3JRUA

Crystal structure of leucyl aminopeptidase (pepa) from xoo0834,xanthomonas oryzae pv. oryzae kacc10331
Total Genus 172
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
172
sequence length
490
structure length
490
Chain Sequence
b'MALQFTLNQDAPASAAVDCIVVGAFADKTLSPAAQALDSASQGRLTALLARGDVAGKTGSTTLLHDLPGVAAPRVLVVGLGDAGKFGVAPYLKAIGDATRALKTGAVGTALLTLTELTVKARDAAWNIRQAVTVSDHAAYRYTATLGKKKVDETGLTTLAIAGDDARALAVGVATAEGVEFARELGNLPPNYCTPAYLADTAAAFAGKFPGAEAEILDEAQMEALGMGSLLSVARGSANRPRLIVLKWNGGGDARPYVLVGKGITFDTGGVNLKTQGGIEEMKYDMCGGATVIGTFVATVKAELPINLVVVVPAVENAIDGNAYRPSDVITSMSGKTIEVGNTDAEGRLILCDALTYAERFNPEALVDVATLTGACMVALGHQTAGLMSKHDDLANELLAAGEHVFDRAWRLPLWDEYQGLLDSTFADVYNIGGRWGGAITAGCFLSRFTENQRWAHLDIAGVASDEGKRGMATGRPVGLLTQWLLDRAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable cytosol aminopeptidase
publication title Crystal structure of Leucyl Aminopeptidase (pepA) from Xoo0834,Xanthomonas oryzae pv. oryzae KACC10331
rcsb
source organism Xanthomonas oryzae pv. oryzae
molecule tags Hydrolase
total genus 172
structure length 490
sequence length 490
chains with identical sequence B
ec nomenclature ec 3.4.11.1: Leucyl aminopeptidase.
pdb deposition date 2009-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00883 Peptidase_M17 Cytosol aminopeptidase family, catalytic domain
A PF02789 Peptidase_M17_N Cytosol aminopeptidase family, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 3jruA01
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3jruA02
4F9UA 2OR4A 3GPQA 4BD9A 3PFOA 4MCRA 4NGQA 4OC1A 2V8DA 1ZR5A 1DE4C 1ARLA 1LANA 2PJ3A 1XRYA 1M4LA 4ZX9A 1R3NA 1ZG8A 5K8OA 4ZI6A 3B3VA 2O4HA 3FJUA 4PXBA 4FBEA 4D86A 3RAMA 3V2BA 2ZEHA 4MMOA 4NGMA 2ZENA 1TY8A 4UF4A 5CPAA 2V8VA 1VHOA 2X47A 3IJ3A 4J5QA 2ABZA 3PBBA 3EWPA 2HC9A 4MRIA 3S9MA 3RBUA 4P4DA 5HXDA 1CP7A 5J1QA 1YW6A 2QVPA 4R7MA 2CIJA 2BFRA 3KQZA 2QJ8A 4ETJA 4A94A 7CPAA 1R43A 4NJRA 3WC7A 1F57A 4P44A 4FUUA 3EW5A 4J5RA 4TU0A 3B3CA 1YMEA 3IIBA 1Y0RA 5AILA 4OC5A 2FAVA 2EK8A 1FT7A 2ZEGA 5D29A 3EJGA 3KI9A 4TNUA 6CPAA 1XFOA 3CT9A 5ELYA 3FF3A 4ESSA 4P4EA 4OIWA 4X2TA 2DEAA 2EK9A 2PJ6A 1SPVA 1VIXA 3PB7X 4JCAA 4ABKA 1ARMA 3BI1A 2PCUA 3NA6A 3V38A 3L2NA 4P4FA 2BOAA 1CG2A 3D66A 4OKOA 2FG1A 5LRGA 3SIGA 3MN8A 4K3NA 1PYTB 1YSJA 4ZX8A 2ZOFA 4PQAA 2PJ7A 1XBUA 3VATA 4F9VA 2PJ0A 5JGFA 1JQGA 1RTQA 4ONWA 2AFXA 5CBMA 4P45A 5LRJA 3KZWA 3GQOA 5IB9A 3TX8A 4P4BA 3H8EA 4UEFA 2GREA 2PE3A 5LYIA 3GPOA 2O53A 3KL9A 1XMBA 2ZEOA 5FSYA 2V8HA 2JBKA 1QQ9A 3LWUA 4Z65A 2I3CA 3PRTA 4GM5A 3D67A 4UIAA 1HEEA 2EEEA 1LAMA 4ZY0A 3PB4X 5FSZA 4GVVA 4KYBA 3GQEA 4P4IA 4J5SA 1CBXA 3ISZA 4MCQA 1F2OA 2OOTA 4Q7AA 3SJFA 4X3RA 5LYFA 4MCSA 4ABLA 2PJAA 4JGKA 3GPGA 3FECA 3NH4A 3IC1A 3SI2A 2BCOA 5DS0A 2C6CA 3CPAA 3D7FA 5FSUA 4IHMA 2Q4ZA 3FVLA 1CPSA 2J9AA 3B2YA 2AFSA 1AYEA 3IFEA 2NYQA 3B3SA 5THWA 3FMCA 3PB6X 3D7GA 4YU9A 1NJRA 2XEIA 3WC6A 4EFDA 5K8NA 1H8LA 1OBRA 3PB9X 4EWTA 1Q7LA 5HVGA 4NGRA 3ETIA 4ZY2A 5CB5A 3JRUA 4B6ZA 2AFCA 3JZTA 4R76A 3EWOA 4J4ZA 2ACFA 1TF9A 4IK2A 5DUSA 3CPXA 3SJXA 4W9YA 2PJ8A 4TWEA 1UWYA 2PJCA 1VHUA 3IIFA 2ANPA 4YWYA 4GVWA 2CTCA 2C1CA 3KR4A 2L8RA 3NH8A 5FSXA 4CPAA 1ZG9A 2PJ2A 3D7DA 1VHEA 2PRQA 4X8IA 3SIJA 2FXKA 2EWBA 4OP4A 5I4MA 3EWRA 2CTBA 1IY7A 3T8WA 1ZG7A 3PB8X 3WABA 1PCAA 1IGBA 3RZAA 4P10A 3H8GA 3ISXA 4OC0A 4NGNA 3VH9A 3GB0A 2F8HA 3D68A 2PJBA 1BPMA 2XD7A 2BO9A 4UEZA 3SJGA 4UEEA 2RFHA 1KWMA 3IWWA 3K9TA 4ZYQA 3KR5A 4OC3A 4P6YA 2CF4A 3PBEA 4H2KA 3LMSA 1BAVA 4PXCA 3GUXA 4NGTA 3FH4A 4RUHA 2GLFA 2XEJA 3CDXA 4UIBA 2V77A 4MHPA 5LYDA 5FSVA 1LAPA 1TKFA 2WZNA 4PXEA 5K8MA 2DX6A 5D8NA 1FNOA 2AFMA 3BXMA 3DGVA 3N5FA 3HUVA 1YLOA 3KGQA 5LYLA 4EMEA 2V8GA 3QNVA 3GLJA 1HDUA 3PEIA 5CMSA 2ZOGA 2PVWA 2IQ6A 5CB3A 1ZR3A 1TF8A 2LGRA 1TXZA 3SIHA 3SIIA 5JH9A 2XEFA 1LFWA 3VFQA 5HVHA 1CPXA 2ZEFA 2VL1A 3DLJA 3H8FA 2AFWA 3K2KA 1NSAA 5HVFA 1TKJA 1Z5RA 5HIHA 4A37A 3EKEA 5HOLA 4NFRA 2AFOA 2GLJA 4JZ0A 2ZEMA 4DUKA 2XEGA 1XJOA 3IEHA 4G1PA 4MXUA 4NGPA 3B3TA 4KSIA 2PIYA 3PFEA 4WWVA 2ZEEA 3S9LA 2C6GA 2FVGA 3V7ZA 2PIZA 4PXDA 3HLPA 2PJ4A 1TXRA 2ZELA 1GYTA 3B3WA 1ELLP 5E3BA 3Q6ZA 3V45A 3B35A 3Q71A 2C6PA 2GU2A 3D7HA 1Z2LA 2PJ9A 2RB7A 3SI0A 4OC4A 5F09A 2PVVA 3SJEA 1BLLE 2AFZA 4P4JA 2WYRA 4DJLA 8CPAA 5K8PA 4NJQA 4MHNA 1QMUA 4IAVA 1DTDA 2G9DA 4R6TA 3NFZA 4LQGA 1BPNA 3NH5A 3BI0A 2POKA 2PJ1A 4OMEA 1HJZA 4OC2A 1CX8A 4FWUA 2F7VA 1CP6A 1YW4A 3VARA 2NSMA 3FEEA 2QYVA 3S9NA 4DYOA 3FEDA 4ZY1A 1AMPA 3BHXA 3EJFA 2JEWA 2JBJA 3KQXA 4JVVA 2VRIA 4A39A 2Q43A 3SI1A 1LCPA 2IMOA 4A38A 3KHZA 1F2PA 1VGYA 3IO1A 4WJBA 2ZEPA 1YD9A 4ETKA 1Y0YA 3IIDA 3KASA 1ZLIA 1TKHA 3WT4A 3I1UA 1ELMP 4MCPA 3WC5A 4K0CA 3KHXA 3TC8A 3D4UA 2BFQA 3FX6A 4O23A 5JM6A 4OIDA 1Z8LA 2PJ5A 4PPZA 4UMLA 2HB6A 4GUAA 4NGSA 3EWQA 1LOKA 4F8ZA 1HDQA 5LRKA 3B7IA 4JYWA 2Q51A 4MHYA 4IQYA 1EE3P 2AFUA 2ZEDA 4FAIA 4JLLA 1ZLHA 1Y7EA 2IJZA 4AXVA 4MHZA 4R8FA 3MRUA
chains in the Genus database with same CATH superfamily
1QSNA 3CXPA 2HUZA 5F46A 4F9UA 2OR4A 3GPQA 2EUIA 4FD7A 4BD9A 1L0CA 3PFOA 4MCRA 4NGQA 4OC1A 2DXQA 3R9GA 4CGOA 2V8DA 1ZR5A 1DE4C 1ARLA 1LANA 2PR8A 2BEIA 2PJ3A 1XRYA 2I00A 1M4LA 4ZX9A 5IB9A 4CAEA 2QIRA 4FD6A 1R3NA 2REEA 1ZG8A 1TIQA 4JXQA 5K8OA 4ZI6A 3E0KA 4HNXB 4PV6A 3B3VA 2O4HA 4KSFA 3FJUA 1NE9A 4PXBA 4D86A 4FBEA 3RAMA 4EVYA 3V2BA 2ZEHA 4HNYB 2Z3LA 4FD4A 5F48A 4MMOA 4NGMA 2EBJA 1TY8A 2ZENA 3CXQA 1WK4A 2V8VA 4LUAA 1VHOA 2Q7SA 4UF4A 5CPAA 3WR7A 4KSAA 4UWIA 1S7NA 4IF5A 2X47A 4J5QA 3IJ3A 2ABZA 2WSAA 3DSBA 3PBBA 4MFZA 3EWPA 4C7HA 1NSLA 2HC9A 4MRIA 2VZZA 2B3UA 3CXSA 3S9MA 1M1DA 3RBUA 2D4OA 3BJ8A 2Q44A 3QAYA 1CP7A 2PQ8A 4P4DA 5HXDA 5J1QA 1IU8A 1YW6A 3N7ZA 4C7IA 2QVPA 4R7MA 3VWEA 4JD6A 4UFXA 2P6FA 2CIJA 2BFRA 4KVXA 3KQZA 2QJ8A 4JXRA 3IWEA 3FNCA 3TOAA 3EC4A 1QSTA 1XMTA 3LD2A 5CNPA 3SXNA 2EVNA 4ETJA 1SQHA 4A94A 4XPKA 7CPAA 4NF1A 1R43A 4NJRA 1KUXA 4K30A 1F57A 3WC7A 2RNKA 2QMLA 2VXKA 4P44A 5KTDA 2JZFA 1WWZA 4FUUA 2Q0YA 3EW5A 4J5RA 3W91A 4TU0A 3B3CA 3QAHA 1P0HA 1YMEA 3IIBA 1S3ZA 3GIUA 1Y0RA 5AILA 3R95A 4OC5A 2FAVA 2EK8A 1S7LA 1FT7A 1QSOA 2FL4A 4R9MA 4QC6A 4JWPA 4CS0B 2ZEGA 3NE8A 2J8RA 1YGHA 5D29A 4CYPA 3EJGA 3KI9A 4TNUA 4A33A 4MBUA 4CGLA 4PSXA 2FXFA 3NE7A 1XFOA 2CNSA 2X7BA 4Q38A 5G21A 3CT9A 4NSQA 5ELYA 3TO6A 3R9EA 1YVOA 3FF3A 3GYAA 4ESSA 4P4EA 4OIWA 4X2TA 2G3TA 2DEAA 2EK9A 2PJ6A 1Q2YA 4KUBA 1SPVA 4MJ8A 4XPDB 3FIXA 1VIXA 4B5PB 3PB7X 4JCAA 1PU9A 4ABKA 4FD5A 1ARMA 2OB0A 2BUEA 1ZO0A 2PCUA 3BJ7A 3BI1A 3I9SA 3NA6A 3L2NA 3QB8A 3D3SA 4P4FA 3V38A 4CGPA 1YX0A 2PC1A 4H89A 4U5YA 1I12A 1S7KA 2ZW6A 4MFKA 1X12A 3DNSA 2BOAA 1CG2A 3D66A 4OKOA 2FG1A 3IU1A 4AVBA 5LRGA 2HV2A 3SIGA 3MN8A 3FRMA 4HPSA 4K3NA 1PYTB 4UBRA 1YSJA 4ZX8A 5EC4A 5GCNA 2ZOFA 3OWCA 2I79A 2ZW7A 4PQAA 2PJ7A 4ONUA 4B13A 5G20A 1XBUA 1KUYA 2VEZA 3VATA 2JZDA 4F9VA 2PJ0A 5JGFA 4ZGYB 3WABA 1JQGA 1RTQA 4KOXA 4M85A 4CAFA 4F0XA 4ONWA 2R1IA 2AFXA 2Q4YA 2OH1A 5CBMA 4P45A 4Q36A 3KZWA 3GQOA 2HQYA 4M6HA 5LRJA 3TTHA 4P4BA 3TX8A 3H8EA 1M4DA 4UEFA 5HMNA 2GIVA 3P2HA 3W6SA 4BINA 4JJXA 2GREA 2PE3A 3EFAA 4UA3A 5LYIA 3GPOA 1S5KA 2O53A 3IU2A 4IUSA 3KL9A 1UFHA 4QB9A 4B5PA 4CAWA 5JQ4A 1XMBA 2ZEOA 3G3SA 5AG5A 5FSYA 4M6GA 4L89A 4B14A 3JUWA 2V8HA 2WPXA 2JBKA 1QQ9A 2O28A 1MJAA 3LWUA 6CPAA 4Z65A 2I3CA 5H84A 1YR0A 4RS2A 2Z3NA 1LRZA 3PRTA 3B8GA 4GM5A 2Z3KA 1Z8TA 3D67A 3PP9A 4UIAA 1YK3A 1HEEA 4GS4A 2EEEA 3FYNA 1LAMA 4NXYA 4ZY0A 2QECA 2Q4VA 3PB4X 5FSZA 3S6HA 1YLEA 4F6AA 4GVVA 4KYBA 3BLNA 3GQEA 4P4IA 1IICA 4U9ZA 4KVME 4B12A 2ATRA 2YNCA 4J5SA 1M4IA 1CBXA 3ISZA 3K9UA 4MCQA 4A95A 1F2OA 2DPSA 1IYKA 2OOTA 4Q7AA 4HKFA 3DDDA 1Y7RA 3SJFA 3P2FA 4X3RA 5LYFA 4MCSA 5I0CA 5J8FA 4ABLA 2PJAA 4JGKA 3GPGA 2YNDA 2WCTA 3FECA 3NH4A 2OZHA 1AUGA 3R96A 3IC1A 3SI2A 2BCOA 4XNHC 5DS0A 2C6CA 1JWQA 3CPAA 3D7FA 3VWDA 5FSUA 4IHMA 3GY9A 2Q4ZA 2PSWA 2JDDA 2FSRA 2K5TA 4AG7A 4OLLA 3JTKA 4PK2A 1MK4A 4PK3A 2G3AA 3FVLA 4KZTA 1CPSA 1IOIA 2J9AA 4M6IA 3EO4A 3B2YA 4QVTA 1QSRA 4II9A 2AFSA 1AYEA 2VI7A 2KCWA 4KOUA 3IFEA 2NYQA 3B3SA 5THWA 3FMCA 3TOBA 3PB6X 3D7GA 1I21A 4YU9A 2B5GA 3MGDA 1NJRA 2XEIA 3WC6A 5DWNA 4B11A 4EFDA 5K8NA 1H8LA 3IWGA 4DNCA 4CYNA 2ODFA 1OBRA 3PB9X 4EWTA 2YNEA 1Q7LA 4KOTA 3R1KA 2BL1A 3R9FA 5HVGA 4NGRA 3ETIA 4ZY2A 1RO5A 5CB5A 4CRZB 3JRUA 4B6ZA 1Z4EA 2Z11A 2Q04A 2AJ6A 2VQYA 3FXTA 2GFQA 1YVKA 2AFCA 3S6FA 3JZTA 4R76A 3EWOA 2DPTA 5IB0A 4J4ZA 2ACFA 1TF9A 2R7HA 4IK2A 5DUSA 2PDOA 3CPXA 4UFWA 2KQVA 4W9YA 4Y49C 3SJXA 4X5KA 2PJ8A 4MFPA 4TWEA 1YREA 1UWYA 2PJCA 2Z3PA 4CRYB 1VHUA 1J4JA 3A9LA 3IIFA 2ANPA 2H5MA 1IOFA 4YWYA 5AG4A 2B58A 2FT0A 4GVWA 2CTCA 5FVJA 1Y9WA 2C1CA 3KR4A 2L8RA 3EXNA 3NH8A 5FSXA 2Z3OA 4CPAA 1ZG9A 1MJ9A 2Z3MA 2PJ2A 3H4QA 1IIDA 3D7DA 1VHEA 3S6GA 2F5IA 2PRQA 4X8IA 3SIJA 2FXKA 4YFJA 5J8CA 2Z0ZA 2EWBA 4OP4A 5I4MA 3EWRA 2OZGA 3D2MA 2CTBA 2GE3A 1IY7A 3T8WA 1ZG7A 1Q2DA 2DF5A 1PCAA 3PB8X 4ZBGA 1IGBA 3RZAA 2AE6A 3SHPA 2WPWA 2WUUA 4P10A 4XPLA 3H8GA 3ISXA 2ZW5A 4M3SA 3S6KA 4OC0A 2FCKA 4NGNA 5AGEA 3VH9A 3GB0A 2F8HA 3D68A 2PJBA 1Z8XA 4GXHA 1BPMA 1NMTA 2XD7A 2BO9A 4UEZA 3SJGA 4UEEA 5EBVA 2P6GA 1B87A 2D4PA 4H6ZA 4R3LA 2RFHA 1KWMA 3H5ZA 1PUAA 3IWWA 2Q7BA 3K9TA 4ZYQA 3KR5A 4OC3A 4MI4A 2ARHA 3RNZA 2PRBA 4P6YA 5BWAB 5AG7A 2CF4A 4CYOA 3LACA 3PBEA 4H2KA 1YQEA 3LMSA 1BAVA 4MFLA 2CXAA 4PXCA 3GUXA 4NGTA 4C2ZA 3TT2A 4CGNA 3FH4A 4RUHA 2GLFA 2XEJA 2J8MA 4PSWA 3CDXA 3LODA 4UIBA 2V77A 4MHPA 3IGRA 4KOWA 5FSVA 2B5GB 1Z4RA 3GKRA 5F47A 5LYDA 2Z10A 1CM0A 1LAPA 1TKFA 4H6UA 3ZZIA 4AVCA 4QBJA 2WZNA 3JVNA 1XEBA 4PXEA 2DX6A 5D8NA 1FNOA 2AFMA 3BXMA 3DGVA 4KORA 5K8MA 2B4BA 3N5FA 4L8AA 3HUVA 1YLOA 3KGQA 5LYLA 3T90A 3V8IA 4EMEA 2V8GA 3QNVA 3GLJA 1HDUA 3PEIA 5CMSA 4UCNA 2ZOGA 2PVWA 2IQ6A 4I49A 4MFJA 3ZJ0A 1VKCA 2JZEA 1OZPA 5CB3A 5DWMA 1Y9KA 4KOVA 3PZJA 4BBHA 1ZR3A 3CZXA 3PGPA 3KKWA 1TF8A 2LGRA 1U6MA 4KLWA 4B5OA 1TXZA 2R8VA 3SIHA 2IL4A 3SIIA 5G1ZA 5JH9A 4C2YA 2W2GA 2XEFA 1LFWA 2CNMA 4C68A 4UCMA 3VFQA 4AB7A 1I1DA 4J3GA 4MY0A 5HVHA 1CPXA 2EO8A 5JPHA 4CAVA 2ZEFA 4OAEA 3RYOA 2VL1A 4KOYA 4IAVA 3DLJA 3H8FA 2AFWA 3K2KA 4R57A 1KUVA 5A27A 2RC4A 1NSAA 3TO7A 2B4DB 5HVFA 1TKJA 1Z5RA 5HIHA 3T9YA 4A37A 1CJWA 1S7FA 2P0WA 5KTAA 3EKEA 1M4GA 5HOLA 2FIWA 4JLYA 4NFRA 2AFOA 2JDCA 4NEXA 2GLJA 4JZ0A 2ZEMA 4DUKA 5E96A 2XEGA 1XJOA 3IEHA 4G1PA 4KVOE 5AG6A 4MXUA 4NGPA 2ZW4A 4CGMA 2REFA 2CNTA 3B3TA 4R3KA 3C26A 5F49A 4KSIA 2PIYA 3PFEA 4WWVA 4C2XA 2ZEEA 3DR8A 2B3VA 1KZFA 4XNHB 5H86A 5HH1A 3S9LA 2C6GA 2FVGA 2P6EA 4UFVA 3V7ZA 1B6BA 4UWJA 2PIZA 4PXDA 3HLPA 3RO0A 2PJ4A 4R87A 2ZPAA 2GANA 1TXRA 1Z8WA 2ZELA 1GYTA 2PR1A 3G8WA 1IYLA 4XPDC 3B3WA 1ELLP 3I3GA 5E3BA 4RN7A 3Q6ZA 2VBQA 4CYQA 5A28A 2CY2A 3V45A 3B35A 4AVAA 3Q71A 2G0BA 1Z9UA 2C6PA 2GU2A 4QUSA 3D7HA 1X10A 4LQGA 3TCVA 1R57A 1Z2LA 2PJ9A 4MFQA 2Y0MA 4RI1A 4B10A 2RB7A 3FBUA 4YRHA 2B4DA 1M44A 4KLVA 3SI0A 4A2ZA 4AG9A 4OC4A 1V0CA 5F09A 2PVVA 2OZUA 1BLLE 2AFZA 4P4JA 2WYRA 3SJEA 3UY5A 4DJLA 8CPAA 5K8PA 4NJQA 4MHNA 1QMUA 2FS5A 1DTDA 2G9DA 4R6TA 3EY5A 3FB3A 1BPNA 3NFZA 3NH5A 4KS9A 2R98A 3BI0A 2POKA 2YGWA 2PJ1A 4OMEA 4U9YA 4E8OA 1FY7A 1N71A 4A31A 1HJZA 4OC2A 1CX8A 1GHEA 4FWUA 2F7VA 1CP6A 1MJBA 1YW4A 2JLMA 4NCZA 3F0AA 2YNCC 2NSMA 3VARA 4A32A 5IX3A 3FEEA 2OU2A 5EMIA 2QYVA 3S9NA 4DYOA 5C82A 3FEDA 2C27A 4ZY1A 1AMPA 3BHXA 3EJFA 3TO9A 2JEWA 2JBJA 4Y49B 3KQXA 4JVVA 2VRIA 4E2AA 4A39A 4CAXA 2Q43A 2BSWA 1S60A 5C88A 3SI1A 5KTCA 1K4JA 1BOBA 1LCPA 2FE7A 5IV0A 1P4NA 1RXTA 2IMOA 4LQ6A 3KHZA 3W6XA 4A38A 2NMTA 3SXOA 1F2PA 1VGYA 2A4NA 3IO1A 4WJBA 2ZEPA 3D8PA 1YD9A 3TFYA 5ISVA 4ETKA 1Y0YA 4YGOA 1XOVA 3IIDA 3KASA 1ZLIA 2ZXVA 1IB1E 1TKHA 4MHDA 3WT4A 3I1UA 1XE4A 4ORFA 5G22A 1ELMP 4HNWB 4MCPA 3WC5A 4F0YA 1QSMA 4KUAA 4OADA 4K0CA 2VZYA 3KHXA 3D4UA 2BFQA 3TC8A 2J8NA 3F8KA 3FX6A 4O23A 4MY3A 5JM6A 4OIDA 1Z8LA 2PJ5A 3D2PA 3F5BA 4PPZA 4UMLA 4KOSA 2HB6A 4LX9A 4GUAA 4NGSA 3EWQA 4A30A 1ON0A 1Q2CA 1BO4A 3TE4A 1LOKA 4E0AA 1HDQA 4F8ZA 5LRKA 2FIAA 3B7IA 4JYWA 2Q51A 4MHYA 4IQYA 1EE3P 2AFUA 1VHSA 3DR6A 4BMHA 2ZEDA 4FAIA 4UCPA 4JLLA 1ZLHA 1Y7EA 1XIXA 2IJZA 4AXVA 1XF8A 4MHZA 4R8FA 2JEVA 1A2ZA 3MRUA
chains in the Genus database with same CATH topology
4F9UA 2OR4A 3GPQA 4BD9A 3PFOA 4MCRA 4NGQA 4OC1A 2V8DA 1ZR5A 1DE4C 1ARLA 1LANA 2PJ3A 1XRYA 1M4LA 4ZX9A 1R3NA 1ZG8A 5K8OA 4ZI6A 3B3VA 2O4HA 3FJUA 4PXBA 4FBEA 4D86A 3RAMA 3V2BA 2ZEHA 4MMOA 4NGMA 2ZENA 1TY8A 4UF4A 5CPAA 2V8VA 1VHOA 2X47A 3IJ3A 4J5QA 2ABZA 3PBBA 3EWPA 2HC9A 4MRIA 3S9MA 3RBUA 4P4DA 5HXDA 1CP7A 5J1QA 1YW6A 2QVPA 4R7MA 2CIJA 2BFRA 3KQZA 2QJ8A 4ETJA 4A94A 7CPAA 1R43A 4NJRA 3WC7A 1F57A 4P44A 4FUUA 3EW5A 4J5RA 4TU0A 3B3CA 1YMEA 3IIBA 1Y0RA 5AILA 4OC5A 2FAVA 2EK8A 1FT7A 2ZEGA 5D29A 3EJGA 3KI9A 4TNUA 6CPAA 1XFOA 3CT9A 5ELYA 3FF3A 4ESSA 4P4EA 4OIWA 4X2TA 2DEAA 2EK9A 2PJ6A 1SPVA 1VIXA 3PB7X 4JCAA 4ABKA 1ARMA 3BI1A 2PCUA 3NA6A 3V38A 3L2NA 4P4FA 2BOAA 1CG2A 3D66A 4OKOA 2FG1A 5LRGA 3SIGA 3MN8A 4K3NA 1PYTB 1YSJA 4ZX8A 2ZOFA 4PQAA 2PJ7A 1XBUA 3VATA 4F9VA 2PJ0A 5JGFA 1JQGA 1RTQA 4ONWA 2AFXA 5CBMA 4P45A 5LRJA 3KZWA 3GQOA 5IB9A 3TX8A 4P4BA 3H8EA 4UEFA 2GREA 2PE3A 5LYIA 3GPOA 2O53A 3KL9A 1XMBA 2ZEOA 5FSYA 2V8HA 2JBKA 1QQ9A 3LWUA 4Z65A 2I3CA 3PRTA 4GM5A 3D67A 4UIAA 1HEEA 2EEEA 1LAMA 4ZY0A 3PB4X 5FSZA 4GVVA 4KYBA 3GQEA 4P4IA 4J5SA 1CBXA 3ISZA 4MCQA 1F2OA 2OOTA 4Q7AA 3SJFA 4X3RA 5LYFA 4MCSA 4ABLA 2PJAA 4JGKA 3GPGA 3FECA 3NH4A 3IC1A 3SI2A 2BCOA 5DS0A 2C6CA 3CPAA 3D7FA 5FSUA 4IHMA 2Q4ZA 3FVLA 1CPSA 2J9AA 3B2YA 2AFSA 1AYEA 3IFEA 2NYQA 3B3SA 5THWA 3FMCA 3PB6X 3D7GA 4YU9A 1NJRA 2XEIA 3WC6A 4EFDA 5K8NA 1H8LA 1OBRA 3PB9X 4EWTA 1Q7LA 5HVGA 4NGRA 3ETIA 4ZY2A 5CB5A 3JRUA 4B6ZA 2AFCA 3JZTA 4R76A 3EWOA 4J4ZA 2ACFA 1TF9A 4IK2A 5DUSA 3CPXA 3SJXA 4W9YA 2PJ8A 4TWEA 1UWYA 2PJCA 1VHUA 3IIFA 2ANPA 4YWYA 4GVWA 2CTCA 2C1CA 3KR4A 2L8RA 3NH8A 5FSXA 4CPAA 1ZG9A 2PJ2A 3D7DA 1VHEA 2PRQA 4X8IA 3SIJA 2FXKA 2EWBA 4OP4A 5I4MA 3EWRA 2CTBA 1IY7A 3T8WA 1ZG7A 3PB8X 3WABA 1PCAA 1IGBA 3RZAA 4P10A 3H8GA 3ISXA 4OC0A 4NGNA 3VH9A 3GB0A 2F8HA 3D68A 2PJBA 1BPMA 2XD7A 2BO9A 4UEZA 3SJGA 4UEEA 2RFHA 1KWMA 3IWWA 3K9TA 4ZYQA 3KR5A 4OC3A 4P6YA 2CF4A 3PBEA 4H2KA 3LMSA 1BAVA 4PXCA 3GUXA 4NGTA 3FH4A 4RUHA 2GLFA 2XEJA 3CDXA 4UIBA 2V77A 4MHPA 5LYDA 5FSVA 1LAPA 1TKFA 2WZNA 4PXEA 5K8MA 2DX6A 5D8NA 1FNOA 2AFMA 3BXMA 3DGVA 3N5FA 3HUVA 1YLOA 3KGQA 5LYLA 4EMEA 2V8GA 3QNVA 3GLJA 1HDUA 3PEIA 5CMSA 2ZOGA 2PVWA 2IQ6A 5CB3A 1ZR3A 1TF8A 2LGRA 1TXZA 3SIHA 3SIIA 5JH9A 2XEFA 1LFWA 3VFQA 5HVHA 1CPXA 2ZEFA 2VL1A 3DLJA 3H8FA 2AFWA 3K2KA 1NSAA 5HVFA 1TKJA 1Z5RA 5HIHA 4A37A 3EKEA 5HOLA 4NFRA 2AFOA 2GLJA 4JZ0A 2ZEMA 4DUKA 2XEGA 1XJOA 3IEHA 4G1PA 4MXUA 4NGPA 3B3TA 4KSIA 2PIYA 3PFEA 4WWVA 2ZEEA 3S9LA 2C6GA 2FVGA 3V7ZA 2PIZA 4PXDA 3HLPA 2PJ4A 1TXRA 2ZELA 1GYTA 3B3WA 1ELLP 5E3BA 3Q6ZA 3V45A 3B35A 3Q71A 2C6PA 2GU2A 3D7HA 1Z2LA 2PJ9A 2RB7A 3SI0A 4OC4A 5F09A 2PVVA 3SJEA 1BLLE 2AFZA 4P4JA 2WYRA 4DJLA 8CPAA 5K8PA 4NJQA 4MHNA 1QMUA 4IAVA 1DTDA 2G9DA 4R6TA 3NFZA 4LQGA 1BPNA 3NH5A 3BI0A 2POKA 2PJ1A 4OMEA 1HJZA 4OC2A 1CX8A 4FWUA 2F7VA 1CP6A 1YW4A 3VARA 2NSMA 3FEEA 2QYVA 3S9NA 4DYOA 3FEDA 4ZY1A 1AMPA 3BHXA 3EJFA 2JEWA 2JBJA 3KQXA 4JVVA 2VRIA 4A39A 2Q43A 3SI1A 1LCPA 2IMOA 4A38A 3KHZA 1F2PA 1VGYA 3IO1A 4WJBA 2ZEPA 1YD9A 4ETKA 1Y0YA 3IIDA 3KASA 1ZLIA 1TKHA 3WT4A 3I1UA 1ELMP 4MCPA 3WC5A 4K0CA 3KHXA 3TC8A 3D4UA 2BFQA 3FX6A 4O23A 5JM6A 4OIDA 1Z8LA 2PJ5A 4PPZA 4UMLA 2HB6A 4GUAA 4NGSA 3EWQA 1LOKA 4F8ZA 1HDQA 5LRKA 3B7IA 4JYWA 2Q51A 4MHYA 4IQYA 1EE3P 2AFUA 2ZEDA 4FAIA 4JLLA 1ZLHA 1Y7EA 2IJZA 4AXVA 4MHZA 4R8FA 3MRUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F9U A;  2OR4 A;  3GPQ A;  4BD9 A;  3PFO A;  4MCR A;  4NGQ A;  4OC1 A;  2V8D A;  1ZR5 A;  1DE4 C;  1ARL A;  1LAN A;  2PJ3 A;  1XRY A;  1M4L A;  4ZX9 A;  1R3N A;  1ZG8 A;  5K8O A;  4ZI6 A;  3B3V A;  2O4H A;  3FJU A;  4PXB A;  4FBE A;  4D86 A;  3RAM A;  3V2B A;  2ZEH A;  4MMO A;  4NGM A;  2ZEN A;  1TY8 A;  4UF4 A;  5CPA A;  2V8V A;  1VHO A;  2X47 A;  3IJ3 A;  4J5Q A;  2ABZ A;  3PBB A;  3EWP A;  2HC9 A;  4MRI A;  3S9M A;  3RBU A;  4P4D A;  5HXD A;  1CP7 A;  5J1Q A;  1YW6 A;  2QVP A;  4R7M A;  2CIJ A;  2BFR A;  3KQZ A;  2QJ8 A;  4ETJ A;  4A94 A;  7CPA A;  1R43 A;  4NJR A;  3WC7 A;  1F57 A;  4P44 A;  4FUU A;  3EW5 A;  4J5R A;  4TU0 A;  3B3C A;  1YME A;  3IIB A;  1Y0R A;  5AIL A;  4OC5 A;  2FAV A;  2EK8 A;  1FT7 A;  2ZEG A;  5D29 A;  3EJG A;  3KI9 A;  4TNU A;  6CPA A;  1XFO A;  3CT9 A;  5ELY A;  3FF3 A;  4ESS A;  4P4E A;  4OIW A;  4X2T A;  2DEA A;  2EK9 A;  2PJ6 A;  1SPV A;  1VIX A;  3PB7 X;  4JCA A;  4ABK A;  1ARM A;  3BI1 A;  2PCU A;  3NA6 A;  3V38 A;  3L2N A;  4P4F A;  2BOA A;  1CG2 A;  3D66 A;  4OKO A;  2FG1 A;  5LRG A;  3SIG A;  3MN8 A;  4K3N A;  1PYT B;  1YSJ A;  4ZX8 A;  2ZOF A;  4PQA A;  2PJ7 A;  1XBU A;  3VAT A;  4F9V A;  2PJ0 A;  5JGF A;  1JQG A;  1RTQ A;  4ONW A;  2AFX A;  5CBM A;  4P45 A;  5LRJ A;  3KZW A;  3GQO A;  5IB9 A;  3TX8 A;  4P4B A;  3H8E A;  4UEF A;  2GRE A;  2PE3 A;  5LYI A;  3GPO A;  2O53 A;  3KL9 A;  1XMB A;  2ZEO A;  5FSY A;  2V8H A;  2JBK A;  1QQ9 A;  3LWU A;  4Z65 A;  2I3C A;  3PRT A;  4GM5 A;  3D67 A;  4UIA A;  1HEE A;  2EEE A;  1LAM A;  4ZY0 A;  3PB4 X;  5FSZ A;  4GVV A;  4KYB A;  3GQE A;  4P4I A;  4J5S A;  1CBX A;  3ISZ A;  4MCQ A;  1F2O A;  2OOT A;  4Q7A A;  3SJF A;  4X3R A;  5LYF A;  4MCS A;  4ABL A;  2PJA A;  4JGK A;  3GPG A;  3FEC A;  3NH4 A;  3IC1 A;  3SI2 A;  2BCO A;  5DS0 A;  2C6C A;  3CPA A;  3D7F A;  5FSU A;  4IHM A;  2Q4Z A;  3FVL A;  1CPS A;  2J9A A;  3B2Y A;  2AFS A;  1AYE A;  3IFE A;  2NYQ A;  3B3S A;  5THW A;  3FMC A;  3PB6 X;  3D7G A;  4YU9 A;  1NJR A;  2XEI A;  3WC6 A;  4EFD A;  5K8N A;  1H8L A;  1OBR A;  3PB9 X;  4EWT A;  1Q7L A;  5HVG A;  4NGR A;  3ETI A;  4ZY2 A;  5CB5 A;  3JRU A;  4B6Z A;  2AFC A;  3JZT A;  4R76 A;  3EWO A;  4J4Z A;  2ACF A;  1TF9 A;  4IK2 A;  5DUS A;  3CPX A;  3SJX A;  4W9Y A;  2PJ8 A;  4TWE A;  1UWY A;  2PJC A;  1VHU A;  3IIF A;  2ANP A;  4YWY A;  4GVW A;  2CTC A;  2C1C A;  3KR4 A;  2L8R A;  3NH8 A;  5FSX A;  4CPA A;  1ZG9 A;  2PJ2 A;  3D7D A;  1VHE A;  2PRQ A;  4X8I A;  3SIJ A;  2FXK A;  2EWB A;  4OP4 A;  5I4M A;  3EWR A;  2CTB A;  1IY7 A;  3T8W A;  1ZG7 A;  3PB8 X;  3WAB A;  1PCA A;  1IGB A;  3RZA A;  4P10 A;  3H8G A;  3ISX A;  4OC0 A;  4NGN A;  3VH9 A;  3GB0 A;  2F8H A;  3D68 A;  2PJB A;  1BPM A;  2XD7 A;  2BO9 A;  4UEZ A;  3SJG A;  4UEE A;  2RFH A;  1KWM A;  3IWW A;  3K9T A;  4ZYQ A;  3KR5 A;  4OC3 A;  4P6Y A;  2CF4 A;  3PBE A;  4H2K A;  3LMS A;  1BAV A;  4PXC A;  3GUX A;  4NGT A;  3FH4 A;  4RUH A;  2GLF A;  2XEJ A;  3CDX A;  4UIB A;  2V77 A;  4MHP A;  5LYD A;  5FSV A;  1LAP A;  1TKF A;  2WZN A;  4PXE A;  5K8M A;  2DX6 A;  5D8N A;  1FNO A;  2AFM A;  3BXM A;  3DGV A;  3N5F A;  3HUV A;  1YLO A;  3KGQ A;  5LYL A;  4EME A;  2V8G A;  3QNV A;  3GLJ A;  1HDU A;  3PEI A;  5CMS A;  2ZOG A;  2PVW A;  2IQ6 A;  5CB3 A;  1ZR3 A;  1TF8 A;  2LGR A;  1TXZ A;  3SIH A;  3SII A;  5JH9 A;  2XEF A;  1LFW A;  3VFQ A;  5HVH A;  1CPX A;  2ZEF A;  2VL1 A;  3DLJ A;  3H8F A;  2AFW A;  3K2K A;  1NSA A;  5HVF A;  1TKJ A;  1Z5R A;  5HIH A;  4A37 A;  3EKE A;  5HOL A;  4NFR A;  2AFO A;  2GLJ A;  4JZ0 A;  2ZEM A;  4DUK A;  2XEG A;  1XJO A;  3IEH A;  4G1P A;  4MXU A;  4NGP A;  3B3T A;  4KSI A;  2PIY A;  3PFE A;  4WWV A;  2ZEE A;  3S9L A;  2C6G A;  2FVG A;  3V7Z A;  2PIZ A;  4PXD A;  3HLP A;  2PJ4 A;  1TXR A;  2ZEL A;  1GYT A;  3B3W A;  1ELL P;  5E3B A;  3Q6Z A;  3V45 A;  3B35 A;  3Q71 A;  2C6P A;  2GU2 A;  3D7H A;  1Z2L A;  2PJ9 A;  2RB7 A;  3SI0 A;  4OC4 A;  5F09 A;  2PVV A;  3SJE A;  1BLL E;  2AFZ A;  4P4J A;  2WYR A;  4DJL A;  8CPA A;  5K8P A;  4NJQ A;  4MHN A;  1QMU A;  4IAV A;  1DTD A;  2G9D A;  4R6T A;  3NFZ A;  4LQG A;  1BPN A;  3NH5 A;  3BI0 A;  2POK A;  2PJ1 A;  4OME A;  1HJZ A;  4OC2 A;  1CX8 A;  4FWU A;  2F7V A;  1CP6 A;  1YW4 A;  3VAR A;  2NSM A;  3FEE A;  2QYV A;  3S9N A;  4DYO A;  3FED A;  4ZY1 A;  1AMP A;  3BHX A;  3EJF A;  2JEW A;  2JBJ A;  3KQX A;  4JVV A;  2VRI A;  4A39 A;  2Q43 A;  3SI1 A;  1LCP A;  2IMO A;  4A38 A;  3KHZ A;  1F2P A;  1VGY A;  3IO1 A;  4WJB A;  2ZEP A;  1YD9 A;  4ETK A;  1Y0Y A;  3IID A;  3KAS A;  1ZLI A;  1TKH A;  3WT4 A;  3I1U A;  1ELM P;  4MCP A;  3WC5 A;  4K0C A;  3KHX A;  3TC8 A;  3D4U A;  2BFQ A;  3FX6 A;  4O23 A;  5JM6 A;  4OID A;  1Z8L A;  2PJ5 A;  4PPZ A;  4UML A;  2HB6 A;  4GUA A;  4NGS A;  3EWQ A;  1LOK A;  4F8Z A;  1HDQ A;  5LRK A;  3B7I A;  4JYW A;  2Q51 A;  4MHY A;  4IQY A;  1EE3 P;  2AFU A;  2ZED A;  4FAI A;  4JLL A;  1ZLH A;  1Y7E A;  2IJZ A;  4AXV A;  4MHZ A;  4R8F A;  3MRU A; 
#chains in the Genus database with same CATH topology
 1QSN A;  3CXP A;  2HUZ A;  5F46 A;  4F9U A;  2OR4 A;  3GPQ A;  2EUI A;  4FD7 A;  4BD9 A;  1L0C A;  3PFO A;  4MCR A;  4NGQ A;  4OC1 A;  2DXQ A;  3R9G A;  4CGO A;  2V8D A;  1ZR5 A;  1DE4 C;  1ARL A;  1LAN A;  2PR8 A;  2BEI A;  2PJ3 A;  1XRY A;  2I00 A;  1M4L A;  4ZX9 A;  5IB9 A;  4CAE A;  2QIR A;  4FD6 A;  1R3N A;  2REE A;  1ZG8 A;  1TIQ A;  4JXQ A;  5K8O A;  4ZI6 A;  3E0K A;  4HNX B;  4PV6 A;  3B3V A;  2O4H A;  4KSF A;  3FJU A;  1NE9 A;  4PXB A;  4D86 A;  4FBE A;  3RAM A;  4EVY A;  3V2B A;  2ZEH A;  4HNY B;  2Z3L A;  4FD4 A;  5F48 A;  4MMO A;  4NGM A;  2EBJ A;  1TY8 A;  2ZEN A;  3CXQ A;  1WK4 A;  2V8V A;  4LUA A;  1VHO A;  2Q7S A;  4UF4 A;  5CPA A;  3WR7 A;  4KSA A;  4UWI A;  1S7N A;  4IF5 A;  2X47 A;  4J5Q A;  3IJ3 A;  2ABZ A;  2WSA A;  3DSB A;  3PBB A;  4MFZ A;  3EWP A;  4C7H A;  1NSL A;  2HC9 A;  4MRI A;  2VZZ A;  2B3U A;  3CXS A;  3S9M A;  1M1D A;  3RBU A;  2D4O A;  3BJ8 A;  2Q44 A;  3QAY A;  1CP7 A;  2PQ8 A;  4P4D A;  5HXD A;  5J1Q A;  1IU8 A;  1YW6 A;  3N7Z A;  4C7I A;  2QVP A;  4R7M A;  3VWE A;  4JD6 A;  4UFX A;  2P6F A;  2CIJ A;  2BFR A;  4KVX A;  3KQZ A;  2QJ8 A;  4JXR A;  3IWE A;  3FNC A;  3TOA A;  3EC4 A;  1QST A;  1XMT A;  3LD2 A;  5CNP A;  3SXN A;  2EVN A;  4ETJ A;  1SQH A;  4A94 A;  4XPK A;  7CPA A;  4NF1 A;  1R43 A;  4NJR A;  1KUX A;  4K30 A;  1F57 A;  3WC7 A;  2RNK A;  2QML A;  2VXK A;  4P44 A;  5KTD A;  2JZF A;  1WWZ A;  4FUU A;  2Q0Y A;  3EW5 A;  4J5R A;  3W91 A;  4TU0 A;  3B3C A;  3QAH A;  1P0H A;  1YME A;  3IIB A;  1S3Z A;  3GIU A;  1Y0R A;  5AIL A;  3R95 A;  4OC5 A;  2FAV A;  2EK8 A;  1S7L A;  1FT7 A;  1QSO A;  2FL4 A;  4R9M A;  4QC6 A;  4JWP A;  4CS0 B;  2ZEG A;  3NE8 A;  2J8R A;  1YGH A;  5D29 A;  4CYP A;  3EJG A;  3KI9 A;  4TNU A;  4A33 A;  4MBU A;  4CGL A;  4PSX A;  2FXF A;  3NE7 A;  1XFO A;  2CNS A;  2X7B A;  4Q38 A;  5G21 A;  3CT9 A;  4NSQ A;  5ELY A;  3TO6 A;  3R9E A;  1YVO A;  3FF3 A;  3GYA A;  4ESS A;  4P4E A;  4OIW A;  4X2T A;  2G3T A;  2DEA A;  2EK9 A;  2PJ6 A;  1Q2Y A;  4KUB A;  1SPV A;  4MJ8 A;  4XPD B;  3FIX A;  1VIX A;  4B5P B;  3PB7 X;  4JCA A;  1PU9 A;  4ABK A;  4FD5 A;  1ARM A;  2OB0 A;  2BUE A;  1ZO0 A;  2PCU A;  3BJ7 A;  3BI1 A;  3I9S A;  3NA6 A;  3L2N A;  3QB8 A;  3D3S A;  4P4F A;  3V38 A;  4CGP A;  1YX0 A;  2PC1 A;  4H89 A;  4U5Y A;  1I12 A;  1S7K A;  2ZW6 A;  4MFK A;  1X12 A;  3DNS A;  2BOA A;  1CG2 A;  3D66 A;  4OKO A;  2FG1 A;  3IU1 A;  4AVB A;  5LRG A;  2HV2 A;  3SIG A;  3MN8 A;  3FRM A;  4HPS A;  4K3N A;  1PYT B;  4UBR A;  1YSJ A;  4ZX8 A;  5EC4 A;  5GCN A;  2ZOF A;  3OWC A;  2I79 A;  2ZW7 A;  4PQA A;  2PJ7 A;  4ONU A;  4B13 A;  5G20 A;  1XBU A;  1KUY A;  2VEZ A;  3VAT A;  2JZD A;  4F9V A;  2PJ0 A;  5JGF A;  4ZGY B;  3WAB A;  1JQG A;  1RTQ A;  4KOX A;  4M85 A;  4CAF A;  4F0X A;  4ONW A;  2R1I A;  2AFX A;  2Q4Y A;  2OH1 A;  5CBM A;  4P45 A;  4Q36 A;  3KZW A;  3GQO A;  2HQY A;  4M6H A;  5LRJ A;  3TTH A;  4P4B A;  3TX8 A;  3H8E A;  1M4D A;  4UEF A;  5HMN A;  2GIV A;  3P2H A;  3W6S A;  4BIN A;  4JJX A;  2GRE A;  2PE3 A;  3EFA A;  4UA3 A;  5LYI A;  3GPO A;  1S5K A;  2O53 A;  3IU2 A;  4IUS A;  3KL9 A;  1UFH A;  4QB9 A;  4B5P A;  4CAW A;  5JQ4 A;  1XMB A;  2ZEO A;  3G3S A;  5AG5 A;  5FSY A;  4M6G A;  4L89 A;  4B14 A;  3JUW A;  2V8H A;  2WPX A;  2JBK A;  1QQ9 A;  2O28 A;  1MJA A;  3LWU A;  6CPA A;  4Z65 A;  2I3C A;  5H84 A;  1YR0 A;  4RS2 A;  2Z3N A;  1LRZ A;  3PRT A;  3B8G A;  4GM5 A;  2Z3K A;  1Z8T A;  3D67 A;  3PP9 A;  4UIA A;  1YK3 A;  1HEE A;  4GS4 A;  2EEE A;  3FYN A;  1LAM A;  4NXY A;  4ZY0 A;  2QEC A;  2Q4V A;  3PB4 X;  5FSZ A;  3S6H A;  1YLE A;  4F6A A;  4GVV A;  4KYB A;  3BLN A;  3GQE A;  4P4I A;  1IIC A;  4U9Z A;  4KVM E;  4B12 A;  2ATR A;  2YNC A;  4J5S A;  1M4I A;  1CBX A;  3ISZ A;  3K9U A;  4MCQ A;  4A95 A;  1F2O A;  2DPS A;  1IYK A;  2OOT A;  4Q7A A;  4HKF A;  3DDD A;  1Y7R A;  3SJF A;  3P2F A;  4X3R A;  5LYF A;  4MCS A;  5I0C A;  5J8F A;  4ABL A;  2PJA A;  4JGK A;  3GPG A;  2YND A;  2WCT A;  3FEC A;  3NH4 A;  2OZH A;  1AUG A;  3R96 A;  3IC1 A;  3SI2 A;  2BCO A;  4XNH C;  5DS0 A;  2C6C A;  1JWQ A;  3CPA A;  3D7F A;  3VWD A;  5FSU A;  4IHM A;  3GY9 A;  2Q4Z A;  2PSW A;  2JDD A;  2FSR A;  2K5T A;  4AG7 A;  4OLL A;  3JTK A;  4PK2 A;  1MK4 A;  4PK3 A;  2G3A A;  3FVL A;  4KZT A;  1CPS A;  1IOI A;  2J9A A;  4M6I A;  3EO4 A;  3B2Y A;  4QVT A;  1QSR A;  4II9 A;  2AFS A;  1AYE A;  2VI7 A;  2KCW A;  4KOU A;  3IFE A;  2NYQ A;  3B3S A;  5THW A;  3FMC A;  3TOB A;  3PB6 X;  3D7G A;  1I21 A;  4YU9 A;  2B5G A;  3MGD A;  1NJR A;  2XEI A;  3WC6 A;  5DWN A;  4B11 A;  4EFD A;  5K8N A;  1H8L A;  3IWG A;  4DNC A;  4CYN A;  2ODF A;  1OBR A;  3PB9 X;  4EWT A;  2YNE A;  1Q7L A;  4KOT A;  3R1K A;  2BL1 A;  3R9F A;  5HVG A;  4NGR A;  3ETI A;  4ZY2 A;  1RO5 A;  5CB5 A;  4CRZ B;  3JRU A;  4B6Z A;  1Z4E A;  2Z11 A;  2Q04 A;  2AJ6 A;  2VQY A;  3FXT A;  2GFQ A;  1YVK A;  2AFC A;  3S6F A;  3JZT A;  4R76 A;  3EWO A;  2DPT A;  5IB0 A;  4J4Z A;  2ACF A;  1TF9 A;  2R7H A;  4IK2 A;  5DUS A;  2PDO A;  3CPX A;  4UFW A;  2KQV A;  4W9Y A;  4Y49 C;  3SJX A;  4X5K A;  2PJ8 A;  4MFP A;  4TWE A;  1YRE A;  1UWY A;  2PJC A;  2Z3P A;  4CRY B;  1VHU A;  1J4J A;  3A9L A;  3IIF A;  2ANP A;  2H5M A;  1IOF A;  4YWY A;  5AG4 A;  2B58 A;  2FT0 A;  4GVW A;  2CTC A;  5FVJ A;  1Y9W A;  2C1C A;  3KR4 A;  2L8R A;  3EXN A;  3NH8 A;  5FSX A;  2Z3O A;  4CPA A;  1ZG9 A;  1MJ9 A;  2Z3M A;  2PJ2 A;  3H4Q A;  1IID A;  3D7D A;  1VHE A;  3S6G A;  2F5I A;  2PRQ A;  4X8I A;  3SIJ A;  2FXK A;  4YFJ A;  5J8C A;  2Z0Z A;  2EWB A;  4OP4 A;  5I4M A;  3EWR A;  2OZG A;  3D2M A;  2CTB A;  2GE3 A;  1IY7 A;  3T8W A;  1ZG7 A;  1Q2D A;  2DF5 A;  1PCA A;  3PB8 X;  4ZBG A;  1IGB A;  3RZA A;  2AE6 A;  3SHP A;  2WPW A;  2WUU A;  4P10 A;  4XPL A;  3H8G A;  3ISX A;  2ZW5 A;  4M3S A;  3S6K A;  4OC0 A;  2FCK A;  4NGN A;  5AGE A;  3VH9 A;  3GB0 A;  2F8H A;  3D68 A;  2PJB A;  1Z8X A;  4GXH A;  1BPM A;  1NMT A;  2XD7 A;  2BO9 A;  4UEZ A;  3SJG A;  4UEE A;  5EBV A;  2P6G A;  1B87 A;  2D4P A;  4H6Z A;  4R3L A;  2RFH A;  1KWM A;  3H5Z A;  1PUA A;  3IWW A;  2Q7B A;  3K9T A;  4ZYQ A;  3KR5 A;  4OC3 A;  4MI4 A;  2ARH A;  3RNZ A;  2PRB A;  4P6Y A;  5BWA B;  5AG7 A;  2CF4 A;  4CYO A;  3LAC A;  3PBE A;  4H2K A;  1YQE A;  3LMS A;  1BAV A;  4MFL A;  2CXA A;  4PXC A;  3GUX A;  4NGT A;  4C2Z A;  3TT2 A;  4CGN A;  3FH4 A;  4RUH A;  2GLF A;  2XEJ A;  2J8M A;  4PSW A;  3CDX A;  3LOD A;  4UIB A;  2V77 A;  4MHP A;  3IGR A;  4KOW A;  5FSV A;  2B5G B;  1Z4R A;  3GKR A;  5F47 A;  5LYD A;  2Z10 A;  1CM0 A;  1LAP A;  1TKF A;  4H6U A;  3ZZI A;  4AVC A;  4QBJ A;  2WZN A;  3JVN A;  1XEB A;  4PXE A;  2DX6 A;  5D8N A;  1FNO A;  2AFM A;  3BXM A;  3DGV A;  4KOR A;  5K8M A;  2B4B A;  3N5F A;  4L8A A;  3HUV A;  1YLO A;  3KGQ A;  5LYL A;  3T90 A;  3V8I A;  4EME A;  2V8G A;  3QNV A;  3GLJ A;  1HDU A;  3PEI A;  5CMS A;  4UCN A;  2ZOG A;  2PVW A;  2IQ6 A;  4I49 A;  4MFJ A;  3ZJ0 A;  1VKC A;  2JZE A;  1OZP A;  5CB3 A;  5DWM A;  1Y9K A;  4KOV A;  3PZJ A;  4BBH A;  1ZR3 A;  3CZX A;  3PGP A;  3KKW A;  1TF8 A;  2LGR A;  1U6M A;  4KLW A;  4B5O A;  1TXZ A;  2R8V A;  3SIH A;  2IL4 A;  3SII A;  5G1Z A;  5JH9 A;  4C2Y A;  2W2G A;  2XEF A;  1LFW A;  2CNM A;  4C68 A;  4UCM A;  3VFQ A;  4AB7 A;  1I1D A;  4J3G A;  4MY0 A;  5HVH A;  1CPX A;  2EO8 A;  5JPH A;  4CAV A;  2ZEF A;  4OAE A;  3RYO A;  2VL1 A;  4KOY A;  4IAV A;  3DLJ A;  3H8F A;  2AFW A;  3K2K A;  4R57 A;  1KUV A;  5A27 A;  2RC4 A;  1NSA A;  3TO7 A;  2B4D B;  5HVF A;  1TKJ A;  1Z5R A;  5HIH A;  3T9Y A;  4A37 A;  1CJW A;  1S7F A;  2P0W A;  5KTA A;  3EKE A;  1M4G A;  5HOL A;  2FIW A;  4JLY A;  4NFR A;  2AFO A;  2JDC A;  4NEX A;  2GLJ A;  4JZ0 A;  2ZEM A;  4DUK A;  5E96 A;  2XEG A;  1XJO A;  3IEH A;  4G1P A;  4KVO E;  5AG6 A;  4MXU A;  4NGP A;  2ZW4 A;  4CGM A;  2REF A;  2CNT A;  3B3T A;  4R3K A;  3C26 A;  5F49 A;  4KSI A;  2PIY A;  3PFE A;  4WWV A;  4C2X A;  2ZEE A;  3DR8 A;  2B3V A;  1KZF A;  4XNH B;  5H86 A;  5HH1 A;  3S9L A;  2C6G A;  2FVG A;  2P6E A;  4UFV A;  3V7Z A;  1B6B A;  4UWJ A;  2PIZ A;  4PXD A;  3HLP A;  3RO0 A;  2PJ4 A;  4R87 A;  2ZPA A;  2GAN A;  1TXR A;  1Z8W A;  2ZEL A;  1GYT A;  2PR1 A;  3G8W A;  1IYL A;  4XPD C;  3B3W A;  1ELL P;  3I3G A;  5E3B A;  4RN7 A;  3Q6Z A;  2VBQ A;  4CYQ A;  5A28 A;  2CY2 A;  3V45 A;  3B35 A;  4AVA A;  3Q71 A;  2G0B A;  1Z9U A;  2C6P A;  2GU2 A;  4QUS A;  3D7H A;  1X10 A;  4LQG A;  3TCV A;  1R57 A;  1Z2L A;  2PJ9 A;  4MFQ A;  2Y0M A;  4RI1 A;  4B10 A;  2RB7 A;  3FBU A;  4YRH A;  2B4D A;  1M44 A;  4KLV A;  3SI0 A;  4A2Z A;  4AG9 A;  4OC4 A;  1V0C A;  5F09 A;  2PVV A;  2OZU A;  1BLL E;  2AFZ A;  4P4J A;  2WYR A;  3SJE A;  3UY5 A;  4DJL A;  8CPA A;  5K8P A;  4NJQ A;  4MHN A;  1QMU A;  2FS5 A;  1DTD A;  2G9D A;  4R6T A;  3EY5 A;  3FB3 A;  1BPN A;  3NFZ A;  3NH5 A;  4KS9 A;  2R98 A;  3BI0 A;  2POK A;  2YGW A;  2PJ1 A;  4OME A;  4U9Y A;  4E8O A;  1FY7 A;  1N71 A;  4A31 A;  1HJZ A;  4OC2 A;  1CX8 A;  1GHE A;  4FWU A;  2F7V A;  1CP6 A;  1MJB A;  1YW4 A;  2JLM A;  4NCZ A;  3F0A A;  2YNC C;  2NSM A;  3VAR A;  4A32 A;  5IX3 A;  3FEE A;  2OU2 A;  5EMI A;  2QYV A;  3S9N A;  4DYO A;  5C82 A;  3FED A;  2C27 A;  4ZY1 A;  1AMP A;  3BHX A;  3EJF A;  3TO9 A;  2JEW A;  2JBJ A;  4Y49 B;  3KQX A;  4JVV A;  2VRI A;  4E2A A;  4A39 A;  4CAX A;  2Q43 A;  2BSW A;  1S60 A;  5C88 A;  3SI1 A;  5KTC A;  1K4J A;  1BOB A;  1LCP A;  2FE7 A;  5IV0 A;  1P4N A;  1RXT A;  2IMO A;  4LQ6 A;  3KHZ A;  3W6X A;  4A38 A;  2NMT A;  3SXO A;  1F2P A;  1VGY A;  2A4N A;  3IO1 A;  4WJB A;  2ZEP A;  3D8P A;  1YD9 A;  3TFY A;  5ISV A;  4ETK A;  1Y0Y A;  4YGO A;  1XOV A;  3IID A;  3KAS A;  1ZLI A;  2ZXV A;  1IB1 E;  1TKH A;  4MHD A;  3WT4 A;  3I1U A;  1XE4 A;  4ORF A;  5G22 A;  1ELM P;  4HNW B;  4MCP A;  3WC5 A;  4F0Y A;  1QSM A;  4KUA A;  4OAD A;  4K0C A;  2VZY A;  3KHX A;  3D4U A;  2BFQ A;  3TC8 A;  2J8N A;  3F8K A;  3FX6 A;  4O23 A;  4MY3 A;  5JM6 A;  4OID A;  1Z8L A;  2PJ5 A;  3D2P A;  3F5B A;  4PPZ A;  4UML A;  4KOS A;  2HB6 A;  4LX9 A;  4GUA A;  4NGS A;  3EWQ A;  4A30 A;  1ON0 A;  1Q2C A;  1BO4 A;  3TE4 A;  1LOK A;  4E0A A;  1HDQ A;  4F8Z A;  5LRK A;  2FIA A;  3B7I A;  4JYW A;  2Q51 A;  4MHY A;  4IQY A;  1EE3 P;  2AFU A;  1VHS A;  3DR6 A;  4BMH A;  2ZED A;  4FAI A;  4UCP A;  4JLL A;  1ZLH A;  1Y7E A;  1XIX A;  2IJZ A;  4AXV A;  1XF8 A;  4MHZ A;  4R8F A;  2JEV A;  1A2Z A;  3MRU A; 
#chains in the Genus database with same CATH homology
 4F9U A;  2OR4 A;  3GPQ A;  4BD9 A;  3PFO A;  4MCR A;  4NGQ A;  4OC1 A;  2V8D A;  1ZR5 A;  1DE4 C;  1ARL A;  1LAN A;  2PJ3 A;  1XRY A;  1M4L A;  4ZX9 A;  1R3N A;  1ZG8 A;  5K8O A;  4ZI6 A;  3B3V A;  2O4H A;  3FJU A;  4PXB A;  4FBE A;  4D86 A;  3RAM A;  3V2B A;  2ZEH A;  4MMO A;  4NGM A;  2ZEN A;  1TY8 A;  4UF4 A;  5CPA A;  2V8V A;  1VHO A;  2X47 A;  3IJ3 A;  4J5Q A;  2ABZ A;  3PBB A;  3EWP A;  2HC9 A;  4MRI A;  3S9M A;  3RBU A;  4P4D A;  5HXD A;  1CP7 A;  5J1Q A;  1YW6 A;  2QVP A;  4R7M A;  2CIJ A;  2BFR A;  3KQZ A;  2QJ8 A;  4ETJ A;  4A94 A;  7CPA A;  1R43 A;  4NJR A;  3WC7 A;  1F57 A;  4P44 A;  4FUU A;  3EW5 A;  4J5R A;  4TU0 A;  3B3C A;  1YME A;  3IIB A;  1Y0R A;  5AIL A;  4OC5 A;  2FAV A;  2EK8 A;  1FT7 A;  2ZEG A;  5D29 A;  3EJG A;  3KI9 A;  4TNU A;  6CPA A;  1XFO A;  3CT9 A;  5ELY A;  3FF3 A;  4ESS A;  4P4E A;  4OIW A;  4X2T A;  2DEA A;  2EK9 A;  2PJ6 A;  1SPV A;  1VIX A;  3PB7 X;  4JCA A;  4ABK A;  1ARM A;  3BI1 A;  2PCU A;  3NA6 A;  3V38 A;  3L2N A;  4P4F A;  2BOA A;  1CG2 A;  3D66 A;  4OKO A;  2FG1 A;  5LRG A;  3SIG A;  3MN8 A;  4K3N A;  1PYT B;  1YSJ A;  4ZX8 A;  2ZOF A;  4PQA A;  2PJ7 A;  1XBU A;  3VAT A;  4F9V A;  2PJ0 A;  5JGF A;  1JQG A;  1RTQ A;  4ONW A;  2AFX A;  5CBM A;  4P45 A;  5LRJ A;  3KZW A;  3GQO A;  5IB9 A;  3TX8 A;  4P4B A;  3H8E A;  4UEF A;  2GRE A;  2PE3 A;  5LYI A;  3GPO A;  2O53 A;  3KL9 A;  1XMB A;  2ZEO A;  5FSY A;  2V8H A;  2JBK A;  1QQ9 A;  3LWU A;  4Z65 A;  2I3C A;  3PRT A;  4GM5 A;  3D67 A;  4UIA A;  1HEE A;  2EEE A;  1LAM A;  4ZY0 A;  3PB4 X;  5FSZ A;  4GVV A;  4KYB A;  3GQE A;  4P4I A;  4J5S A;  1CBX A;  3ISZ A;  4MCQ A;  1F2O A;  2OOT A;  4Q7A A;  3SJF A;  4X3R A;  5LYF A;  4MCS A;  4ABL A;  2PJA A;  4JGK A;  3GPG A;  3FEC A;  3NH4 A;  3IC1 A;  3SI2 A;  2BCO A;  5DS0 A;  2C6C A;  3CPA A;  3D7F A;  5FSU A;  4IHM A;  2Q4Z A;  3FVL A;  1CPS A;  2J9A A;  3B2Y A;  2AFS A;  1AYE A;  3IFE A;  2NYQ A;  3B3S A;  5THW A;  3FMC A;  3PB6 X;  3D7G A;  4YU9 A;  1NJR A;  2XEI A;  3WC6 A;  4EFD A;  5K8N A;  1H8L A;  1OBR A;  3PB9 X;  4EWT A;  1Q7L A;  5HVG A;  4NGR A;  3ETI A;  4ZY2 A;  5CB5 A;  3JRU A;  4B6Z A;  2AFC A;  3JZT A;  4R76 A;  3EWO A;  4J4Z A;  2ACF A;  1TF9 A;  4IK2 A;  5DUS A;  3CPX A;  3SJX A;  4W9Y A;  2PJ8 A;  4TWE A;  1UWY A;  2PJC A;  1VHU A;  3IIF A;  2ANP A;  4YWY A;  4GVW A;  2CTC A;  2C1C A;  3KR4 A;  2L8R A;  3NH8 A;  5FSX A;  4CPA A;  1ZG9 A;  2PJ2 A;  3D7D A;  1VHE A;  2PRQ A;  4X8I A;  3SIJ A;  2FXK A;  2EWB A;  4OP4 A;  5I4M A;  3EWR A;  2CTB A;  1IY7 A;  3T8W A;  1ZG7 A;  3PB8 X;  3WAB A;  1PCA A;  1IGB A;  3RZA A;  4P10 A;  3H8G A;  3ISX A;  4OC0 A;  4NGN A;  3VH9 A;  3GB0 A;  2F8H A;  3D68 A;  2PJB A;  1BPM A;  2XD7 A;  2BO9 A;  4UEZ A;  3SJG A;  4UEE A;  2RFH A;  1KWM A;  3IWW A;  3K9T A;  4ZYQ A;  3KR5 A;  4OC3 A;  4P6Y A;  2CF4 A;  3PBE A;  4H2K A;  3LMS A;  1BAV A;  4PXC A;  3GUX A;  4NGT A;  3FH4 A;  4RUH A;  2GLF A;  2XEJ A;  3CDX A;  4UIB A;  2V77 A;  4MHP A;  5LYD A;  5FSV A;  1LAP A;  1TKF A;  2WZN A;  4PXE A;  5K8M A;  2DX6 A;  5D8N A;  1FNO A;  2AFM A;  3BXM A;  3DGV A;  3N5F A;  3HUV A;  1YLO A;  3KGQ A;  5LYL A;  4EME A;  2V8G A;  3QNV A;  3GLJ A;  1HDU A;  3PEI A;  5CMS A;  2ZOG A;  2PVW A;  2IQ6 A;  5CB3 A;  1ZR3 A;  1TF8 A;  2LGR A;  1TXZ A;  3SIH A;  3SII A;  5JH9 A;  2XEF A;  1LFW A;  3VFQ A;  5HVH A;  1CPX A;  2ZEF A;  2VL1 A;  3DLJ A;  3H8F A;  2AFW A;  3K2K A;  1NSA A;  5HVF A;  1TKJ A;  1Z5R A;  5HIH A;  4A37 A;  3EKE A;  5HOL A;  4NFR A;  2AFO A;  2GLJ A;  4JZ0 A;  2ZEM A;  4DUK A;  2XEG A;  1XJO A;  3IEH A;  4G1P A;  4MXU A;  4NGP A;  3B3T A;  4KSI A;  2PIY A;  3PFE A;  4WWV A;  2ZEE A;  3S9L A;  2C6G A;  2FVG A;  3V7Z A;  2PIZ A;  4PXD A;  3HLP A;  2PJ4 A;  1TXR A;  2ZEL A;  1GYT A;  3B3W A;  1ELL P;  5E3B A;  3Q6Z A;  3V45 A;  3B35 A;  3Q71 A;  2C6P A;  2GU2 A;  3D7H A;  1Z2L A;  2PJ9 A;  2RB7 A;  3SI0 A;  4OC4 A;  5F09 A;  2PVV A;  3SJE A;  1BLL E;  2AFZ A;  4P4J A;  2WYR A;  4DJL A;  8CPA A;  5K8P A;  4NJQ A;  4MHN A;  1QMU A;  4IAV A;  1DTD A;  2G9D A;  4R6T A;  3NFZ A;  4LQG A;  1BPN A;  3NH5 A;  3BI0 A;  2POK A;  2PJ1 A;  4OME A;  1HJZ A;  4OC2 A;  1CX8 A;  4FWU A;  2F7V A;  1CP6 A;  1YW4 A;  3VAR A;  2NSM A;  3FEE A;  2QYV A;  3S9N A;  4DYO A;  3FED A;  4ZY1 A;  1AMP A;  3BHX A;  3EJF A;  2JEW A;  2JBJ A;  3KQX A;  4JVV A;  2VRI A;  4A39 A;  2Q43 A;  3SI1 A;  1LCP A;  2IMO A;  4A38 A;  3KHZ A;  1F2P A;  1VGY A;  3IO1 A;  4WJB A;  2ZEP A;  1YD9 A;  4ETK A;  1Y0Y A;  3IID A;  3KAS A;  1ZLI A;  1TKH A;  3WT4 A;  3I1U A;  1ELM P;  4MCP A;  3WC5 A;  4K0C A;  3KHX A;  3TC8 A;  3D4U A;  2BFQ A;  3FX6 A;  4O23 A;  5JM6 A;  4OID A;  1Z8L A;  2PJ5 A;  4PPZ A;  4UML A;  2HB6 A;  4GUA A;  4NGS A;  3EWQ A;  1LOK A;  4F8Z A;  1HDQ A;  5LRK A;  3B7I A;  4JYW A;  2Q51 A;  4MHY A;  4IQY A;  1EE3 P;  2AFU A;  2ZED A;  4FAI A;  4JLL A;  1ZLH A;  1Y7E A;  2IJZ A;  4AXV A;  4MHZ A;  4R8F A;  3MRU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...