3JQXA

Crystal structure of clostridium histolyticum colh collagenase collagen binding domain 3 at 2.2 angstrom resolution in the presence of calcium and cadmium
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
117
structure length
117
Chain Sequence
YPIGTEKEPNNSKETASGPIVPGIPVSGTIENTSDQDYFYFDVITPGEVKIDINKLGYGGATWVVYDENNNAVSYATDDGQNLSGKFKADKPGRYYIHLYMFNGSYMPYRINIEGSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ColH protein
publication title Structural Comparison of ColH and ColG Collagen-Binding Domains from Clostridium histolyticum.
pubmed doi rcsb
source organism Clostridium histolyticum
molecule tags Cell adhesion
total genus 23
structure length 117
sequence length 117
chains with identical sequence B, C
ec nomenclature ec 3.4.24.3: Microbial collagenase.
pdb deposition date 2009-09-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.380 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3jqxA00
4DXZA 1WMEA 2XVLA 1QXPA 1KFXL 1NQJA 3JQWA 1DF0A 4DY5A 2O8OA 5FBZA 1WMDA 1U5IA 2XVKA 4DY3A 3JQXA 1KFUL 1WMFA 2XVGA 3BOWA 4HPKA 2LUWA 4HPKB 4DZGA 5FAXA 1NQDA 5SV5A 2QFEA 3DF0A 4G9SB 4I3GA 3AFGA
chains in the Genus database with same CATH superfamily
2FDFA 2HWE3 2OUJA 3OYWB 4HKOA 1ZZ9A 4FTEA 3POBA 2JG8C 3T4VA 1UNBA 2OQ7A 2N7GA 2YC0A 1W8TA 2B8MA 2WC2A 3POYA 4URTA 2XDVA 3AP7A 4BHPA 3I3BA 1GLHA 1ZA7A 2VTXA 3T3YA 4YZ5A 4BQ1A 3UKNA 2NN8A 4PLMA 5A3WA 1H6XA 4Q29A 1LECA 1YFXA 5DZGA 1EYBA 2BEOA 2BUKA 4LIUA 4NAMA 5CB7A 4A42A 5CBLA 1WA4A 4MX3A 1LJ7A 4LJHA 2ZHMA 1U5ZA 2VNVA 3MLJA 1APNA 1GSLA 4PIZA 5DAQA 3WUDA 1OLMA 2VC9A 4Q0SA 3LEKA 4DO0A 1HN1A 4K40A 5FXVA 5DN2A 4XF4A 3VD5A 1ASJ2 4CDQA 2VY0A 2IXIA 4UXAA 4P9XA 1MQTC 3LIHA 4NR1A 3OPTA 2BRTA 1OVSA 4CUCA 4FFIA 3SH3A 1R1ZA 1YLLA 3AP5A 3V56A 1ASJ1 4COWA 1QJFA 2E53A 1JXNA 4AHWA 1HN0A 1XOYA 1C5HA 5FQ0B 3M2MA 5G04L 4DY3A 4C1WA 1ND2C 2D6NA 3I2KA 1POQA 4NPMA 1S1AA 2JB4A 4QKNA 3UJQA 1IPJA 4EV0A 4ARXA 4Y20B 1RUE3 4M3CF 3AL5A 4PBOA 4QXBA 4W50A 3V0BB 1EPWA 4I3GA 4QKFA 5FO7B 3GZAA 5HCBA 2WT1A 1JU3A 2YXSA 1AX2A 4X8PA 4N7IA 3R4UA 4A41A 5C70A 4RS5C 3EB7A 3ZXFA 1VBD3 3I2DA 4MUVA 4C0HA 4B7EA 2W08A 3FHQA 3GGLA 4I30A 2XKOA 3WW2A 2YC2A 4H2AA 5I0TA 3H8RA 1SBDA 4E2GA 2B5HA 4FXKB 1R081 1WLTA 4JDNA 5D2AA 3WD5A 2JG9B 1PGW2 4AL9A 1LR5A 2NYYA 4QQLA 2X8KA 1NCRA 2JWPA 1AR82 3AKQA 2RDQA 1YI7A 3NV4A 2MHFA 1S2EA 4Q0VA 2Q8EA 1GP4A 1PGW1 4H3WA 2EAKA 1WBLA 4KWLA 3ALQA 4A2UA 1TNFA 4YG0A 3SLIA 1L7RA 2LALA 1AR81 3FX3A 1DGWX 1N47A 5FREA 1ND3A 1RYYA 1VBE3 1QH6A 4Q1PA 5FZGA 5AC92 2D3PA 1FT9A 2BNOA 5FY5A 5C33A 5JOXA 4CE8A 4LBQB 1V6JA 1LOBA 1XC6A 2VBDA 1F9KA 1OKOA 5FPAA 4HONA 4H14A 2D6PA 3POJA 5AC91 4RR3A 2VUAA 2H0VA 2G9GA 3FHAA 4HK8A 1CX1A 3H50A 2YZ4A 2ET1A 3VKFC 1IS5A 1L7LA 1S0IA 1D0HA 1HW5A 2HWE2 2Y26A 3THPA 1GP6A 2PAEA 2DFCA 4GKYA 4META 2X5IB 4I0AA 5GLVA 1K5MC 1NLQA 4GIQA 3E6CC 4BPZA 1E57A 1HKDA 1LOAA 2A3WA 1GWMA 2R0FA 3OOXA 4RHV3 4ZKTB 5IAXA 2HWE1 1LEDA 1NA1C 2XJPA 1I1EA 4W8JA 2XOMA 2R073 1I6XA 2J22A 3CJIC 3WW1A 3KV9A 2QQKA 3JXSA 2OPWA 3WT3A 2BBAA 1H1IA 4R9BA 5FPUA 2Z79A 1SDWA 4IV3A 3O12A 3Q9OA 2V4VA 2HH9A 2B9UA 4DRVA 1PIV3 5LK7B 2A1XA 5JR2A 5EYXA 2WA4A 4FFFA 2ID4A 3P6BA 2ZAHA 1YEWA 2CWMA 4R8HA 1I5ZA 1Q56A 1GOFA 1US2A 2VUCA 4Q0UA 5HCFA 4A7ZA 5AFEA 2TNFA 4ORFA 4LMFA 5CYYA 3SITA 3KB5A 1OFNA 1BYHA 1H8TA 2AGSA 4X8NA 4GZ9A 2D44A 3WNNA 4YVSB 2XKPA 2BFUS 1V0AA 2ZHNA 3LGRA 3IM0A 2AACA 5F3GA 3VZOA 3B00A 3PTRB 4WM8B 1HB2A 1JTZX 4LITA 1J84A 4G4FA 1KXGA 5C9AC 1RMU2 2WFF3 5ERLA 1S2KA 2VZTA 3TRSB 4ZZ5A 4Y24A 3HBKA 1RUE2 4MSVA 3OCPA 4D7YA 3SMHA 5FOJB 1PK6C 1N1VA 2J1AA 2QJVA 1LAJA 2XG3A 1RMU1 1RUJ2 4Y4YA 5FPBA 2JDAA 2OA2A 4XFBA 1W2TA 1YRZA 4QB2A 1RUE1 1VBD2 1RXFA 3GZTB 4UF0A 1CX4A 2VMDA 2ERFA 3W58A 3VDCA 4RFRB 1HXS1 1UL9A 1RUJ1 1PZ9A 1FNZA 4GJYA 4QT6A 4XF3A 3S7EA 2RDRA 5EPAA 1DGRN 3FFQA 2WR9A 1VBD1 1V6LA 2WFPA 5F2SA 2ZX2A 2KM2A 5FP7A 5ANNA 3S7IA 5F1RA 4BQWA 3N9PA 4FPLA 3L2YA 3WNLA 2VVFA 4BLJA 1CJPA 2DYCA 2WKKA 1H2KA 1GUIA 4MZUA 4XW3A 4NIIA 3T0BA 4AFBA 3RG0A 2H6BA 1JMUB 3LD8A 4ZS3A 4NRPA 3S5QA 1WMFA 1OI6A 4Z07A 5F5CA 5H9RA 3UGGA 3DGTA 1MEC3 3D5OA 3ETPA 1VBE2 5LASA 4AFMA 1FV2A 5I0DA 2PHWA 3IDAA 2VL4A 1EAH3 2W1QA 3A4UA 4LKSA 4YVWA 1VBE1 4AQ2A 5BNOA 3MUY1 3O1PA 1TVGA 5BNQA 3O1TA 3CL1A 1H2NA 2XBO2 3K4AA 3ZSMA 2IFRA 4PI0A 1AR93 4QHZA 2VQTA 1JOBA 4LKFA 3BPZA 2PLV3 1W6MA 2VNOA 2VOXA 1SPPB 2BZDA 5FZ4A 3WNOA 3DV8A 4CDUB 3BYWA 3KS7A 2XBO1 4RHV2 2R043 1EUUA 3K46A 1AR72 2Y33A 3KSCA 4FPGA 2R072 1G9BA 1MS4A 4XFCA 3ZYGA 2RMU3 3NNLA 4HANA 1SMVA 3AB0A 1CAVA 4RHV1 1O6UA 2JG8B 2R30A 5A7SA 5I8TA 2P5BA 4QKDA 4QXCA 1AR71 1G9FA 1S0EA 4K6BA 2XWBB 3N36A 4CXXA 2R071 4W6XA 1XNTA 2RG4A 3K51A 3RZLA 2FDJA 3VDDA 2I07B 1MS1A 4NPRA 3SKVA 1B09A 2XLFA 3MFAA 2D5HA 3ZFGA 3WDUA 3ZVXA 1YQ6A 4YGDA 5G05L 2VGDA 4XC9A 2WA3A 1G6NA 1RB8G 3ZKYA 3PJYA 2BDRA 4A6OA 1U5IA 3HWJA 3I2IA 1W8NA 4QPWA 1G9DA 1OF4A 3DUIA 4YZ2A 1MR5A 4J1WA 4KU7A 3TYJA 5FMOS 4DRRA 3RYKA 1U0AA 4HPKB 2CHHA 3NAPA 3OG2A 3PVOA 3B02A 5HBAA 2VO5A 4CDXA 4KGQA 2RV9A 4MVTA 2GC3A 3I2HA 1MQTB 3T0AA 5ABJC 2JX9A 3VDAA 4CRQA 1DQ0A 1O5UA 4KMQA 1ULOA 1LHWA 1RJ7A 1Q8PA 4ZZ8A 2OZJA 1CIYA 3IIAA 3MIHA 4D69A 1G8WA 3FUOA 5IT6A 3WDXA 3NQHA 3JBG1 5L7OA 2VW0A 3UGHA 3R6SA 4E4SA 3ZR6A 2ZGSA 1UZWA 2GC1A 2O0OA 5BNNC 2CDPA 2Z5WA 1XBFA 2Z4FA 4M0HA 2XMLA 3D6EA 3M3OA 2ET7A 3FE5A 3B7MA 3ZMOA 1R64A 5APAA 3MF6A 1W03A 4FPHA 1F2NA 4XF9A 3JUUA 1KEXA 1MS3A 2AEZA 5K4LA 3MPPG 2WIIB 2VULA 4RS5B 3DF0A 3MIBA 3S57A 5J36A 5IHRA 2RJKA 3J26N 5E89A 4A45A 5EHDA 4D6SA 4NHMA 3I2OA 1HV0A 5L19A 5CU1A 1M06G 2VZRA 1GQPA 3VKLA 1PVC2 2DUPA 1GV9A 1WD4A 1QWRA 1IKQA 5DQ0A 2JDUA 1QIQA 1W6NB 3PIGA 3H9AA 3VBHA 1RUG2 2D7FA 2MPFA 1DGWA 1XNBA 4S2GA 1QOOA 1PVC1 1Z0HA 5HV0A 4UW3A 2CWSA 1AHSA 2RM23 1DLLA 3IIIA 4N53C 2A71A 2GNBA 1DU3D 1B35C 1RUG1 3M3CA 1EPZA 2EIBA 4FPKA 3E5XA 4GALA 5GZEA 5LCWL 5AFBA 5J1XA 4OUEA 1YC61 3R4SA 5KHIA 3ZKUA 1GNYA 4CU9A 1ZRFA 3WQ0A 2NZ9A 3ES4A 4MYEA 2ZGTA 3HR9A 5J98B 4XQDA 3C7FA 3KVAA 3A21A 1C1LA 2E7AA 3IMNA 4UWDA 3H7YA 2Q30A 5FKCA 4LBQD 5GJ6A 4AEDC 1Q5OA 3AL6A 2VCMA 3PMSA 4GWIA 2QVSB 3CLPA 4K1ZA 3NNJA 2R6QA 1DGRA 2WNEA 4M0NA 3FJSA 4A7YA 2W91A 4DUXA 4S2HA 4AI1A 1K5MB 3P5BA 2VD7A 4BZ4A 1S4CA 1P8JA 4PJYA 4H7MA 1JN2P 1NA1B 2ZGRA 4FVVA 1C8M2 2W52A 1JYCA 3UJOA 1A8MA 3CJIB 2UURA 2PHTA 4HVOA 3GM8A 1VJ2A 1AJKA 1OF3A 2AREA 2R063 5CKNA 3A22A 4Y1ZA 4LA2A 1SLIA 4OI1A 1C8M1 2V5YA 5JI7A 2JKXA 3FUQA 5DAVA 5JMOA 1JZ3A 1ACCA 4JGYC 5C9AA 4AEMA 4HBNA 4QWNA 3HEIA 4R9AA 3WR0A 1MPXA 1QJU2 3Q8EA 4JQRA 1AL23 3ZFEA 4BXSV 4D0QA 1O3RA 3OPZA 3ZXKA 3AZWA 5A33B 3HNMA 4BMEA 4EN0A 3I8TA 3TEZA 5CFCA 5FZIA 3O7OA 2AC1A 1N1TA 2AYHA 2HBTA 1QJU1 2B42B 3LA2A 5FWJA 1W6PB 1T6GC 1RUC3 4ITCA 1YIPA 1D4M2 3HOBA 1RUOA 3EMRA 1LOFC 2C26A 2HEVF 4Z2AA 3PJQA 1HQNA 3EQEA 2A3YA 3PUQA 1ZX5A 1UYZA 4EZ4A 1D4M1 4GQ7A 3TBDA 1ZZBA 3AK0A 3SKJE 3WF3A 3HQUA 1CZSA 3WLUA 3WV6A 4OHZA 4C8DA 3B9IA 4DUVA 2ZEWA 3HVDA 4IE6A 3VBUC 1PK6B 2Y6JA 4NUBA 5FBJA 4FQ4A 4HMZA 1PGL1 2DBIA 1FPN3 4CXYA 1OD3A 2VMIA 2XJRA 4DEQA 5BY5A 4W6WA 3AC0A 3N9NA 2W3JA 3ZPOA 1W2NA 2ZJCA 1HB4A 2DWRA 1JZ5A 2PMWB 4CCLA 4LOSA 4CEWA 1DQ2A 3OGJA 3RZMA 1N1YA 4FAHA 3I97A 1GNZA 1W8FA 3GBWA 2VVEA 1VR3A 4FSJA 1U12A 2GH8A 1UZVA 3HN3A 4R52A 3N7LA 3J7NA 5CVRA 4E4DX 2W1WA 3ACGA 2XUMA 2JXAA 2VNGA 3PMEA 4HSLA 3ZSLA 5IVBA 5HCHA 1CPMA 2E26A 1GQHA 3QACA 3VKOA 3ACIA 3NKTA 4HOOA 3ZN6A 3MIEA 4DS0A 3PU8A 4E4HA 1SLCA 1BEV3 2DVGA 1UY2A 1V9U3 1WMDA 2A3XA 3OY8A 5FYVA 3OGVA 5L9RA 5HCAA 5FYMA 1RGSA 1LOGA 1XU2A 4ZPIA 4QGMA 5A32B 1ZYBA 3N9LA 5EJ1B 1IZ3A 3IB3A 3WEZA 3C7HA 4JV4A 1YQ8A 3I49A 1A34A 1JYTA 2E63A 2VOWA 3AFKA 1XRUA 4JKLA 4AHZA 4AQTA 1S0FA 2VZOA 2YPDA 5CAZA 3BTAA 3I3EA 3P3NA 4HXCA 2QDNA 3GALA 4JHTA 3RJRA 1UYXA 2B45X 4XMIA 4QXKA 1W05A 1JOJA 3K2OA 4Z82A 2QCSB 4AG4A 1X9TA 3OSDA 1RUNA 1FOD1 4KWUA 2W5FA 2XH6A 4CDQC 3AP9A 4NOTA 5D21A 1WZXA 5DDJ2 2GH2A 2CU5A 3HN1A 5JIAA 2G9FA 5KXEA 2R062 5FYZA 4OHWA 1YWKA 1W39A 4DUWA 5EZWA 3RZZA 1IS6A 5DDJ1 3VGIA 2JB8A 2OW4A 4HVQA 1WW7A 2ZACA 4B4RA 2ES3A 4Y1UA 2OXBA 4AOCA 3KMHA 2YFZA 4QGNA 3TEWA 4ONUA 2E9QA 3RS6A 5JI9A 1DYPA 1OXCA 1HQLA 3AMPA 2QQWA 3JB4C 5BUVA 4CEYC 4V1PA 3EBRA 4LULA 5HXVA 5BXXA 4KG8A 3RWNA 3T0DA 4RA0A 3AZYA 1U5YA 4AEJA 1J83A 4KQ7A 3INAA 4FPCA 5HI0A 5ABJB 3SEPA 3K3NA 1PO13 3KVBA 4FQZA 1IG3A 4U2AA 4CCMA 4HSJA 2DUOA 2W92A 2WYSA 1KRIA 5A6QA 2DCZA 4AYUA 1COV2 1LOEA 1NCRC 2BQPA 3WVJA 5DXDA 1QJX2 4SBVA 3SC7X 1BZWA 3U0ZA 5IK5A 3FBMA 2Y60A 1E5RA 1T6BX 2WZR3 4NPLA 1LCLA 2OZ6A 1COV1 1MZFA 2XL9A 2GC0A 4Y22B 1QJX1 3CU7A 1ND3C 4OMDA 1VBC2 1WWYA 3W5MA 3BTZA 3HD8B 4NWVA 4QPIA 4UYBA 2JJ6A 3W59A 1Q43A 2CV6A 4MH0E 1OOPA 5LY1A 3MW3A 5F8PA 2RJLA 2HYXA 4PCRA 1VBC1 2W0XA 2FZ2A 1DYKA 1QEXA 4RR3C 1G9CA 1C3HA 1OFSA 5F6KA 4ZY9A 1MZEA 2ZHLA 5FZ9A 1WCKA 1JYWA 1CESA 2P6CA 3LWCA 3RFRA 5LBBA 3RZKA 3CZUA 4L9BA 4I02A 5FP4A 4LO8A 1V9U2 3I3DA 2P3KA 3WY6A 3WNMA 2DVFA 4A4AA 2HWB2 4QQOA 4ZONA 3I2FA 2V09A 2QQIA 4N53B 5FUPA 1V9U1 5T54A 1WW5A 1ZREA 3DYPA 1GR3A 1B35B 1MVEA 1PO23 3H0OA 2HWB1 2Y34A 5IVCA 1ASJ3 4IV3C 3DECA 1QKQA 2JE9A 3N7JA 5IK4A 4XF1A 1JZ8A 3V0AB 2JE7A 1AXKA 1OLME 4SLIA 2P3JA 3HAGA 2EICA 3OPWA 5FZ7A 2DCJA 3TNQA 3OBTA 2NLRA 5DUVA 2WUHA 5FZOB 1IG0A 3KCYA 4AEDB 1FXZA 5FMDA 2VZQA 1F8VA 3M8LA 5IVFA 1H8TC 1OPMA 1UY1A 1RUI3 2UYAA 4UOJA 4AW7A 2WS92 3LE0A 4GH4A 4R4ZA 2P34A 3SHRA 5C3SA 2ZKNA 2QQOA 5GZDA 4TSVA 1QDCA 1ENQA 2WS91 1R083 1PMHX 2GN7A 1V70A 2AH2A 4QX7A 4WZCA 1KGYA 4LQRA 4D6QA 2YBPA 1ZZ8A 1QDOA 2ZGPA 3MPBA 4W4ZA 2WNOA 4GB31 1YFYA 4YZ3A 5C3RA 2GNTA 4HG6B 1TG7A 3E5QA 3FL7A 3KD4A 3ZXEA 3I59A 4QPGC 3CDZB 1OA2A 4UFIA 4BU2A 5IFTA 2BP6A 3Q8BA 1AR83 4NHKA 4Y1VA 4XJZA 2DBNA 4A3ZA 5A3TA 2WDBA 1AJOA 5C3QA 3KF3A 2BTVC 1YQ2A 4IEOA 3HNBM 3I54A 1RVF2 2VMCA 1MS8A 3G6JB 5FY9A 3T30A 3NV1A 3WSOA 1W9WA 1CAXA 5AC93 4MGSA 1X8EA 2VMHA 5GZCA 2GAUA 3J8F1 3E1F1 4E4ZA 3M7AA 3UKTA 1RVF1 1UZ0A 2WZR2 3ME2A 3NNFA 4BQYA 4ZU4A 2QFEA 2TEPA 3EJKA 3K4ZA 3OD4A 4IXLA 4YW6A 1VRH2 4Z8BA 1CD3G 5LA9A 4Y5TA 1REDA 4RQPA 3VBUB 2WZR1 5LEJA 1ENXA 2IXLA 4MOAA 5CZKA 3H1YA 4XFFA 2JENA 1YO8A 2Z42A 3PIJA 1VRH1 4YVWC 3ZO0B 5BNOC 2FDGA 2YPJA 2GU9A 4BB3A 5FY1A 3A7QA 2J1RA 3ZLIA 1PGSA 4IEXA 3VHRA 3UK9A 1GWLA 2UYBA 4NHLA 1Y9QA 4WZFA 4L0PA 4K3UA 5JZGC 2D43A 5FYYA 4AI8A 1Q8OA 2CNAA 1H0BA 1RHI2 2DTWA 2BGOA 1BJQA 5JXHA 2GNDA 3S30A 1QJY1 4K8RB 5FMCA 4MGIE 3ZX7A 2FDIA 4UBGA 3BCWA 3RMXA 3LQCA 4HKWA 3VBSA 2WN2A 1TMF3 1RHI1 1PO22 1ZBE2 4XAAA 4Y26A 4IV1A 4EN9B 1NX9A 1HRI3 1UY4A 1Z7S2 2VECA 3WNXA 1VP6A 3O1VA 2PHDA 5FCCA 4BCUA 3ILRA 4M3CA 1ZBA2 1ZBE1 2PHRA 1PO21 4JTOA 4XIKA 1HB3A 1UMHA 3VDDC 4P9JA 2F4LA 5T50A 3ZFGC 1O91A 4CDWA 3ZSJA 5FO9B 1UU4A 5F5IA 1Z7S1 2R1DA 3QD6A 4I2OA 4LE3A 1ZBA1 2XUEA 5EIYB 2VXRA 4FP3A 1IS4A 3ZXJA 1C57A 1JI6A 2JDMA 4GWMA 1OQEA 4FI9A 3P1IA 4LIVA 3O0XA 1RMU3 2HEYF 4NROA 3WP4A 2VZ1A 4I01A 5E8AA 4ASMB 1ULFA 1WW4A 3V0BA 4LHLA 1RUI2 3E5UA 3NAPC 2B46X 1BBT2 3AP4A 2ZMKA 5KHKA 1CWPA 2X09A 1HXS3 3CBNA 5JOZA 4CDXC 1RUJ3 2K9ZA 4NWWA 4OVEA 4YW7A 4CDQB 3O0WA 5CEHA 5A3UA 1UIKA 3THDA 1RUI1 1XSQA 2LRPA 3DXUA 1BBT1 1R082 5FMBA 2NMNA 5FWEA 4XHBA 4Q1RA 4BJ0A 2VW1A 3NNGA 5IFPA 2QTWB 5EJZB 5AVAA 1A3KA 2GDFA 1X9PA 3ENRA 3WQ7A 4CUBA 4AI3A 5L7OC 4TN7A 3RNSA 1W9YA 2JIGA 2CDOA 1VRBA 4CCKA 1SCRA 2VG9A 4LO4B 5IVEA 2I2SA 4Z92B 3LAGA 5FZKA 2RDNA 4UW4A 2LROA 4JAAA 4XFHA 4YW5A 3RGBA 5KHJA 1FI2A 5FZBA 2Q1MA 3PTYA 5LRSA 3LEIA 4OI2A 4CPBD 2X10A 5A7PA 5EWSA 5LA0A 3OGGA 1O3TA 3SXWA 1X50A 3H3UA 4MG2A 1BVP1 2DVDA 5FBZA 2QZ2A 4AZZA 4CP9A 2CY6A 4NHYA 1EP0A 5E16A 2XVKA 4JZRA 1CAWA 3VBHC 1MVQA 2KR2A 2VMEA 2A6XA 1NCRB 2XBO3 5FO8B 2ZX4A 4INDA 4ISQA 3HQRA 4IE7A 1AL0G 4X6QB 2BWAA 2GSYA 3GJAA 1N3QA 5JR7B 4QQHA 4PLOA 4NIDA 3VHOA 1ND3B 1AR73 1X36A 3ATGA 4HVRA 3RYPA 3R05A 3ZDVA 2ZPXA 4ATEA 4ZHNA 2ZOEB 3X29B 4MHUA 4QXHA 4EYUA 3D0JA 4AHYA 3NVCA 3LF7A 5DABA 1VMJA 2HWC2 2VQAA 4RR3B 5T5PA 1IOAA 2LM3A 4TYSA 4MLOA 4E2QA 5KBFA 3UNPA 2J7MA 3ZYHA 1XQNA 2J42A 4XMAA 3NRUA 4TZDA 4GKXA 4JC1A 4YSFA 3RYRA 3RPQA 1TMF2 2VZSA 4KGGA 1SG3A 2HWC1 2X53S 3ZMNA 1O3SA 1XJAA 2XWJB 3H3LA 2Y8KA 1HRI2 1OQ1A 1O59A 1YQ5A 4P9YA 3K3OA 3VZLA 5HV4A 2Q5TA 1TMF1 2BGCA 2Q4SA 4P9IA 4YVSA 3CO2A 2XQXA 1GZTA 1HRI1 4GA9A 4MXWA 5CKMA 4OUSA 3U07A 4BIFA 4DY5A 1X33A 2WZEA 3ABZA 4IV3B 4WVMA 5I0UA 1N1SA 3VDBA 3O1RA 4P00B 2WRAA 3ECQA 3JBG3 4EWEA 3ACFA 4K20A 4I0WB 3T1MA 5HXMA 3ZFEC 1RJ8A 1E5HA 1T2XA 1HLCA 1BK1A 3LKJA 5DUWA 4JKKA 2QKDA 1IQDC 3MHZA 5IWFA 3W21A 1HXS2 4GJZA 4MGZE 5CA6A 5CFCC 3DPRA 2WL1A 5FK7A 3MO4A 4XZPA 1HX6A 4QPGA 4YZ1A 2HYKA 2EIGA 1S2BA 5IVYA 3VBRA 5FTTC 2W1UA 4DXSA 1H8TB 5ACA2 3ETQA 2RE9A 5IK8A 4GULA 1C28A 2BVBA 5FPZA 3MV01 2BJSA 2YBKA 3LDBA 5FY7A 1NOVA 3AKPA 4ARYA 3MV11 5ACA1 4IGPA 4DNYA 1U5XA 4WVWA 3WDVA 1XE8A 2BWCA 1OH4A 4XJ9A 3IZOA 4PQQA 2MEV2 1QNWA 2RR13 2QQMA 1W9TA 4LOTA 4BWOA 3AYAA 4QDRA 3RI9A 1BHGA 3OJBA 1PVC3 5FYBA 2YHJA 1R1A2 1QF3A 2VMGA 3THCA 2VU9A 4NIGA 3N7KA 1A78A 2MEV1 4DIQA 4OZXA 1RUG3 1PGL2 1YJKA 1XYOA 5A6XA 4MGQA 3WQBA 1R1A1 2WQZC 1OC1A 3GXUA 4OHVA 3KT1A 3LEMA 4CU6A 1MS0A 4CEWC 4NE9A 4WVVA 3POEA 4FO9A 1TME2 2ZEZA 4RYDA 1QOSA 4UFHA 2OS2A 4XTMA 3HT2A 1FAYA 1UKRA 5CFDA 1PHMA 5F2WA 4W65A 2YGLA 1BXHA 5KXDA 3LSDA 4BQXA 1JZ2A 2DV9A 3N7MA 4DFSA 5JXJA 2QBXA 5A3OA 3D0SA 1TME1 4AR2A 3MIFA 5F7UA 2WABA 4LT5A 4MXVA 1K3IA 5BNPB 5DPNA 5C3OA 5F9TA 5JZGA 3S6PA 3AKRA 2EXJA 4YPJA 4LUMA 3AZVA 2VOTA 1X7NA 2IUWA 5EQUA 3VD7A 2JD4A 3IDBB 3M3EA 3OB8A 5A70A 1YQCA 4Q26A 1IGOA 2WJSA 3B94A 3LB9A 2ARCA 3PL0A 5E6HA 5JOWA 1JW6A 2O1QA 1WKYA 4YVWB 1OD5A 1GBGA 5BNOB 2XVLA 3DKQA 3R4DB 3K48A 1DZTA 3ZIXA 1UD1A 1XB9A 1C8M3 4QM9A 4V2WA 4BYYA 4DINB 3GBFA 2P3IA 4ES9A 3JQWA 4YFWA 1YCIA 1W6MB 3RJ2X 3M4FA 4Z2WA 2DCTA 1VMFA 1JOPA 3LA3A 2A75A 3B69A 4Y33A 3I4IA 3USUA 3PHMA 4JTNA 4CEYA 3WXPA 3O1UA 2R49A 1ZVFA 2WO1A 1PX3A 1UY0A 4HPKA 4XIOA 1QJU3 4I09A 1HDKA 1LHOA 2E6VA 2QQJA 1CAVB 2FHRA 4JGZA 4P02B 4OFGA 1NLRA 2YUEA 3FMGA 4XUQA 4YARA 2W46A 2ZGQA 4QX5A 2ZEXA 4BE3A 4F7ZA 1UX7A 5JXIA 1PNGA 4ZS2A 2WNVA 4O9GA 3IBMA 4DXZA 3SCHA 5FZDA 2VCCA 3VDDB 3JBG2 3BODA 4KBBA 4OULA 1D4M3 4Q8LA 3ZFGB 4XBLA 3BIEA 4FPFA 1QQP3 1AVBA 2Y0OA 1UAIA 1S55A 2MNGA 3A0KA 2K46A 1KDKA 1N3OA 1ND2B 1GNHA 4QU1A 1GOHA 1YFUA 2R0HA 2RS12 3MEPA 5A7NA 3VKMA 4BXFA 3S5AA 3ZR5A 2IVIB 1GQGA 3VBFA 1LENA 2HJIA 3PURA 2W39A 3NAPB 2RS11 3N3HA 2VZVA 4AVTA 5BYNA 5CISA 5CG9A 5FYCA 4CDXB 4YZ4A 2LTNA 5IATA 4P9LA 4QGLA 5IUQA 4LHSA 5JAXA 3OUHA 1NLSA 5FJKA 3RQ0A 3N4MA 4A44A 2J1UA 4CCNA 1LU2A 3UESA 2OIIA 4B29A 4XUTA 1LODA 3LA7A 3RVHA 1VAMA 1UX6A 1W8WA 2RR12 3GHNA 3PLQA 4P5HA 4AVCA 4C0BA 4PF1A 1NCQA 3BALA 2WSUA 5KHHA 3LEGA 5L7OB 3WNPA 1WLDA 2HWD2 3J7LA 3WZ1A 4B4QA 3IKWA 1CQ9A 3WG1A 3NKGA 4PI2A 1G7YA 2RR11 1VBA2 2D6LX 3D8CA 3HMYA 3ZSEA 4E8CA 1V00A 3W5NA 2ETEA 2HWD1 4PIXA 2OX0A 3PDQA 3UL2A 3QBQA 4QPIC 2B39A 3BOWA 3KV4A 1VBA1 2FD8A 5FLHA 4AVVA 1OOPC 4MHRA 2UWBA 4R9DA 5K9YA 2Y38A 3DCQA 2C0ZA 2DUQA 1REEA 4O9EA 1RUD2 4HKLA 4AVAA 3RZGA 1UF2C 1NT0A 5F6LB 4EQVA 1QXPA 5JVVA 2D3RA 2VZ3A 3ES1A 3DYMA 4LA3A 3WG3A 1C1FA 1S0GA 2SBAA 4QPYA 4QHOA 3RDIA 4M01A 4XURA 1RUD1 4AEKA 4DB5A 5JXGA 3VBHB 4UBHA 2PTMA 1W9FA 5KR7A 5LBFA 1AYM2 1UWWA 2V73A 1FOD3 2D40A 5LBCA 1BCXA 3IWZA 2ZMLA 1JHNA 4N8MA 3VZMA 2BV4A 2ATFA 1AYM1 3JB8A 1KDMA 1JU4A 2ZKLA 3AX4A 3NSTA 5DG1A 5A3PA 1JODA 5DDJ3 5A7QA 5T5OA 1K42A 2BU9A 1AUYA 1W8UA 3LZZA 4YGCA 4M4PA 1WCUA 1DZQA 2D98A 1SFNA 3LFMA 5CNAA 2G4IA 3VL9A 4DEVA 3GJBA 4P5YA 4D6RA 5T5JA 2VBPA 4XDPA 1DQ6A 4UFKA 4QD2A 2YG0A 3VZJA 1ULEA 3PVEA 4BOWA 2P2KA 1REFA 1SQ4A 5IW0A 3GNEA 4GH4C 1W9SA 5IVVA 3ZXDA 4R4XA 5FY8A 3U4XA 2NPIA 1JZ4A 3MFCA 2FMDA 2D6OX 3MIDA 4L2NA 4YG6A 2NP0A 5K0UA 1AYN1 5SV5A 2VCBA 1QQP2 2DVAA 5F3EA 4QU2A 1NYWA 2AR6A 2DDUA 3CEWA 2ZBJA 1EV12 2PAKA 2WQ4A 3K4DA 3HQXA 3OUJA 5FRAA 3AVSA 4NO4A 1SLAA 1XE0A 3BGAA 5FJHA 1QQP1 1Y9MA 5C9AB 1C5IA 1GP5A 4BQ4A 1EV11 3Q8FA 4BQ3A 4EE2A 3U37A 1WW6A 3WOGA 5KHGA 3ZFEB 1COV3 4AF9A 1FYUA 4K7JA 3IDCB 1QJX3 5A7WA 3IPVA 5A6ZA 3DXTA 3TOJA 2ZGKA 2QQPA 2VZPA 5CFCB 4COVA 2V72A 2ZEYA 1NZCA 1W90A 4PQ9A 1WA6X 1LB2A 1UMIA 3H42B 2VR4A 1FX5A 3F2ZA 1YJLA 4Q4X2 3GBGA 4QB1A 5JCTA 1VBC3 4Q4V2 4AQSA 1QH7A 2JKBA 4COZA 1X8MA 1XXNA 3K77A 4G9SB 1XNAA 4LO5B 4YM1A 4IGQA 1US3A 3HBZA 1VE0A 5FP3A 5KXCA 3NL1A 4Q4X1 3AZZA 4XOGA 3PVNA 4Q4V1 4XEZA 1AZDA 4ASLA 2WWJA 3FN9A 4Q4Y2 1E5SA 4RQPC 1BQPA 4B3NA 1POV1 4AVSA 2UWAA 4JDOA 1O8SA 1DG6A 5FXXA 5F5QA 2AEYA 3ZFFA 3IMMA 2P17A 2UU8A 2GN3A 4QQ2A 4XDOA 4BK5A 5D8AA 4Q4Y1 5FUNA 2VE1A 4YGBA 4CYDA 4ZU7A 4IQPA 2OPKA 1UZZA 1H9PA 2HWB3 3T2PA 3FLPA 2B4KA 3OEAA 1WD3A 2VH9A 5A3MA 3H8UA 5FIXA 3FC0A 4S2DA 3I2JA 4CEWB 5DMYA 5C8CA 2F6BA 3N35A 5A1AA 3ASIA 1W2UA 1A6CA 1ODMA 1W2AX 3MF9A 2CTVA 1Y9GA 4XJWA 3GZEA 4E9KA 5L9VA 3WW3A 4Q2FA 2KD7A 5A3NA 3POSA 1CGPA 5FXZA 5C6CA 1WUVA 2FDKA 3WP6A 1FOD2 1J3RA 1DZRA 3C3VA 3H1MA 3VBSC 3ZN6B 1MS5A 2XXZA 5T5LA 2OYZA 4WVZA 4IEWA 4KG0A 2WO7A 3BN6A 3MDPA 2ZTNA 2ZZJA 4IV1C 5CIRA 3OY8B 1HQWA 4NJ4A 1AXZA 1D2SA 4UW6A 3H8XA 3C7EA 1F5JA 2HEWF 3AXDA 3LIGA 5FYTA 4FFHA 4XBQA 4IEUA 3GF6A 4TXWA 4CDWC 3BUCA 2E7TA 2DCKA 2BPA2 1XYNA 3O0VA 3ACHA 4XVHA 2WS93 5JSPA 3WX5A 1NQDA 4IEPA 4NIHA 4ZU5A 4UFJA 5FOBB 1QMJA 1H2MA 2C9AA 2IXHA 5CG8A 1CPNA 1C4RA 4GB33 5AVPA 3NNMA 5FZEA 2WAAA 4EWDA 5CADA 2ZA9A 3L2HA 2FCTA 4JKMA 3CIHA 5LEKA 2R1BA 1H8VA 2OT7A 1RUH2 2CAVA 1I5PA 4YW4A 4L8QA 4NRMA 4CP1A 3LPGA 5FPXA 1K45A 2XL7A 4LKDA 4A7KA 5FYSA 2WNUA 1NXMA 2C24A 1RUH1 2IXJA 2P37A 1ZZ7A 3O14A 2XJQA 3MW4A 4EWAA 1UOGA 3B5LB 1UOJA 2VVDA 1SLBA 2CAUA 2BGPA 3J8F3 1UW8A 1RVF3 1YXWA 4ZXKA 1W3VA 2YB7A 1ULPA 3NV3A 2WZPP 2P1BA 2F17A 1FNYA 2QQLA 3AFGA 1Y4WA 2PHFA 4D7SA 5FDBA 5KC6A 1WCSA 3MI8A 4IE4A 3GDBA 3I3QA 4BQ2A 4YM3A 1W06A 1OKQA 5BNNB 5JOYA 1O3QA 5E1RA 1VRH3 2QQUA 4JX0A 1PM4A 1HJGA 3VZKA 4AVBA 4XJ8A 5JPMB 1OLQA 5F32A 4N90A 1W6OA 3ZYRA 1POV0 3POIA 4DZGA 2XVGA 1VALA 2E32A 1A8DA 3ILFA 4AGVA 3APBA 2G9ZA 4RL7A 5J3UA 3EHKA 1LHUA 2ZXQA 1IS3A 2BNNA 4KBZA 1J1TA 2JICA 1AX1A 2H6CA 3NJXA 1QJY3 3ST7A 4YGEA 1TZOA 1YHFA 2ADEA 2ORXA 1RHI3 4BISA 1PZ8A 1YFWA 2JIJA 2NQYA 4CP2A 1DQ1A 1W28A 3KGZA 4IEYA 1GMMA 5FZFA 3NV2A 4QPIB 4ISRA 1ZBE3 2ZMNA 1CIWA 3OBRA 4AI0A 4E27A 4NRQA 3LCPA 2LW8A 3AYCA 2EXHA 1OOPB 3OBAA 4KL1A 5FY4A 3WQ1A 5LATA 1Q8SA 2Q8OA 4FOVA 3AYDA 2VPVA 1Z7S3 4PBPA 3KGLA 3M70A 1ZBA3 5TSWA 2W87A 1SFYA 5EJ3A 5IVJA 2QUOA 5EYYA 4LHKA 2KA3A 2W1SA 1GZWB 5C71A 1F31A 2VOKA 1NG0A 4LBJA 2J1EA 2WINB 4LXLA 5FZOA 4EN7B 1CZTA 2C6SA 2QNKA 1STMA 3B93A 1SDDB 3KWVA 3M3QA 1DLCA 2JECA 4PDWA 5DAPA 4M3CE 5F39A 2C9KA 2UY8A 2A70A 2XR4A 3N9QA 2ARAA 1WLCA 4QAWA 1AF9A 2K0GA 2PHXA 2FDHA 4YVSC 5E88A 5DAWA 5FR3A 4IE5A 3IAPA 1BBT3 1W6QA 3AM2A 3WF1A 4BA6A 4HFSA 5A1LA 3I3MA 2JDYA 1I3HA 2VJXA 4GB32 2WQ8A 4XXAA 2Y6FA 1ONAA 1KFUL 5FZ1A 2WWUA 3TNPB 1S0JA 2VZUA 4Y1YA 3EXUA 2OKXA 4JGYB 4HLTA 4F8AA 3DPRC 1PM7A 1CAUA 5I8YA 1TNRA 5FZAA 2IZWA 3U75A 3VBRC 4YWAA 4NIAA 1XE7A 4AFDA 4YW1A 1SBFA 3ELNA 4IETA 4CSWA 1OPOA 4GH4B 3RRDA 3KT4A 3J8F2 3RI8A 4RGKA 3OBZA 3C7OA 3KHBA 1W8ZA 1ULCA 1XPWA 3VBOA 5IYYA 4WM7A 3CMGA 5JUVA 4UFLA 4YG3A 1KITA 1UYPA 3U10A 3H8OA 3OF1A 2PN5A 3LDRA 3WG4A 4IEVA 4D94A 5GZGA 1SBEA 1H2LA 2EALA 5FK8A 3TAYA 2ZX1A 5C4WA 2WLQA 1O4TA 5F5AA 1UO9A 4GAZA 3ZOIA 4KU8A 4N43A 2ZGOA 3UV9A 3NO8A 5FZ8A 3VB9A 3OYWA 2ZGNA 4FOWA 4FPOB 4XABA 4BLIA 2HWF2 1ZRRA 1OSGA 5F3CA 3N9OA 1RINA 3JD73 3R0RA 2J1TA 1MACA 1RITA 2Q8CA 3POFA 4LBOA 5CFDC 2IC1A 3GCXA 2EA7A 1CAXB 2HWF1 2GP3A 3I7DA 3OTFA 1VBB2 2CL2A 2YDEA 5BV6A 2VXJA 3B01A 1QJY2 3PNAA 3SH5A 1Y43B 4YNIA 5GM0A 4CDUC 5A3LA 1PNFA 1OA4A 1VBB1 3DKWA 1OUXA 3ZIWA 2HWC3 2VOVA 4L97A 3MICA 3U14A 3H1WA 4RQPB 1J59A 2RS31 3IN9A 3WP5A 4DXRA 1VAVA 1HJFA 2ZAAA 3BTXA 1PMJX 2EIEA 2VTXJ 1AR62 2O14A 4FCAA 4J6GA 4UW5A 3B3QE 3WF0A 1QY4A 2Y6LA 1DFQA 2VW2A 1QGLA 3HJRA 4XJAA 5DUXA 2V5DA 5J96B 1Y3TA 5FPLA 1AR61 3WF4A 2RJ2A 1O7FA 4BH9A 3SEEA 3AJYA 4CUGA 3KQ4B 3DYOA 1CZVA 4TLGA 5FQ0A 1QNYA 2A6WA 2FQPA 1JZ7A 1XSRA 2YMZA 1FATA 4QHBA 4XFIA 2D6KA 2YBSA 2A5ZA 3F95A 4FOQA 5FYHA 3B9CA 5I8SA 4BM8A 3VBSB 4Y20A 4Y5SA 1YYNA 2QDRA 4JGZC 1WMEA 3RMYA 5DZEA 2Q1ZB 1BK0A 4IV1B 2R32A 2XJSA 1FV3A 2PFWA 2WNVC 1LKNA 4M3CB 1WMXA 3ON7A 1UZYA 1LTEA 5JDBA 4CDWB 5ACA3 2VAUA 1X82A 1KD7A 5KWRA 2XGXA 4JHZA 4K8FA 3CJXA 2JG9A 2TUNA 5FFOC 2A6YA 2VM9A 3VBFC 2GNMA 2MEV3 2XLGA 4AE2A 4YFZA 2BOIA 3ZDSA 4GXLA 2F4PA 2GMMA 4RSUA 1J1LA 4XCAA 3V65A 3O1SA 1R1A3 4XETA 4OQ9A 1SFPA 3VLBB 4AAXA 4CA9A 3RSJA 1H4HA 4LBQA 3TB0A 4ZXEA 4XUOA 5I0RA 4TLFA 1NCQC 3CZJA 3VL8A 3T09A 1VB4A 1TME3 3QOPA 4B1MA 1DCSA 1K5JA 2HBUA 4BQ5A 4COYA 2BVVA 3IAQA 2WO3A 2XLAA 4H7LA 4HK9A 4YYOA 2Z69A 2X5IA 4OI4A 5FYUA 3JD72 1UXZA 4KWKA 5C5TA 3VUOA 3A0NA 4XJUA 4JRLA 1ALYA 2FMYA 3MLLA 3ZYIB 3WCRA 2CGNA 3P3PA 4K21A 1WBFA 3SISA 4GD4A 4IW3A 4L92A 3JD71 4R9CA 2OUHA 3WHUA 4XCBA 4Q0QA 4HL0A 2QZ3A 2GMEA 2O8OA 2WWSA 4AXOA 4RFT0 4FP2A 1V6KA 3W9AA 4CCEA 2QE3A 4CP9B 1UU5A 1WLWA 5GALA 5FZCA 3ITQA 1CAWB 4TTGA 4LLFA 1NKGA 1L7QA 3Q8CA 3LOBA 3KCXA 1F15A 2W68A 4OCTA 1OA3A 3T2TA 1F35A 5KC5A 1W3XA 4YW3A 5IJRA 1NZIA 3U78A 4EJRA 3EYPA 2Y6GA 3J7MA 1LULA 2P6HA 2X05A 2IXKA 4LTAA 4XILA 5FYIA 1GZCA 4LBNA 2CSGA 3SQOA 3NW4A 5LB6A 1YNAA 2YV8A 3VHPA 5LZ6A 3HPNA 4FXGB 5C8WA 2UWCA 4QX2A 4WM8A 3KHCA 5JLVA 1JZ6A 4XAEA 3WUCA 4BDVB 1GYKA 3T1LA 4AGRA 2C1FA 4XTPA 3TWIA 2ILMA 1H1MA 3H3ZA 2YY1A 5I93A 1GOGA 2RS13 3CQOA 2WSVA 1RXGA 4MADA 2BW8A 4NN0A 4QKBA 4UI9L 4CCOA 2BYVE 2FCVA 1G9AA 5K0UC 3WW4A 1PX4A 4FFGA 1S0DA 1OT5A 5F37A 4MXWB 1KFXL 3PUHA 2TBVA 1W0OA 4FT8A 3M1HA 1XYPA 4AFAA 4WVMB 1UIJA 4CCDA 4OMCA 1DF0A 4XFAA 1OVPA 4XQWA 3KV6A 3KZ4C 3VZNA 5T52A 4S2FA 2P4EA 1Q3EA 4XYXA 1JYIA 2VUJA 4XF0A 4OYUA 1WCQA 1UOBA 1WGPA 4AWDA 3GZUC 4QB6A 3ZM8A 5LA1A 4YM2A 2IWGB 2HWD3 4OZOA 5FKBA 2JEMA 2UY9A 2VBBA 1AX0A 1KJRA 1W8OA 2W9XA 3DPRB 4LKEA 4QPGB 1H6YA 2DURA 4UF0B 1VBA3 3VBRB 3BU7A 3T4HB 4GMP3 4O65A 5GKAC 1I9RA 1F5FA 4A3XA 3I2GA 1J3PA 4LBKA 1Q8VA 1JBCA 1TQ5A 4OHXA 2O8QA 2C4XA 5B4NA 1O8PA 3J4UH 1RUD3 4I3PA 2D3SA 4FPJA 1GICA 2WT0A 1O4ZA 4QM8A 4Y3OA 5BNPA 1SPPA 1QJEA 4CDUA 2YFUA 3ZFFC 3VKNA 1UMZA 3POGA 1R093 1RUF3 3H7JA 5D8AC 3AKTA 2FBEA 1D7PM 3WINE 3FLRA 1PMIA 1HB1A 1VB2A 1AYM3 1BKZA 1DBNA 1MZ6A 1ZRIA 2JG8A 3SNMA 3KQRA 5C8CC 1UOFA 5LRRA 2WLPA 2IXCA 4KNCA 2K2SA 5CFDB 4QX1A 4XXPA 2P3YA 3WDYA 4FOYA 3PUAA 2G1MA 1CN1A 4LHNA 2EXKA 4NVPA 3NJYA 3USSA 4C90A 4CU8A 3BB6A 2ARXA 5JZGB 3HNYM 5FZMA 2ZABA 2J1SA 1OURA 2XB6C 4NHXA 2VMFA 4XACA 1ZZ6A 4YRDA 2W47A 4LE4A 4QMAA 1D0GA 1HV1A 4PHZA 4PIYA 4XE9A 1F4AA 2LUWA 1F4HA 5I91A 1E5IA 4DMIA 4CUAA 3J9SA 4AAPA 1AYN3 1BLZA 3KF5A 4RN5A 4JCKA 3O1MA 1D2QA 4ATFA 1GWKA 1ULDA 2EAAA 1PIV2 1MQTA 3CHXA 3JZVA 3M3IA 3THTA 5JIUA 4EN8B 3QLQA 3SCGA 1L3JA 5C3PA 1UU6A 2DU0A 4XZUG 1JYNA 2Z2SB 2IVJA 2Y64A 1LU1A 4J1XA 1EV13 1PIV1 3BI3A 5LA2A 1ND2A 1KJLA 4LUKA 3USUB 4CEYB 3SH4A 4OLLA 3ZSKA 2A6VA 2PELA 2SLIA 3JQXA 2CGPA 4AI2A 2WNUC 4QDQA 4JGZB 4EROA 3QH6A 4F83A 2VNRA 1LEMA 1K12A 1UPSA 2PAMA 4HN0A 3T2QA 4FAGA 4RS5A 4LO7A 1ULGA 2GP5A 2WNVB 3FZ3A 5J48A 3POWA 3U11A 2WFF2 2HLEA 1H1AA 1YIFA 1DHKB 3UGFA 4Q4X3 5FPVA 2DVBA 2XHNA 1OUSA 4Q4V3 4DOUA 1NY72 3LOIA 5GLZA 1LRHA 2WFF1 3JU9A 4LPLA 1UKGA 3ACLA 3WP3A 4RGGA 1S0CA 4CVUA 4AQ6A 2VUDA 1POV3 4B8EA 1W6NA 2YROA 4KWJA 3T2OA 5L9BA 3ZYBA 1VMHA 4CU7A 3E6DA 3MLKA 2GMPA 2ZGLA 3VD3A 3FBYA 3VBFB 1NY71 1QOTA 3V64A 3ZXAC 4Q4Y3 1DGLA 4AHXA 4ASKA 3LPFA 1VLNA 1SEFA 2GZWA 5DZFA 2XONA 1ZRCA 1JUIA 3UETA 1W8HA 2AENA 2E7QA 4GMP1 4Y5Z0 4P08A 4FTBA 3RWKX 3OD0A 4Q4W3 1LHVA 2FCUA 4AGGA 1NCQB 4ES8A 3HT1A 3SCFA 2GC2A 3CKHA 4FTSA 2BFUL 5A80A 2E51A 3D3AA 1VIWB 2V4AA 1R092 1RUF2 2D97A 1MEC2 2ENRA 1W04A 3OEBA 5FZ0A 2BBVA 2JDNA 3CNAA 1MS9A 1RC6A 1EAH2 1R091 1RUF1 5EFUA 1MEC1 3TN93 1K5MA 5H9SA 2Y6HA 1LOCA 2AUYA 5FAXA 4MGTA 1NA1A 5FUIA 4D7TA 1LGCA 3AMNA 3BOPA 1DDLA 1C8NA 1EAH1 3K75B 1AR92 2PXJA 3CJIA 4EZHA 3GHMA 2PLV2 4IGOA 3ZN5A 1DYOA 4MGKE 1NXD1 1OLRA 3WHTA 1RTVA 4JQTA 4XDQA 3ZYPA 2R042 1AR91 5FXWA 5GLWA 4Q27A 2PLV1 4WBBA 4PDWC 2EXIA 4HETA 1ODNA 4LNVA 3T08A 2RMU2 4X6RB 2ZX0A 4Z1VA 2R041 3C2UA 4B7KA 1J58A 5A33A 1QJZA 1DQ4A 1AYN2 1JHJA 1ZM1A 3G7DA 1CJDA 1ENRA 1HRV3 1QXRA 1RUH3 5GLTA 4HZFA 4LLOA 3BTYA 1CVNA 2RMU1 1W6PA 4ET7A 1W0NA 5FZ3A 2XJUA 1BVVA 1LGNA 2Q0AA 4RGAA 2A7AA 4Y4RA 2PYTA 3LDKA 1M4WA 4XFGA 4AFCA 3KT7A 4LK6A 3UKVA 2EF6A 2DF7A 5K7PA 5LWBA 1BMV2 4OQ8A 3VD4A 3IT8A 3UT0A 2WT2A 4IUGA 5C7GA 4P14A 4YW2A 2PHLA 5A1FA 4TWTA 1PK6A 3AYEA 2WBKA 1OMIA 2XQRA 1BMV1 2YYOA 2OVUA 4FPYA 4C1XA 1H4GA 1CR7A 3AJZA 4FBFA 4IEZA 5H9QA 1GANA 2VTFA 2YC4A 4URAA 5K0UB 3VBOC 4YM0A 4WM7C 3TEXA 1AXYA 4Y1XA 3U1XA 4D3WA 5A6YA 2BNMA 3KCCA 3ROUA 1TEIA 2RVAA 5A7OA 1O5LA 2DTYA 4IESA 5EP9A 3WF2A 3J7HA 3TEYA 4U36A 5C4WC 1SACA 4GMP0 4H55A 5JSRA 2WN3A 3S0MA 2VQUA 4N43C 4DPNA 3EO6A 1IKPA 3GYDA 5FZLA 3FFZA 1SLTA 3IPVB 1IPKA 1IQAA 2GALA 2KXLA 2PQQA 5A7WB 4PF5A 4P9GA 2DCYA 5FY0A 1UN1A 4OHYA 1ZNPA 2HKXA 2LS6A 2A73B 2W2IA 3AVRA 3AZXA 3PVBB 3BIWE 4L11A 1ZZCA 4Q4W2 3URFA 2XPJA 4QX0A 4W6YA 4IERA 5A32A 2PHUA 5FMOL 3MUZ1 4E2SA 1XNKA 4NMIA 3AXEA 3WCSA 4JVAA 4C91A 5IK7A 4Q4W1 1JUHA 4D8MA 3MBWA 2DFBA 1W2OA 5GLUA 2QQNA 1UQXA 2RM22 3NJVA 1EY2A 2ZHKA 3IDEA 5B2GB 2WYFA 3ZXGA 3TN92 3ZFFB 1QHDA 5D8AB 5FP8A 2RM21 4J25A 1YUDA 1V6OA 3QCWA 4XQ4A 1SZBA 4K1YA 4LORA 3TN91 3DN7A 5EV7A 3WNKA 2VQ0A 5B4XA 1FMD3 5ANQA 5C8CB 1N3PA 4QQPA 5J7MA 1QU0A 3E6BA 4JRAA 1JYVA 2QQVA 4MO3M 5L73A 4KH9A 3L9JT 3HIFA 3BKZA 4K9SA 2RDSA 4AK3A 2ZGMA 2W94A 1NQJA 4IEQA 1W99A 1YI9A 2E31A 4CPBA 2AZ5A 4COUA 1HRV2 4AI9A 1W0PA 4Q0PA 5ISLA 1UPIA 4BMBA 4FPEA 4GWJA 1VAKA 5FP9A 1WCDJ 2Y6KA 1HRV1 2I45A 2XJTA 3NWKA 4CP0A 2D5FA 3MZHA 2JE8A 4OUMA 4DXTA 1PVXA 3ILNA 3FHIB 3OGSA 1VPHA 3MGUA 1OBNA 4G3YC 4O7XA 5ABJA 2JG9C 4UT5A 2R061 2XHKA 5JWPA 3LFIA 3WDWA 5JPNB 1AL22 2XJVA 2B9VA 2RS53 3OUIA 5DUUA 2Y0IA 4UFMA 3GCWA 5FZHA 2OQ6A 1GKBA 3BPSA 4P9WA 4M00A 2ZZQA 3U4SA 1LHNA 5BNNA 2NMOA 1AL21 1DP0A 3DL3A 1RUC2 1NE6A 3OGRA 4LBMA 2ZCWA 3O5SA 4Y22A 4A6SA 4IE0A 2WNUB 2H0BA 4KI5M 4CTEA 5HPOA 3QH7A 5GZFA 1V6NA 4CCCA 1RUC1 2HWF3 1NUKA 2ADDA 1OHFA 3C7GA 3D4KA 4Q5OA 3KLSA 3ZXLA 2ZGUA 1RL3A 2ORZA 2BOJA 1Z78A 1VBB3 1KS4A 5KXBA 4Q8KA 3BU0A 1ZRDA 4I0BA 1FPN2 3E97A 5DAXA 3NMBA 2JDZA 3WDTA 4MGYE 4XBNA 2RS33 2X5IC 4LBLA 4QX3A 4IDZA 3VHNA 4BIOA 2EIDA 1D4VB 2WO2A 3CF6E 1OQDA 4F3JA 5LBEA 1FPN1 2PQSA 3ORJA 1ENSA 4N53A 4CCJA 4B1LA 4XHXA 1B35A 5CKQA 1W6OB 1AR63 4PT6A 4E8DA 3WG2A 4DQAA 3JCIA 5JMCA 5BPXA 2A6ZA 2JDKA 1S0BA 4GWNA 3Q8AA 5LW9A 3NJZA 3W20A 1KQRA 2E33A 5J37A 3KV5A 3V0AA 4O61A 3MW2A 1KS5A 1DQ5A 1ST8A 1GZWA 1UCXA 5T3NA 1BEV2 1GFF2 4HT1T 3AMMA 5DG2A 4LEJA 3ZYJB 1LNSA 4BK4A 3MYXA 4AEDA 4LR4A 4B4PA 2YU1A 1BEV1 1QXJA 4N7UA 2D6MA 1EUTA 1XNDA 2YGMA 3MIGA 5K8SA 1FMD2 2CGOA 5I0SA 1ZA4A 2BERA 3C8XA 1RIRA 1SHWB 1HIXA 1V6IA 1NAEA 3LSEA 5SV8A 3ZYFA 4WM8C 4CXWA 1FMD1 2Q8DA 3KM5A 5FLJA 3RZHA 5C5UA 1XNCA 1SLLA 1UY3A 1JYXA 1PZ7A 3FLTA 1LGBA 3PUIA 4V2VA 3AMHA 4LK7A 1GU3A 5H9PA 1URXA 2IFWA 2PA7A 2NM1A 4QDSA 1Y7BA 2G19A 2VCAA 4JGYA 5IAVA 2C5DA 5D1IA 5FLIA 1LESA 4PDWB 3D82A 2ZX3A 1J3QA 1IHMA 2JDPA 5J09A 5EXOA 4JDMA 3AMQA 1OH3A 1UYYA 4PLNA 4WV8A 5M0TA 2W95A 1W6QB 3VD9A 1JS9A 3AKSA 4HN1A 2L9LA 2WZ8A 1O4YA 4XUNA 3UYJA 4IL7A 1H30A 2EVXA 1LOFA 3VV1A 2JDHA 2Q1FA 2RS52 2JD9A 4QX8A 5T55A 3VN4A 2R16A 2X29A 4XUPA 5F3IA 1GZ9A 4NAOA 1H9WA 1IPSA 2FZ1A 4LO6B 2ARBA 3RZJA 2I74A 4N9IA 1CAUB 2RS51 3I59B 4OI0A 1DIWA 5FZ6A 2ZS6B 3ZPYA 3N9MA 3PU3A 1TE1B 5LY2A 3VBUA 2RHPA 1MZ5A 2CYFA 1V6MA 5LK5A 4CZSA 1Q8QA 2R7EB 4M4RA 1SCSA 1PO12 1XU1A 2B7YA 5FV3A 2D93A 5JSOA 4EN6B 4UAPA 1G86A 2WAOA 4L99A 4N9HA 4WM7B 4XPVA 3VBOB 2DU1A 1NE4A 1UXXX 4RD7A 3O1OA 3BVCA 1PO11 5BNPC 3ZN4A 4YLZA 2RS32 3DEMA 5C4WB 1JH5A 3AP6A 1CONA 3FWEA 2J1VA 2YU2A 4MV2A 5L36A 4N43B 3PUSA 3A23A
chains in the Genus database with same CATH topology
2HWE3 2OUJA 3OYWB 4HKOA 1ZZ9A 4FTEA 2JG8C 2N7GA 2YC0A 2B8MA 2WC2A 3POYA 4URTA 3AP7A 4BHPA 1GLHA 4YZ5A 4BQ1A 3UKNA 2NN8A 4PLMA 4Q29A 1LECA 1YFXA 5DZGA 1EYBA 2BEOA 2BUKA 5CB7A 5CBLA 1WA4A 4MX3A 1LJ7A 2ZHMA 1U5ZA 3MLJA 1APNA 1GSLA 4PIZA 3WUDA 4Q0SA 4K40A 4XF4A 1ASJ2 4CDQA 2VY0A 2IXIA 4UXAA 4P9XA 1MQTC 4NR1A 3SH3A 1R1ZA 1YLLA 3AP5A 3V56A 1ASJ1 4COWA 2E53A 4AHWA 1JXNA 1C5HA 5FQ0B 3M2MA 4DY3A 4C1WA 1ND2C 2D6NA 1S1AA 3UJQA 1IPJA 4EV0A 4Y20B 1RUE3 4M3CF 4PBOA 3V0BB 1EPWA 4I3GA 5FO7B 3GZAA 5HCBA 2WT1A 2YXSA 4X8PA 1AX2A 4N7IA 3R4UA 4RS5C 3ZXFA 1VBD3 3I2DA 4MUVA 4C0HA 4B7EA 2W08A 4I30A 2XKOA 3WW2A 5I0TA 1SBDA 4E2GA 2B5HA 4FXKB 1R081 1WLTA 4JDNA 3WD5A 2JG9B 1PGW2 1LR5A 2NYYA 4QQLA 2X8KA 1NCRA 3AKQA 1AR82 3NV4A 1YI7A 4Q0VA 2MHFA 1PGW1 4H3WA 2EAKA 1WBLA 4KWLA 3ALQA 4A2UA 1TNFA 4YG0A 3SLIA 2LALA 1AR81 3FX3A 1DGWX 1N47A 5FREA 1ND3A 4Q1PA 1VBE3 1QH6A 5AC92 5C33A 2D3PA 1FT9A 2BNOA 5JOXA 4LBQB 1V6JA 1LOBA 1F9KA 4H14A 2D6PA 5AC91 4RR3A 2VUAA 2H0VA 2G9GA 4HK8A 3H50A 2YZ4A 2ET1A 3VKFC 1IS5A 1S0IA 2HWE2 1D0HA 1HW5A 2Y26A 3THPA 2PAEA 2DFCA 4GKYA 4META 2X5IB 4I0AA 5GLVA 1K5MC 3E6CC 4GIQA 4BPZA 1E57A 1HKDA 1LOAA 2A3WA 2R0FA 4RHV3 4ZKTB 2HWE1 1LEDA 1NA1C 2XJPA 1I1EA 2R073 1I6XA 3CJIC 3WW1A 1H1IA 4R9BA 2Z79A 1SDWA 4IV3A 3O12A 3Q9OA 2B9UA 4DRVA 1PIV3 5LK7B 5EYXA 2WA4A 2ZAHA 4R8HA 2CWMA 5HCFA 1I5ZA 1Q56A 3RJRA 4A7ZA 4Q0UA 5AFEA 2TNFA 4ORFA 3SITA 3KB5A 1OFNA 1BYHA 1H8TA 2AGSA 4X8NA 2D44A 4YVSB 2XKPA 2BFUS 2ZHNA 3LGRA 3IM0A 3VZOA 3B00A 4WM8B 1JTZX 4G4FA 1KXGA 5C9AC 1RMU2 2WFF3 1S2KA 3TRSB 4Y24A 1RUE2 4MSVA 3OCPA 4D7YA 3SMHA 5FOJB 1PK6C 1N1VA 2QJVA 2XG3A 1RMU1 1RUJ2 4Y4YA 2OA2A 4XFBA 1YRZA 1RUE1 1VBD2 3GZTB 1CX4A 3W58A 2ERFA 1HXS1 1UL9A 1RUJ1 1PZ9A 1FNZA 4QT6A 4XF3A 3S7EA 1DGRN 3FFQA 1VBD1 1V6LA 2WFPA 2ZX2A 2KM2A 3S7IA 5F1RA 4FPLA 3L2YA 2VVFA 4BLJA 1CJPA 2DYCA 2WKKA 1H2KA 4MZUA 4XW3A 4AFBA 3RG0A 2H6BA 1WMFA 1OI6A 4Z07A 5H9RA 3DGTA 1MEC3 3D5OA 4AFMA 1VBE2 1FV2A 2PHWA 1EAH3 3A4UA 4YVWA 1VBE1 4AQ2A 5BNOA 5BNQA 3CL1A 1H2NA 2XBO2 3ZSMA 2IFRA 1AR93 3BPZA 2PLV3 1W6MA 2VNOA 2VOXA 3DV8A 4CDUB 3KS7A 2XBO1 4RHV2 2R043 1AR72 3KSCA 4FPGA 2R072 1G9BA 1MS4A 4XFCA 3ZYGA 2RMU3 4HANA 1SMVA 3AB0A 1CAVA 4RHV1 2JG8B 2R30A 5I8TA 1AR71 1G9FA 1S0EA 4K6BA 2XWBB 3N36A 2R071 4W6XA 3K51A 3VDDA 2I07B 1MS1A 4NPRA 1B09A 2XLFA 3MFAA 2D5HA 3ZFGA 3WDUA 3ZVXA 4YGDA 2VGDA 2WA3A 1G6NA 1RB8G 3PJYA 1U5IA 3HWJA 1G9DA 3DUIA 4YZ2A 1MR5A 4J1WA 4KU7A 3TYJA 5FMOS 4DRRA 3RYKA 1U0AA 4HPKB 3NAPA 3PVOA 3B02A 5HBAA 4CDXA 4KGQA 4MVTA 2GC3A 1MQTB 5ABJC 2JX9A 4CRQA 1DQ0A 1O5UA 1LHWA 1RJ7A 1Q8PA 2OZJA 3IIAA 3MIHA 4D69A 1G8WA 3FUOA 5IT6A 3WDXA 5L7OA 3JBG1 2VW0A 3R6SA 4E4SA 2ZGSA 5BNNC 2GC1A 2O0OA 2Z5WA 4M0HA 3D6EA 3M3OA 2ET7A 3FE5A 3B7MA 3ZMOA 3MF6A 4FPHA 1F2NA 4XF9A 3JUUA 1MS3A 3MPPG 2WIIB 2VULA 4RS5B 3DF0A 3MIBA 5J36A 2RJKA 3J26N 5E89A 4NHMA 1HV0A 5L19A 5CU1A 1M06G 3VKLA 1PVC2 2DUPA 1GV9A 1WD4A 1QWRA 1IKQA 1W6NB 3H9AA 3VBHA 1RUG2 2D7FA 2MPFA 1DGWA 1XNBA 4S2GA 1QOOA 1PVC1 1Z0HA 4UW3A 2CWSA 1AHSA 2RM23 1DLLA 4N53C 2A71A 2GNBA 1DU3D 1B35C 1RUG1 3M3CA 1EPZA 4FPKA 3E5XA 4GALA 5GZEA 5AFBA 3R4SA 5KHIA 1ZRFA 3WQ0A 2NZ9A 3ES4A 4MYEA 2ZGTA 3HR9A 5J98B 4XQDA 1C1LA 2E7AA 3IMNA 3H7YA 2Q30A 4LBQD 5GJ6A 4AEDC 1Q5OA 3PMSA 2QVSB 3CLPA 4K1ZA 2R6QA 1DGRA 2WNEA 4M0NA 3FJSA 4A7YA 4S2HA 4AI1A 1K5MB 4BZ4A 4PJYA 4H7MA 1JN2P 1NA1B 2ZGRA 4FVVA 1C8M2 2W52A 1JYCA 3UJOA 1A8MA 3CJIB 2UURA 2PHTA 4HVOA 1VJ2A 1AJKA 2AREA 2R063 4Y1ZA 4LA2A 1SLIA 4OI1A 1C8M1 2V5YA 5JI7A 3FUQA 4JGYC 5C9AA 4AEMA 4HBNA 4R9AA 3WR0A 1QJU2 4JQRA 1AL23 3ZFEA 1O3RA 3OPZA 3ZXKA 3AZWA 5A33B 4BMEA 4EN0A 3I8TA 5CFCA 3O7OA 1N1TA 2AYHA 3LA2A 1QJU1 2B42B 1W6PB 1T6GC 1RUC3 4ITCA 1YIPA 1D4M2 1RUOA 1LOFC 2HEVF 3PJQA 1HQNA 3EQEA 2A3YA 1ZX5A 1D4M1 4GQ7A 3TBDA 1ZZBA 3AK0A 3WV6A 3WLUA 4OHZA 3B9IA 3VBUC 1PK6B 4FQ4A 4HMZA 1FPN3 2VMIA 2XJRA 5BY5A 4W6WA 2ZJCA 2DWRA 4CEWA 1DQ2A 3OGJA 1N1YA 4FAHA 1GNZA 3GBWA 2VVEA 1VR3A 4FSJA 1U12A 2GH8A 4E4DX 4R52A 5CVRA 3N7LA 2XUMA 2JXAA 2VNGA 3PMEA 4HSLA 3ZSLA 1CPMA 1GQHA 3QACA 3VKOA 3NKTA 3ZN6A 3MIEA 4DS0A 1SLCA 1BEV3 1V9U3 2DVGA 1WMDA 2A3XA 3OY8A 5HCAA 1RGSA 1LOGA 1XU2A 5A32B 4QGMA 1ZYBA 1IZ3A 4JV4A 2E63A 2VOWA 3AFKA 1XRUA 4AHZA 4AQTA 1S0FA 5CAZA 3BTAA 3P3NA 2QDNA 3GALA 2B45X 4XMIA 4QXKA 1JOJA 4Z82A 2QCSB 4AG4A 1RUNA 1FOD1 4CDQC 2XH6A 3AP9A 4NOTA 5DDJ2 2GH2A 3HN1A 5JIAA 2G9FA 5KXEA 2R062 4OHWA 1YWKA 1W39A 5EZWA 3RZZA 1IS6A 5DDJ1 3VGIA 2OW4A 4HVQA 1WW7A 2ZACA 2ES3A 4Y1UA 3KMHA 4QGNA 4ONUA 2E9QA 3RS6A 5JI9A 1DYPA 1HQLA 3AMPA 3JB4C 5BUVA 4V1PA 3EBRA 4LULA 5HXVA 5BXXA 4KG8A 3RWNA 4RA0A 3AZYA 1U5YA 4AEJA 4KQ7A 3INAA 4FPCA 5HI0A 5ABJB 1PO13 4FQZA 4U2AA 4HSJA 2DUOA 1KRIA 2DCZA 4AYUA 1COV2 1LOEA 1NCRC 2BQPA 3WVJA 5DXDA 1QJX2 4SBVA 3U0ZA 1BZWA 3FBMA 2WZR3 1LCLA 2OZ6A 1COV1 1MZFA 2XL9A 2GC0A 4Y22B 1QJX1 3CU7A 1ND3C 1VBC2 3HD8B 4NWVA 4QPIA 3W59A 2JJ6A 1Q43A 2CV6A 4MH0E 1OOPA 3MW3A 2RJLA 4PCRA 1VBC1 2W0XA 2FZ2A 1DYKA 4RR3C 1G9CA 1C3HA 1OFSA 5F6KA 1MZEA 2ZHLA 1WCKA 1CESA 3LWCA 4L9BA 4I02A 4LO8A 1V9U2 3WY6A 2P3KA 2DVFA 2HWB2 4QQOA 2V09A 4N53B 1ZREA 1V9U1 5T54A 1WW5A 1GR3A 1B35B 1MVEA 1PO23 3H0OA 2HWB1 1ASJ3 4IV3C 1QKQA 2JE9A 3N7JA 5IK4A 4XF1A 3V0AB 2JE7A 1AXKA 4SLIA 2P3JA 3HAGA 3TNQA 2DCJA 3OBTA 2NLRA 5DUVA 4AEDB 3KCYA 1FXZA 1F8VA 3M8LA 1H8TC 1OPMA 1RUI3 2UYAA 4AW7A 2WS92 4GH4A 4R4ZA 2P34A 3SHRA 2ZKNA 5GZDA 4TSVA 1QDCA 1ENQA 2WS91 1R083 2GN7A 4WZCA 1V70A 2AH2A 1ZZ8A 1QDOA 2ZGPA 3MPBA 4GB31 1YFYA 4YZ3A 2GNTA 3E5QA 3KD4A 3ZXEA 3I59A 4QPGC 1OA2A 1AR83 4NHKA 4Y1VA 4XJZA 1AJOA 2BTVC 4IEOA 3I54A 1RVF2 1MS8A 3G6JB 3NV1A 1CAXA 5AC93 1X8EA 2VMHA 5GZCA 2GAUA 3J8F1 4E4ZA 3M7AA 3UKTA 1RVF1 2WZR2 3ME2A 4ZU4A 2QFEA 2TEPA 3EJKA 4IXLA 3OD4A 1VRH2 4Z8BA 1CD3G 3VBUB 1REDA 4RQPA 2WZR1 5LEJA 1ENXA 2IXLA 3H1YA 4XFFA 2JENA 1YO8A 2Z42A 1VRH1 4YVWC 3ZO0B 5BNOC 2YPJA 2GU9A 1PGSA 4IEXA 3VHRA 3UK9A 4WZFA 2UYBA 4NHLA 1Y9QA 4K3UA 5JZGC 2D43A 4AI8A 1Q8OA 2CNAA 1H0BA 1RHI2 2DTWA 1BJQA 2GNDA 3S30A 1QJY1 4MGIE 3ZX7A 4UBGA 3BCWA 3RMXA 4HKWA 3VBSA 1TMF3 1RHI1 1PO22 1ZBE2 4Y26A 4IV1A 4EN9B 1HRI3 2VECA 1Z7S2 3WNXA 1VP6A 2PHDA 5FCCA 4BCUA 3ILRA 4M3CA 1ZBA2 1ZBE1 2PHRA 1PO21 4JTOA 4XIKA 3VDDC 3WT3A 4P9JA 5T50A 3ZFGC 1O91A 4CDWA 3ZSJA 5FO9B 1UU4A 1Z7S1 2R1DA 3QD6A 4I2OA 4LE3A 1ZBA1 2VXRA 4FP3A 1IS4A 3ZXJA 1C57A 4GWMA 1OQEA 3O0XA 1RMU3 2HEYF 3WP4A 4I01A 5E8AA 4ASMB 1ULFA 1WW4A 3V0BA 4LHLA 1RUI2 3E5UA 3NAPC 2B46X 1BBT2 3AP4A 2ZMKA 5KHKA 1HXS3 5JOZA 4CDXC 1RUJ3 2K9ZA 4NWWA 4OVEA 4CDQB 3O0WA 1UIKA 1RUI1 1BBT1 1R082 2NMNA 4XHBA 4Q1RA 2VW1A 5AVAA 1A3KA 2GDFA 3ENRA 5L7OC 3WQ7A 4AI3A 3RNSA 1SCRA 2VG9A 4LO4B 2I2SA 4Z92B 3LAGA 4UW4A 4XFHA 4JAAA 4YW5A 5KHJA 1FI2A 2Q1MA 3PTYA 5LRSA 4OI2A 5EWSA 3OGGA 1O3TA 3SXWA 1X50A 3H3UA 1BVP1 2DVDA 5FBZA 2QZ2A 2CY6A 1EP0A 5E16A 2XVKA 1CAWA 3VBHC 1MVQA 2XBO3 2A6XA 1NCRB 5FO8B 2ZX4A 4INDA 4ISQA 1AL0G 4X6QB 2BWAA 2GSYA 5JR7B 1N3QA 4QQHA 4PLOA 3VHOA 1ND3B 1AR73 1X36A 3ATGA 4HVRA 3RYPA 3R05A 2ZPXA 4ATEA 2ZOEB 3X29B 3D0JA 4AHYA 3NVCA 2HWC2 4RR3B 2VQAA 5T5PA 1IOAA 2LM3A 4TYSA 4MLOA 4E2QA 5KBFA 1XQNA 4XMAA 4TZDA 4GKXA 4JC1A 4YSFA 3RYRA 3RPQA 1TMF2 4KGGA 2HWC1 2X53S 3ZMNA 1O3SA 2XWJB 1HRI2 1OQ1A 4P9YA 3VZLA 2Q5TA 1TMF1 2BGCA 2Q4SA 4P9IA 4YVSA 3CO2A 4GA9A 1HRI1 4MXWA 4OUSA 3U07A 4BIFA 4DY5A 1X33A 4IV3B 4WVMA 5I0UA 1N1SA 3ECQA 3JBG3 4EWEA 4K20A 4I0WB 3T1MA 3ZFEC 1RJ8A 3LKJA 1HLCA 1BK1A 5DUWA 4B4RA 2QKDA 5CA6A 1HXS2 4MGZE 5CFCC 3DPRA 2WL1A 4XZPA 1HX6A 4QPGA 4YZ1A 2HYKA 2EIGA 1S2BA 3VBRA 5FTTC 1H8TB 5ACA2 3ETQA 2RE9A 5IK8A 4GULA 1C28A 2BVBA 5FPZA 1NOVA 3AKPA 5ACA1 4DNYA 1U5XA 4WVWA 3WDVA 1XE8A 2BWCA 4XJ9A 2MEV2 1QNWA 2RR13 4BWOA 3AYAA 3RI9A 3OJBA 1PVC3 2YHJA 1R1A2 1QF3A 2VMGA 2VU9A 3N7KA 1A78A 2MEV1 4OZXA 1RUG3 1PGL2 1YJKA 1XYOA 1R1A1 2WQZC 4OHVA 3KT1A 4CEWC 1MS0A 4WVVA 1PGL1 4FO9A 1TME2 1QOSA 4XTMA 5CFDA 3HT2A 1FAYA 1UKRA 1PHMA 4W65A 2YGLA 1BXHA 5KXDA 3LSDA 2DV9A 3N7MA 4DFSA 4LT5A 3D0SA 1TME1 3MIFA 4MXVA 5JZGA 5BNPB 5F9TA 3S6PA 3AKRA 2EXJA 4LUMA 3AZVA 1X7NA 2JD4A 3IDBB 3M3EA 4Q26A 1IGOA 2WJSA 3B94A 3LB9A 5JOWA 1JW6A 2O1QA 4YVWB 1OD5A 1GBGA 5BNOB 2XVLA 3R4DB 3K48A 1DZTA 3ZIXA 1UD1A 4QM9A 1C8M3 4BYYA 4DINB 3GBFA 2P3IA 4ES9A 3JQWA 4YFWA 1YCIA 1W6MB 3RJ2X 3M4FA 4Z2WA 2DCTA 3LA3A 2A75A 3B69A 3I4IA 3USUA 3PHMA 4JTNA 4CEYA 3WXPA 2R49A 1ZVFA 4HPKA 4XIOA 1QJU3 4I09A 1HDKA 1LHOA 2E6VA 1CAVB 2FHRA 4JGZA 4OFGA 1NLRA 2YUEA 3FMGA 4YARA 2ZGQA 4BE3A 4QX5A 4F7ZA 1PNGA 2WNVA 4O9GA 3IBMA 4DXZA 3SCHA 3VDDB 3JBG2 3BODA 4KBBA 4OULA 1D4M3 4Q8LA 3ZFGB 4XBLA 4FPFA 1QQP3 1AVBA 2Y0OA 1UAIA 1S55A 2MNGA 3A0KA 1KDKA 1N3OA 1ND2B 1GNHA 3VKMA 1YFUA 2R0HA 2RS12 3MEPA 1GQGA 3VBFA 1LENA 2HJIA 2W39A 3NAPB 2RS11 3N3HA 4AVTA 5BYNA 5CG9A 4CDXB 4YZ4A 2LTNA 5JAXA 4P9LA 4QGLA 5IUQA 1NLSA 3RQ0A 3N4MA 1LU2A 2OIIA 4B29A 1LODA 3LA7A 1VAMA 1UX6A 2RR12 3GHNA 3PLQA 4P5HA 4AVCA 4C0BA 1NCQA 3BALA 2WSUA 5KHHA 5L7OB 1WLDA 2HWD2 3WZ1A 4B4QA 3IKWA 1CQ9A 3WG1A 3NKGA 1G7YA 2RR11 1VBA2 2D6LX 3D8CA 3HMYA 3ZSEA 1V00A 2ETEA 2HWD1 4PIXA 3UL2A 3QBQA 4QPIC 2B39A 3BOWA 1VBA1 5FLHA 4AVVA 1OOPC 2UWBA 4R9DA 5K9YA 2Y38A 2C0ZA 2DUQA 1REEA 4O9EA 1RUD2 4HKLA 4AVAA 1UF2C 5F6LB 1QXPA 5JVVA 2D3RA 3ES1A 4LA3A 3WG3A 1C1FA 1S0GA 2SBAA 4QPYA 3RDIA 4M01A 1RUD1 4AEKA 4DB5A 3VBHB 4UBHA 2PTMA 1AYM2 2V73A 1FOD3 2D40A 1BCXA 3IWZA 2ZMLA 1JHNA 3VZMA 2ATFA 1AYM1 3JB8A 1KDMA 2ZKLA 3AX4A 3NSTA 5DG1A 5DDJ3 5T5OA 1AUYA 3LZZA 4YGCA 1DZQA 2D98A 1SFNA 3VL9A 5CNAA 2G4IA 5T5JA 1DQ6A 4QD2A 3VZJA 1ULEA 3PVEA 4BOWA 2P2KA 1REFA 1SQ4A 3GNEA 4GH4C 3ZXDA 4R4XA 3U4XA 2NPIA 3MFCA 2FMDA 2D6OX 3MIDA 4L2NA 4YG6A 2NP0A 5K0UA 1AYN1 5SV5A 1QQP2 2DVAA 4QU2A 1NYWA 2AR6A 3CEWA 2ZBJA 1EV12 2PAKA 2WQ4A 3HQXA 5FRAA 4NO4A 1SLAA 1QQP1 5C9AB 1C5IA 1EV11 1WW6A 3WOGA 5KHGA 3ZFEB 1COV3 4AF9A 1FYUA 4K7JA 3IDCB 1QJX3 3IPVA 3TOJA 2ZGKA 2QQPA 5CFCB 4COVA 1NZCA 1LB2A 4PQ9A 1FX5A 1YJLA 4Q4X2 3GBGA 5JCTA 1VBC3 4Q4V2 4AQSA 1QH7A 2JKBA 4COZA 1X8MA 1XXNA 4G9SB 4LO5B 4YM1A 5KXCA 3HBZA 3NL1A 4Q4X1 3AZZA 4XOGA 3PVNA 4Q4V1 4XEZA 1AZDA 4ASLA 4Q4Y2 4RQPC 1BQPA 4B3NA 1POV1 4AVSA 2UWAA 4JDOA 1DG6A 5F5QA 3ZFFA 2P17A 2UU8A 2GN3A 4QQ2A 5D8AA 4Q4Y1 4YGBA 4CYDA 4ZU7A 4IQPA 2OPKA 1UZZA 1H9PA 2HWB3 3FLPA 1WD3A 2VH9A 5A3MA 3H8UA 3FC0A 4S2DA 4CEWB 5C8CA 2F6BA 3N35A 3ASIA 1W2UA 1A6CA 3MF9A 4XJWA 4E9KA 2CTVA 3WW3A 4Q2FA 3POSA 1CGPA 5C6CA 1WUVA 3WP6A 1FOD2 1J3RA 1DZRA 3C3VA 3H1MA 3VBSC 3ZN6B 1MS5A 5T5LA 2OYZA 4WVZA 4IEWA 4KG0A 3MDPA 2ZTNA 2ZZJA 4IV1C 5CIRA 3OY8B 1HQWA 1AXZA 1D2SA 1F5JA 2HEWF 3AXDA 4XBQA 4IEUA 3GF6A 4CDWC 2E7TA 2DCKA 2BPA2 1XYNA 3O0VA 2WS93 5JSPA 3WX5A 1NQDA 4IEPA 4ZU5A 5FOBB 1QMJA 1H2MA 2C9AA 2IXHA 5CG8A 1CPNA 1C4RA 4GB33 5AVPA 4EWDA 5CADA 2ZA9A 3L2HA 5LEKA 2R1BA 1H8VA 1RUH2 2CAVA 4YW4A 4L8QA 4CP1A 5FPXA 2XL7A 4A7KA 2WNUA 1NXMA 2P37A 1RUH1 2IXJA 3O14A 1ZZ7A 4EWAA 2XJQA 3MW4A 3B5LB 2VVDA 1SLBA 2CAUA 3J8F3 1UW8A 1RVF3 1YXWA 4ZXKA 3NV3A 2WZPP 3AFGA 1FNYA 2PHFA 4D7SA 5FDBA 5KC6A 1WCSA 3MI8A 4YM3A 1OKQA 5BNNB 5JOYA 1O3QA 5E1RA 1VRH3 3VZKA 4AVBA 5JPMB 4XJ8A 1OLQA 4N90A 1W6OA 3ZYRA 1POV0 4DZGA 2XVGA 1VALA 1A8DA 3ILFA 4AGVA 3APBA 4RL7A 5J3UA 3EHKA 1LHUA 1IS3A 2BNNA 1J1TA 2JICA 1AX1A 2H6CA 1QJY3 3ST7A 4YGEA 1YHFA 1RHI3 1PZ8A 1YFWA 2NQYA 4CP2A 1DQ1A 3KGZA 4IEYA 3NV2A 4QPIB 4ISRA 1ZBE3 2ZMNA 1CIWA 3OBRA 4AI0A 4E27A 3LCPA 3AYCA 2EXHA 1OOPB 4KL1A 3WQ1A 1Q8SA 2Q8OA 4FOVA 3AYDA 2VPVA 1Z7S3 4PBPA 3KGLA 3M70A 1ZBA3 5TSWA 5EJ3A 1SFYA 2QUOA 5EYYA 4LHKA 2KA3A 1GZWB 1F31A 2VOKA 1NG0A 4LBJA 2WINB 4EN7B 2QNKA 3M3QA 3B93A 2JECA 4PDWA 4M3CE 2UY8A 2A70A 1WLCA 1AF9A 2K0GA 2PHXA 4YVSC 5E88A 1BBT3 1W6QA 3AM2A 4BA6A 4HFSA 4XXAA 1I3HA 4GB32 1ONAA 1KFUL 3TNPB 1S0JA 4Y1YA 3EXUA 4JGYB 4HLTA 4F8AA 3DPRC 1PM7A 1CAUA 5I8YA 1TNRA 2IZWA 3VBRC 1XE7A 4AFDA 4YW1A 1SBFA 3ELNA 4IETA 1OPOA 4GH4B 3RRDA 3KT4A 3J8F2 3RI8A 1ULCA 3VBOA 4WM7A 4YG3A 1KITA 3U10A 3OF1A 2PN5A 3WG4A 4IEVA 4D94A 5GZGA 1SBEA 1H2LA 2EALA 3TAYA 2ZX1A 5C4WA 2WLQA 1O4TA 4KU8A 4N43A 2ZGOA 3UV9A 3NO8A 3OYWA 2ZGNA 4FOWA 4FPOB 4BLIA 2HWF2 1ZRRA 1OSGA 1RINA 3JD73 3R0RA 1MACA 1RITA 4LBOA 5CFDC 2IC1A 2EA7A 1CAXB 2HWF1 3I7DA 3OTFA 1VBB2 2CL2A 2YDEA 5BV6A 3B01A 1QJY2 3PNAA 3SH5A 1Y43B 4YNIA 5GM0A 4CDUC 5A3LA 1PNFA 1OA4A 1VBB1 3DKWA 3ZIWA 2HWC3 2VOVA 4L97A 3MICA 3H1WA 4RQPB 1J59A 2RS31 3IN9A 3WP5A 1VAVA 2ZAAA 1AR62 4FCAA 4J6GA 4UW5A 3B3QE 1QY4A 1DFQA 2VW2A 1QGLA 4XJAA 5DUXA 5J96B 1Y3TA 1AR61 1O7FA 4BH9A 3AJYA 5FQ0A 1QNYA 2A6WA 2FQPA 2YMZA 1FATA 4QHBA 4XFIA 2D6KA 4FOQA 2A5ZA 5I8SA 4CEYC 3B9CA 4BM8A 3VBSB 4Y20A 1YYNA 2QDRA 4JGZC 1WMEA 3RMYA 5DZEA 2Q1ZB 4IV1B 2R32A 2XJSA 1FV3A 2PFWA 2WNVC 1LKNA 4M3CB 1UZYA 1LTEA 5JDBA 4CDWB 5ACA3 1X82A 1KD7A 5KWRA 2XGXA 4K8FA 3CJXA 2JG9A 2TUNA 5FFOC 2A6YA 3VBFC 2GNMA 2MEV3 2XLGA 4AE2A 4YFZA 3ZDSA 4GXLA 2F4PA 2GMMA 4RSUA 1J1LA 3V65A 1R1A3 4XETA 3VLBB 3RSJA 1H4HA 4LBQA 3TB0A 5I0RA 4TLFA 1NCQC 3VL8A 1VB4A 1TME3 3QOPA 4COYA 2BVVA 2XLAA 4H7LA 4HK9A 4YYOA 2Z69A 2X5IA 4OI4A 3JD72 4KWKA 3VUOA 3A0NA 4XJUA 4JRLA 1ALYA 2FMYA 3MLLA 3ZYIB 3WCRA 2CGNA 3P3PA 4K21A 1WBFA 3SISA 4L92A 3JD71 4R9CA 2OUHA 3WHUA 4Q0QA 4HL0A 2QZ3A 2WWSA 2O8OA 2GMEA 4AXOA 4RFT0 4FP2A 1V6KA 3W9AA 5IK5A 2QE3A 1UU5A 1WLWA 5GALA 1CAWB 4LLFA 3LOBA 3KCXA 2W68A 1OA3A 3T2TA 5KC5A 4YW3A 4EJRA 1LULA 2IXKA 4LTAA 4XILA 1GZCA 4LBNA 3NW4A 1YNAA 2YV8A 3VHPA 4FXGB 5C8WA 2UWCA 4WM8A 5JLVA 3WUCA 1GYKA 3T1LA 4AGRA 2C1FA 4XTPA 3TWIA 2ILMA 1H1MA 3H3ZA 2YY1A 5I93A 2RS13 2WSVA 2BW8A 4NN0A 1G9AA 2BYVE 5K0UC 3WW4A 1S0DA 4MXWB 1KFXL 2TBVA 1W0OA 4FT8A 3M1HA 1XYPA 4AFAA 4WVMB 1UIJA 4XFAA 1DF0A 4XQWA 3KZ4C 3VZNA 5T52A 4S2FA 1Q3EA 4XYXA 1JYIA 2VUJA 4XF0A 1WGPA 4AWDA 3GZUC 4YM2A 2IWGB 2HWD3 2JEMA 2UY9A 3DPRB 1AX0A 1KJRA 4QPGB 2DURA 1VBA3 3VBRB 3BU7A 4GMP3 5GKAC 1I9RA 1F5FA 4A3XA 1J3PA 4LBKA 1Q8VA 1JBCA 1TQ5A 4OHXA 2O8QA 3J4UH 1RUD3 4I3PA 2D3SA 4FPJA 1GICA 2WT0A 1O4ZA 4QM8A 5BNPA 4CDUA 3ZFFC 3VKNA 1UMZA 1R093