3JQYA

Crystal strucutre of the polysia specific acetyltransferase neuo
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
233
structure length
233
Chain Sequence
KTQDSRLKTQDSFSVDDNGSGNVFVCGDLVNSKENKVQFNGNNNKLIIEDDVECRWLTVIFRGDNNYVRIHKNSKIKGDIVATKGSKVIIGRRTTIGAGFEVVTDKCNVTIGHDCMIARDVILRASDGHPIFDIHSKKRINWAKDIIISSYVWVGRNVSIMKGVSVGSGSVIGYGSIVTKDVPSMCAAAGNPAKIIKRNIIWARTDKAELISDDKRCSSYHAKLTQLEHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Polysialic acid O-acetyltransferase
publication title Crystal structure analysis of the polysialic acid specific O-acetyltransferase NeuO
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 89
structure length 233
sequence length 233
chains with identical sequence B, C
ec nomenclature ec 2.3.1.136: Polysialic-acid O-acetyltransferase.
pdb deposition date 2009-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 3jqyA00
1KRUA 1KRVA 2V0KA 4G3SA 4G87A 3BXYA 1FWYA 3FSBA 2I5KA 3V4EA 3FSYA 5DG3A 3DHOA 2AQ9A 2VD4A 4R37A 1KK4A 3TDTA 5U2KA 1G97A 2OEGA 3OU9A 4M28A 3FS8A 3R5CA 2OEFA 4IHGA 5L6VA 3R3IA 2WLFA 4M2BA 2TDTA 2WLEA 3IXCA 2WLCA 4R7PA 5DEMA 2IU9A 3EG4A 4E6UA 5AFUU 1Z90A 1KGQA 2IUAA 2ICYA 5E3RA 3R5DA 3KWEA 3GVDA 4EAAA 1V67A 2JF3A 4M2AA 4E79A 3MC4A 1HM9A 2Q4JA 3DJ4A 4M9CA 3MQHA 2QIVX 4KNXA 4HCQA 3HJJA 1QQ0A 1SSMA 3I3AA 2IC7A 4FCEA 4M99A 1QRGA 1YP3A 1S80A 4EA9A 4AC3A 1HV9A 4E1KA 2QIAA 4KPXA 1KK6A 1OCXA 1MR9A 3BSYA 4AA7A 1J2ZA 3R1WA 3FWWA 3T57A 5E3PA 2FKOA 4G3PA 4N27A 3P1BA 3CJ8A 3Q1XA 3R5BA 4G3QA 4N6AA 1XATA 3FSCA 4EABA 3EEVA 4E6TA 2VHEA 3I3XA 3SRTA 4J18A 1SSTA 1G95A 5L6SA 3TISA 2QKXA 2V0IA 4KPZA 3NZ2A 4N69A 4J09A 2ICXA 1KHRA 5F42A 3KWCA 1QREA 5ADXV 3HSQA 3FTTA 3P47A 3R3RA 4KNRA 4HURA 1HM8A 1MR7A 2OI7A 4EQYA 3VBPA 1KQAA 2JF2A 1KK5A 3MQGA 1QRFA 3OUPA 4E75A 3EH0A 3BFPA 1QRLA 3IGJA 4H7OA 4R36A 3GUEA 3PMOA 1KRRA 2NPOA 3DK5A 4IHHA 1HM0A 1V3WA 4ISXA 3TWDA 3OTZA 4EA8A 4EGGA 2GGQA 2V0JA 4MYOA 1LXAA 1THJA 1MRLA 4HUSA 3SPTA 2RIJA 5E3QA 4EA7A 2W0VA 1QRMA 3C8VA 3R2WA 4MFGA 1KGTA 5ADXU 3TV0A 2WLGA 2GGOA 5DEPA 3KWDA 1XHDA 3F1XA 3ECTA 3FSXA 3GOSA 3VNPA 2OI6A 4N6BA 3VBKA 3D8VA 2XATA 4K6RA 3TIOA 4M98A 1TDTA 4KQLA 4DCLA 3OTMA 3JQYA 3FOQA 2WLDA 3VBJA 4AAWA 3BRKX 3D98A 3BSWA 4MZUA 3VBMA 1YP4A 2IU8A 3VBNA 1T3DA 3VBLA 3R5AA 3R8YA 2OI5A 1FXJA 1YP2A 2P2OA 3OW5A 5AFUV 2V0LA 3ST8A 2W0WA 4IHFA 2V0HA 3BSSA 3R0SA 4HZCA 3TK8A 3VBIA 1SSQA 4HZDA
chains in the Genus database with same CATH superfamily
1KRUA 1KRVA 2V0KA 4G3SA 4G87A 3BXYA 1FWYA 3FSBA 2I5KA 3V4EA 3FSYA 5DG3A 3DHOA 2AQ9A 1M8NA 2VD4A 1KK4A 4R37A 3TDTA 5U2KA 1G97A 2OEGA 3OU9A 4M28A 3FS8A 3R5CA 2OEFA 4IHGA 5L6VA 3R3IA 2WLFA 4M2BA 2TDTA 2WLEA 3IXCA 2WLCA 4R7PA 5DEMA 3GQAA 2IU9A 3EG4A 4E6UA 5AFUU 1Z90A 1KGQA 2IUAA 2ICYA 5E3RA 3R5DA 3KWEA 3GVDA 4EAAA 1V67A 2JF3A 4M2AA 3OH3A 4E79A 3MC4A 1HM9A 2Q4JA 3DJ4A 4M9CA 3OH2A 3MQHA 2QIVX 4KNXA 4HCQA 3HJJA 1QQ0A 1SSMA 3I3AA 2IC7A 4FCEA 4M99A 1QRGA 1YP3A 1S80A 4EA9A 4AC3A 1HV9A 4E1KA 2QIAA 4KPXA 1KK6A 1OCXA 1MR9A 3BSYA 4AA7A 1J2ZA 3R1WA 3FWWA 3T57A 5E3PA 2FKOA 4G3PA 4N27A 3P1BA 3CJ8A 3Q1XA 3R5BA 4G3QA 4N6AA 1XATA 3FSCA 4EABA 3EEVA 4E6TA 2VHEA 3I3XA 1EWWA 3SRTA 4J18A 1SSTA 1G95A 5L6SA 3TISA 2QKXA 2V0IA 4KPZA 3NZ2A 4N69A 4J09A 2ICXA 1KHRA 5F42A 3KWCA 1QREA 5ADXV 3HSQA 3FTTA 3P47A 3R3RA 4KNRA 4HURA 1HM8A 1MR7A 2OI7A 4EQYA 3VBPA 1KQAA 2JF2A 1KK5A 3MQGA 1QRFA 3OUPA 4E75A 3EH0A 3BFPA 1QRLA 3IGJA 4H7OA 4R36A 3GUEA 1N4IA 1KRRA 3PMOA 2NPOA 3DK5A 4IHHA 1HM0A 1V3WA 3OH1A 4ISXA 3TWDA 3OTZA 3SUCA 4EA8A 3OGZA 4EGGA 2GGQA 2V0JA 4MYOA 1LXAA 1THJA 1MRLA 4HUSA 3SPTA 2RIJA 5E3QA 4EA7A 2W0VA 1QRMA 3C8VA 3R2WA 4MFGA 1KGTA 5ADXU 3TV0A 2WLGA 2GGOA 5DEPA 3KWDA 1XHDA 3F1XA 3ECTA 3FSXA 3GOSA 3VNPA 2OI6A 4N6BA 3VBKA 3D8VA 2XATA 4K6RA 3TIOA 4M98A 1TDTA 4KQLA 4DCLA 3OTMA 3JQYA 3FOQA 2WLDA 3VBJA 4AAWA 3BRKX 3D98A 3BSWA 4MZUA 3GQ7A 1L0SA 1YP4A 3VBMA 3GQ9A 2IU8A 3VBNA 3OH4A 1T3DA 3VBLA 3R5AA 3R8YA 2OI5A 1FXJA 3GQ8A 3OH0A 1YP2A 2P2OA 3OW5A 5AFUV 2V0LA 3ST8A 2W0WA 4IHFA 2V0HA 3BSSA 3R0SA 1Z2FA 4HZCA 3TK8A 3VBIA 1SSQA 4HZDA
chains in the Genus database with same CATH topology
1KRUA 1KRVA 2V0KA 4G3SA 4G87A 3BXYA 1FWYA 3FSBA 2I5KA 3V4EA 3FSYA 5DG3A 3DHOA 2AQ9A 2VD4A 4R37A 1KK4A 3TDTA 5U2KA 1G97A 2OEGA 3OU9A 4M28A 3FS8A 3R5CA 2OEFA 4IHGA 5L6VA 3R3IA 2WLFA 4M2BA 2TDTA 2WLEA 3IXCA 2WLCA 4R7PA 5DEMA 2IU9A 3EG4A 4E6UA 5AFUU 1Z90A 1KGQA 2IUAA 2ICYA 5E3RA 3R5DA 3KWEA 3GVDA 4EAAA 1V67A 2JF3A 4M2AA 4E79A 3MC4A 1HM9A 2Q4JA 3DJ4A 4M9CA 3MQHA 2QIVX 4KNXA 4HCQA 3HJJA 1QQ0A 1SSMA 3I3AA 2IC7A 4FCEA 4M99A 1QRGA 1YP3A 1S80A 4EA9A 4AC3A 1HV9A 4E1KA 2QIAA 4KPXA 1KK6A 1OCXA 1MR9A 3BSYA 4AA7A 1J2ZA 3R1WA 3FWWA 3T57A 5E3PA 2FKOA 4G3PA 4N27A 3P1BA 3CJ8A 3Q1XA 3R5BA 4G3QA 4N6AA 1XATA 3FSCA 4EABA 3EEVA 4E6TA 2VHEA 3I3XA 3SRTA 4J18A 1SSTA 1G95A 5L6SA 3TISA 2QKXA 2V0IA 4KPZA 3NZ2A 4N69A 4J09A 2ICXA 1KHRA 5F42A 3KWCA 1QREA 5ADXV 3HSQA 3FTTA 3P47A 3R3RA 4KNRA 4HURA 1HM8A 1MR7A 2OI7A 4EQYA 3VBPA 1KQAA 2JF2A 1KK5A 3MQGA 1QRFA 3OUPA 4E75A 3EH0A 3BFPA 1QRLA 3IGJA 4H7OA 4R36A 3GUEA 3PMOA 1KRRA 2NPOA 3DK5A 4IHHA 1HM0A 1V3WA 4ISXA 3TWDA 3OTZA 4EA8A 4EGGA 2GGQA 2V0JA 4MYOA 1LXAA 1THJA 1MRLA 4HUSA 3SPTA 2RIJA 5E3QA 4EA7A 2W0VA 1QRMA 3C8VA 3R2WA 4MFGA 1KGTA 5ADXU 3TV0A 2WLGA 2GGOA 5DEPA 3KWDA 1XHDA 3F1XA 3ECTA 3FSXA 3GOSA 3VNPA 2OI6A 4N6BA 3VBKA 3D8VA 2XATA 4K6RA 3TIOA 4M98A 1TDTA 4KQLA 4DCLA 3OTMA 3JQYA 3FOQA 2WLDA 3VBJA 4AAWA 3BRKX 3D98A 3BSWA 4MZUA 3VBMA 1YP4A 2IU8A 3VBNA 1T3DA 3VBLA 3R5AA 3R8YA 2OI5A 1FXJA 1YP2A 2P2OA 3OW5A 5AFUV 2V0LA 3ST8A 2W0WA 4IHFA 2V0HA 3BSSA 3R0SA 4HZCA 3TK8A 3VBIA 1SSQA 4HZDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KRU A;  1KRV A;  2V0K A;  4G3S A;  4G87 A;  3BXY A;  1FWY A;  3FSB A;  2I5K A;  3V4E A;  3FSY A;  5DG3 A;  3DHO A;  2AQ9 A;  2VD4 A;  4R37 A;  1KK4 A;  3TDT A;  5U2K A;  1G97 A;  2OEG A;  3OU9 A;  4M28 A;  3FS8 A;  3R5C A;  2OEF A;  4IHG A;  5L6V A;  3R3I A;  2WLF A;  4M2B A;  2TDT A;  2WLE A;  3IXC A;  2WLC A;  4R7P A;  5DEM A;  2IU9 A;  3EG4 A;  4E6U A;  5AFU U;  1Z90 A;  1KGQ A;  2IUA A;  2ICY A;  5E3R A;  3R5D A;  3KWE A;  3GVD A;  4EAA A;  1V67 A;  2JF3 A;  4M2A A;  4E79 A;  3MC4 A;  1HM9 A;  2Q4J A;  3DJ4 A;  4M9C A;  3MQH A;  2QIV X;  4KNX A;  4HCQ A;  3HJJ A;  1QQ0 A;  1SSM A;  3I3A A;  2IC7 A;  4FCE A;  4M99 A;  1QRG A;  1YP3 A;  1S80 A;  4EA9 A;  4AC3 A;  1HV9 A;  4E1K A;  2QIA A;  4KPX A;  1KK6 A;  1OCX A;  1MR9 A;  3BSY A;  4AA7 A;  1J2Z A;  3R1W A;  3FWW A;  3T57 A;  5E3P A;  2FKO A;  4G3P A;  4N27 A;  3P1B A;  3CJ8 A;  3Q1X A;  3R5B A;  4G3Q A;  4N6A A;  1XAT A;  3FSC A;  4EAB A;  3EEV A;  4E6T A;  2VHE A;  3I3X A;  3SRT A;  4J18 A;  1SST A;  1G95 A;  5L6S A;  3TIS A;  2QKX A;  2V0I A;  4KPZ A;  3NZ2 A;  4N69 A;  4J09 A;  2ICX A;  1KHR A;  5F42 A;  3KWC A;  1QRE A;  5ADX V;  3HSQ A;  3FTT A;  3P47 A;  3R3R A;  4KNR A;  4HUR A;  1HM8 A;  1MR7 A;  2OI7 A;  4EQY A;  3VBP A;  1KQA A;  2JF2 A;  1KK5 A;  3MQG A;  1QRF A;  3OUP A;  4E75 A;  3EH0 A;  3BFP A;  1QRL A;  3IGJ A;  4H7O A;  4R36 A;  3GUE A;  3PMO A;  1KRR A;  2NPO A;  3DK5 A;  4IHH A;  1HM0 A;  1V3W A;  4ISX A;  3TWD A;  3OTZ A;  4EA8 A;  4EGG A;  2GGQ A;  2V0J A;  4MYO A;  1LXA A;  1THJ A;  1MRL A;  4HUS A;  3SPT A;  2RIJ A;  5E3Q A;  4EA7 A;  2W0V A;  1QRM A;  3C8V A;  3R2W A;  4MFG A;  1KGT A;  5ADX U;  3TV0 A;  2WLG A;  2GGO A;  5DEP A;  3KWD A;  1XHD A;  3F1X A;  3ECT A;  3FSX A;  3GOS A;  3VNP A;  2OI6 A;  4N6B A;  3VBK A;  3D8V A;  2XAT A;  4K6R A;  3TIO A;  4M98 A;  1TDT A;  4KQL A;  4DCL A;  3OTM A;  3JQY A;  3FOQ A;  2WLD A;  3VBJ A;  4AAW A;  3BRK X;  3D98 A;  3BSW A;  4MZU A;  3VBM A;  1YP4 A;  2IU8 A;  3VBN A;  1T3D A;  3VBL A;  3R5A A;  3R8Y A;  2OI5 A;  1FXJ A;  1YP2 A;  2P2O A;  3OW5 A;  5AFU V;  2V0L A;  3ST8 A;  2W0W A;  4IHF A;  2V0H A;  3BSS A;  3R0S A;  4HZC A;  3TK8 A;  3VBI A;  1SSQ A;  4HZD A; 
#chains in the Genus database with same CATH topology
 1KRU A;  1KRV A;  2V0K A;  4G3S A;  4G87 A;  3BXY A;  1FWY A;  3FSB A;  2I5K A;  3V4E A;  3FSY A;  5DG3 A;  3DHO A;  2AQ9 A;  1M8N A;  2VD4 A;  1KK4 A;  4R37 A;  3TDT A;  5U2K A;  1G97 A;  2OEG A;  3OU9 A;  4M28 A;  3FS8 A;  3R5C A;  2OEF A;  4IHG A;  5L6V A;  3R3I A;  2WLF A;  4M2B A;  2TDT A;  2WLE A;  3IXC A;  2WLC A;  4R7P A;  5DEM A;  3GQA A;  2IU9 A;  3EG4 A;  4E6U A;  5AFU U;  1Z90 A;  1KGQ A;  2IUA A;  2ICY A;  5E3R A;  3R5D A;  3KWE A;  3GVD A;  4EAA A;  1V67 A;  2JF3 A;  4M2A A;  3OH3 A;  4E79 A;  3MC4 A;  1HM9 A;  2Q4J A;  3DJ4 A;  4M9C A;  3OH2 A;  3MQH A;  2QIV X;  4KNX A;  4HCQ A;  3HJJ A;  1QQ0 A;  1SSM A;  3I3A A;  2IC7 A;  4FCE A;  4M99 A;  1QRG A;  1YP3 A;  1S80 A;  4EA9 A;  4AC3 A;  1HV9 A;  4E1K A;  2QIA A;  4KPX A;  1KK6 A;  1OCX A;  1MR9 A;  3BSY A;  4AA7 A;  1J2Z A;  3R1W A;  3FWW A;  3T57 A;  5E3P A;  2FKO A;  4G3P A;  4N27 A;  3P1B A;  3CJ8 A;  3Q1X A;  3R5B A;  4G3Q A;  4N6A A;  1XAT A;  3FSC A;  4EAB A;  3EEV A;  4E6T A;  2VHE A;  3I3X A;  1EWW A;  3SRT A;  4J18 A;  1SST A;  1G95 A;  5L6S A;  3TIS A;  2QKX A;  2V0I A;  4KPZ A;  3NZ2 A;  4N69 A;  4J09 A;  2ICX A;  1KHR A;  5F42 A;  3KWC A;  1QRE A;  5ADX V;  3HSQ A;  3FTT A;  3P47 A;  3R3R A;  4KNR A;  4HUR A;  1HM8 A;  1MR7 A;  2OI7 A;  4EQY A;  3VBP A;  1KQA A;  2JF2 A;  1KK5 A;  3MQG A;  1QRF A;  3OUP A;  4E75 A;  3EH0 A;  3BFP A;  1QRL A;  3IGJ A;  4H7O A;  4R36 A;  3GUE A;  1N4I A;  1KRR A;  3PMO A;  2NPO A;  3DK5 A;  4IHH A;  1HM0 A;  1V3W A;  3OH1 A;  4ISX A;  3TWD A;  3OTZ A;  3SUC A;  4EA8 A;  3OGZ A;  4EGG A;  2GGQ A;  2V0J A;  4MYO A;  1LXA A;  1THJ A;  1MRL A;  4HUS A;  3SPT A;  2RIJ A;  5E3Q A;  4EA7 A;  2W0V A;  1QRM A;  3C8V A;  3R2W A;  4MFG A;  1KGT A;  5ADX U;  3TV0 A;  2WLG A;  2GGO A;  5DEP A;  3KWD A;  1XHD A;  3F1X A;  3ECT A;  3FSX A;  3GOS A;  3VNP A;  2OI6 A;  4N6B A;  3VBK A;  3D8V A;  2XAT A;  4K6R A;  3TIO A;  4M98 A;  1TDT A;  4KQL A;  4DCL A;  3OTM A;  3JQY A;  3FOQ A;  2WLD A;  3VBJ A;  4AAW A;  3BRK X;  3D98 A;  3BSW A;  4MZU A;  3GQ7 A;  1L0S A;  1YP4 A;  3VBM A;  3GQ9 A;  2IU8 A;  3VBN A;  3OH4 A;  1T3D A;  3VBL A;  3R5A A;  3R8Y A;  2OI5 A;  1FXJ A;  3GQ8 A;  3OH0 A;  1YP2 A;  2P2O A;  3OW5 A;  5AFU V;  2V0L A;  3ST8 A;  2W0W A;  4IHF A;  2V0H A;  3BSS A;  3R0S A;  1Z2F A;  4HZC A;  3TK8 A;  3VBI A;  1SSQ A;  4HZD A; 
#chains in the Genus database with same CATH homology
 1KRU A;  1KRV A;  2V0K A;  4G3S A;  4G87 A;  3BXY A;  1FWY A;  3FSB A;  2I5K A;  3V4E A;  3FSY A;  5DG3 A;  3DHO A;  2AQ9 A;  2VD4 A;  4R37 A;  1KK4 A;  3TDT A;  5U2K A;  1G97 A;  2OEG A;  3OU9 A;  4M28 A;  3FS8 A;  3R5C A;  2OEF A;  4IHG A;  5L6V A;  3R3I A;  2WLF A;  4M2B A;  2TDT A;  2WLE A;  3IXC A;  2WLC A;  4R7P A;  5DEM A;  2IU9 A;  3EG4 A;  4E6U A;  5AFU U;  1Z90 A;  1KGQ A;  2IUA A;  2ICY A;  5E3R A;  3R5D A;  3KWE A;  3GVD A;  4EAA A;  1V67 A;  2JF3 A;  4M2A A;  4E79 A;  3MC4 A;  1HM9 A;  2Q4J A;  3DJ4 A;  4M9C A;  3MQH A;  2QIV X;  4KNX A;  4HCQ A;  3HJJ A;  1QQ0 A;  1SSM A;  3I3A A;  2IC7 A;  4FCE A;  4M99 A;  1QRG A;  1YP3 A;  1S80 A;  4EA9 A;  4AC3 A;  1HV9 A;  4E1K A;  2QIA A;  4KPX A;  1KK6 A;  1OCX A;  1MR9 A;  3BSY A;  4AA7 A;  1J2Z A;  3R1W A;  3FWW A;  3T57 A;  5E3P A;  2FKO A;  4G3P A;  4N27 A;  3P1B A;  3CJ8 A;  3Q1X A;  3R5B A;  4G3Q A;  4N6A A;  1XAT A;  3FSC A;  4EAB A;  3EEV A;  4E6T A;  2VHE A;  3I3X A;  3SRT A;  4J18 A;  1SST A;  1G95 A;  5L6S A;  3TIS A;  2QKX A;  2V0I A;  4KPZ A;  3NZ2 A;  4N69 A;  4J09 A;  2ICX A;  1KHR A;  5F42 A;  3KWC A;  1QRE A;  5ADX V;  3HSQ A;  3FTT A;  3P47 A;  3R3R A;  4KNR A;  4HUR A;  1HM8 A;  1MR7 A;  2OI7 A;  4EQY A;  3VBP A;  1KQA A;  2JF2 A;  1KK5 A;  3MQG A;  1QRF A;  3OUP A;  4E75 A;  3EH0 A;  3BFP A;  1QRL A;  3IGJ A;  4H7O A;  4R36 A;  3GUE A;  3PMO A;  1KRR A;  2NPO A;  3DK5 A;  4IHH A;  1HM0 A;  1V3W A;  4ISX A;  3TWD A;  3OTZ A;  4EA8 A;  4EGG A;  2GGQ A;  2V0J A;  4MYO A;  1LXA A;  1THJ A;  1MRL A;  4HUS A;  3SPT A;  2RIJ A;  5E3Q A;  4EA7 A;  2W0V A;  1QRM A;  3C8V A;  3R2W A;  4MFG A;  1KGT A;  5ADX U;  3TV0 A;  2WLG A;  2GGO A;  5DEP A;  3KWD A;  1XHD A;  3F1X A;  3ECT A;  3FSX A;  3GOS A;  3VNP A;  2OI6 A;  4N6B A;  3VBK A;  3D8V A;  2XAT A;  4K6R A;  3TIO A;  4M98 A;  1TDT A;  4KQL A;  4DCL A;  3OTM A;  3JQY A;  3FOQ A;  2WLD A;  3VBJ A;  4AAW A;  3BRK X;  3D98 A;  3BSW A;  4MZU A;  3VBM A;  1YP4 A;  2IU8 A;  3VBN A;  1T3D A;  3VBL A;  3R5A A;  3R8Y A;  2OI5 A;  1FXJ A;  1YP2 A;  2P2O A;  3OW5 A;  5AFU V;  2V0L A;  3ST8 A;  2W0W A;  4IHF A;  2V0H A;  3BSS A;  3R0S A;  4HZC A;  3TK8 A;  3VBI A;  1SSQ A;  4HZD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...