3JQYA

Crystal strucutre of the polysia specific acetyltransferase neuo
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
233
structure length
233
Chain Sequence
KTQDSRLKTQDSFSVDDNGSGNVFVCGDLVNSKENKVQFNGNNNKLIIEDDVECRWLTVIFRGDNNYVRIHKNSKIKGDIVATKGSKVIIGRRTTIGAGFEVVTDKCNVTIGHDCMIARDVILRASDGHPIFDIHSKKRINWAKDIIISSYVWVGRNVSIMKGVSVGSGSVIGYGSIVTKDVPSMCAAAGNPAKIIKRNIIWARTDKAELISDDKRCSSYHAKLTQLEHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure analysis of the polysialic acid specific O-acetyltransferase NeuO
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords Polysialic acid O-acetyltransferase
total genus 89
structure length 233
sequence length 233
chains with identical sequence B, C
ec nomenclature ec 2.3.1.136: Polysialic-acid O-acetyltransferase.
pdb deposition date 2009-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 3jqyA00
2IU9A 4M99A 5E3QA 5L6SA 3MC4A 4M2BA 1KK4A 3F1XA 4G3QA 2JF2A 3FSBA 4IHGA 5ADXU 1HM8A 1QREA 3IXCA 4M28A 3V4EA 2W0VA 3EEVA 2IUAA 1LXAA 3R3IA 2WLEA 4EA9A 5AFUU 1QRMA 3OTZA 1KK5A 4HZCA 1KRUA 2V0KA 1TDTA 4R7PA 1HM9A 4KPZA 2OI7A 4J09A 3FS8A 3MQHA 1YP3A 3GOSA 2XATA 3CJ8A 4E6UA 2QIAA 4M9CA 1QRFA 4E1KA 3BFPA 2GGOA 4AAWA 5F42A 3OUPA 2VHEA 3TIOA 3FTTA 1KRVA 4G3PA 3OU9A 3FOQA 4KNXA 4DCLA 3SPTA 2IC7A 4EGGA 4EAAA 4MFGA 2WLFA 3KWCA 2OEGA 4HUSA 3I3XA 3R5CA 3VBLA 1KK6A 1KRRA 1SSQA 2W0WA 1HM0A 2WLCA 3FSXA 2OI6A 4KPXA 3VBMA 3D8VA 3KWEA 3P47A 4R36A 4HCQA 1KHRA 3DHOA 4R37A 5ADXV 4N6BA 4MYOA 1QQ0A 2FKOA 3HSQA 1QRGA 3Q1XA 3VNPA 3TISA 2ICYA 1THJA 1V3WA 3OTMA 3VBJA 3R5DA 3TK8A 3BRKX 3TDTA 3TV0A 4IHHA 2OEFA 4KNRA 1XHDA 1MRLA 3R5BA 3IGJA 3R3RA 4EQYA 3FSCA 4M98A 4EABA 3FSYA 2I5KA 3KWDA 3NZ2A 3JQYA 4IHFA 1SSMA 1G97A 1FXJA 2GGQA 4N69A 5DEPA 3PMOA 2RIJA 2P2OA 3R2WA 1V67A 3GVDA 4N27A 5L6VA 3MQGA 4AA7A 1G95A 1YP4A 1Z90A 4HURA 4EA8A 1OCXA 2VD4A 3C8VA 2V0JA 3ECTA 1J2ZA 4FCEA 4ISXA 4G87A 3BSWA 3VBPA 4AC3A 2WLGA 2OI5A 3EH0A 3GUEA 3T57A 3D98A 4J18A 5U2KA 3R8YA 2V0IA 2AQ9A 3VBIA 1KGTA 5E3RA 4E79A 4N6AA 3ST8A 1MR9A 3P1BA 2Q4JA 3BSSA 2ICXA 3SRTA 4EA7A 1T3DA 5DEMA 3R1WA 3BSYA 2V0HA 3VBKA 3R5AA 2QKXA 1HV9A 4KQLA 1SSTA 2V0LA 5AFUV 3DJ4A 3DK5A 4K6RA 4MZUA 4E6TA 1QRLA 1S80A 3I3AA 4G3SA 1XATA 1YP2A 3FWWA 2WLDA 2QIVX 3HJJA 4H7OA 3EG4A 1KQAA 3OW5A 1FWYA 2JF3A 4HZDA 5E3PA 3VBNA 1MR7A 4E75A 3TWDA 3BXYA 1KGQA 3R0SA 4M2AA 2NPOA 2IU8A 5DG3A 2TDTA
chains in the Genus database with same CATH superfamily
2IU9A 4M99A 5E3QA 5L6SA 3MC4A 4M2BA 1KK4A 3F1XA 4G3QA 2JF2A 3FSBA 3GQ9A 4IHGA 5ADXU 1HM8A 1QREA 3IXCA 4M28A 3V4EA 2W0VA 3EEVA 2IUAA 1LXAA 3R3IA 2WLEA 4EA9A 5AFUU 1QRMA 3OTZA 1KK5A 4HZCA 1KRUA 3OGZA 2V0KA 1TDTA 4R7PA 1HM9A 4KPZA 2OI7A 4J09A 3FS8A 3OH1A 3MQHA 1YP3A 3SUCA 3GOSA 2XATA 3CJ8A 4E6UA 2QIAA 1M8NA 1QRFA 3GQAA 4M9CA 3OH2A 4E1KA 3BFPA 2GGOA 4AAWA 5F42A 3OUPA 2VHEA 3TIOA 3FTTA 1KRVA 4G3PA 3OU9A 3FOQA 4KNXA 4DCLA 3SPTA 2IC7A 4EGGA 4EAAA 4MFGA 2WLFA 3KWCA 2OEGA 4HUSA 3I3XA 3R5CA 3VBLA 1KK6A 1KRRA 1SSQA 2W0WA 1HM0A 2WLCA 3FSXA 2OI6A 4KPXA 3VBMA 3D8VA 3KWEA 3P47A 4R36A 4HCQA 1KHRA 3DHOA 4R37A 5ADXV 4N6BA 4MYOA 1QQ0A 2FKOA 1N4IA 3HSQA 1QRGA 3GQ7A 3OH4A 3Q1XA 3TISA 3VNPA 2ICYA 1THJA 1V3WA 3OTMA 3VBJA 3R5DA 3TK8A 3BRKX 3TDTA 3TV0A 4IHHA 2OEFA 4KNRA 1XHDA 1MRLA 3R5BA 3IGJA 3R3RA 4EQYA 1EWWA 3FSCA 4M98A 4EABA 3FSYA 2I5KA 3GQ8A 3KWDA 1Z2FA 3NZ2A 3JQYA 3OH3A 4IHFA 1SSMA 1G97A 1FXJA 2GGQA 4N69A 5DEPA 3PMOA 2RIJA 1L0SA 2P2OA 3R2WA 1V67A 3GVDA 4N27A 5L6VA 3MQGA 4AA7A 1G95A 1YP4A 1Z90A 4HURA 4EA8A 1OCXA 2VD4A 3C8VA 2V0JA 3ECTA 1J2ZA 4FCEA 4ISXA 4G87A 3BSWA 3VBPA 4AC3A 2WLGA 2OI5A 3EH0A 3GUEA 3T57A 3D98A 4J18A 5U2KA 3R8YA 2V0IA 2AQ9A 3VBIA 1KGTA 5E3RA 4E79A 3OH0A 4N6AA 3ST8A 1MR9A 3P1BA 2Q4JA 3BSSA 2ICXA 3SRTA 4EA7A 1T3DA 5DEMA 3R1WA 3BSYA 2V0HA 3VBKA 3R5AA 2QKXA 1HV9A 4KQLA 1SSTA 2V0LA 5AFUV 3DJ4A 3DK5A 4K6RA 4MZUA 4E6TA 1QRLA 1S80A 3I3AA 4G3SA 1XATA 1YP2A 3FWWA 2WLDA 2QIVX 3HJJA 4H7OA 3EG4A 1KQAA 3OW5A 1FWYA 2JF3A 4HZDA 5E3PA 3VBNA 1MR7A 4E75A 3TWDA 3BXYA 1KGQA 3R0SA 4M2AA 2NPOA 2IU8A 5DG3A 2TDTA
chains in the Genus database with same CATH topology
2IU9A 4M99A 5E3QA 5L6SA 3MC4A 4M2BA 1KK4A 3F1XA 4G3QA 2JF2A 3FSBA 4IHGA 5ADXU 1HM8A 1QREA 3IXCA 4M28A 3V4EA 2W0VA 3EEVA 2IUAA 1LXAA 3R3IA 2WLEA 4EA9A 5AFUU 1QRMA 3OTZA 1KK5A 4HZCA 1KRUA 2V0KA 1TDTA 4R7PA 1HM9A 4KPZA 2OI7A 4J09A 3FS8A 3MQHA 1YP3A 3GOSA 2XATA 3CJ8A 4E6UA 2QIAA 4M9CA 1QRFA 4E1KA 3BFPA 2GGOA 4AAWA 5F42A 3OUPA 2VHEA 3TIOA 3FTTA 1KRVA 4G3PA 3OU9A 3FOQA 4KNXA 4DCLA 3SPTA 2IC7A 4EGGA 4EAAA 4MFGA 2WLFA 3KWCA 2OEGA 4HUSA 3I3XA 3R5CA 3VBLA 1KK6A 1KRRA 1SSQA 2W0WA 1HM0A 2WLCA 3FSXA 2OI6A 4KPXA 3VBMA 3D8VA 3KWEA 3P47A 4R36A 4HCQA 1KHRA 3DHOA 4R37A 5ADXV 4N6BA 4MYOA 1QQ0A 2FKOA 3HSQA 1QRGA 3Q1XA 3VNPA 3TISA 2ICYA 1THJA 1V3WA 3OTMA 3VBJA 3R5DA 3TK8A 3BRKX 3TDTA 3TV0A 4IHHA 2OEFA 4KNRA 1XHDA 1MRLA 3R5BA 3IGJA 3R3RA 4EQYA 3FSCA 4M98A 4EABA 3FSYA 2I5KA 3KWDA 3NZ2A 3JQYA 4IHFA 1SSMA 1G97A 1FXJA 2GGQA 4N69A 5DEPA 3PMOA 2RIJA 2P2OA 3R2WA 1V67A 3GVDA 4N27A 5L6VA 3MQGA 4AA7A 1G95A 1YP4A 1Z90A 4HURA 4EA8A 1OCXA 2VD4A 3C8VA 2V0JA 3ECTA 1J2ZA 4FCEA 4ISXA 4G87A 3BSWA 3VBPA 4AC3A 2WLGA 2OI5A 3EH0A 3GUEA 3T57A 3D98A 4J18A 5U2KA 3R8YA 2V0IA 2AQ9A 3VBIA 1KGTA 5E3RA 4E79A 4N6AA 3ST8A 1MR9A 3P1BA 2Q4JA 3BSSA 2ICXA 3SRTA 4EA7A 1T3DA 5DEMA 3R1WA 3BSYA 2V0HA 3VBKA 3R5AA 2QKXA 1HV9A 4KQLA 1SSTA 2V0LA 5AFUV 3DJ4A 3DK5A 4K6RA 4MZUA 4E6TA 1QRLA 1S80A 3I3AA 4G3SA 1XATA 1YP2A 3FWWA 2WLDA 2QIVX 3HJJA 4H7OA 3EG4A 1KQAA 3OW5A 1FWYA 2JF3A 4HZDA 5E3PA 3VBNA 1MR7A 4E75A 3TWDA 3BXYA 1KGQA 3R0SA 4M2AA 2NPOA 2IU8A 5DG3A 2TDTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IU9 A;  4M99 A;  5E3Q A;  5L6S A;  3MC4 A;  4M2B A;  1KK4 A;  3F1X A;  4G3Q A;  2JF2 A;  3FSB A;  4IHG A;  5ADX U;  1HM8 A;  1QRE A;  3IXC A;  4M28 A;  3V4E A;  2W0V A;  3EEV A;  2IUA A;  1LXA A;  3R3I A;  2WLE A;  4EA9 A;  5AFU U;  1QRM A;  3OTZ A;  1KK5 A;  4HZC A;  1KRU A;  2V0K A;  1TDT A;  4R7P A;  1HM9 A;  4KPZ A;  2OI7 A;  4J09 A;  3FS8 A;  3MQH A;  1YP3 A;  3GOS A;  2XAT A;  3CJ8 A;  4E6U A;  2QIA A;  4M9C A;  1QRF A;  4E1K A;  3BFP A;  2GGO A;  4AAW A;  5F42 A;  3OUP A;  2VHE A;  3TIO A;  3FTT A;  1KRV A;  4G3P A;  3OU9 A;  3FOQ A;  4KNX A;  4DCL A;  3SPT A;  2IC7 A;  4EGG A;  4EAA A;  4MFG A;  2WLF A;  3KWC A;  2OEG A;  4HUS A;  3I3X A;  3R5C A;  3VBL A;  1KK6 A;  1KRR A;  1SSQ A;  2W0W A;  1HM0 A;  2WLC A;  3FSX A;  2OI6 A;  4KPX A;  3VBM A;  3D8V A;  3KWE A;  3P47 A;  4R36 A;  4HCQ A;  1KHR A;  3DHO A;  4R37 A;  5ADX V;  4N6B A;  4MYO A;  1QQ0 A;  2FKO A;  3HSQ A;  1QRG A;  3Q1X A;  3VNP A;  3TIS A;  2ICY A;  1THJ A;  1V3W A;  3OTM A;  3VBJ A;  3R5D A;  3TK8 A;  3BRK X;  3TDT A;  3TV0 A;  4IHH A;  2OEF A;  4KNR A;  1XHD A;  1MRL A;  3R5B A;  3IGJ A;  3R3R A;  4EQY A;  3FSC A;  4M98 A;  4EAB A;  3FSY A;  2I5K A;  3KWD A;  3NZ2 A;  3JQY A;  4IHF A;  1SSM A;  1G97 A;  1FXJ A;  2GGQ A;  4N69 A;  5DEP A;  3PMO A;  2RIJ A;  2P2O A;  3R2W A;  1V67 A;  3GVD A;  4N27 A;  5L6V A;  3MQG A;  4AA7 A;  1G95 A;  1YP4 A;  1Z90 A;  4HUR A;  4EA8 A;  1OCX A;  2VD4 A;  3C8V A;  2V0J A;  3ECT A;  1J2Z A;  4FCE A;  4ISX A;  4G87 A;  3BSW A;  3VBP A;  4AC3 A;  2WLG A;  2OI5 A;  3EH0 A;  3GUE A;  3T57 A;  3D98 A;  4J18 A;  5U2K A;  3R8Y A;  2V0I A;  2AQ9 A;  3VBI A;  1KGT A;  5E3R A;  4E79 A;  4N6A A;  3ST8 A;  1MR9 A;  3P1B A;  2Q4J A;  3BSS A;  2ICX A;  3SRT A;  4EA7 A;  1T3D A;  5DEM A;  3R1W A;  3BSY A;  2V0H A;  3VBK A;  3R5A A;  2QKX A;  1HV9 A;  4KQL A;  1SST A;  2V0L A;  5AFU V;  3DJ4 A;  3DK5 A;  4K6R A;  4MZU A;  4E6T A;  1QRL A;  1S80 A;  3I3A A;  4G3S A;  1XAT A;  1YP2 A;  3FWW A;  2WLD A;  2QIV X;  3HJJ A;  4H7O A;  3EG4 A;  1KQA A;  3OW5 A;  1FWY A;  2JF3 A;  4HZD A;  5E3P A;  3VBN A;  1MR7 A;  4E75 A;  3TWD A;  3BXY A;  1KGQ A;  3R0S A;  4M2A A;  2NPO A;  2IU8 A;  5DG3 A;  2TDT A; 
#chains in the Genus database with same CATH topology
 2IU9 A;  4M99 A;  5E3Q A;  5L6S A;  3MC4 A;  4M2B A;  1KK4 A;  3F1X A;  4G3Q A;  2JF2 A;  3FSB A;  3GQ9 A;  4IHG A;  5ADX U;  1HM8 A;  1QRE A;  3IXC A;  4M28 A;  3V4E A;  2W0V A;  3EEV A;  2IUA A;  1LXA A;  3R3I A;  2WLE A;  4EA9 A;  5AFU U;  1QRM A;  3OTZ A;  1KK5 A;  4HZC A;  1KRU A;  3OGZ A;  2V0K A;  1TDT A;  4R7P A;  1HM9 A;  4KPZ A;  2OI7 A;  4J09 A;  3FS8 A;  3OH1 A;  3MQH A;  1YP3 A;  3SUC A;  3GOS A;  2XAT A;  3CJ8 A;  4E6U A;  2QIA A;  1M8N A;  1QRF A;  3GQA A;  4M9C A;  3OH2 A;  4E1K A;  3BFP A;  2GGO A;  4AAW A;  5F42 A;  3OUP A;  2VHE A;  3TIO A;  3FTT A;  1KRV A;  4G3P A;  3OU9 A;  3FOQ A;  4KNX A;  4DCL A;  3SPT A;  2IC7 A;  4EGG A;  4EAA A;  4MFG A;  2WLF A;  3KWC A;  2OEG A;  4HUS A;  3I3X A;  3R5C A;  3VBL A;  1KK6 A;  1KRR A;  1SSQ A;  2W0W A;  1HM0 A;  2WLC A;  3FSX A;  2OI6 A;  4KPX A;  3VBM A;  3D8V A;  3KWE A;  3P47 A;  4R36 A;  4HCQ A;  1KHR A;  3DHO A;  4R37 A;  5ADX V;  4N6B A;  4MYO A;  1QQ0 A;  2FKO A;  1N4I A;  3HSQ A;  1QRG A;  3GQ7 A;  3OH4 A;  3Q1X A;  3TIS A;  3VNP A;  2ICY A;  1THJ A;  1V3W A;  3OTM A;  3VBJ A;  3R5D A;  3TK8 A;  3BRK X;  3TDT A;  3TV0 A;  4IHH A;  2OEF A;  4KNR A;  1XHD A;  1MRL A;  3R5B A;  3IGJ A;  3R3R A;  4EQY A;  1EWW A;  3FSC A;  4M98 A;  4EAB A;  3FSY A;  2I5K A;  3GQ8 A;  3KWD A;  1Z2F A;  3NZ2 A;  3JQY A;  3OH3 A;  4IHF A;  1SSM A;  1G97 A;  1FXJ A;  2GGQ A;  4N69 A;  5DEP A;  3PMO A;  2RIJ A;  1L0S A;  2P2O A;  3R2W A;  1V67 A;  3GVD A;  4N27 A;  5L6V A;  3MQG A;  4AA7 A;  1G95 A;  1YP4 A;  1Z90 A;  4HUR A;  4EA8 A;  1OCX A;  2VD4 A;  3C8V A;  2V0J A;  3ECT A;  1J2Z A;  4FCE A;  4ISX A;  4G87 A;  3BSW A;  3VBP A;  4AC3 A;  2WLG A;  2OI5 A;  3EH0 A;  3GUE A;  3T57 A;  3D98 A;  4J18 A;  5U2K A;  3R8Y A;  2V0I A;  2AQ9 A;  3VBI A;  1KGT A;  5E3R A;  4E79 A;  3OH0 A;  4N6A A;  3ST8 A;  1MR9 A;  3P1B A;  2Q4J A;  3BSS A;  2ICX A;  3SRT A;  4EA7 A;  1T3D A;  5DEM A;  3R1W A;  3BSY A;  2V0H A;  3VBK A;  3R5A A;  2QKX A;  1HV9 A;  4KQL A;  1SST A;  2V0L A;  5AFU V;  3DJ4 A;  3DK5 A;  4K6R A;  4MZU A;  4E6T A;  1QRL A;  1S80 A;  3I3A A;  4G3S A;  1XAT A;  1YP2 A;  3FWW A;  2WLD A;  2QIV X;  3HJJ A;  4H7O A;  3EG4 A;  1KQA A;  3OW5 A;  1FWY A;  2JF3 A;  4HZD A;  5E3P A;  3VBN A;  1MR7 A;  4E75 A;  3TWD A;  3BXY A;  1KGQ A;  3R0S A;  4M2A A;  2NPO A;  2IU8 A;  5DG3 A;  2TDT A; 
#chains in the Genus database with same CATH homology
 2IU9 A;  4M99 A;  5E3Q A;  5L6S A;  3MC4 A;  4M2B A;  1KK4 A;  3F1X A;  4G3Q A;  2JF2 A;  3FSB A;  4IHG A;  5ADX U;  1HM8 A;  1QRE A;  3IXC A;  4M28 A;  3V4E A;  2W0V A;  3EEV A;  2IUA A;  1LXA A;  3R3I A;  2WLE A;  4EA9 A;  5AFU U;  1QRM A;  3OTZ A;  1KK5 A;  4HZC A;  1KRU A;  2V0K A;  1TDT A;  4R7P A;  1HM9 A;  4KPZ A;  2OI7 A;  4J09 A;  3FS8 A;  3MQH A;  1YP3 A;  3GOS A;  2XAT A;  3CJ8 A;  4E6U A;  2QIA A;  4M9C A;  1QRF A;  4E1K A;  3BFP A;  2GGO A;  4AAW A;  5F42 A;  3OUP A;  2VHE A;  3TIO A;  3FTT A;  1KRV A;  4G3P A;  3OU9 A;  3FOQ A;  4KNX A;  4DCL A;  3SPT A;  2IC7 A;  4EGG A;  4EAA A;  4MFG A;  2WLF A;  3KWC A;  2OEG A;  4HUS A;  3I3X A;  3R5C A;  3VBL A;  1KK6 A;  1KRR A;  1SSQ A;  2W0W A;  1HM0 A;  2WLC A;  3FSX A;  2OI6 A;  4KPX A;  3VBM A;  3D8V A;  3KWE A;  3P47 A;  4R36 A;  4HCQ A;  1KHR A;  3DHO A;  4R37 A;  5ADX V;  4N6B A;  4MYO A;  1QQ0 A;  2FKO A;  3HSQ A;  1QRG A;  3Q1X A;  3VNP A;  3TIS A;  2ICY A;  1THJ A;  1V3W A;  3OTM A;  3VBJ A;  3R5D A;  3TK8 A;  3BRK X;  3TDT A;  3TV0 A;  4IHH A;  2OEF A;  4KNR A;  1XHD A;  1MRL A;  3R5B A;  3IGJ A;  3R3R A;  4EQY A;  3FSC A;  4M98 A;  4EAB A;  3FSY A;  2I5K A;  3KWD A;  3NZ2 A;  3JQY A;  4IHF A;  1SSM A;  1G97 A;  1FXJ A;  2GGQ A;  4N69 A;  5DEP A;  3PMO A;  2RIJ A;  2P2O A;  3R2W A;  1V67 A;  3GVD A;  4N27 A;  5L6V A;  3MQG A;  4AA7 A;  1G95 A;  1YP4 A;  1Z90 A;  4HUR A;  4EA8 A;  1OCX A;  2VD4 A;  3C8V A;  2V0J A;  3ECT A;  1J2Z A;  4FCE A;  4ISX A;  4G87 A;  3BSW A;  3VBP A;  4AC3 A;  2WLG A;  2OI5 A;  3EH0 A;  3GUE A;  3T57 A;  3D98 A;  4J18 A;  5U2K A;  3R8Y A;  2V0I A;  2AQ9 A;  3VBI A;  1KGT A;  5E3R A;  4E79 A;  4N6A A;  3ST8 A;  1MR9 A;  3P1B A;  2Q4J A;  3BSS A;  2ICX A;  3SRT A;  4EA7 A;  1T3D A;  5DEM A;  3R1W A;  3BSY A;  2V0H A;  3VBK A;  3R5A A;  2QKX A;  1HV9 A;  4KQL A;  1SST A;  2V0L A;  5AFU V;  3DJ4 A;  3DK5 A;  4K6R A;  4MZU A;  4E6T A;  1QRL A;  1S80 A;  3I3A A;  4G3S A;  1XAT A;  1YP2 A;  3FWW A;  2WLD A;  2QIV X;  3HJJ A;  4H7O A;  3EG4 A;  1KQA A;  3OW5 A;  1FWY A;  2JF3 A;  4HZD A;  5E3P A;  3VBN A;  1MR7 A;  4E75 A;  3TWD A;  3BXY A;  1KGQ A;  3R0S A;  4M2A A;  2NPO A;  2IU8 A;  5DG3 A;  2TDT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...