3JQXA

Crystal structure of clostridium histolyticum colh collagenase collagen binding domain 3 at 2.2 angstrom resolution in the presence of calcium and cadmium
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
117
structure length
117
Chain Sequence
YPIGTEKEPNNSKETASGPIVPGIPVSGTIENTSDQDYFYFDVITPGEVKIDINKLGYGGATWVVYDENNNAVSYATDDGQNLSGKFKADKPGRYYIHLYMFNGSYMPYRINIEGSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Comparison of ColH and ColG Collagen-Binding Domains from Clostridium histolyticum.
pubmed doi rcsb
source organism Clostridium histolyticum
molecule tags Cell adhesion
molecule keywords ColH protein
total genus 23
structure length 117
sequence length 117
chains with identical sequence B, C
ec nomenclature ec 3.4.24.3: Microbial collagenase.
pdb deposition date 2009-09-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.380 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3jqxA00
3BOWA 1DF0A 4DZGA 3AFGA 3JQXA 4HPKB 3DF0A 2XVKA 2QFEA 4DXZA 1WMEA 4DY3A 5SV5A 4I3GA 5FAXA 2LUWA 1U5IA 1NQJA 1KFXL 3JQWA 4HPKA 1QXPA 4DY5A 2XVLA 1NQDA 2XVGA 5FBZA 4G9SB 1WMDA 1KFUL 1WMFA 2O8OA
chains in the Genus database with same CATH superfamily
4N9HA 3S7IA 3A22A 1XQNA 2GALA 5SV8A 3FC0A 2J42A 2ZMLA 3PUQA 4LE3A 4QPWA 3NRUA 5FZBA 4MG2A 3O7OA 3IAPA 5J1XA 4MGIE 5HCHA 2C9KA 2BGOA 1GZTA 1E5RA 1OQ1A 3L9JT 5EWSA 5FYHA 5FUPA 4UFHA 3BALA 2FHRA 3ECQA 1KJLA 4M3CF 3B9IA 4ISRA 1AR72 5D8AC 4ZS3A 4ZU7A 1B35A 4KNCA 2W46A 3UGGA 3ZXLA 4UXAA 1UY2A 1UXXX 3D6EA 1PM7A 2XWBB 3TWIA 2O14A 4PDWB 1OA4A 5F5AA 1MS8A 2JIJA 3N9MA 1JZ7A 4BWOA 2LRPA 5FZ6A 2JDAA 3HPNA 4M01A 1WKYA 4PQQA 3VBFB 1V6IA 3V0BA 3RYPA 5KHGA 4HLTA 3AJZA 3ZPYA 4XUOA 3H3ZA 4F7ZA 1GU3A 2R1DA 4LBLA 2HWD3 5F6KA 1HRI2 3JXSA 4WVZA 4D69A 1GLHA 2BEOA 3P1IA 3JZVA 4OI2A 1RUNA 1G6NA 4XDOA 2CDPA 5FR3A 1VAVA 2BVBA 1FV2A 2XBO2 3T30A 3T4HB 1QDOA 1JMUB 1XSRA 4PI0A 2YZ4A 4AEMA 4R4ZA 4XQ4A 2DVDA 4COVA 4R8HA 5HCAA 1RUH2 3RMYA 2HLEA 3JBG2 3WD5A 4M3CA 1VBD1 4GH4C 1D0HA 4W6XA 1POQA 5IVYA 4ZZ5A 5L7OC 2HWD1 2OUJA 4BLJA 2A6XA 2RE9A 5K7PA 4OHWA 3TN92 2MNGA 2YBKA 1KS5A 3WNOA 2J7MA 3M1HA 4XFIA 5F9TA 1SLCA 3WOGA 2RV9A 1HV1A 2AC1A 3NV3A 3T1MA 3AZYA 3C7EA 1H0BA 2H6BA 1COV3 1D7PM 1W05A 2ENRA 3ZYIB 1ULOA 4MV2A 2WQZC 4QPIA 2WSUA 1RVF1 1HLCA 1C1LA 4AGRA 5BXXA 1TEIA 4FOWA 5FFOC 4XILA 1YIPA 1W8UA 3BYWA 1U5XA 2JXAA 4L8QA 4Q4X2 2QQNA 4HKWA 1OVPA 2W1QA 3O1RA 4K7JA 1HN1A 1PNFA 4GQ7A 2BP6A 1RUF1 3VGIA 3NKTA 4L11A 5A1FA 1XE8A 2RM21 4QPGC 3LA3A 5EP9A 2VVFA 4MZUA 2UURA 3GM8A 3WSOA 3PDQA 3Q9OA 4CP2A 4NO4A 2W1UA 1UY3A 5ABJC 4RFRB 2ZX3A 4MGYE 1NLSA 1IG3A 1LU2A 5ACA1 1SLBA 4NHYA 4LULA 4XF0A 3RWKX 4FPKA 1OVSA 4DXRA 1NY71 4JKKA 1SACA 2XVLA 3A21A 2YG0A 3SXWA 2Y38A 4KQ7A 2V4AA 5D2AA 4MGQA 1WMDA 5L9BA 4YYOA 4WM7C 2VTXJ 1CJDA 1LEDA 4FFGA 4WM8C 5J37A 1DF0A 2WWUA 4DXTA 2W91A 5K0UC 1FT9A 1UYXA 5BNPC 3EXUA 5JPMB 3HIFA 1OC1A 4BM8A 5A70A 2DU1A 3H1MA 4Y26A 2GNMA 2HWC1 4FP3A 1QHDA 4MO3M 2ZGOA 3TYJA 2JENA 3B5LB 2XLGA 3ZXAC 1WA4A 5BNNB 3BU7A 5KHJA 2Q1MA 3POEA 1RUJ1 1RXFA 1BZWA 2ET1A 2OS2A 1CIYA 2K9ZA 2OZ6A 4EN8B 4Q4V3 2EF6A 1EUTA 3ZSEA 2UYAA 4Z07A 2Z79A 1BKZA 4LO6B 1WCQA 2VMIA 1BXHA 1TMF3 4B4PA 3CHXA 1SMVA 1WD3A 4WBBA 2XKOA 4XAEA 4CDXB 2CGPA 5A3WA 5LZ6A 3TNPB 1SLIA 3CBNA 4HPKB 1AXZA 3AC0A 3EMRA 4B29A 3WQ1A 2GMMA 4BIFA 3ZLIA 4W65A 3A0KA 3RPQA 4M3CE 3S7EA 4LBNA 5FXVA 3J7HA 5F6LB 4YVSC 2EA7A 3U37A 3OD4A 3TEWA 2GP3A 5C70A 1LGCA 5F39A 3GGLA 5B4XA 1NCQC 3UYJA 1CAXB 2R041 3LEGA 1PGL2 1PK6C 2F4PA 3OEBA 2FMYA 5FZHA 4OI1A 5LY2A 1PNGA 2PHUA 3THDA 4RGKA 2B8MA 1JU4A 1D4VB 3MIEA 4AXOA 3RS6A 4BOWA 4DIQA 5LWBA 3RZHA 1DQ0A 5DG2A 5L7OB 4DMIA 2X5IB 4H2AA 1E5SA 2BNOA 4CCDA 2ZEXA 1ODNA 3HR9A 3MLKA 4FTSA 3VBHA 1PVXA 4IV3C 5FIXA 2IVIB 3ACHA 1NZCA 1OF3A 4QXKA 5FY4A 1DG6A 5GLUA 5JSOA 4QPYA 2D93A 4M3CB 1W28A 4FPYA 4EN9B 4YZ3A 2XJQA 5DDJ3 3SH5A 2QQJA 1W6MA 4BA6A 5E16A 1RUH3 1LOFC 2QQPA 1RMU2 1FPN1 2UY9A 4OZXA 5C33A 5CADA 1B09A 4BLIA 4OUSA 1DBNA 4ET7A 1X8EA 3H3UA 5LBEA 5BYNA 4UBHA 2WO2A 2WLQA 3JBG1 4E8DA 2XPJA 2WA4A 2QQKA 3N9PA 1GZWA 1W8FA 1GWKA 3ZFEA 1LOBA 3A7QA 2GNDA 1K5JA 4AVTA 3MZHA 5A3LA 1TME1 4DEVA 5DDJ2 1ENSA 3PIJA 3KSCA 1POV3 2HWC2 2WAOA 2NMOA 1RUE3 3THPA 2DVGA 5DZFA 2VUDA 3N9QA 1EYBA 1R1A3 3RZJA 5CZKA 5DPNA 5FPUA 1DLLA 4FOYA 1X50A 4K8FA 5AVAA 1W8ZA 5A7WB 1RUI2 2HWF1 1WLWA 1IQAA 2Q8OA 1ULFA 4QDRA 1VBB2 2QNKA 5ANQA 4BCUA 1GUIA 1AUYA 1XXNA 3WT3A 4D0QA 4AFMA 3TOJA 3J8F1 1LOFA 4GH4B 4C1XA 4NHXA 3UETA 1QY4A 2LTNA 3ACLA 3LA2A 3POIA 4KWLA 1RITA 4PT6A 1REDA 1TVGA 1Q8VA 1ULPA 5FZLA 2XJTA 3GZEA 4FSJA 5IJRA 4TTGA 5A1AA 5CFCA 4MUVA 2ZKLA 3MV01 5E1RA 3VBHC 1PO23 2V09A 4R9AA 3JQXA 4QWNA 4XMAA 1CPMA 3H1YA 5DQ0A 3RI8A 4AI8A 1PK6B 3UGHA 3ZXEA 4XURA 1M4WA 1C8M3 1PZ7A 1BQPA 3RYKA 5JOYA 1SPPB 1V6KA 3VBSA 4RGGA 1STMA 4BQWA 4HL0A 3AKSA 2C1FA 3N35A 2Q8CA 1ND3A 1GZ9A 3WDUA 4OI0A 2VR4A 1QJFA 3PUIA 5FYIA 2VY0A 1LAJA 3FFQA 4MOAA 1GSLA 1XNKA 5A7PA 1VRH1 3WNMA 4Z1VA 3KB5A 2I45A 4TN7A 1WMXA 1US2A 2D6MA 3DPRC 2UU8A 4AFCA 1MACA 4QQ2A 5FO7B 4A45A 1ZBA1 2X10A 4MXVA 3FZ3A 3OGVA 4XAAA 3IN9A 1W6PA 4MGZE 4YGCA 4AF9A 4XACA 4YM0A 3ST7A 3ABZA 3WVJA 1CPNA 1NUKA 4AZZA 2RS31 4IEYA 4QKNA 3PTYA 1YQCA 3VBRB 2QKDA 3KGZA 4WVVA 4GKXA 4ZU5A 5JZGC 2RHPA 2FDHA 1N47A 1OA2A 2RG4A 2Q8EA 4LO4B 4CUGA 3VKLA 5CFCB 2WNVC 4H3WA 4H7MA 4FPCA 3KQ4B 1H2LA 5FZOB 4XFAA 4O9GA 3DGTA 4RHV3 2QTWB 2GNBA 4BQ1A 5HXVA 1AL21 2GP5A 3L2HA 5A3OA 1WW4A 2HEVF 3MFCA 4ES8A 2HBUA 1I3HA 3BB6A 1UMHA 3WF2A 3JUUA 1N1SA 4LJHA 5C4WC 3BVCA 2J1VA 1VBB1 4UW3A 1JOBA 2VCAA 3HQXA 4AI2A 2JICA 4E27A 3DN7A 5FZ8A 3ORJA 1WCDJ 2EIEA 5CKQA 1H8VA 3TB0A 5FOJB 1J83A 3H7YA 2WO3A 1DQ1A 4MLOA 3JD72 2W0XA 3ZYPA 1ALYA 1KFXL 2ZACA 2YYOA 2HWF3 1W6QA 2A6YA 4K20A 4QPGB 3FLRA 1SLLA 5FPXA 1COV2 1TME2 1UPIA 4XJZA 4P5HA 1GICA 2OPWA 3DYPA 5FZ0A 5IK7A 3BOPA 2XOMA 4P00B 2WWSA 1RUC3 4EROA 2AH2A 3WG4A 2A71A 2QQWA 3WF4A 3U78A 1JBCA 2AYHA 2YMZA 3FL7A 4QKFA 3KGLA 2RMU2 1GOFA 2HWE3 3KM5A 5LRSA 1W9TA 1RTVA 1VMHA 2DUOA 3LFMA 4UW5A 3T0AA 3ZDVA 1RUF2 3GF6A 2UWBA 3ZFGA 3ZO0B 3TAYA 5JIUA 3VHOA 3WCRA 2PFWA 1U5YA 3NNFA 5GZGA 1W6MB 1I5PA 1UZ0A 2DVAA 2Q0AA 2VUJA 4ITCA 3VD3A 4AW7A 1DFQA 1QIQA 3POBA 1I1EA 2XQXA 4D6QA 3AMNA 1C1FA 4I0WB 3B00A 3JB4C 3PTRB 5FYUA 1YO8A 4ZKTB 1H6YA 2W1WA 1JYCA 2DTWA 4DINB 4Y3OA 3KMHA 5FLIA 1S0CA 4HT1T 1OKQA 4AOCA 4XFFA 4E4SA 3W5MA 4FPJA 1OPMA 1Z7S2 3KT1A 3MI8A 3UT0A 2OT7A 1QJX1 4DRRA 1I5ZA 4OQ9A 5JDBA 5IYYA 4LE4A 3QACA 3MYXA 2OKXA 1F4AA 1GYKA 3KT7A 4UI9L 2HEYF 3VBSB 1HRI3 1QNYA 1BK1A 1PIV2 1F15A 2VXJA 4PI2A 3KT4A 4LIUA 3J9SA 2MEV2 2IXJA 3GZAA 4XQDA 2BWAA 5HI0A 1H1MA 4N43C 1JHNA 1YLLA 5DAXA 1AX1A 2YY1A 2EIGA 1D4M1 1VBE3 1BLZA 2C9AA 2JE7A 1CAVA 3MIFA 3E6DA 4PLNA 1NLQA 1VMJA 3U0ZA 2VZPA 1DLCA 1OXCA 3N7KA 1MQTC 4CDQC 1HQLA 2LM3A 3V65A 1S0JA 3WP3A 2ATFA 3O5SA 4ZONA 3BTZA 3NAPA 1J1TA 2I74A 4ONUA 2RS33 5FO9B 3VZNA 5JXGA 1G9DA 4OHVA 4GZ9A 2AEZA 1ZBA2 4XFGA 2XR4A 1FNZA 5C4WA 4IGQA 4TYSA 5ISLA 3A23A 3VBOC 1SLTA 4JGYA 5I0SA 2BTVC 1LHOA 1ZBA3 2IC1A 4HETA 4E4HA 1MS4A 5J48A 3KHCA 2XHKA 3LOBA 2RS32 1EUUA 5G05L 2XJSA 5JLVA 5C71A 1WCKA 1TZOA 4B3NA 1RGSA 2L9LA 1LU1A 4LBKA 4QX8A 4A7ZA 1WWYA 3LDRA 5EYXA 5GJ6A 1AR93 1YUDA 4AAPA 5F3CA 2AREA 1JOPA 1H4GA 1NT0A 5KXCA 1W0NA 1C8M1 3ZYFA 2HWB2 4K1YA 4NOTA 5FK7A 2B9VA 2CNAA 5IK5A 3FN9A 3W9AA 1TNFA 2OQ6A 1GP5A 1ZBE1 4E9KA 2D44A 3DKQA 4HK9A 4BK4A 4M0HA 1GANA 2DYCA 4V1PA 3S57A 5FP3A 4KBZA 1F8VA 4JDOA 2VTFA 1KGYA 2CL2A 2JG8B 1LGNA 4IGPA 4NVPA 4BMBA 2R073 1YJLA 4D94A 1UY4A 3AZZA 2ZGLA 1SFPA 2PELA 4HZFA 2F6BA 4QX2A 1YJKA 5A7NA 5FWEA 1O3TA 1UU5A 4I0AA 3I3QA 1H2MA 2VM9A 4FPLA 5A7SA 4YZ5A 1BMV2 5T5LA 4Y24A 1JYXA 2B9UA 4OMCA 2B4KA 5CYYA 3ROUA 1MZEA 4QMAA 1FMD2 4RHV2 4EYUA 3FLTA 4IXLA 4SBVA 4JQRA 3TRSB 3LPFA 3PUAA 1KXGA 3ZKUA 3M3QA 2CGOA 1N3QA 3R4SA 2W5FA 5C3RA 3E6BA 1VBD3 1AYN1 2D6OX 3LIGA 4YLZA 4YVWB 2D3RA 4IE0A 1A8DA 1W0OA 2P4EA 3VB9A 1RMU1 5JWPA 2YPDA 5DUUA 3POYA 3S5AA 4QU2A 4CXYA 2RS11 3URFA 3CMGA 2PHFA 2BZDA 3T2QA 3CKHA 1W03A 5FYVA 3MDPA 3CIHA 4E2SA 5GZCA 1JZ8A 5IVEA 3GJBA 1F35A 5FV3A 4LIVA 4C8DA 1W8WA 3BODA 1R64A 1H8TB 4UFJA 1AX2A 2R16A 2VNGA 2AR6A 4I02A 4INDA 2IXIA 3FJSA 5JZGB 1L7QA 3PVBB 5EZWA 3LEMA 2QVSB 3RI9A 1UQXA 5B2GB 4LQRA 2Y6FA 3B01A 4PDWA 1GMMA 2DCTA 4HBNA 4QM9A 2JG8C 3T4VA 4MXWA 3HMYA 4CP0A 4LHSA 3WW3A 2FDGA 3LSEA 3SKVA 1ULCA 5C9AA 3ETPA 2LROA 1BCXA 4PCRA 4XBLA 1Y4WA 3DKWA 4FP2A 3WNKA 3PNAA 3EYPA 1PO12 4PQ9A 3PL0A 1ZREA 3AP7A 4A3ZA 1X7NA 1XRUA 1GV9A 2C24A 1VMFA 4GB32 4ZPIA 3ACFA 5IAXA 2HYKA 1K12A 1TMF1 4Q8LA 1DU3D 3NW4A 1S0BA 3N9NA 2O1QA 2ZPXA 3RSJA 1T2XA 5J98B 1YEWA 3E5XA 4Q1RA 5L9RA 2JDUA 3ACIA 5C3PA 3ASIA 2XB6C 2ZX4A 3K48A 1LESA 3K3NA 1BBT3 4I30A 3I3DA 4LNVA 4QXCA 4QD2A 4XCBA 1ENXA 4GXLA 1IPSA 1W9YA 2HWC3 2R7EB 1CZSA 5TSWA 3VBOA 1NKGA 1XNAA 1CZTA 2MEV3 1FNYA 2VUCA 3WG3A 1EPWA 4AVAA 2JDMA 1NQDA 3M3IA 1SFYA 2ZGKA 4LK7A 1IZ3A 3ZFFC 3DV8A 3VD7A 4CP9B 2RS13 1DHKB 4YZ1A 3WP4A 2ZTNA 1YNAA 3IM0A 3I4IA 3I2GA 5JMCA 4NR1A 1OT5A 4Z2AA 1HB4A 1O3QA 5AC91 2XH6A 1C3HA 4Q0UA 1ZA4A 1ZRRA 2WUHA 4AQ2A 3OYWA 4CRQA 1YQ8A 3G7DA 4O61A 5DAPA 5DZEA 1OURA 5KHIA 3NSTA 1IOAA 2W87A 1SDDB 1QOSA 4I3GA 1OF4A 4LO7A 4N43A 4ZS2A 5A6XA 3K75B 5K9YA 3LKJA 3AB0A 1ZZ9A 4W6YA 1PO22 2E63A 5L36A 4YW5A 5CA6A 5FDBA 2VMDA 1CAWA 5JSPA 5FY0A 3USUA 3IDBB 3CF6E 5F5IA 5A7QA 4AVCA 5J09A 1O8PA 1R092 1SHWB 2Q30A 1VR3A 3FMGA 4WM8A 1LCLA 3AMMA 5H9SA 2IXKA 1RUF3 3GBWA 3MFAA 5KHHA 1DP0A 2OUHA 1NG0A 5FXWA 3QD6A 4QXBA 3ZN6A 1OFSA 2PXJA 5T5PA 4P9JA 2Z5WA 2PQSA 1RIRA 2W95A 2ZGUA 3K51A 1UIJA 2Q1FA 4AEDB 4AWDA 4COYA 4NHMA 5DXDA 3U75A 1UZZA 1KEXA 3WNNA 2WYSA 3PJQA 4CTEA 2IFRA 2ARAA 1MR5A 1ZBE3 1CR7A 2IXCA 1AYM2 2Y6KA 5FZCA 1SBEA 1VALA 2ORXA 5HBAA 4RHV1 4Q29A 2CGNA 2BOJA 4AHXA 3TBDA 1DCSA 4CEYA 1WBLA 2A70A 1O6UA 1PGW1 3WY6A 2Y6GA 3JB8A 3KHBA 3I2FA 1OH4A 3C2UA 2YGLA 2OYZA 1SCSA 4MGSA 4XBNA 2YC0A 2Z2SB 3FHQA 2D6LX 3OYWB 1UYPA 1JODA 1JOJA 3I59A 1OD3A 1QJZA 4IW3A 1AR83 4Q4Y3 3VDDB 2PMWB 5A6YA 4NIDA 3S6PA 4YVSB 4ASLA 2Y64A 3AL6A 3OB8A 4ORFA 1CESA 2BWCA 4QKDA 3EQEA 1JYNA 2GN3A 3LAGA 4FPOB 4XE9A 5IWFA 4CPBD 3OGRA 1AVBA 1ENQA 3VBUC 4FFHA 5K0UB 3O1UA 1DQ2A 4GWIA 5FMCA 3Q8AA 3H8OA 5D21A 5FZGA 2WZR1 3UKNA 4RR3B 4DY5A 2QDRA 3ZM8A 5T54A 1LULA 4KH9A 5DN2A 3PVNA 2BOIA 2KM2A 4EQVA 1J3RA 2VVEA 2D43A 4I0BA 3IIAA 3NWKA 4Z8BA 3ILRA 1PGW2 3RG0A 1HIXA 4QX1A 4MHUA 2G9FA 3FBMA 2ZEWA 1OOPC 4Q4W2 1Y9QA 1W99A 4EWEA 3A0NA 1CX1A 4RQPA 3K4DA 2F17A 4MVTA 4C1WA 3QH6A 4WZFA 2P3IA 2WO7A 1RC6A 4B1LA 5JXIA 4CEYC 2LW8A 1XNTA 4IUGA 5DG1A 4A42A 4OZOA 2K0GA 2YU1A 1V9U3 4IV1B 3UJQA 4L0PA 2BNMA 2HJIA 1HXS2 2XJPA 1AXYA 4CSWA 1O91A 5BNQA 2VZQA 3WINE 3D4KA 2VZTA 3PLQA 4HN0A 5K4LA 3ME2A 3VBFC 5F3EA 5CBLA 1K5MB 2A5ZA 2WNVA 2GAUA 3AZWA 1OHFA 1TMF2 3KVBA 2WZR2 3MPBA 4G9SB 5EHDA 1AR71 1Y9MA 2JDPA 4GMP3 4JGZB 3VDAA 2VG9A 1Y43B 2E7QA 4W6WA 5CVRA 4DZGA 3OOXA 4XFBA 2X29A 3MIDA 1MQTB 4J1WA 2JG9B 3KV6A 4JRLA 5FJHA 3RQ0A 4XABA 5CG9A 2N7GA 4AI0A 1KRIA 4NIGA 2FBEA 2H6CA 1HRV2 5I0TA 3SISA 1K45A 4DUWA 3FUOA 4HVQA 4S2HA 5IVJA 4NIIA 3WQ7A 4OYUA 3FHIB 4W50A 1F31A 4LK6A 4TLGA 4OVEA 4Y5SA 1QH7A 2P1BA 3DPRA 3GZTB 3HT2A 3VKNA 4TZDA 1JXNA 3ON7A 1W2AX 4N43B 4QB1A 1CAVB 1VBC1 1H30A 4S2FA 3H3LA 2NZ9A 2P17A 3T09A 5KHKA 1HJFA 1UKGA 4KU8A 4Q4X1 1S0GA 3QH7A 4O9EA 1S55A 3CO2A 1O7FA 4LUMA 3VBSC 1WLDA 3USSA 4AAXA 4AVSA 2TBVA 1H9WA 1LHVA 1MEC1 3CJIB 4M00A 2RJ2A 1REFA 2WNOA 1ZVFA 4I3PA 5IT6A 3LDKA 3IPVA 5FYCA 1LTEA 2VCBA 4LKFA 3PIGA 3IDEA 4IEZA 3OBAA 3HBKA 4PF5A 3DECA 5CB7A 1JZ6A 4C0HA 4NRMA 3UJOA 1DZRA 5A6QA 5JI9A 3E5QA 4CDWA 4AEDA 5BNOC 4QGMA 3WQBA 2PYTA 1ND2C 3PURA 4LHLA 2BPA2 3E6CC 5EFUA 3O14A 3W58A 3AMHA 4CXXA 1FATA 4AVBA 1GFF2 1RUG3 3GCWA 1NXD1 1Q3EA 4BDVB 2ILMA 2BUKA 3D0JA 2PHXA 2ARXA 4XUPA 5FZ9A 2JB8A 1R081 4XDQA 1AL23 4Z2WA 3QLQA 3WLUA 4P02B 2FCVA 4EN6B 4EV0A 3C3VA 1XBFA 2BVVA 2NMNA 2DCYA 4LHKA 1CD3G 3TN93 3SCFA 3RNSA 1W6OB 4N90A 3POWA 3AJYA 4PDWC 4YW2A 3B94A 5FZEA 5IVFA 4FQZA 1RUJ3 4YM1A 3IMMA 5GLVA 2XLFA 2BU9A 3VZLA 5C3OA 3RZKA 5CFDC 4IE5A 1UY1A 1C8NA 1W8NA 2W9XA 4XTMA 1G9BA 2PLV1 3WP5A 4RL7A 4PIXA 3NNJA 3CL1A 2ZEZA 4CUAA 3LSDA 2XBO3 1O3RA 3HN3A 1YRZA 2RS12 3H7JA 3ZIXA 3ZKYA 1JYWA 3R6SA 3VV1A 3Q8EA 2HWD2 4IV3A 3H8XA 3BPSA 3JU9A 2X53S 1LOAA 3I3EA 1QJU1 2A3XA 3SKJE 3D0SA 3M3OA 2OPKA 2JB4A 3WF3A 2WKKA 3BIWE 1OLQA 4XIKA 4RA0A 2WZEA 1SLAA 4MYEA 2WS91 1NCQA 1Z78A 2SLIA 4HSLA 4JCKA 4LBOA 3M2MA 4Q4V2 4CCJA 2A3WA 3WF1A 3WR0A 5JSRA 2LS6A 4Y20A 3O1MA 4E2QA 1AR73 3W5NA 1LECA 4P08A 3NJVA 4SLIA 3LEIA 3N36A 4D7SA 4LT5A 1V00A 4FQ4A 2ZGRA 4NRPA 5HXMA 3GBGA 1Z0HA 2ARCA 4XUTA 5A1LA 5I91A 4Z92B 1JYIA 4AQTA 2WT1A 2ZGNA 4LBQA 1S2KA 3GNEA 3M3CA 2P6CA 3R05A 4RS5C 5FTTC 3T3YA 4N9IA 4P9YA 3WX5A 3CDZB 4NAMA 4L99A 1KD7A 5A3PA 1PO11 2CYFA 1PMIA 2C26A 4NPLA 5GKAC 2NM1A 1RVF3 2VPVA 3LF7A 2XQRA 1QXJA 1YHFA 1COV1 2WS93 4B7EA 1J1LA 4EWAA 4Q5OA 2HEWF 4D3WA 4CDWC 4Y5Z0 1XSQA 2I07B 4HXCA 1U0AA 1R1A1 4W8JA 1PX3A 1KDKA 4UFLA 1EPZA 4ISQA 5IVVA 3KV4A 4V2WA 3SHRA 4I09A 1POV1 5LBFA 1V0AA 3MIGA 3T2TA 3WQ0A 2FCUA 2GU9A 5BNPB 3UV9A 2J1UA 1T6GC 1TME3 4IDZA 4YM3A 3I2HA 2R49A 4Y22A 3LFIA 4RR3A 1OLRA 4AG4A 4WM7A 4FAGA 2LALA 2ZHLA 4P9GA 3KF5A 4JVAA 4NWWA 3B02A 3OEAA 1DYKA 4HSJA 4WZCA 1UIKA 2XVGA 3J8F2 2GDFA 1YI7A 1UZWA 2D5HA 4BMEA 3ZN4A 1RUH1 1X9PA 2JDKA 4FAHA 2YU2A 1NCRB 2EXJA 2WT2A 3DYOA 4QX7A 4BIOA 1O5UA 1VB2A 2PAEA 4IE4A 4JGYC 1X82A 1ULGA 4FPHA 4XF4A 4BXSV 3ZMOA 3M70A 1FMD3 4N7UA 2WFF1 4GALA 4D6SA 3ZSLA 3KZ4C 4HOOA 4WVWA 3VL9A 3HOBA 1IQDC 3AP4A 4IEVA 1MPXA 4AHYA 3ZFFB 4V2VA 1OUXA 3N7JA 2DURA 3SITA 4DXSA 2GH2A 3KWVA 2VNOA 1GR3A 2VMHA 1PGL1 1VRH2 4OULA 1APNA 2GMPA 3HN1A 4OHXA 1XNDA 1OQEA 3LGRA 4YNIA 3U10A 2BJSA 3LZZA 3OSDA 1MVQA 4AVVA 1LNSA 1GWLA 1AJKA 4XYXA 4A41A 3O1OA 1ASJ1 1BVP1 5D8AB 1GOGA 1AR61 4Y33A 4KMQA 2OIIA 4JRAA 5FPLA 2R0FA 4OHYA 1W90A 3EJKA 5F32A 4BU2A 2Q8DA 4P5YA 1PVC3 2A6WA 4HG6B 4Y1UA 3KCCA 2W92A 3HD8B 4CPBA 2ADDA 5GZFA 2DFBA 4PJYA 2IZWA 1UPSA 1JS9A 3H8UA 2V5DA 1A3KA 2VBBA 5AC93 5LA2A 1ZZCA 1C57A 4CZSA 2AENA 3H9AA 2EXIA 1YQ2A 2V5YA 3IKWA 3D82A 1WGPA 2G1MA 1UOGA 2Y0IA 2ZMNA 3NNGA 3C7FA 1O5LA 4ZU4A 5JOXA 2RJKA 5JAXA 1Q8SA 3KLSA 3MEPA 5CKNA 1K3IA 2TUNA 3VBUA 1HB1A 2QQOA 2VBDA 5GALA 1W3XA 2YB7A 1AZDA 3MF9A 1NQJA 2J1TA 1AR62 2Y8KA 1ND3B 3I3MA 1QXPA 1H2KA 1G7YA 2SBAA 1A34A 5CIRA 5KR7A 4K9SA 4RFT0 1VBA1 3SCHA 1B35C 1UYZA 2D6NA 2WDBA 4CCOA 4LA2A 5CKMA 4EJRA 3MUZ1 2E26A 3U4SA 1NY72 1JZ2A 3N4MA 4NIHA 3RYRA 2JKBA 1AR63 1SQ4A 2NPIA 1UCXA 1YFXA 2JDHA 3KV5A 4YFWA 1OQDA 4Y1YA 2FDIA 4OFGA 2WN2A 4CE8A 1W6NB 3KCYA 4OI4A 3WDWA 5JPNB 1WLTA 4ZXKA 4ATFA 1W06A 2KD7A 4K6BA 1MZFA 3WDXA 1QGLA 5IAVA 3N9OA 2VZ1A 1XYOA 4RN5A 2DTYA 2E6VA 2VZUA 4JGZC 5EXOA 3UK9A 5C6CA 1UO9A 3K4ZA 2QUOA 4Y1XA 4KWKA 2P3JA 2ZAHA 1W04A 2QZ3A 4E4DX 4RR3C 1KJRA 1MZ6A 1YWKA 3BTAA 3ENRA 3U11A 3VL8A 2DUQA 1N1VA 2VOTA 5A3UA 1FMD1 3VZOA 3VLBB 4UW6A 1JHJA 5IATA 1BEV3 1M06G 1LODA 1PIV3 1RL3A 3WZ1A 1D2SA 3R0RA 2WFF2 4YW4A 4BB3A 4URAA 2E9QA 1Y3TA 5IK8A 1JN2P 4YRDA 3NJZA 1W2TA 3AMPA 1XU2A 4L97A 5HCFA 3NV4A 1YCIA 4XETA 1ZM1A 2ETEA 1RMU3 3J7NA 1LB2A 3ZXDA 1BYHA 1FV3A 1PM4A 1AR81 5T55A 1LOEA 4LHNA 4AGGA 4DOUA 1AYN3 1ACCA 4Q26A 3VHPA 4RS5A 3DPRB 4XMIA 4YGEA 5ANNA 5A3TA 4Y22B 2CSGA 3AFGA 3MF6A 3MGUA 4J6GA 1R082 4HANA 4JHTA 1N1YA 4KL1A 2VQ0A 5JXHA 4BQ5A 4LKEA 3WDTA 2CV6A 2XDVA 1UAIA 2G9GA 4YGBA 3O1VA 4JV4A 5FYYA 4LA3A 5LB6A 5F7UA 2PHDA 1VRBA 3PJYA 1C5HA 2ZS6B 5CU1A 3BN6A 4FXKB 4NMIA 4NJ4A 4R52A 5HV0A 1HKDA 3AYAA 2VW1A 3CJIC 3BUCA 1C4RA 4LBMA 4P9XA 5F3IA 5FZMA 1SPPA 2HWE2 1FXZA 4LORA 1CAXA 1ST8A 1TE1B 2VULA 3VD9A 2D3PA 4NWVA 3IAQA 4LITA 3LQCA 4CU6A 2E7TA 2FMDA 3VD4A 1OPOA 3U14A 1V9U2 2VU9A 2BDRA 3CQOA 3B9CA 1BBT2 1Q8PA 5C9AC 1H9PA 1UX6A 4DUXA 1L3JA 5LATA 4D8MA 3VDBA 4GMP0 5LK7B 3KCXA 3VZKA 1X36A 3I2DA 4FOQA 2PN5A 2ARBA 4E4ZA 4BQ4A 1RUOA 1QQP1 2VMEA 2Q4SA 4JTOA 4Q4W3 3ZFEC 4A6SA 3BTXA 1X9TA 1AR91 2JG9C 4UYBA 2WS92 4GB33 1OLMA 2K2SA 5H9PA 1GQPA 1H8TA 2QQVA 2QZ2A 3D3AA 1QJX2 1QJU3 1Q56A 5H9RA 4WVMB 3HNYM 4X6QB 3X29B 4AQSA 4LBJA 2ZX1A 3ZPOA 1BHGA 1ZZ6A 1QEXA 3T08A 4QB2A 2XXZA 1J58A 4FFIA 2VMFA 2VE1A 2VECA 4BQ3A 4FBFA 4LBQD 3DCQA 4W4ZA 1ZRCA 1HV0A 3V0BB 3VHRA 3K77A 4BH9A 2YDEA 4WV8A 3B7MA 2QFEA 3HQUA 4BZ4A 2KA3A 4L2NA 4PF1A 1CAUA 1AHSA 4XF3A 1CN1A 1BBT1 1UU4A 3ELNA 1U5IA 2D98A 2CAUA 3MW2A 1DGLA 4AI3A 2RVAA 4HONA 1A78A 5CG8A 5BNOB 1I9RA 3SNMA 2GZWA 1PHMA 1W6NA 2H0BA 3VKOA 1BK0A 1V6JA 2WRAA 1OUSA 1YQ6A 5L19A 1FYUA 3ES1A 1ZYBA 4NE9A 5E89A 2RR13 4ZY9A 5FPVA 1ASJ3 2IWGB 1OKOA 1NYWA 4IL7A 4KGGA 3WUDA 1ZNPA 1AYM3 1HXS3 5I8YA 2ZGTA 4QDSA 4HKLA 1MVEA 2D7FA 2V72A 5DZGA 1GNZA 5JR7B 2D6PA 2J1AA 2V4VA 3GHMA 4P9IA 3TEXA 4AQ6A 4FOVA 2AGSA 1N1TA 2XL9A 3OBTA 3R4DB 4DPNA 1XNBA 4PBPA 3UNPA 5C7GA 1HB3A 1QJY2 2V73A 1W2OA 3HT1A 1D4M2 1IKQA 1VBD2 4Q8KA 4Y20B 1G9AA 4QQLA 3WF0A 2RS53 1LGBA 2PA7A 4NN0A 1OOPB 4OUEA 4KWUA 5FY8A 5FYZA 4D7YA 4CDWB 1S0EA 4HKOA 1RUI3 4CP9A 1C8M2 2YFUA 2DFCA 2VH9A 2WFF3 1IS3A 4D7TA 5KXDA 4LO8A 2YBSA 4KBBA 1G9FA 4LBQB 4XOGA 3OY8B 4J1XA 4AGVA 2WNEA 5KXBA 4F83A 3UKTA 5K0UA 1WD4A 4RS5B 5I0DA 1GNYA 4IEQA 2D6KA 2ZCWA 4ZXEA 4YW3A 1DGRA 4MX3A 3ZSKA 1T6BX 1ZX5A 3ZX7A 5GZDA 2BBAA 1HW5A 5FZOA 3P5BA 2IXHA 2A7AA 4GD4A 4YVWA 2RJLA 3VBRA 2FCTA 4QQHA 1ODMA 4K8RB 4AEKA 2JEMA 4EWDA 4XEZA 1MZ5A 1NE6A 1ZZBA 3J7LA 3LD8A 3P6BA 5C8WA 3SMHA 1KFUL 1RHI3 3M4FA 3MICA 3VBOB 4AI9A 4JKLA 4O65A 3C7OA 1REEA 4BJ0A 3TEYA 3BI3A 2VW2A 1XYPA 3OF1A 5FMOL 1DZQA 3OGSA 2DDUA 2WYFA 3AL5A 5ABJB 4TWTA 2A6VA 1XE7A 1IGOA 1XPWA 1RHI2 1XJAA 3QBQA 4S2DA 4RQPC 3MV11 1EAH2 3S0MA 1OOPA 3VBRC 3F2ZA 4QM8A 4YVWC 1QKQA 4NUBA 1MQTA 2A73B 5FPAA 4CDQA 1FI2A 1FOD2 3LA7A 4GMP1 4XFCA 5FPZA 2YUEA 3U1XA 4A3XA 3E97A 2Z69A 1F9KA 1UD1A 3PHMA 3PUSA 3ZYRA 4DFSA 3THTA 1B35B 2R071 5LRRA 2QCSB 1D0GA 2R32A 3OCPA 3SH3A 3ZXJA 4AHZA 5T5JA 5A6ZA 3OGGA 1DZTA 1YFUA 3CZUA 4XQWA 4JTNA 2IXLA 1GKBA 5EJ3A 5FUIA 1W8OA 4A2UA 4QKBA 5LEKA 1NA1C 2PHLA 2NN8A 3AK0A 1VAKA 2YROA 1R1ZA 1MS5A 5AC92 4M0NA 1QXRA 4P14A 4A6OA 2YPJA 3AXEA 4GH4A 3HAGA 1TNRA 3VDDC 5T5OA 4ATEA 5HCBA 3ZN6B 3WG2A 2RS52 2OZJA 4QPIC 5DAQA 4QGLA 4CYDA 1ZZ7A 5FUNA 4Y5TA 4ASMB 2IUWA 5KC6A 4RYDA 1CIWA 4N53A 4IV3B 4CU7A 1GZCA 2WZR3 2JX9A 2A6ZA 1JUHA 2C0ZA 4COZA 1IKPA 2F4LA 3O0VA 4Q1PA 3NJXA 2BQPA 4B7KA 3NV1A 2WWJA 3M3EA 1CONA 2WC2A 2VZ3A 1R091 3CNAA 3ES4A 4HFSA 3OPTA 3KD4A 2E7AA 2VCCA 5JI7A 1UOJA 2XBO1 2Y6JA 4QQPA 5F37A 4MHRA 3RJRA 3IDCB 2PLV3 1VRH3 4BQYA 4XJAA 3W21A 3LEKA 3SEPA 4XZUG 1N3PA 2ZABA 1KQRA 1MEC2 3AYEA 3S30A 4ARXA 5FXZA 2QJVA 2WO1A 3SH4A 4KG8A 5EQUA 4N7IA 3JCIA 1IS6A 3JQWA 4GAZA 3RZLA 4NPRA 5FZDA 1JUIA 4LLFA 3ZVXA 1Q8QA 5D8AA 5E6HA 1S0DA 2HWB1 2JD4A 2QE3A 3HJRA 5EJ1B 5FBJA 4CDXC 2EXKA 1DGWA 4F3JA 1ONAA 1PO21 4H14A 1OI6A 2A3YA 4FO9A 4R4XA 5APAA 2KR2A 4XF9A 3ITQA 1HRI1 2XL7A 2IVJA 1RUG1 1W8HA 5CNAA 4FTEA 2VJXA 1QJY1 5FY5A 1CGPA 2Z42A 2GH8A 3EBRA 1QJX3 1QJU2 5KXEA 4XJ8A 5A7WA 4MXWB 1RUD3 5FK8A 3J8F3 4XHXA 2JG9A 2VQUA 4PHZA 4RQPB 4GWNA 4Q4Y2 2W08A 5FYTA 1J3PA 3DEMA 5AFBA 3USUB 1P8JA 1WCSA 3WW4A 1OFNA 1CAWB 2WZ8A 3GYDA 3C7HA 4WM8B 3BCWA 1VJ2A 3EB7A 5LA0A 2G9ZA 1YYNA 4S2GA 4GWMA 2HBTA 4TXWA 3GHNA 2G19A 3ALQA 1SEFA 5FLJA 4DQAA 3FX3A 4A4AA 4CEWA 1MS9A 3JD73 5ACA2 1NAEA 2VOWA 3PU3A 3BIEA 3POSA 3ZOIA 2C4XA 3AYDA 1AYN2 1RVF2 2Y33A 4XZPA 1NA1B 1LKNA 4Q4X3 4ZHNA 5F8PA 5FAXA 5C3SA 1ULDA 3AP9A 3CJIA 4CEYB 2XUMA 5G04L 3W20A 1VBC3 2NQYA 2YHJA 5BNNA 1JI6A 5GLTA 2ZAAA 3VDCA 1FPN3 1QMJA 1X33A 2FDJA 1UWWA 1WUVA 2WNUA 5I0RA 1QOTA 3ZN5A 2EXHA 1OSGA 5DDJ1 1MS3A 5FBZA 3INAA 5FQ0B 5FZ7A 3C8XA 1OH3A 4UFIA 1V6NA 2X05A 2UYBA 2YC2A 4OCTA 5JVVA 3VN4A 2PHTA 4HVRA 3IIIA 3MW3A 3H8RA 4YSFA 2WBKA 1K42A 3VZMA 2P34A 4EZHA 2XJRA 4YGDA 3N7MA 5EPAA 5T52A 5BNNC 3ACGA 3T1LA 2WZPP 1RJ8A 2RS51 2BBVA 3BKZA 5M0TA 2LUWA 2Y0OA 1HQWA 2XLAA 1RUD1 4RSUA 2FZ1A 2Q1ZB 3POFA 2VQTA 1G86A 1OMIA 2ZEYA 1NX9A 2VNRA 3KV9A 2WABA 4UF0B 3MLLA 1WW6A 4R9CA 1OA3A 2ERFA 2WR9A 5CFCC 2DUPA 1HXS1 1WMFA 5FY7A 5LA1A 4FCAA 3AZVA 4DS0A 5DUWA 2RDRA 1S0IA 5CISA 3IBMA 3NVCA 4YARA 2FDKA 3M7AA 3GBFA 4BYYA 1SBFA 3MUY1 2QQLA 4IEPA 5BPXA 3VKMA 1ULEA 5FYSA 1PMHX 1W8TA 3LWCA 1F5JA 3WEZA 1GQHA 2I2SA 3MBWA 2HH9A 2VCMA 2GC3A 4YW7A 2JWPA 5SV5A 2PAMA 2R6QA 2WL1A 4URTA 5FZ4A 4QHOA 2YXSA 1LR5A 2E33A 4GWJA 3U07A 4B4RA 3D5OA 4XXPA 2BRTA 2PQQA 2W68A 4IE6A 3I49A 2JKXA 2DCKA 3DXTA 3ZR5A 2ZGMA 3NL1A 3WHTA 1AL0G 4N8MA 2MHFA 4MADA 2VW0A 3HEIA 5GZEA 4ZZ8A 3RDIA 2PHWA 1CZVA 3MW4A 1GP6A 3J26N 2QDNA 3T0DA 2XJVA 1FPN2 4QAWA 3W59A 3IZOA 4G4FA 3H0OA 4AHWA 1VBC2 1W9WA 3DF0A 5DAWA 5FZKA 4NHKA 2BGCA 3VUOA 4DY3A 1O8SA 4I01A 1UZVA 2B45X 2C6SA 4Y4YA 5CAZA 1UN1A 5ACA3 1R1A2 2BFUS 1VIWB 2RDNA 1HRV1 4G3YC 3IDAA 5C9AB 1RUE2 1QJEA 2ZA9A 4EE2A 4BXFA 5BUVA 2EVXA 2VMGA 4KG0A 4FT8A 5C8CA 3O0XA 1UYYA 3AVRA 2ZJCA 5GM0A 2EICA 1JZ3A 1UZYA 1U5ZA 2XKPA 4IE7A 3FBYA 4LKSA 3ZIWA 4EZ4A 2E32A 2VZRA 4CDUA 2X09A 1JYTA 2VZOA 1XYNA 1UKRA 2ADEA 2WQ8A 4MGKE 4JDNA 4CCEA 5JIAA 4N53C 3MO4A 2W39A 4JQTA 2W94A 3HQRA 5GLWA 5FP7A 2R1BA 2X5IA 4NHLA 5BY5A 4BPZA 2GC0A 2J1SA 4NAOA 1VB4A 3UESA 1O4TA 4TLFA 1HJGA 1OD5A 5CFDB 4YPJA 4E8CA 4U2AA 3V0AA 4Q2FA 1W39A 4XVHA 2RDQA 1G8WA 4LXLA 5LASA 2FD8A 3TEZA 2XUEA 4XFHA 3O0WA 2R063 3FLPA 1IG0A 3OJBA 4OHZA 1HRV3 4EN0A 3NNMA 3ILFA 4LR4A 2FQPA 4JKMA 4UAPA 3MPPG 2WN3A 3NAPC 4META 2O8OA 5FREA 3PUHA 2WNUB 3AKTA 4Q0SA 1EV13 3B3QE 3ZFEB 2ZHMA 3I54A 4IERA 4YG0A 4E2GA 1WLCA 3ZDSA 1L7LA 2WJSA 1XU1A 1NCRA 3LE0A 3UKVA 2RDSA 1QF3A 4GJZA 2R042 4CXWA 3LDBA 4CCNA 5A33A 3CLPA 3KQRA 1PZ8A 4MSVA 3APBA 3AYCA 3VBFA 1YFYA 4CEWB 2MEV1 4JGYB 2VMCA 5BNPA 3LCPA 3N3HA 4MH0E 5JCTA 2RR12 5C3QA 1Q8OA 2EIDA 4QHZA 1K5MC 3RZMA 2Q5TA 2VL4A 4Y1VA 4YZ4A 4QHBA 4FFFA 4LUKA 5F5CA 5FWJA 3UGFA 2YC4A 4CU8A 3WNPA 1JZ4A 2HWF2 3WDVA 3WW1A 3FHAA 4DNYA 2E31A 2CY6A 3IT8A 4P9LA 1DQ5A 1VBE1 5T3NA 1QOOA 4NPMA 3P3PA 1JU3A 1RUD2 5FP4A 2K46A 1A6CA 4AFAA 3WDYA 5FY9A 1SBDA 1O4YA 5LBCA 1PMJX 1Q5OA 1A8MA 5ABJA 5IHRA 2BNNA 4AYUA 3WV6A 4IEXA 2FZ2A 5FY1A 5FLHA 1XB9A 3T2OA 1FX5A 1IS4A 2XJUA 3ZSMA 4BISA 2MPFA 1CVNA 2P6HA 3OD0A 3RFRA 4H55A 1UMIA 3ETQA 5F5QA 2JDZA 3OPZA 3DXUA 1Q43A 2JIGA 1URXA 2RR11 5DAVA 1O3SA 5IFPA 1SG3A 1UX7A 3P3NA 4OLLA 5FKCA 3G6JB 1VBA3 1UOFA 5LCWL 2W47A 2XGXA 2ZKNA 3E5UA 1DQ6A 5I93A 4CUCA 3KS7A 4Y4RA 5DUXA 1LENA 2D40A 4NRQA 3VD5A 2CWSA 5C5TA 2VAUA 1VBE2 3DYMA 4LOSA 4XJUA 4Q27A 4U36A 5I8SA 3SEEA 2GSYA 1W6PB 1JW6A 4CCMA 2WSVA 1RJ7A 2J1EA 1LHNA 2DCJA 1GP4A 2VZSA 2VD7A 5K8SA 5L7OA 3K4AA 3MHZA 4A44A 4R9DA 1AR82 3PMSA 4B8EA 3K2OA 1SZBA 2XMLA 1EV11 2YFZA 2YV8A 4IQPA 2TEPA 2ZBJA 3F95A 1JTZX 3SQOA 1NE4A 4QX5A 1IS5A 5FZFA 1BVVA 2R061 4UWDA 5J3UA 4IESA 2UWCA 3K3OA 4XW3A 4COWA 3I8TA 3OUHA 4WM7B 3VZJA 1QWRA 4IV1A 5IW0A 2WAAA 1UXZA 2HKXA 1L7RA 2RM23 5D1IA 3RZZA 3I2OA 1W6QB 2UY8A 5L9VA 4R9BA 2BYVE 4X6RB 3RMXA 1O59A 3HVDA 3I7DA 5JZGA 5CFDA 3V0AB 2W2IA 4LPLA 5JOZA 1VAMA 3IWZA 1QJY3 1VBB3 1WA6X 5FZIA 3UL2A 4A7KA 1CWPA 2VNVA 3OUJA 2QBXA 4CDQB 1E57A 2XHNA 1POV0 2KXLA 4HVOA 3AKRA 3ZFFA 3HBZA 2AACA 1HDKA 2B42B 2ZGPA 3NNLA 4BE3A 4DB5A 3PVOA 1H2NA 4LTAA 3H50A 1UW8A 2EAAA 1C5IA 1W2UA 5FZ1A 1AL22 1J3QA 1PGSA 1ZRFA 2OX0A 4Q0QA 2WNUC 3B93A 5IVCA 1UMZA 1WZXA 5A3MA 4FPEA 2ES3A 1GBGA 4Y1ZA 3WXPA 5C5UA 1ND3C 5KC5A 3ZFGB 2VXRA 3PU8A 4KI5M 1VBA2 1W0PA 4GIQA 4MGTA 1YIFA 1HB2A 3EO6A 1V6LA 1V6OA 4AEDC 4B4QA 1HN0A 4QX0A 5FMDA 1NCQB 1RINA 4GJYA 2VOVA 3H42B 3V64A 2DVFA 1ZRDA 4DXZA 3MIHA 4X8NA 4CA9A 4AK3A 2DBIA 5FP8A 2JE8A 4JZRA 3N7LA 3ZR6A 3WP6A 5EV7A 4QXHA 4UW4A 2B5HA 3EHKA 1J84A 1KITA 1OBNA 2JJ6A 2VO5A 4IEWA 3RJ2X 3KF3A 1PIV1 2FDFA 5IFTA 3WUCA 4GA9A 1AX0A 5GLZA 2OA2A 2W52A 4Z82A 2VZVA 1W3VA 2JG8A 3NMBA 3ZYJB 1S2EA 1RYYA 5EIYB 1VPHA 4XHBA 4PLOA 1YC61 2HYXA 4K21A 1DYOA 4XIOA 3K46A 5J7MA 1ENRA 3OBZA 3OGJA 3VHNA 1D4M3 4M4PA 3GXUA 4BK5A 5DABA 2RMU1 2GNTA 3RVHA 1PO13 1QDCA 4PBOA 1C28A 4FTBA 3QOPA 3ILNA 4LKDA 1I6XA 2PLV2 3AM2A 4XUQA 4C91A 4LO5B 5IVBA 2D3SA 1VE0A 4LOTA 2CDOA 3OY8A 1GWMA 2YBPA 5A32B 4CDXA 1S1AA 3RRDA 3PMEA 5EJZB 5JXJA 4QDQA 3AKQA 3FUQA 4YWAA 3I3BA 2QQIA 5ERLA 1WCUA 3C7GA 2J1RA 3AP5A 1VP6A 1LOGA 4QX3A 4YW6A 2A75A 2P37A 3AVSA 4IGOA 3O1TA 2IFWA 4K3UA 1LEMA 1PVC2 1OLME 4XBQA 4XDPA 3ZYGA 4AFDA 1BMV1 3WNXA 5A80A 2AEYA 1FOD1 1S4CA 1RUE1 2CWMA 4FPFA 4IV1C 4EN7B 1MS0A 1CAUB 4YG6A 2CTVA 3BPZA 1DQ4A 4QGNA 3NV2A 4ES9A 4FXGB 3SC7X 2JDYA 1KS4A 1H6XA 2DU0A 3GCXA 3I97A 1UF2C 4DO0A 2VQAA 2Y34A 3JBG3 1AJOA 3GZUC 3MLJA 1UU6A 1PX4A 2VGDA 4JC1A 2HWE1 1TG7A 1NZIA 1PK6A 2A1XA 1N3OA 4IEUA 3ZYHA 3RZGA 3OTFA 4LEJA 5F1RA 5DUVA 5F3GA 5EYYA 3VDDA 3U4XA 4YVSA 3I59B 1AF9A 3JD71 5F2SA 1CX4A 3O1SA 3LPGA 3O12A 3OUIA 3WCSA 3SLIA 2DBNA 2EAKA 4CU9A 4QU1A 1RUC1 3FE5A 4UF0A 4C90A 1NA1A 1PVC1 1S2BA 3VKFC 3PVEA 3ZMNA 2PAKA 1BEV2 1UNBA 1F4HA 1UOBA 2H0VA 2VOKA 4PLMA 5J36A 2O0OA 4Q0VA 5J96B 1H4HA 1AXKA 1LHUA 5FRAA 3VBHB 4UFKA 4LMFA 4F8AA 1AR92 3WG1A 3ZXKA 5KBFA 4Q0PA 2TNFA 5H9QA 2ZHNA 3POJA 3AX4A 1D2QA 2GC1A 4XC9A 4IETA 5JMOA 1SDWA 4IEOA 3GJAA 4LLOA 2QQMA 3ZXFA 3AKPA 1NXMA 4CP1A 2WQ4A 1XNCA 2ZX0A 3IPVB 5FYMA 2WIIB 5C8CB 2G4IA 5FMOS 2RM22 1W2NA 3RWNA 3TNQA 2JD9A 4XXAA 1JYVA 1GZWB 1CQ9A 2HWB3 2D5FA 1K5MA 2JDNA 4XTPA 5FO8B 3H1WA 3ZSJA 4QQOA 3GALA 2E53A 4XPVA 1ZBE2 1ZRIA 1LRHA 3DL3A 5FMBA 3HNMA 1DGWX 1WW7A 4J25A 1Y7BA 2GMEA 2X8KA 2BFUL 4TSVA 4UBGA 3BGAA 3T2PA 1LOCA 5CEHA 2WT0A 5A7OA 1VLNA 4RD7A 3BU0A 2DF7A 3IMNA 4BQ2A 1UL9A 1YXWA 3M8LA 1DIWA 1R093 1US3A 4L9BA 4OQ8A 2BGPA 2CU5A 4QPGA 1W9SA 2OXBA 4QT6A 3GDBA 3L2YA 4KGQA 2BW8A 2ZMKA 1NLRA 3ZXGA 5IK4A 4XJWA 1SCRA 3SCGA 3NAPB 1ASJ2 4XF1A 1ND2B 1V6MA 3A4UA 1CJPA 5A33B 1NCRC 3AFKA 4FPGA 4CCLA 3ATGA 4GKYA 1HQNA 2PHRA 5FXXA 2ZZJA 1XOYA 3CU7A 4WVMA 4CCKA 5A3NA 2X5IC 4P9WA 3DUIA 2P2KA 5A32A 4AL9A 5L73A 5LEJA 2XG3A 3J4UH 4X8PA 3N9LA 3THCA 1KDMA 3I2IA 1Z7S1 4K1ZA 5FZ3A 4CDUC 5FOBB 5JUVA 2JECA 3AMQA 3FFZA 1YQ5A 1NOVA 5C8CC 2UWAA 1V9U1 1J59A 3E1F1 5FPBA 1W9FA 3ZFGC 5FYBA 2J22A 4PIZA 2VUAA 1EY2A 2B7YA 1Z7S3 4FVVA 4CVUA 5AFEA 2EIBA 2D97A 4BQXA 2RMU3 2NYYA 4D6RA 3V56A 1PZ9A 1RUJ2 1QQP2 3HWJA 5LY1A 1ZA7A 2P3YA 1BJQA 3BOWA 2DWRA 4CUBA 4GULA 2DCZA 4QPIB 1RXGA 5BV6A 2Y60A 2WINB 3OBRA 3IB3A 1RUC2 5FQ0A 4CDUB 4KU7A 1DDLA 1E5IA 2R30A 2B39A 4PIYA 4OMDA 5HV4A 5FZAA 3VBUB 1S0FA 4HK8A 3MIBA 1RHI1 5DMYA 3R4UA 5B4NA 2BV4A 1RUG2 1MS1A 2EALA 4M4RA 4DEQA 1RB8G 2WFPA 4RGAA 3OPWA 4H7LA 2XONA 4YW1A 1H8TC 4UFMA 1XC6A 3LIHA 4OUMA 3WW2A 1ZZ8A 3NKGA 1XE0A 2ZHKA 3I2JA 5E8AA 1TQ5A 1F5FA 5FCCA 5I0UA 5KWRA 2AUYA 3I2KA 2VC9A 2ZXQA 1W6OA 2NP0A 4Q4Y1 1LHWA 4HMZA 4AEJA 3QCWA 2ZX2A 1JZ5A 2W3JA 4YFZA 4O7XA 5T50A 2O8QA 2XWJB 3POGA 2OQ7A 1EV12 3T0BA 2CHHA 1V70A 1BEV1 2Y6LA 1Y9GA 2Z4FA 4NROA 2C5DA 4ASKA 3TN91 3CZJA 3KVAA 1LJ7A 3WHUA 2R062 1H1IA 2AZ5A 2ORZA 5AVPA 4ARYA 2QQUA 1RUI1 2DVBA 4K40A 3ZYBA 2VOXA 1H1AA 1R083 2ZOEB 5FKBA 3LOIA 4B1MA 2DV9A 3J7MA 4YZ2A 2Y26A 2WA3A 2BERA 2GN7A 4UOJA 2ZGSA 5LK5A 2R043 1DYPA 2P5BA 3NJYA 2WNVB 3NO8A 4BHPA 1EP0A 1X8MA 2VVDA 2GC2A 3AXDA 3WNLA 4YM2A 1IPJA 1UY0A 5E88A 4QB6A 1WW5A 4HN1A 4XCAA 2OW4A 1AYM1 4JAAA 4UT5A 1G9CA 2VTXA 2XVKA 5LBBA 4NIAA 1F2NA 1WMEA 4AE2A 3S5QA 1WBFA 1HX6A 3Q8FA 2E51A 2NLRA 4XUNA 4AFBA 3B69A 5JR2A 5LW9A 1EAH1 3RGBA 4L92A 1GOHA 4HPKA 3AZXA 4Q4V1 2VBPA 1MEC3 2P3KA 4AI1A 3AP6A 1JH5A 1YFWA 2ET7A 1SFNA 4JDMA 2JE9A 5LA9A 4YG3A 2R072 1ND2A 3CJXA 4COUA 1E5HA 5FP9A 5HPOA 5BNOA 1YI9A 1GNHA 2WLPA 2B46X 4I2OA 2W1SA 2PTMA 4CCCA 2YGMA 5FJKA 2R0HA 3CEWA 4XJ9A 5IUQA 1QU0A 3NQHA 1IHMA 5F2WA 3O1PA 1FAYA 3FWEA 4AR2A 4KWJA 5C4WB 3LB9A 3HNBM 3BTYA 1GQGA 4JX0A 1U12A 2ZZQA 2Y6HA 4N53B 4FI9A 4GB31 4DRVA 3D8CA 1DGRN 2CAVA 4C0BA 5JOWA 1FOD3 4DUVA 5I8TA 1O4ZA 3OG2A 1QQP3 4Q4W1 3Q8CA 4A7YA 1QH6A 3Q8BA 1QNWA 2OVUA 1IPKA 1EAH3 2ID4A 4JGZA 4CEWC 2ZGQA 4JHZA
chains in the Genus database with same CATH topology
4N9HA 3S7IA 1XQNA 2GALA 5SV8A 3FC0A 2ZMLA 4LE3A 3O7OA 4MGIE 1OQ1A 3L9JT 5EWSA 3BALA 2FHRA 3ECQA 1KJLA 4M3CF 3B9IA 4ISRA 1AR72 5D8AC 4ZU7A 1B35A 4KNCA 3ZXLA 4UXAA 3D6EA 1PM7A 2XWBB 3TWIA 4PDWB 1OA4A 1MS8A 4BWOA 4M01A 3VBFB 1V6IA 3V0BA 3RYPA 5KHGA 4HLTA 3AJZA 3ZPYA 3H3ZA 4F7ZA 2R1DA 4LBLA 2HWD3 5F6KA 1HRI2 4WVZA 4D69A 1GLHA 2BEOA 1RUNA 3JZVA 4OI2A 1G6NA 1VAVA 2BVBA 1FV2A 2XBO2 1QDOA 2YZ4A 4AEMA 4R4ZA 4XQ4A 2DVDA 4COVA 4R8HA 5HCAA 1RUH2 3RMYA 3JBG2 3WD5A 4M3CA 1VBD1 4GH4C 1D0HA 4W6XA 5L7OC 2HWD1 2OUJA 4BLJA 2A6XA 2RE9A 5K7PA 4OHWA 3TN92 2MNGA 1KS5A 3M1HA 4XFIA 5F9TA 1SLCA 3WOGA 1HV1A 3NV3A 3T1MA 3AZYA 1H0BA 2H6BA 1COV3 2ENRA 3ZYIB 4MV2A 2WQZC 4QPIA 2WSUA 1RVF1 1HLCA 1C1LA 4AGRA 5BXXA 1TEIA 4FOWA 5FFOC 4XILA 1YIPA 1U5XA 2JXAA 4L8QA 4Q4X2 4HKWA 4K7JA 4GQ7A 1PNFA 1RUF1 3VGIA 3NKTA 4L11A 1XE8A 2RM21 4QPGC 3LA3A 2VVFA 4MZUA 2UURA 4CP2A 3Q9OA 4NO4A 5ABJC 2ZX3A 4MGYE 1NLSA 1LU2A 5ACA1 1SLBA 4XF0A 4LULA 4FPKA 1NY71 1SACA 2XVLA 3SXWA 2Y38A 4KQ7A 4YYOA 1WMDA 4WM7C 1CJDA 1LEDA 4WM8C 5J37A 1DF0A 5K0UC 1FT9A 5BNPC 3EXUA 5JPMB 3HIFA 4BM8A 2DU1A 3H1MA 4Y26A 2GNMA 2HWC1 4FP3A 1QHDA 3TYJA 2ZGOA 2JENA 3B5LB 2XLGA 3ZXAC 1WA4A 5BNNB 3BU7A 5KHJA 2Q1MA 1RUJ1 2ET1A 1BZWA 2K9ZA 4EN8B 2OZ6A 4Q4V3 2EF6A 3ZSEA 2UYAA 4Z07A 2Z79A 1BKZA 4LO6B 2VMIA 1BXHA 1TMF3 4B4PA 1SMVA 1WD3A 4WBBA 2XKOA 4CDXB 2CGPA 3TNPB 1SLIA 4HPKB 1AXZA 4B29A 3WQ1A 2GMMA 4BIFA 4W65A 3A0KA 3RPQA 4M3CE 3S7EA 4LBNA 5F6LB 4YVSC 2EA7A 3OD4A 1LGCA 1NCQC 1CAXB 2R041 1PGL2 1PK6C 2F4PA 2FMYA 4OI1A 1PNGA 2PHUA 2B8MA 1D4VB 3MIEA 4AXOA 3RS6A 4BOWA 1DQ0A 5DG2A 5L7OB 4DMIA 2X5IB 2BNOA 3HR9A 3MLKA 4FTSA 3VBHA 1PVXA 4IV3C 5GLUA 1NZCA 4QXKA 5JSOA 1DG6A 4QPYA 2D93A 4M3CB 4FPYA 4EN9B 4YZ3A 2XJQA 5DDJ3 3SH5A 1W6MA 4BA6A 5E16A 1RUH3 1LOFC 2QQPA 1RMU2 1FPN1 2UY9A 4OZXA 5C33A 5CADA 1B09A 4BLIA 4OUSA 1DBNA 1X8EA 3H3UA 5BYNA 4UBHA 3JBG1 2WLQA 2XPJA 2WA4A 1GZWA 3ZFEA 1LOBA 3MZHA 2GNDA 4AVTA 5A3LA 1TME1 5DDJ2 1ENSA 3KSCA 1POV3 2HWC2 3THPA 2NMOA 1RUE3 2DVGA 5DZFA 1EYBA 1R1A3 1DLLA 4FOYA 1X50A 4K8FA 5AVAA 1RUI2 2HWF1 1WLWA 1IQAA 2Q8OA 1ULFA 1VBB2 2QNKA 4BCUA 1AUYA 1XXNA 3WT3A 4AFMA 3TOJA 3J8F1 1LOFA 4GH4B 4C1XA 1QY4A 2LTNA 3ACLA 3LA2A 4KWLA 1RITA 1REDA 1Q8VA 2XJTA 4FSJA 5CFCA 4MUVA 2ZKLA 5E1RA 3VBHC 1PO23 2V09A 4R9AA 3JQXA 4XMAA 1CPMA 3H1YA 3RI8A 4AI8A 1PK6B 3ZXEA 1M4WA 1C8M3 1PZ7A 1BQPA 3RYKA 5JOYA 1V6KA 3VBSA 4RGGA 4HL0A 3AKSA 2C1FA 3N35A 1ND3A 1GZ9A 3WDUA 4OI0A 2VY0A 3FFQA 1GSLA 1XNKA 1VRH1 4Z1VA 3KB5A 2I45A 2D6MA 3DPRC 2UU8A 4AFCA 1MACA 4QQ2A 5FO7B 1ZBA1 4MXVA 3FZ3A 3IN9A 1W6PA 4MGZE 4YGCA 4AF9A 4YM0A 3ST7A 3WVJA 1CPNA 2RS31 4IEYA 3PTYA 3VBRB 2QKDA 3KGZA 4WVVA 4GKXA 4ZU5A 5JZGC 2RHPA 1N47A 1OA2A 4LO4B 3VKLA 5CFCB 2WNVC 4H3WA 4H7MA 4FPCA 1H2LA 4XFAA 4O9GA 3DGTA 4RHV3 2GNBA 4BQ1A 5HXVA 1AL21 3L2HA 4ES8A 1WW4A 2HEVF 3MFCA 1I3HA 3BB6A 3JUUA 1N1SA 5C4WC 1VBB1 4UW3A 3HQXA 4AI2A 2JICA 4E27A 3DN7A 1WCDJ 1H8VA 3TB0A 5FOJB 3H7YA 1DQ1A 4MLOA 3JD72 2W0XA 3ZYPA 1ALYA 1KFXL 2ZACA 2YYOA 2HWF3 1W6QA 2A6YA 4K20A 4QPGB 3FLRA 1SLLA 5FPXA 1COV2 1TME2 1UPIA 4XJZA 4P5HA 1GICA 5IK7A 3BOPA 2WWSA 1RUC3 4EROA 2AH2A 3WG4A 2A71A 1JBCA 2AYHA 2YMZA 3KGLA 2RMU2 2HWE3 3KM5A 5LRSA 1RTVA 2DUOA 4UW5A 1RUF2 3GF6A 2UWBA 3ZFGA 3ZO0B 3TAYA 5JIUA 3VHOA 3WCRA 2PFWA 1U5YA 5GZGA 1W6MB 4ITCA 2DVAA 2Q0AA 2VUJA 4AW7A 1DFQA 1I1EA 3AMNA 1C1FA 4I0WB 3B00A 3JB4C 1YO8A 4ZKTB 1JYCA 2DTWA 4DINB 3KMHA 5FLIA 1S0CA 4HT1T 1OKQA 4E4SA 4XFFA 4FPJA 1OPMA 1Z7S2 3KT1A 3MI8A 1QJX1 4DRRA 1I5ZA 5JDBA 4LE4A 3QACA 3MYXA 1GYKA 3KT7A 3VBSB 2HEYF 1HRI3 1QNYA 1BK1A 1PIV2 3KT4A 4XQDA 3J9SA 2MEV2 2IXJA 3GZAA 2BWAA 5HI0A 1H1MA 4N43C 1JHNA 1YLLA 1AX1A 2YY1A 1D4M1 2EIGA 1VBE3 2C9AA 2JE7A 1CAVA 3MIFA 3E6DA 4PLNA 3U0ZA 3N7KA 1MQTC 4CDQC 1HQLA 2LM3A 3V65A 1S0JA 3WP3A 2ATFA 3O5SA 3NAPA 1J1TA 2I74A 4ONUA 2RS33 5FO9B 3VZNA 1G9DA 4OHVA 1ZBA2 4XFGA 5C4WA 1FNZA 4TYSA 3VBOC 1SLTA 4JGYA 5I0SA 2BTVC 1LHOA 1ZBA3 2IC1A 4HETA 1MS4A 5J48A 2XHKA 3LOBA 2RS32 2XJSA 5JLVA 1WCKA 4B3NA 1RGSA 1LU1A 4LBKA 4A7ZA 5EYXA 5GJ6A 1AR93 1YUDA 2AREA 1H4GA 5KXCA 1C8M1 2HWB2 4K1YA 4NOTA 2CNAA 5IK5A 3W9AA 1TNFA 1ZBE1 4E9KA 2D44A 4HK9A 4M0HA 1GANA 2DYCA 4V1PA 1F8VA 4JDOA 2CL2A 2JG8B 1LGNA 4NVPA 4BMBA 2R073 1YJLA 4D94A 3AZZA 2ZGLA 2PELA 4HZFA 2F6BA 1YJKA 1O3TA 1UU5A 4I0AA 1H2MA 4FPLA 4YZ5A 1BMV2 5T5LA 4Y24A 2B9UA 3ROUA 1MZEA 4QMAA 1FMD2 4RHV2 3FLTA 4IXLA 4SBVA 4JQRA 3TRSB 1KXGA 3M3QA 2CGOA 1N3QA 3R4SA 3E6BA 1VBD3 1AYN1 2D6OX 4YLZA 4YVWB 2D3RA 1A8DA 1W0OA 1RMU1 5JWPA 5DUUA 3POYA 4QU2A 2RS11 3URFA 4E2SA 2PHFA 3MDPA 5GZCA 3BODA 1H8TB 1AX2A 2R16A 2VNGA 2AR6A 4I02A 4INDA 2IXIA 3FJSA 5JZGB 3PVBB 5EZWA 2QVSB 3RI9A 5B2GB 3B01A 4PDWA 2DCTA 4HBNA 4QM9A 2JG8C 4MXWA 3HMYA 4CP0A 3WW3A 3LSEA 1ULCA 5C9AA 1BCXA 4PCRA 4XBLA 3DKWA 4FP2A 3PNAA 1PO12 4PQ9A 1ZREA 3AP7A 1X7NA 1XRUA 1GV9A 4GB32 2HYKA 1TMF1 4Q8LA 1DU3D 3NW4A 1S0BA 3RSJA 2O1QA 2ZPXA 5J98B 4Q1RA 3E5XA 3ASIA 2XB6C 2ZX4A 3K48A 1LESA 1BBT3 4I30A 4LNVA 4QD2A 1ENXA 4GXLA 2HWC3 5TSWA 3VBOA 2MEV3 1FNYA 3WG3A 1EPWA 4AVAA 1NQDA 3M3IA 1SFYA 2ZGKA 3ZFFC 1IZ3A 3DV8A 2RS13 1DHKB 4YZ1A 3WP4A 2ZTNA 1YNAA 3IM0A 3I4IA 5JMCA 4NR1A 1O3QA 5AC91 2XH6A 1C3HA 4Q0UA 1ZA4A 1ZRRA 4AQ2A 3OYWA 4CRQA 3G7DA 5DZEA 5KHIA 3NSTA 1IOAA 4I3GA 4N43A 1QOSA 4LO7A 5K9YA 3LKJA 3AB0A 1ZZ9A 4W6YA 1PO22 2E63A 5L36A 4YW5A 5CA6A 5FDBA 1CAWA 5JSPA 5J09A 3USUA 3IDBB 3CF6E 4AVCA 1R092 2Q30A 1VR3A 3FMGA 4WM8A 1LCLA 3AMMA 5H9SA 2IXKA 1RUF3 3GBWA 3MFAA 5KHHA 2OUHA 1NG0A 3QD6A 3ZN6A 1OFSA 5T5PA 4P9JA 2Z5WA 1RIRA 2ZGUA 3K51A 1UIJA 4AEDB 4COYA 4AWDA 4NHMA 5DXDA 1UZZA 3PJQA 4CTEA 2IFRA 1MR5A 1ZBE3 1CR7A 2IXCA 1AYM2 1SBEA 1VALA 5HBAA 4RHV1 4Q29A 2CGNA 4AHXA 3TBDA 4CEYA 1WBLA 2A70A 1PGW1 3WY6A 3JB8A 3C2UA 2YGLA 2OYZA 1SCSA 4XBNA 2YC0A 2Z2SB 2D6LX 3OYWB 1JOJA 3I59A 1QJZA 1AR83 4Q4Y3 3VDDB 3S6PA 4YVSB 4ASLA 4ORFA 1CESA 2BWCA 3EQEA 2GN3A 3LAGA 4FPOB 4XE9A 3VBUC 1AVBA 1ENQA 5K0UB 1DQ2A 2WZR1 3UKNA 4RR3B 4DY5A 2QDRA 5T54A 1LULA 4KH9A 3PVNA 2KM2A 1J3RA 2VVEA 2D43A 4I0BA 3IIAA 3NWKA 4Z8BA 3ILRA 1PGW2 3RG0A 1HIXA 2G9FA 3FBMA 1OOPC 4Q4W2 1Y9QA 4EWEA 3A0NA 4RQPA 4C1WA 4MVTA 3QH6A 4WZFA 2P3IA 1RC6A 4CEYC 5DG1A 2K0GA 4IV1B 1V9U3 3UJQA 2BNMA 2HJIA 1HXS2 2XJPA 1AXYA 5BNQA 1O91A 3WINE 3D4KA 3PLQA 4HN0A 3ME2A 3VBFC 5CBLA 1K5MB 2A5ZA 2WNVA 2GAUA 3AZWA 1OHFA 1TMF2 3MPBA 2WZR2 4G9SB 1AR71 4JGZB 4GMP3 2VG9A 1Y43B 2E7QA 4W6WA 5CVRA 4DZGA 4XFBA 2X29A 3MIDA 1MQTB 4J1WA 2JG9B 4JRLA 3RQ0A 5CG9A 2N7GA 4AI0A 1KRIA 2FBEA 2H6CA 1HRV2 5I0TA 3SISA 4HVQA 3FUOA 4S2HA 3WQ7A 3FHIB 1F31A 4OVEA 1QH7A 3DPRA 3GZTB 3HT2A 3VKNA 4TZDA 1JXNA 4N43B 1CAVB 1VBC1 1H30A 4S2FA 2NZ9A 2P17A 5KHKA 4KU8A 1UKGA 4Q4X1 1S0GA 3QH7A 4O9EA 1S55A 3CO2A 1O7FA 4LUMA 3VBSC 1WLDA 3USSA 4AVSA 2TBVA 1H9WA 1LHVA 1MEC1 3CJIB 4M00A 1REFA 1ZVFA 4I3PA 5IT6A 3IPVA 1LTEA 3IDEA 4IEZA 4PF5A 5CB7A 4C0HA 3UJOA 1DZRA 5JI9A 3E5QA 4CDWA 4AEDA 5BNOC 4QGMA 2PYTA 1ND2C 4LHLA 2BPA2 3E6CC 5EFUA 3O14A 3W58A 3AMHA 1FATA 4AVBA 1GFF2 1RUG3 1NXD1 1Q3EA 2ILMA 2BUKA 3D0JA 2PHXA 2ARXA 1R081 4XDQA 1AL23 4Z2WA 3QLQA 3WLUA 4EN6B 4EV0A 3C3VA 2BVVA 2NMNA 2DCYA 4LHKA 1CD3G 3TN93 3SCFA 3RNSA 1W6OB 4N90A 3POWA 3AJYA 4PDWC 4YW2A 3B94A 4FQZA 1RUJ3 4YM1A 5GLVA 2XLFA 3VZLA 5CFDC 1C8NA 4XTMA 1G9BA 2PLV1 3WP5A 4RL7A 4PIXA 3CL1A 3LSDA 2XBO3 1O3RA 1YRZA 2RS12 3H7JA 3ZIXA 3R6SA 3VV1A 2HWD2 4IV3A 3JU9A 2X53S 1LOAA 1QJU1 2A3XA 3D0SA 3M3OA 2OPKA 2WKKA 3BIWE 1OLQA 4XIKA 4RA0A 1SLAA 4MYEA 2WS91 1NCQA 1Z78A 2SLIA 4HSLA 4JCKA 4LBOA 3M2MA 4Q4V2 2A3WA 3WR0A 5JSRA 4Y20A 4E2QA 1AR73 1LECA 4SLIA 3N36A 4D7SA 4LT5A 1V00A 4FQ4A 2ZGRA 3GBGA 1Z0HA 5I91A 4Z92B 1JYIA 4AQTA 2WT1A 2ZGNA 4LBQA 1S2KA 3GNEA 3M3CA 4RS5C 3R05A 5FTTC 4DB5A 3WX5A 4N9IA 4P9YA 4L99A 1KD7A 1PO11 2CYFA 1PMIA 5GKAC 2NM1A 1RVF3 2VPVA 1QXJA 1YHFA 1COV1 2WS93 4B7EA 1J1LA 4EWAA 2HEWF 4D3WA 4CDWC 4Y5Z0 2I07B 1U0AA 1R1A1 1KDKA 1EPZA 4ISQA 3SHRA 4I09A 1POV1 3T2TA 3MIGA 3WQ0A 2GU9A 5BNPB 3UV9A 1T6GC 1TME3 4YM3A 2R49A 4Y22A 4RR3A 1OLRA 4AG4A 4WM7A 4FAGA 2LALA 2ZHLA 4P9GA 4JVAA 4NWWA 3B02A 1DYKA 4HSJA 4WZCA 1UIKA 2XVGA 3J8F2 2GDFA 1YI7A 2D5HA 4BMEA 3ZN4A 1RUH1 4FAHA 1NCRB 2EXJA 2WT2A 4BIOA 1O5UA 1VB2A 2PAEA 4JGYC 1X82A 1ULGA 4FPHA 4XF4A 3ZMOA 3M70A 1FMD3 4N7UA 2WFF1 4GALA 3ZSLA 3KZ4C 4WVWA 3VL9A 3AP4A 4IEVA 4AHYA 3ZFFB 3N7JA 2DURA 3SITA 2GH2A 2VNOA 1GR3A 2VMHA 1PGL1 1VRH2 4OULA 1APNA 2GMPA 3HN1A 4OHXA 1XNDA 1OQEA 3LGRA 4YNIA 3U10A 3LZZA 1MVQA 4AVVA 1AJKA 4XYXA 1ASJ1 1BVP1 5D8AB 1AR61 2OIIA 4JRAA 2R0FA 4OHYA 3EJKA 1PVC3 2A6WA 4Y1UA 3KCCA 3HD8B 5GZFA 2DFBA 4PJYA 2IZWA 1UPSA 3H8UA 1A3KA 5AC93 1ZZCA 1C57A 4CZSA 2AENA 3H9AA 2EXIA 2V5YA 3IKWA 3D82A 1WGPA 2ZMNA 2Y0IA 1O5LA 4ZU4A 5JOXA 2RJKA 5JAXA 1Q8SA 3KLSA 3MEPA 2TUNA 3VBUA 5GALA 1AZDA 3MF9A 1NQJA 1AR62 1ND3B 1QXPA 1H2KA 1G7YA 2SBAA 5CIRA 4K9SA 4RFT0 1VBA1 3SCHA 1B35C 2D6NA 4LA2A 4EJRA 1NY72 3N4MA 3RYRA 2JKBA 1AR63 1SQ4A 2NPIA 1UCXA 1YFXA 4YFWA 1OQDA 4Y1YA 4OFGA 1W6NB 3KCYA 4OI4A 3WDWA 5JPNB 1WLTA 4ZXKA 4ATFA 4K6BA 1MZFA 3WDXA 1QGLA 1XYOA 2DTYA 2E6VA 4JGZC 5EXOA 3UK9A 5C6CA 2QUOA 4Y1XA 4KWKA 2P3JA 2ZAHA 2QZ3A 4E4DX 4RR3C 1KJRA 1MZ6A 1YWKA 3BTAA 3ENRA 3U11A 3VL8A 2DUQA 1N1VA 1FMD1 3VZOA 3VLBB 4UW6A 1BEV3 1M06G 1LODA 1PIV3 1RL3A 3WZ1A 1D2SA 3R0RA 2WFF2 4YW4A 2E9QA 1Y3TA 5IK8A 1JN2P 4YRDA 3NJZA 3AMPA 1XU2A 4L97A 5HCFA 3NV4A 1YCIA 4XETA 1ZM1A 2ETEA 1RMU3 1LB2A 3ZXDA 1BYHA 1FV3A 1AR81 5T55A 1LOEA 4LHNA 4AGGA 4DOUA 1AYN3 3VHPA 4Q26A 4RS5A 3DPRB 4XMIA 4YGEA 4Y22B 4J6GA 3AFGA 3MF6A 3MGUA 4KL1A 1R082 4HANA 1N1YA 2VQ0A 3WDTA 2CV6A 1UAIA 2G9GA 4YGBA 4JV4A 4LA3A 2PHDA 3PJYA 1C5HA 2ZS6B 5CU1A 4FXKB 4R52A 1HKDA 3AYAA 2VW1A 3CJIC 1C4RA 4LBMA 4P9XA 2HWE2 1FXZA 1CAXA 1TE1B 2VULA 2D3PA 4NWVA 2E7TA 2FMDA 1OPOA 1V9U2 2VU9A 3B9CA 1BBT2 1Q8PA 5C9AC 1H9PA 1UX6A 1L3JA 4GMP0 5LK7B 3KCXA 3VZKA 1X36A 3I2DA 4FOQA 2PN5A 2ARBA 4E4ZA 1RUOA 1QQP1 4Q4W3 2Q4SA 4JTOA 3ZFEC 2JG9C 1AR91 2WS92 4GB33 2K2SA 5H9PA 1H8TA 2QZ2A 1QJX2 1QJU3 1Q56A 5H9RA 4WVMB 4X6QB 3X29B 4AQSA 4LBJA 2ZX1A 1ZZ6A 1J58A 2VECA 4FBFA 4LBQD 1ZRCA 1HV0A 3V0BB 3VHRA 4BH9A 2YDEA 4WV8A 3B7MA 2QFEA 4BZ4A 2KA3A 4L2NA 1CAUA 1AHSA 4XF3A 1CN1A 1BBT1 1UU4A 3ELNA 1U5IA 2D98A 2CAUA 3MW2A 1DGLA 4AI3A 1A78A 5CG8A 5BNOB 1I9RA 3SNMA 2GZWA 1PHMA 1W6NA 2H0BA 3VKOA 1V6JA 5L19A 1FYUA 3ES1A 1ZYBA 5E89A 2RR13 1ASJ3 2IWGB 4IL7A 1NYWA 4KGGA 3WUDA 1ZNPA 1AYM3 1HXS3 5I8YA 2ZGTA 4HKLA 1MVEA 2D7FA 5JR7B 5DZGA 1GNZA 2D6PA 4AQ6A 3GHMA 4P9IA 4FOVA 2AGSA 1N1TA 2XL9A 3OBTA 3R4DB 4DPNA 1XNBA 4PBPA 1QJY2 2V73A 3HT1A 1D4M2 1IKQA 1VBD2 4Q8KA 4Y20B 1G9AA 4QQLA 2RS53 1LGBA 2PA7A 4NN0A 1OOPB 4D7YA 4CDWB 1S0EA 4HKOA 1RUI3 1C8M2 2DFCA 2VH9A 2WFF3 1IS3A 4D7TA 5KXDA 4LO8A 4KBBA 1G9FA 4LBQB 4XOGA 3OY8B 4J1XA 4AGVA 2WNEA 5KXBA 4F83A 3UKTA 5K0UA 1WD4A 4RS5B 4IEQA 2ZCWA 2D6KA 4YW3A 1DGRA 4MX3A 3ZSKA 1ZX5A 3ZX7A 5GZDA 1HW5A 2IXHA 2A7AA 4YVWA 2RJLA 3VBRA 4QQHA 4AEKA 2JEMA 4EWDA 4XEZA 1MZ5A 1NE6A 1ZZBA 5C8WA 3SMHA 1KFUL 1RHI3 3M4FA 3MICA 3VBOB 1REEA 2VW2A 1XYPA 3OF1A 5FMOL 1DZQA 5ABJB 4TWTA 2A6VA 1XE7A 1IGOA 4S2DA 1RHI2 3QBQA 4RQPC 1EAH2 3S0MA 1OOPA 3VBRC 4QM8A 4YVWC 1QKQA 4CDQA 1MQTA 2A73B 1FI2A 1FOD2 3LA7A 4GMP1 4XFCA 5FPZA 2YUEA 4A3XA 3E97A 2Z69A 1F9KA 1UD1A 3PHMA 3ZYRA 4DFSA 3THTA 1B35B 2R071 5LRRA 2QCSB 1D0GA 2R32A 3OCPA 3SH3A 3ZXJA 4AHZA 5T5JA 3OGGA 1DZTA 1YFUA 4XQWA 4JTNA 2IXLA 1GKBA 5EJ3A 4A2UA 5LEKA 1NA1C 2PHLA 2NN8A 3AK0A 1VAKA 2YROA 1R1ZA 1MS5A 5AC92 4M0NA 1QXRA 4P14A 2YPJA 3AXEA 4GH4A 3HAGA 1TNRA 3VDDC 5T5OA 4ATEA 5HCBA 3ZN6B 3WG2A 2RS52 2OZJA 4QPIC 4QGLA 4CYDA 1ZZ7A 4ASMB 5KC6A 1CIWA 4N53A 4IV3B 1GZCA 2WZR3 2JX9A 2A6ZA 1JUHA 2C0ZA 4COZA 1IKPA 3O0VA 4Q1PA 2BQPA 4B7KA 3NV1A 3M3EA 1CONA 2WC2A 3CNAA 1R091 3ES4A 4HFSA 3KD4A 2E7AA 5JI7A 2XBO1 4QQPA 3RJRA 3IDCB 2PLV3 1VRH3 4XJAA 1N3PA 2ZABA 1KQRA 1MEC2 3AYEA 3S30A 2QJVA 3SH4A 4KG8A 4N7IA 3JCIA 1IS6A 3JQWA 4NPRA 1JUIA 4LLFA 3ZVXA 1Q8QA 5D8AA 1S0DA 2HWB1 2JD4A 2QE3A 4CDXC 2EXKA 1DGWA 4F3JA 1ONAA 1PO21 4H14A 1OI6A 2A3YA 4FO9A 4R4XA 4XF9A 1HRI1 2XL7A 1RUG1 5CNAA 4FTEA 1QJY1 1CGPA 2Z42A 2GH8A 3EBRA 1QJX3 1QJU2 5KXEA 4XJ8A 4MXWB 1RUD3 3J8F3 4XHXA 2JG9A 4RQPB 4GWNA 4Q4Y2 2W08A 1J3PA 5AFBA 3USUB 1WCSA 3WW4A 1OFNA 1CAWB 3GYDA 4WM8B 3BCWA 1VJ2A 1YYNA 4S2GA 4GWMA 3GHNA 3ALQA 1SEFA 5FLJA 4DQAA 3FX3A 4CEWA 1MS9A 3JD73 5ACA2 2VOWA 3POSA 3AYDA 1AYN2 1RVF2 4XZPA 1NA1B 1LKNA 4Q4X3 5FAXA 1ULDA 3AP9A 3CJIA 4CEYB 2XUMA 1VBC3 2NQYA 2YHJA 5BNNA 5GLTA 2ZAAA 1FPN3 1QMJA 1X33A 1WUVA 2WNUA 5I0RA 1QOTA 3ZN5A 2EXHA 1OSGA 5DDJ1 1MS3A 5FBZA 3INAA 5FQ0B 1V6NA 2UYBA 5JVVA 3VN4A 2PHTA 4HVRA 3MW3A 4YSFA 3VZMA 2P34A 2XJRA 4YGDA 3N7MA 5T52A 5BNNC 3T1LA 2WZPP 1RJ8A 2RS51 2BBVA 2LUWA 2Y0OA 1HQWA 2XLAA 1RUD1 4RSUA 2FZ1A 2Q1ZB 1G86A 1OMIA 2VNRA 3MLLA 1WW6A 4R9CA 1OA3A 2ERFA 5CFCC 1HXS1 1WMFA 2DUPA 4FCAA 3AZVA 4DS0A 5DUWA 1S0IA 3IBMA 3NVCA 4YARA 3M7AA 3GBFA 4BYYA 1SBFA 4IEPA 5BPXA 3VKMA 1ULEA 3LWCA 1F5JA 1GQHA 2I2SA 2GC3A 5SV5A 2PAMA 2R6QA 2WL1A 4URTA 2YXSA 1LR5A 3U07A 4B4RA 3D5OA 4XXPA 2PQQA 2W68A 2DCKA 2ZGMA 3NL1A 3WHTA 1AL0G 2MHFA 2VW0A 5GZEA 3RDIA 2PHWA 3MW4A 3J26N 2QDNA 2XJVA 1FPN2 3W59A 4G4FA 3H0OA 4AHWA 1VBC2 3DF0A 4NHKA 2BGCA 3VUOA 4DY3A 4I01A 5CAZA 2B45X 4Y4YA 1UN1A 5ACA3 1R1A2 2BFUS 1VIWB 4G3YC 1HRV1 5C9AB 1RUE2 2ZA9A 5BUVA 2EVXA 2VMGA 4KG0A 4FT8A 5C8CA 3O0XA 2ZJCA 5GM0A 1UZYA 1U5ZA 2XKPA 3FBYA 3ZIWA 4CDUA 1XYNA 1UKRA 4MGKE 4JDNA 5JIAA 4N53C 2W39A 5GLWA 2R1BA 2X5IA 4NHLA 5BY5A 4BPZA 2GC0A 1VB4A 1O4TA 4TLFA 1OD5A 5CFDB 3V0AA 4U2AA 4Q2FA 1W39A 1G8WA 4XFHA 3O0WA 2R063 3FLPA 3OJBA 4OHZA 4EN0A 1HRV3 3ILFA 4LR4A 2FQPA 3MPPG 3NAPC 4META 5FREA 2O8OA 2WNUB 3AKTA 4Q0SA 1EV13 3B3QE 3ZFEB 2ZHMA 3I54A 4IERA 4YG0A 4E2GA 1WLCA 3ZDSA 2WJSA 1XU1A 1NCRA 3UKVA 1QF3A 2R042 5A33A 3CLPA 3KQRA 1PZ8A 4MSVA 3APBA 3AYCA 3VBFA 1YFYA 4CEWB 2MEV1 4JGYB 5JCTA 5BNPA 3LCPA 3N3HA 4MH0E 2RR12 1Q8OA 1K5MC 2Q5TA 4Y1VA 4YZ4A 4QHBA 4LUKA 2HWF2 3WDVA