1ULPA 4XEZA 3ILRA 1SLLA 2XGXA 3N9LA 4K7JA 4FQ4A 4HLTA 2B8MA 2WABA 3A4UA 5FPVA 2OA2A 4U36A 3IDBB 2W3JA 5HCBA 3EJKA 3P5BA 5HPOA 4JDNA 4P9IA 2QCSB 1X9TA 4XHXA 2GNDA 2VOTA 4PHZA 2B7YA 3T0AA 1HRI2 3O7OA 2R1DA 1OH3A 2VPVA 1XNCA 1OMIA 3CZJA 3ZXLA 4DIQA 1JYTA 3ZYBA 3I3DA 5H9SA 1UZ0A 1SZBA 2QDRA 1EYBA 2DTWA 2VQUA 3D0JA 3VZLA 3ZSEA 2W94A 4META 4ZKTB 5LZ6A 1OVPA 4IV1C 1MQTB 3CKHA 1R1A1 5DG1A 1VRH2 2JIGA 1JYXA 1J58A 1VBE1 4ONUA 1SLCA 1SHWB 5IVEA 4JHTA 5SV8A 2Z69A 4N43C 3NKTA 4XIOA 2YV8A 2RS32 4MLOA 5DUXA 3USUA 4DY3A 2BVVA 3N4MA 1UXZA 3M3CA 1XU2A 1DGRA 1A3KA 1WA4A 3OSDA 5IJRA 4WM8B 4LA2A 3RJRA 2AGSA 2ZPXA 1DBNA 3CL1A 5DDJ3 2KR2A 1PVC2 1LESA 3H9AA 3GBWA 4XUQA 1VPHA 4JKMA 3KVBA 4MV2A 1JYWA 4K1ZA 1UOJA 4YWAA 4XDPA 4D69A 2BOIA 3ES4A 3JD73 3VD4A 3AMMA 4HXCA 3BTXA 5IYYA 4Y22B 1ZA4A 3VHRA 2UU8A 1GWLA 1CWPA 1GV9A 4I0AA 1MR5A 3TEXA 3I2FA 3VBSB 1UF2C 2WS93 4XJWA 3RZMA 2DCJA 2FDFA 1AYM3 5FYSA 1VBC2 3WQ7A 3ZXDA 5DAQA 5CIRA 3O1PA 2Q1MA 1W6PB 3HNMA 3A21A 3WW2A 5A3MA 1YIPA 3LDRA 3N9MA 3H7JA 5DZGA 5KXEA 1QJU2 4KWKA 3KSCA 4HVOA 2JIJA 4KL1A 3HBKA 3N7KA 3S30A 2DCZA 4FTBA 1OPOA 4PI0A 2RJ2A 2JDYA 2Y64A 5A32A 2V72A 1UL9A 2XJVA 2XVGA 5T5OA 4CTEA 1AL0G 1I1EA 1UU6A 4OI2A 2YFUA 3PU8A 1WCSA 1YEWA 2LTNA 4GMP0 4MGZE 5HCAA 1IOAA 4UI9L 4Y5TA 4XPVA 2GNTA 1E57A 3P3NA 2BWAA 3POFA 2NMOA 1RUI3 1RMU2 3AP7A 4QX2A 4LHSA 5F5QA 4OFGA 5I0DA 2PMWB 3QOPA 3MLKA 4AI2A 1I3HA 1CGPA 3UESA 1ZVFA 1WD4A 1PGL2 1J1TA 4GQ7A 1I9RA 2JDHA 2RJLA 1KXGA 2BYVE 2OXBA 4B7KA 5EJ3A 5B4XA 3JU9A 1Q5OA 1XE0A 1LGBA 2CWSA 5FZ7A 2VTFA 1EUUA 1OSGA 4LLOA 5LBBA 3OJBA 3AK0A 4P9JA 3M3EA 1XNAA 2XJRA 3J8F1 4UWDA 4Q5OA 4NHXA 4GULA 4A42A 3O1TA 5FDBA 2VCAA 4CDQA 1UO9A 3S57A 1HV1A 5EIYB 1HIXA 4PDWA 4MADA 4IW3A 1DDLA 3HIFA 3WY6A 1NCRA 2ZCWA 4DZGA 2WO2A 1RTVA 2CDPA 3WG4A 1BK0A 4TLGA 1H8TA 2W47A 4Y26A 2DCYA 3ZMOA 3DECA 1SFNA 1ZBA2 4R9AA 4ZS3A 5C8CA 3UJOA 1CAXB 1GYKA 3R4DB 2R041 4JGZB 4L97A 2VZOA 3ZFGA 3QH6A 2E7AA 2JD9A 4AVCA 3KLSA 4GH4C 3OBRA 4JGYA 1LJ7A 3B3QE 5E89A 5IVBA 1AR63 3KCCA 5BNNA 5FZCA 3KGLA 1NE6A 5G05L 4S2HA 2DVAA 1S0BA 3LB9A 3BU0A 2WNUB 5I0TA 5BV6A 1R081 2F4LA 2VCMA 2VMFA 3K3NA 4NMIA 1V70A 4YGEA 2BDRA 4I3PA 1KRIA 4M00A 1TME3 5EWSA 1JUHA 2RM22 5J98B 1ZZ9A 3JQXA 5A6XA 5JDBA 2FQPA 4QD2A 3WV6A 4LMFA 1Q56A 1ZX5A 1ND3B 2AYHA 2LS6A 4QPWA 3N9NA 3Q9OA 1IPSA 1RUH3 4ZU4A 3UGHA 5FYCA 5FQ0B 1RUD2 2HWB2 1PIV1 1L7LA 1OT5A 2QTWB 4KNCA 2XL9A 4Y1ZA 3UKVA 2A6WA 4GWJA 1TZOA 3OD4A 1FATA 1XOYA 4HONA 3VB9A 4CDQC 2G9FA 1SCSA 5DUVA 1LGNA 4Q26A 5L9BA 4PDWC 2YU1A 1NCRC 3HR9A 3LGRA 2VMDA 1OURA 4IE6A 1H8TC 2BBAA 1VBD1 3HQRA 2CAVA 2OKXA 4AI0A 5C8CC 5FP3A 4CE8A 3NNMA 2EAKA 5FAXA 3WT3A 3ZFGC 3MLJA 1ULEA 2ZTNA 4E27A 1K12A 2WUHA 1GNZA 1PGW2 3DYMA 1CVNA 2V5YA 4JGYC 4M4RA 4KWJA 4OHWA 4XAAA 4IGOA 3ZPYA 2GH8A 3V64A 5BNNC 2DBIA 4QQOA 4YZ2A 1UY3A 4V2WA 5FREA 2DVBA 2D6NA 3RI8A 5JLVA 4JDMA 1IGOA 2VO5A 1VBB1 1BXHA 4NIGA 4XIKA 3S7IA 3J26N 1YO8A 5FYYA 1HB4A 5K0UB 2IXLA 4QQPA 2DFBA 2WKKA 4Y4RA 1R1A3 1W9FA 1MS1A 1AL22 4WV8A 2R0FA 2ZGTA 1UAIA 2HKXA 1VBE3 3ACGA 1W6NB 1O4TA 3ASIA 4PBOA 3KCYA 2V4VA 3VBFB 2AEZA 3MUY1 1RGSA 2XWJB 4XUTA 2W1UA 1WW5A 2X29A 3PTYA 3N9QA 4CCEA 4A7YA 4JAAA 4HSLA 3PVNA 3POYA 4LPLA 2EXHA 2FDJA 1OOPC 2GMPA 2W1QA 4N7IA 3QLQA 5T52A 2WWSA 5JXIA 3ROUA 3CEWA 4FXKB 4K20A 3ZYHA 3MEPA 4F8AA 5FPUA 2B9UA 2RS12 5FZ6A 2SLIA 1NCQC 1MS4A 3ZYGA 4RQPB 2BBVA 1AX1A 1O7FA 4TZDA 2JD4A 4HSJA 1XXNA 1XBFA 2A6ZA 1LEDA 5KHJA 1YHFA 1YFWA 4K8FA 2BPA2 2PAMA 1IS3A 4Q4X1 1GOFA 3KCXA 5J37A 5LCWL 4YM0A 1AR72 5FYVA 1VAVA 2VUAA 2ZGSA 3WVJA 4ASMB 4DQAA 1JN2P 2ZMNA 2QJVA 2ZMKA 1WW6A 3I2DA 4QDSA 3M7AA 4BMEA 4YM3A 5F32A 1UW8A 4WM7B 4B1LA 4D7YA 4A45A 1J1LA 2FZ2A 2W52A 2W68A 1XU1A 4FP2A 4TLFA 4C0BA 1FXZA 3HOBA 1YXWA 3WDWA 2HEYF 1W8ZA 2ZKLA 1ZRDA 3DXUA 3OYWA 5CNAA 3VZMA 5T5JA 1IG0A 3JCIA 2CAUA 3Q8BA 5FY1A 4QPYA 3WNNA 3LAGA 4Z2WA 2WLPA 3OY8A 1ULDA 2Y6HA 3CQOA 1RUF1 5KC5A 1ODNA 5KHIA 5F9TA 4BQ2A 3LA3A 2TBVA 2R062 2Z4FA 4BIOA 2WC2A 1W8NA 2F6BA 3VDAA 1T6BX 1H9PA 5A3WA 4Y5Z0 3T2OA 3WNKA 4OZOA 5JXHA 5CFDA 1AR91 2HWF2 3N35A 1YIFA 1XYOA 4MYEA 4XUNA 4CU7A 1ZA7A 2VUJA 4JQTA 1W6MA 2ES3A 1LODA 3H3LA 3MF6A 4CU9A 2ZGQA 1POQA 3J8F3 2NPIA 4MHRA 2K9ZA 1VRBA 4LORA 3FHIB 1TMF1 1GKBA 1LOEA 2P1BA 1BEV1 1QJX1 1BJQA 4DUVA 4FPYA 1CX1A 3AL5A 2FZ1A 3OPWA 4FOYA 3FX3A 1YCIA 4NWWA 1BBT2 3SCHA 3UNPA 4MUVA 4Z8BA 3K2OA 4EV0A 2R043 2WZPP 3LQCA 4FO9A 1XC6A 3MICA 4MXWA 4NPMA 2HBTA 1MZEA 1VB2A 2Y38A 2JG9A 1EAH2 3RZLA 1WBFA 2D5HA 4AVTA 4OUMA 5KHHA 4MH0E 2UYAA 2DVDA 1JOBA 3EHKA 5FJKA 1L7RA 2BOJA 4NJ4A 5FPAA 2EA7A 4D6RA 1R083 1X50A 4QWNA 1G6NA 2BGCA 4YARA 1O5UA 1VE0A 5T54A 1X82A 2BZDA 1YFXA 2Y6JA 4QX3A 2Q8EA 1NX9A 2XG3A 5F6LB 1MS3A 2QQKA 5CFDC 5IHRA 2VUDA 5F5CA 1RYYA 4CDUA 5FKCA 1AXZA 1GWKA 5LATA 1T6GC 2DUOA 1PIV3 2VW2A 2VJXA 1OQEA 5C4WA 3M3OA 3P6BA 2GP5A 3RPQA 3U07A 3LKJA 3OGGA 5A1FA 4H7MA 3LDBA 3OYWB 2D6MA 4XDOA 1Q3EA 3PHMA 1RJ8A 4TWTA 3K4ZA 1DFQA 4YVSB 4BH9A 2ETEA 3RZJA 3FLTA 2X5IB 3ZMNA 3RSJA 1VBD3 1OLRA 2AEYA 2ZHLA 3SKVA 2VW0A 3ZPOA 4BQYA 3ZN4A 4MGSA 1U5XA 1Q8OA 2ORZA 4ZPIA 3ZSKA 5A6ZA 1HRI1 3NL1A 4GWIA 2W5FA 3FUQA 4NIHA 5C8WA 1DQ1A 2EF6A 4ARXA 5JOZA 2YUEA 4A7KA 3ITQA 2JE9A 4TTGA 2Y34A 4COWA 4FSJA 4PIYA 1EUTA 4BMBA 3KWVA 1VBB3 4O9GA 2Y33A 3B9IA 3PDQA 5IK5A 5JPMB 5FYTA 1XSRA 2BW8A 5CKMA 4FT8A 5IVYA 3WCSA 4N9IA 4XJZA 5JOYA 3ZFEB 3LCPA 1H2NA 2WN3A 5F6KA 1F9KA 1PMIA 2RMU2 3PVEA 1CAVB 1HV0A 3NW4A 4HN1A 4Q4V2 1LNSA 3VBUC 4B1MA 2DURA 1R091 3TBDA 2OW4A 4CDUC 4YSFA 2F4PA 2YGMA 5C4WC 3HWJA 1U0AA 1AJKA 2YPDA 1PVC1 3H8XA 4D6QA 2WNVB 4FPEA 2W92A 4B3NA 2JG9B 1PM4A 4GA9A 5I0RA 1D4M2 4D7SA 2QZ2A 3WP5A 2JE7A 1IHMA 2QQVA 3NRUA 4IEPA 5KC6A 4X6QB 4DINB 4O7XA 3RYPA 5BY5A 2DDUA 2XJUA 3THTA 4BWOA 4ORFA 1VBA1 1GANA 3ZIXA 2ZAHA 2YBSA 3CJIB 4IV3A 4OLLA 3MUZ1 1V9U2 5EPAA 4EN0A 4RL7A 1W3VA 3SITA 4AXOA 3VDDA 4EJRA 3I2HA 4FP3A 1W2AX 1HRV2 4QT6A 4NOTA 3SH4A 1LHVA 2Y6LA 3WG1A 5F37A 2Q5TA 4Q4X3 3I8TA 1ENQA 4HL0A 5CEHA 1QJU1 5FR3A 4WVMB 2DWRA 4CP9A 5FY9A 3IT8A 3U37A 3KB5A 5FIXA 3POGA 4COZA 1Q8PA 2HYKA 2W08A 4MO3M 5ACA1 1JYNA 4W50A 2VBPA 1QF3A 3I3BA 1S2BA 1BZWA 1AZDA 2D6OX 4HK9A 3RGBA 1WD3A 3B01A 2FCTA 5JPNB 5A3OA 2PXJA 4PLMA 4AEDC 4UAPA 4XTMA 1DZQA 1NKGA 2WQZC 1CAUA 2HWC2 3FFZA 2JB8A 5L9RA 3VD9A 1ZRFA 1RMU1 3PLQA 2XMLA 4P14A 3ZXEA 1XE8A 2KA3A 3DYPA 4CA9A 1NOVA 2G4IA 2LRPA 4GZ9A 5E8AA 5A3TA 5JR2A 1KS4A 5JIAA 3T2QA 1RUF3 2R30A 4EN7B 1PGL1 4FPCA 1XQNA 2VE1A 1DHKB 4UOJA 5ABJB 2YMZA 4V1PA 1GP4A 3VV1A 2J1EA 5FKBA 2GDFA
chains in the Genus database with same CATH topology
1WCDJ 1UPSA 3FBMA 2WLQA 4IEXA 4IL7A 4M3CB 3ILFA 3SH5A 1SFYA 2Z2SB 1AR93 2QKDA 4Y20A 2ZZJA 3U10A 2GMEA 4IV3C 1H9WA 4CP0A 2ZGOA 4DFSA 3D6EA 3VDDC 2FHRA 1HQLA 1S2KA 5TSWA 1TMF3 2D6PA 4OHZA 2TUNA 1ZBA1 4YLZA 1QJX3 1CX4A 1S1AA 1V6OA 3VKMA 2A71A 5FMOS 3V65A 2CGOA 4OHVA 4HK8A 3WNXA 1COV2 1GFF2 2CGNA 3WP6A 4LBLA 4W6YA 3BU7A 3AP5A 3LSDA 3S6PA 3HMYA 4I09A 1MS8A 4OVEA 4K3UA 2Z5WA 5FBZA 4YW4A 1WW7A 4CDWA 2A5ZA 1BMV1 1SBDA 5I8SA 3MIDA 1UN1A 4EN8B 1JXNA 2ZHNA 3P3PA 4QPIA 4TSVA 3ZFFB 5KHKA 2RM21 5FLIA 2PYTA 4AGVA 4COUA 3BALA 3V0BA 4YNIA 1WLDA 2WZR1 3R4SA 5GKAC 3PMEA 2D6LX 5FPZA 4HKWA 1CPNA 3VHOA 3TN92 1FV3A 2GC3A 4RR3B 2C0ZA 1QKQA 4Q4Y2 1DGWX 4GKXA 2A7AA 1QJY1 2BFUL 1HXS2 3K51A 1M4WA 2OUJA 3LZZA 1YFUA 3B69A 4FXGB 4B8EA 2H0BA 1CAWA 2DVFA 2NN8A 5GALA 5AFEA 5JSPA 4IESA 4D7TA 4PF5A 1WW4A 3WUDA 1C57A 1SBFA 1FI2A 4HVQA 1W0OA 3AKPA 3AJYA 3AZYA 3I59A 1OLQA 1HRI3 4NPRA 2NYYA 2XBO1 3NO8A 4J1XA 1WCKA 3RS6A 5EZWA 1SLTA 5L7OA 3JQWA 4I30A 5AC92 4CDWC 2ZZQA 4ISRA 1TEIA 4RHV2 1PK6A 3WDUA 4F7ZA 3HT1A 4CEWB 4LEJA 4QPIC 1AL21 4H14A 1V6NA 3E97A 1S0DA 3BPZA 1Q43A 3INAA 3ILNA 1N1TA 4ITCA 5C33A 4DNYA 1GZWB 5LEJA 1RUC1 1NLSA 2ZABA 2VH9A 4E2QA 4KBBA 1R093 4CEYB 2MEV2 1H4GA 2UURA 4LUKA 1ZREA 4W6WA 4CDXB 4XW3A 4P5HA 1PVC3 3USSA 3ZXDA 1WLTA 4GMP1 4P9GA 5FLHA 1KFUL 2RS11 1O4ZA 5JZGB 2JG8B 3X29B 1JBCA 1NA1B 1LCLA 4HANA 4BQ1A 1VBA3 2W0XA 3V0BB 1ASJ2 5L73A 3PMSA 1C8NA 1RUG2 4N53B 1KD7A 1VALA 4PLNA 5L7OC 4M01A 1ENSA 2DU0A 1YNAA 3N3HA 1PK6C 3N7MA 1QJU3 5FOBB 2DTYA 1DG6A 2UWCA 4I0BA 1GZCA 4Z92B 5DXDA 5ACA3 4LR4A 4HKOA 3ZYRA 3V0AA 3U0ZA 2GZWA 5JI7A 4BM8A 3VBOB 4K40A 2DUQA 1M06G 2ZA9A 3JB8A 3DPRA 1H4HA 4YM1A 5CG8A 4PIZA 4DY5A 4LBOA 2WL1A 1NQDA 1RMU3 1W6OB 4ES8A 1MVEA 1RC6A 1Z7S2 2CGPA 3UV9A 4IEUA 1BCXA 1LULA 1OFSA 5JIUA 1RINA 1LHUA 2C9AA 4XJAA 3ACLA 2WT1A 2D3PA 1ZYBA 1POV0 3CU7A 5DZFA 1OI6A 3H1YA 2WSVA 1ZBE2 1ZZ8A 1NZCA 3GHNA 2DVGA 3WDVA 1DQ6A 1RUNA 4XFCA 4DMIA 3FJSA 1RUJ1 3K48A 3VZJA 1OA3A 1C8M1 2Y0IA 4IV1B 1BBT1 2RJKA 3GYDA 1ZBA3 4P9WA 3ZX7A 2D3RA 4FPLA 5LEKA 1FNYA 4WVVA 4GB32 1OPMA 2HWD1 4LO8A 4N43B 4OHXA 3B93A 2A3WA 1X33A 1O3TA 3BB6A 1C4RA 1QOOA 2QNKA 4JVAA 4RGGA 2WFF2 3FZ3A 2B39A 3DPRC 4XTPA 1U5IA 2PQQA 4HPKB 3TNQA 3ZXAC 5FO8B 3GBGA 3WW4A 2EVXA 4GH4A 2IXJA 2X53S 3M2MA 3MIGA 4GWMA 4ASLA 2RM23 3OTFA 2DUPA 2EALA 2ZGPA 5FRAA 4C91A 2WZR3 1RUE1 2K2SA 4NN0A 3FFQA 2GH2A 1PNFA 3LA2A 5IT6A 3AM2A 1A8MA 3AZVA 1HLCA 2NZ9A 4MSVA 2O8QA 2YROA 2JICA 3DV8A 1QJY3 1XNKA 4IXLA 4YYOA 3ZVXA 3ZDSA 1SQ4A 3AYAA 5GZGA 3EO6A 1BQPA 3VLBB 1O3RA 1IZ3A 3D8CA 5A33A 5LK5A 4LHLA 3NJZA 4D94A 2RS52 4E2SA 2GC0A 2CNAA 1U5YA 2VMGA 4RA0A 3PVOA 2OVUA 1PO12 5J09A 2OZ6A 3VL9A 4NHKA 3CO2A 4JGZC 1W0PA 1N3PA 3USUB 3A0NA 3VBHA 3M1HA 1L3JA 2XBO3 1B35A 1VR3A 1N3OA 2OUHA 4HBNA 5CG9A 1BYHA 1FMD2 1MEC1 2E7QA 4XE9A 5CU1A 1YYNA 1W6QA 3CF6E 4E4SA 3HQXA 3IKWA 5C9AA 3EXUA 1ND2A 2PHTA 3JUUA 5EFUA 1UU5A 1S0GA 5D1IA 3ECQA 1RUC3 1ND3C 3AX4A 2FMDA 1QNYA 2ZGUA 2C5DA 2VNOA 2AREA 2QFEA 4M0NA 4UBHA 1KJRA 3NV1A 4G3YC 1SBEA 4L8QA 3SNMA 4E9KA 1N47A 4GMP3 1RIRA 1C5HA 2RS13 5A32B 3WXPA 3MFCA 1D0HA 4AVVA 1FX5A 2GC1A 1OOPA 4XF0A 1HRV1 4N9HA 3AP9A 4Y1YA 2E9QA 3M8LA 3QACA 3VBHC 2VULA 2SBAA 1REEA 1B35C 1LGCA 2PLV1 1QJZA 4KGQA 2BUKA 5GLVA 1NCQA 5HI0A 3WZ1A 3IN9A 2PELA 1S0JA 3MI8A 4QU2A 2PHXA 4JRAA 2WFPA 4CRQA 1RUI2 2YDEA 5C9AC 1J59A 1LEMA 5J3UA 1AXYA 3RZZA 1IPKA 2WJSA 1ND2C 3THPA 2ZX3A 5FFOC 3MIBA 3R05A 3ZN6A 3AKSA 3MW3A 3NAPA 4ATEA 1FOD1 2G9GA 4INDA 4CDQB 4Q1PA 5T50A 4PDWB 4KU7A 1NCRB 3JZVA 4LHKA 2GC2A 2Q8OA 3TOJA 1KITA 2VG9A 3LA7A 1H8TB 4ZU7A 3MDPA 5C8CB 1JW6A 4AI1A 2CTVA 3ZN5A 3VGIA 3ZFGB 1AYN1 5SV5A 4GKYA 4JGYB 2VOKA 3WDTA 4EROA 5BNNB 2CY6A 2X8KA 3AP4A 1RUOA 1DIWA 4LBKA 2ZS6B 2WT0A 2PHUA 1WBLA 2A6YA 1AR62 2Q30A 1HKDA 3KGZA 4R9BA 1G9CA 1RUJ3 2IZWA 2XLAA 1V6LA 3ALQA 1ZZ7A 1ENRA 1C8M3 2YXSA 3IMNA 5EXOA 1BBT3 4GIQA 1COV1 5I91A 4L9BA 3W58A 3DL3A 2V09A 1C1FA 2HWD3 3KS7A 3RRDA 1Z78A 5T55A 4EWAA 1TQ5A 1F5FA 3NAPC 1RUH2 2JENA 1CESA 4WZCA 5J96B 2RR12 4QPGA 1FAYA 3UKNA 3IPVA 4KQ7A 4U2AA 4B4PA 5BNPA 1LR5A 3OCPA 1X8MA 1Q8VA 2I07B 4AFBA 1VP6A 5BUVA 1RUE3 1FNZA 3MIEA 4Q4W2 4Q4Y1 4A3XA 3PVBB 3A0KA 2ZGMA 2I74A 3OF1A 3WQ1A 1HXS1 3BCWA 3WDYA 1IKPA 2VOWA 3PJQA 4XFBA 1IKQA 2ZKNA 1UU4A 2IFRA 1UZYA 1GBGA 2CWMA 2PN5A 4JTOA 5JR7B 1LOAA 1H30A 1UIKA 3KT4A 4YGDA 1D4VB 1O5LA 5CBLA 4K21A 2IXIA 4LTAA 5GZFA 1HDKA 3JBG2 4AFAA 3RMYA 1VJ2A 3BOWA 3O0XA 3WUCA 2P2KA 1MZ5A 3SMHA 2D5FA 5H9QA 5E16A 3VBRA 4OI0A 2ENRA 4M0HA 5AC91 1JTZX 1VBE2 4X8PA 2EXIA 5D8AA 4IEYA 2LM3A 4QPGC 4S2DA 2R32A 1MEC3 4YVWC 2QE3A 3WX5A 2R072 4AE2A 5E88A 5BNPC 1ENXA 1QQP2 2PAKA 3RG0A 1ZZCA 4QQLA 2IXKA 5CADA 1AXKA 2NQYA 1WLWA 1XE7A 5HXVA 1QGLA 3WDXA 3S7EA 3VN4A 4OI4A 2D7FA 1PO21 2MEV1 2O1QA 3WG2A 1GLHA 2XB6C 5CFCA 1S55A 4Y24A 2AH2A 1F8VA 1U12A 1QWRA 2NMNA 3VBUA 4E2GA 2R16A 4LBQA 4L11A 3JB4C 3KT1A 4W65A 2UYBA 2E53A 3H3UA 4RS5A 4XQWA 5K9YA 1Q8SA 1HX6A 1ASJ1 1LOGA 1XNDA 4C1WA 4MX3A 3VBRC 4I0WB 3SCFA 1HRV3 3MZHA 1F5JA 4UW5A 4GWNA 1NQJA 5D8AC 3OY8B 2PLV3 3WW1A 5FOJB 2KXLA 3UJQA 5KHGA 2DFCA 3AYEA 4XXAA 5I0SA 3NKGA 1NXMA 4QM9A 4DOUA 2P3JA 5CFDB 2BNOA 1RHI2 1DZTA 1H1IA 2A6XA 1CQ9A 1W6MB 5I8TA 1V6KA 1VRH1 2NLRA 3OGJA 4JC1A 2OYZA 1FOD3 2A70A 2PFWA 5CFCC 1Z7S1 1IS4A 3ZXFA 3J8F2 2RS31 1ULGA 1K5MA 1GICA 4AEDA 2P3KA 5FLJA 5DUWA 2WNVC 2ZGLA 3N7JA 1S0EA 3O14A 3B94A 2HEWF 1BKZA 4XETA 2ZOEB 4RS5C 4YG6A 1X8EA 3AMQA 1AYN3 4XXPA 1GSLA 3TWIA 4B29A 4MXWB 3AB0A 2R042 4NR1A 1F31A 4LHNA 1C3HA 3AXEA 5DG2A 3AYDA 4URTA 4LBNA 2ZBJA 2XPJA 4M3CE 4RD7A 1BVP1 4EN9B 4MGIE 1O4YA 4SBVA 4K9SA 4GB31 4BE3A 3RYRA 3VHPA 1O3SA 2OIIA 1COV3 1ZRCA 3J4UH 1VBC1 1JHNA 3VBUB 3UK9A 2XVLA 4M3CF 3FUOA 3T2TA 4B4QA 4CDUB 4R4XA 2WT2A 2Z42A 5I8YA 2A3YA 5C4WB 1PNGA 5JPMB 4Z1VA 4IEQA 5J36A 1GR3A 3IDEA 1PIV2 1REFA 5L19A 1H2LA 2VW1A 3E5UA 3QH7A 1FPN2 4MGYE 1K5MC 3WCRA 3WOGA 4AEJA 4COYA 3AFGA 2BTVC 5KWRA 3M3IA 3GALA 4DB5A 5IK7A 2A3XA 1AR82 2GSYA 1N3QA 4Q4Y3 4N7UA 3H0OA 2ERFA 4FOQA 1HXS3 1QH7A 2CV6A 4PIXA 2R1BA 3AYCA 4HZFA 2H6BA 2RS51 1LU1A 3MF9A 3FMGA 1PO11 5DZEA 4P9LA 1DGRN 1Y43B 4JDOA 4Q1RA 3GNEA 3M3QA 4PBPA 4YG0A 1SLBA 5FO9B 1BEV3 2XWBB 5AC93 1UZZA 1FMD1 3AKQA 2ZX2A 3AJZA 5AVPA 2DU1A 4AQ2A 1RL3A 1XNBA 4IEZA 4D3WA 4FOVA 5JWPA 2YPJA 4YW2A 4XILA 3B00A 3DN7A 2P3IA 4UW3A 4IV3B 2DF7A 3O0VA 4ZU5A 3DUIA 1SDWA 1PO23 2MEV3 3VDDB 3ZXKA 3L2YA 4LUMA 2O0OA 5A3LA 3VUOA 3GZTB 4LNVA 1RUD1 2HWB1 2BEOA 4LA3A 2WA3A 1CJPA 4XOGA 3FLPA 2XL7A 2VU9A 3RNSA 2BFUS 2BVBA 1DQ2A 2EAAA 1QU0A 3GZUC 3IDCB 4UW6A 4YW5A 4GALA 2A6VA 4AW7A 2QZ3A 1LU2A 3MW4A 1CAUB 4L2NA 3LSEA 5LRSA 5BNOA 3HD8B 4O9EA 4OZXA 3NV3A 4YZ3A 2E7TA 1POV1 5HBAA 4C1XA 2DCKA 1PGW1 5JCTA 4Q8LA 4C90A 3GHMA 3HT2A 1ZZ6A 4Y1VA 4BLJA 4Y20B 4JV4A 4QGNA 4YG3A 1HQNA 1SMVA 2D98A 1MVQA 2I2SA 1QDOA 2WSUA 1VRH3 2GN7A 1H8VA 1UX6A 4W6XA 2B5HA 2WIIB 1MQTA 1Z7S3 3HN1A 1UKGA 1H0BA 2RS33 4FPOB 1OHFA 1DQ0A 1UIJA 3PJYA 1QXPA 3ZSLA 3IIAA 1TMF2 1D2QA 4IERA 4WBBA 1KS5A 1H1AA 2IFWA 2GNMA 1IPJA 3AZWA 3KT7A 1UCXA 3VZKA 4ZXKA 4J1WA 4R9DA 3QCWA 2VQAA 4WM8A 5FPXA 1G9AA 4YZ4A 4CDWB 4AFMA 2ARBA 4KU8A 2D3SA 2W39A 4QM8A 5BNOC 4XBLA 4XFFA 1DF0A 1N1SA 3KZ4C 5IK8A 4QPIB 5K7PA 2D93A 2GN3A 2XVKA 4BYYA 4GB33 2UWBA 1D2SA 1WMDA 4FTEA 4Y22A 2UY9A 1VBC3 4QQHA 4YFWA 4Q0PA 1EP0A 5GZCA 1AR71 3VBSA 3AKTA 5LK7B 1JH5A 3MIHA 2RR11 3WP3A 1W6PA 4AHYA 1OA2A 4BIFA 5KBFA 2IC1A 4LO5B 4MGKE 3LWCA 4KGGA 4FBFA 4PJYA 1MQTC 1TE1B 1OQ1A 1G86A 3NVCA 1CAWB 1UMZA 1XYPA 3TNPB 2YC0A 4Q4W1 3ME2A 3RJ2X 4CYDA 4XJ8A 1KDMA 5J7MA 1LHOA 4YFZA 2D44A 4XBQA 2Q1ZB 3I59B 2R061 2HWE2 4YGBA 2ILMA 1LB2A 5T5PA 4WM8C 5L7OB 2HWF1 3ZYIB 2XKOA 1LOFA 2ZAAA 4XF3A 1PK6B 3HBZA 1G8WA 3JBG1 5JMCA 3QBQA 1AHSA 2RS53 2ZHMA 5JVVA 2E51A 3H3ZA 3RDIA 4XFIA 1G7YA 1VIWB 1PO13 4AFDA 1NLRA 2VMHA 5BXXA 3VBSC 1N1VA 2ZGNA 4AFCA 4OULA 3D4KA 4AQ6A 1QY4A 1FMD3 5C6CA 2GAUA 1R092 2R071 3U11A 1CAXA 3AZXA 2FMYA 1QQP1 4KWLA 4JGZA 1FT9A 1GZ9A 3DF0A 1EAH1 2UY8A 3MIFA 3GZAA 3WQ0A 3H50A 2ET7A 1DGLA 5AVAA 4NHMA 4I3GA 4KG0A 3BIWE 3BTAA 4SLIA 4KG8A 1RVF2 1URXA 4NWVA 3HAGA 4JCKA 3N36A 2WNUA 2HJIA 1PZ7A 1VBA2 2JDZA 1EV12 1BK1A 2EIGA 4YZ1A 2BNMA 3RMXA 1LOFC 1YI7A 3R6SA 1Y7BA 3SISA 3VHNA 1RUD3 2HWB3 3M70A 1ND3A 1AVBA 4AGRA 4OHYA 4CP2A 3U4XA 4HMZA 2WINB 3FBYA 4Q29A 5FQ0A 3V0AB 4BHPA 1GQHA 3EQEA 3O12A 4YW1A 1VAMA 2VVEA 2V73A 5ACA2 4B7EA 1NE4A 1VAKA 2PHWA 4I01A 3DPRB 3AMPA 2GMMA 1GNHA 4Q27A 2ZX4A 5EYYA 1Y9QA 1POV3 4X6RB 1QMJA 3KM5A 4QX5A 5J48A 4BLIA 4UBGA 1ULCA 1RHI1 3FC0A 1A6CA 1CPMA 4Q2FA 3AZZA 4AQTA 4I02A 2AZ5A 1LECA 4S2GA 3VZNA 5JOWA 3OD0A 3IWZA 2WNUC 1AL23 2AR6A 1CR7A 3CNAA 4AF9A 5K0UA 2XHKA 3O5SA 4Q4V1 2RMU1 1BVVA 5DDJ2 2R6QA 1NY72 1RJ7A 1W6NA 4R4ZA 3TB0A 1Z0HA 4HN0A 1KDKA 4Q8KA 3VBFA 3JD72 2DV9A 4IEVA 4AEMA 3POSA 1D4M1 2WS92 3W9AA 5JSOA 1AYM2 4JTNA 4RSUA 4AHWA 5GM0A 1OFNA 4PCRA 3WP4A 2WQ4A 1V9U1 3ATGA 4GH4B 3E6CC 5CB7A 3C2UA 1BMV2 3LOIA 3RYKA 2ET1A 3NSTA 5GZEA 4RQPA 3TAYA 1AUYA 3G7DA 2PTMA 2IWGB 4K6BA 1LHWA 4Q0SA 1SLAA 2VY0A 1CONA 4YW3A 1S0CA 3NV4A 2WZR2 1AR73 4BPZA 4XQ4A 2K0GA 2XJPA 1LOBA 1H1MA 1EPWA 1Y3TA 2RR13 3L9JT 2NM1A 4XFGA 1FPN1 5K0UC 3ZYJB 1HW5A 5I0UA 3MGUA 2VOVA 2VVFA 2ZHKA 5KXDA 4WM7A 3PNAA 1AX2A 1QJY2 2H6CA 2HWC1 5A33B 1LKNA 1R1ZA 4Q0QA 1I6XA 1MZFA 1WMFA 2MNGA 5EYXA 3D0SA 3IBMA 2QQPA 1AR81 4Q4W3 4ISQA 3T1LA 3VBFC 1AJOA 3B5LB 1N1YA 3O0WA 4MVTA 2R063 1GQGA 3MW2A 5CAZA 3VBHB 4N90A 1PZ8A 1B35B 5JSRA 2D97A 5CA6A 2HWF3 1ZZBA 4Q0UA 1TNFA 2XBO2 3GBFA 3JBG3 1W6QB 3ENRA 4IEOA 5C9AB 3EBRA 2XLGA 3GF6A 1DYKA 1ND2B 4L92A 4BOWA 4DXZA 1A8DA 4OI1A 2EXJA 2VXRA 4RQPC 2XH6A 1PVXA 2XKPA 4KH9A 1LTEA 4BCUA 4YGCA 4PQ9A 3B02A 4QGLA 1SCRA 1CIWA 4DS0A 3H1MA 4QQ2A 4XJUA 2GU9A 1RUC2 1KQRA 3VKNA 1TME2 3E5QA 2R073 1DQ4A 1QQP3 4WM7C 3RWNA 1EAH3 1ZRRA 3E6BA 3CLPA 2RE9A 4FQZA 4HKLA 4AK3A 3NV2A 2JECA 2VNGA 4YVWA 1LENA 1OOPB 2O8OA 4Y1UA 2AUYA 1WLCA 1DQ5A 2D40A 3SHRA 1VLNA 2Q4SA 1A78A 4JRLA 3TN91 4AVBA 1NCQB 1AX0A 3RQ0A 1NG0A 3WHUA 1DLLA 1RITA 2NP0A 1DYPA 2UWAA 3H7YA 3SH3A 4I2OA 3E5XA 5K8SA 4HT1T 1F2NA 2XJQA 2XLFA 4UW4A 3ZN6B 1OD5A 4XF4A 2JKBA 3NAPB 4XF1A 4S2FA 3E6DA 2VQ0A 4P9XA 3WLUA 4AQSA 4YVSA 2YY1A 4XBNA 4QMAA 4H3WA 3ZXGA 2N7GA 2X5IA 2VECA 4DPNA 1YRZA 1R1A2 1LOCA 1PHMA 1CD3G 2BNNA 3WR0A 1KFXL 4Y1XA 2B42B 2IXCA 1PM7A 1APNA 1RHI3 4RHV1 2B46X 2P17A 4LBJA 3H8UA 3N7LA 3MFAA 2BQPA 2GNBA 1J3QA 1YI9A 1WUVA 4NHLA 4BZ4A 3ZO0B 1NYWA 1EPZA 4FOWA 4COVA 2E6VA 2MPFA 4XMAA 2JX9A 4Q4V3 2RMU3 5E1RA 3ZFEA 1V6JA 2Y0OA 2ZJCA 3R0RA 1RUJ2 1CAVA 2WNEA 1X7NA 1C8M2 2KM2A 3WHTA 3ZSJA 2YGLA 1DZRA 3FLRA 1Q8QA 1YFYA 3SLIA 4FAHA 1DU3D 5BNQA 3T1MA 2HWD2 4WZFA 2I45A 1D4M3 4FPKA 2WNVA 2LALA 4R8HA 2ZMLA 1IS5A 1DGWA 4FAGA 1ONAA 2AENA 4QPGB 5FCCA 4TYSA 4YVSC 1JOJA 4YVWB 3IPVB 1ULFA 2X5IC 1QNWA 1V9U3 5BNPB 1JYIA 4R52A 1RUG1 2FBEA 3FE5A 4K1YA 3CJIA 4AG4A 4LBQD 4G9SB 4P9YA 4ES9A 1SACA 1YLLA 2IXHA 3VL8A 1RUE2 1ZNPA 4LULA 1MZ6A 1YWKA 1D0GA 4WVMA 5BPXA 1X36A 5L36A 2PHFA 2H0VA 3NWKA 1OQDA 1FPN3 4Z82A 2JEMA 2PHLA 4OUSA 2HWC3 3ZFEC 1MS9A 3I7DA 3C3VA 2E63A 1AR83 5GLUA 2HWE1 1PZ9A 2LUWA 3VBRB 4AWDA 1QOSA 4QGMA 1CN1A 5BYNA 3I4IA 5ABJA 5D8AB 3DGTA 4EN6B 2XUMA 2VOXA 4WVZA 2EXKA 2JG9C 1S0IA 3QD6A 2TEPA 3MPPG 4FTSA 1ZBE1 5GLWA 1IS6A 4YZ5A 4LE3A 4M3CA 5FTTC 3ES1A 1AF9A 2PHDA 3URFA 1B09A 1RB8G 2PHRA 1I5ZA 3VKOA 1MEC2 5B2GB 3CJIC 4XF9A 3AKRA 4QXKA 1SEFA 3MYXA 1XYNA 3ETQA 2D43A 2CYFA 2PAEA 3BODA 5CFCB 5H9PA 3WINE 4UXAA 2R49A 5GLTA 3APBA 1QXRA 1R082 4A2UA 4EWEA 1WGPA 1MACA 4AYUA 3LOBA 4FPGA 1J3RA 1J3PA 1G9BA 4XFHA 1C5IA 1QH6A 2R0HA 4LBQB 2WFF1 3J9SA 2YHJA 1RVF1 2Z79A 1H2KA 4RS5B 3UKTA 5JAXA 3MPBA 3WD5A 1MS5A 1SLIA 3TRSB 3IM0A 4LLFA 4QHBA 4LO4B 1EV11 1LRHA 1PGSA 2XJTA 3ZFFA 2OZJA 1REDA 2ZX0A 4NVPA 4XMIA 1QDCA 3DKWA 5ABJC 4MZUA 1UPIA 4FPFA 3TN93 1OKQA 2QVSB 1IQAA 3SCGA 1VBD2 4IETA 2PLV2 2ZGKA 3VKLA 4RR3A 4H7LA 3AFKA 1QHDA 1JUIA 3ZSMA 1QXJA 2A73B 4AHZA 2YYOA 5F1RA 4LT5A 1C28A 4YM2A 2YZ4A 3G6JB 4XYXA 2WA4A 2Y26A 1VBB2 3BOPA 3D5OA 5T5LA 1FOD2 1K5MB 4Q0VA 4AHXA 4XDQA 4AEDB 2ZGRA 4LBMA 1C1LA 4RFT0 5AFBA 4LO7A 1QOTA 2C1FA 4RHV3 5DUUA 4HETA 5GLZA 2JJ6A 2GALA 3D82A 4CEWA 1AYN2 4ATFA 2VVDA 3AMHA 1V6MA 1W2UA 5DDJ1 4R9CA 4RGAA 1FV2A 4XFAA 3ZFFC 4B4RA 1NY71 4YRDA 4DRRA 4F83A 5JOXA 4LE4A 2RHPA 4DRVA 1WMEA 1NXD1 1V6IA 4PLOA 1GZWA 3JD71 3ZXJA 5FO7B 4RR3C 4IEWA 2WS91 5FMOL 5H9RA 4AI8A 4CEYA 3AP6A 1AYM1 2P34A 3ELNA 3L2HA 1MS0A 1LHNA 2VGDA 4Z07A 3B9CA 4CDXA 4E4DX 4Q4X2 2TNFA 2ZX1A 4HVRA 2ZACA 3VZOA 1S0FA 4AVSA 5JZGA 1ASJ3 2ARXA 2XJSA 3H1WA 2JG8A 2Q0AA 1NA1A 1RUG3 1G9FA 3ZYPA 1TNRA 1H2MA 3WG3A 4CP1A 3OBTA 2BWCA 4MXVA 2PA7A 4N53A 1O91A 2JXAA 3VKFC 3OPZA 1RUI1 5JI9A 4HFSA 3V56A 4FCAA 4GXLA 4WVWA 1YJKA 4FPHA 4G4FA 1ZM1A 4CEWC 1RUF2 3W59A 4C0HA 2D6KA 1HQWA 3POWA 1EY2A 3RI9A 5EV7A 2DYCA 1YUDA 4XZPA 3VBOA 1V00A 3KQRA 4FVVA 4L99A 5IUQA 3WW3A 1UD1A 4XHBA 1AR92 2HEVF 1OA4A 1KJLA 2HWE3 4LO6B 1VB4A 2QUOA 1W6OA 4CEYC 1U5ZA 4J6GA 1O3QA 1YJLA 4XQDA 1CJDA 5T3NA 4CZSA 4CDXC 5IK4A 2VMIA 1BEV2 5KXCA 1QJX2 1JYCA 1ZBE3 5HCFA 3ZIWA 5JZGC 4A7ZA 3CJXA 2JG8C 3FWEA 1AR61 1NA1C 2QDNA 4FPJA 3B7MA 1XRUA 3KD4A 4IQPA 4E4ZA 4N53C 4NO4A 4Y4YA 2OPKA 4IV1A 1TME1 3I54A 1ALYA 3KMHA 1PO22 4JQRA 5GJ6A 3S0MA 4XJ9A 1G9DA 2B45X 2DCTA 3SXWA 4BA6A 2P37A 1UKRA 4N43A 1RUH1 2A75A 2WFF3 2ATFA 3TYJA 3VBOC 3AMNA 4AEKA 1RVF3 2VNRA 5GZDA 2CL2A 4AGGA 5KXBA 5LRRA 3AXDA 3ST7A 4H55A 4F3JA 1W39A 3R4UA 4AVAA 3UL2A 4HPKA 1FYUA 4EWDA 5CVRA 2MHFA 4X8NA 1EV13 3MLLA 5BNOB 3M4FA 4AI3A 4XEZA 3ILRA 1SLLA 2XGXA 4K7JA 4FQ4A 4HLTA 2B8MA 3A4UA 2OA2A 4U36A 3IDBB 5HCBA 3EJKA 4JDNA 4P9IA 2QCSB 4XHXA 2GNDA 2B7YA 1HRI2 3O7OA 2R1DA 2VPVA 1XNCA 1OMIA 3ZXLA 5H9SA 2QDRA 1EYBA 2DTWA 3D0JA 3VZLA 3ZSEA 4ZKTB 4META 4IV1C 1MQTB 1R1A1 5DG1A 1VRH2 1J58A 1VBE1 4ONUA 1SLCA 5SV8A 2Z69A 4N43C 3NKTA 4XIOA 2YV8A 2RS32 4MLOA 5DUXA 3USUA 4DY3A 2BVVA 3N4MA 3M3CA 1XU2A 1DGRA 1A3KA 1WA4A 4WM8B 4LA2A 3RJRA