3JRUA

Crystal structure of leucyl aminopeptidase (pepa) from xoo0834,xanthomonas oryzae pv. oryzae kacc10331
Total Genus 172
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
172
sequence length
490
structure length
490
Chain Sequence
b'MALQFTLNQDAPASAAVDCIVVGAFADKTLSPAAQALDSASQGRLTALLARGDVAGKTGSTTLLHDLPGVAAPRVLVVGLGDAGKFGVAPYLKAIGDATRALKTGAVGTALLTLTELTVKARDAAWNIRQAVTVSDHAAYRYTATLGKKKVDETGLTTLAIAGDDARALAVGVATAEGVEFARELGNLPPNYCTPAYLADTAAAFAGKFPGAEAEILDEAQMEALGMGSLLSVARGSANRPRLIVLKWNGGGDARPYVLVGKGITFDTGGVNLKTQGGIEEMKYDMCGGATVIGTFVATVKAELPINLVVVVPAVENAIDGNAYRPSDVITSMSGKTIEVGNTDAEGRLILCDALTYAERFNPEALVDVATLTGACMVALGHQTAGLMSKHDDLANELLAAGEHVFDRAWRLPLWDEYQGLLDSTFADVYNIGGRWGGAITAGCFLSRFTENQRWAHLDIAGVASDEGKRGMATGRPVGLLTQWLLDRAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable cytosol aminopeptidase
molecule tags Hydrolase
source organism Xanthomonas oryzae pv. oryzae
publication title Crystal structure of Leucyl Aminopeptidase (pepA) from Xoo0834,Xanthomonas oryzae pv. oryzae KACC10331
rcsb
total genus 172
structure length 490
sequence length 490
chains with identical sequence B
ec nomenclature ec 3.4.11.1: Leucyl aminopeptidase.
pdb deposition date 2009-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00883 Peptidase_M17 Cytosol aminopeptidase family, catalytic domain
A PF02789 Peptidase_M17_N Cytosol aminopeptidase family, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 3jruA01
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3jruA02
3D67A 4IHMA 1EE3P 4B6ZA 5D8NA 1BPMA 5K8PA 4DUKA 3KHXA 2AFCA 4X2TA 2RB7A 4MHYA 1KWMA 3EWRA 3SIIA 4P44A 4ZY1A 1YW6A 2XEFA 1TKHA 3D7GA 4PXDA 2NSMA 2PJAA 4FAIA 4JGKA 5FSZA 2HC9A 2PCUA 1TXRA 3B3TA 1ZG7A 5DS0A 4R76A 2Q4ZA 3FMCA 3NFZA 2JEWA 5LRKA 4ONWA 3ETIA 1ELLP 1ZR5A 1ZLHA 5FSVA 3EWQA 4UEFA 2PIZA 3B2YA 3LWUA 4O23A 4LQGA 2X47A 4PXEA 4R6TA 2V8GA 1HDQA 4FUUA 4DJLA 4OC5A 2EK8A 3GQEA 2FAVA 3BXMA 5CBMA 4UIBA 2CTBA 3PB9X 3FECA 2JBKA 5J1QA 2PJBA 2V8DA 3B3WA 4W9YA 1F2OA 1ZLIA 5LYFA 3EWOA 3KR4A 4NGTA 4RUHA 3NA6A 3D4UA 1TF9A 3D68A 1VHEA 4BD9A 3SI2A 5HIHA 2IJZA 1QMUA 1RTQA 1JQGA 3KL9A 2PJ3A 5K8NA 1SPVA 1ELMP 2C6CA 3DGVA 1IY7A 4UF4A 2BOAA 4WWVA 3EJGA 3K9TA 3H8FA 3V38A 1NSAA 1XBUA 5HVFA 2GU2A 1CG2A 5JGFA 5FSXA 3Q71A 4EFDA 1YSJA 1TF8A 3PEIA 5IB9A 1DTDA 3KQXA 2PE3A 3TX8A 2FG1A 2AFZA 3PB6X 1YW4A 3IWWA 4OC0A 2J9AA 1XMBA 4ETKA 4OC3A 4MHPA 1LAMA 3PBBA 2AFOA 3PB7X 3MN8A 3KASA 3SIJA 3FJUA 4K0CA 4PQAA 3L2NA 3VARA 4P6YA 3GPOA 5D29A 4F9VA 3KGQA 1XJOA 1Y0RA 3D66A 2G9DA 3IJ3A 3IC1A 4MCPA 2PJ2A 1BAVA 1AMPA 4P45A 1CPSA 5THWA 1QQ9A 2F7VA 3H8EA 3FX6A 2IMOA 4Q7AA 3EWPA 2GREA 8CPAA 2EK9A 2PVWA 2PJ4A 2ZELA 1R3NA 4NGQA 2ZEDA 3V7ZA 3SJGA 3IFEA 1OBRA 3EW5A 3EKEA 2BO9A 5F09A 1YLOA 3CPAA 2GLFA 2Q43A 2O53A 1LOKA 3SI1A 3IEHA 1CPXA 1YMEA 2FXKA 5HVGA 1F57A 3WC7A 1UWYA 3PRTA 4P4JA 3NH4A 5CB5A 3WABA 5JM6A 2PRQA 3KR5A 4GUAA 1LFWA 3KZWA 3SIGA 4TNUA 4X8IA 3PFOA 4UIAA 3JZTA 1LCPA 3FEEA 5AILA 2AFUA 3FEDA 1ZR3A 4GM5A 3HUVA 4ZY0A 2PJ0A 3V45A 3RZAA 3S9NA 3S9MA 1Y7EA 4ZI6A 3D7HA 3ISZA 4MCQA 4ABLA 5FSYA 5JH9A 1BLLE 4YWYA 2AFXA 4K3NA 4P4BA 4R7MA 3B35A 4P4DA 4F9UA 4D86A 2PJ1A 4JLLA 4JVVA 1ZG9A 4ESSA 3WC6A 5CMSA 2QJ8A 3B7IA 4JYWA 2ZEFA 2ZOGA 2IQ6A 4DYOA 2XD7A 4FBEA 4A39A 4YU9A 5LYDA 1YD9A 5LRGA 5I4MA 3PFEA 2ZOFA 1TKJA 2RFHA 4A94A 3CDXA 4Z65A 3DLJA 3ISXA 3VH9A 4WJBA 4NGPA 2PJ9A 4EMEA 3RAMA 4UEEA 5DUSA 3NH8A 5FSUA 1NJRA 2BCOA 4OMEA 5ELYA 4EWTA 2FVGA 3IIBA 1TKFA 2BFRA 4NJQA 3GB0A 2CTCA 1XRYA 1XFOA 2AFMA 3Q6ZA 2DEAA 5CB3A 2XEGA 3D7DA 1DE4C 4ZYQA 4MHZA 4UEZA 4NGRA 2CF4A 2OR4A 3WC5A 2AFWA 3NH5A 3LMSA 3B3SA 3IIDA 2WYRA 1VHUA 4IQYA 4KSIA 4J5SA 4MRIA 4GVWA 1Z8LA 3D7FA 1R43A 3MRUA 4G1PA 2BFQA 2VRIA 1TY8A 1HEEA 3GLJA 3BI1A 3CPXA 2PJCA 2NYQA 3GUXA 1HJZA 1VGYA 4JZ0A 3SJFA 5K8OA 2EWBA 3JRUA 3FF3A 3SJXA 1Q7LA 4P4FA 1ZG8A 2C6PA 4IAVA 4ZX9A 2PIYA 3BI0A 3K2KA 4J5RA 1PCAA 4FWUA 1TXZA 2C6GA 2PJ6A 2XEJA 4H2KA 3GPGA 2ZEMA 1FNOA 1LANA 3BHXA 2AFSA 4ABKA 1VHOA 3KQZA 4MCRA 3N5FA 2ZENA 2HB6A 2JBJA 5HVHA 3IO1A 1BPNA 2F8HA 3PBEA 2ZEEA 2V8VA 6CPAA 5E3BA 3TC8A 4NJRA 1CP6A 4P4EA 3KI9A 1Z2LA 1F2PA 4J4ZA 2PVVA 3B3VA 4MXUA 3CT9A 2O4HA 3GPQA 4IK2A 4NGNA 7CPAA 4X3RA 3QNVA 4NGSA 2QVPA 3T8WA 2PJ8A 3PB8X 3GQOA 3V2BA 4OIDA 3VATA 3SI0A 3RBUA 4UMLA 3HLPA 4OC1A 1PYTB 4MHNA 4ZY2A 1CX8A 2QYVA 5K8MA 5LYLA 2V8HA 3FVLA 4AXVA 4ETJA 2CIJA 3KHZA 3IIFA 2I3CA 3B3CA 2C1CA 5LYIA 1CBXA 4MMOA 3VFQA 5LRJA 3EJFA 1H8LA 4JCAA 2GLJA 2DX6A 3FH4A 2POKA 4TWEA 2ZEGA 4ZX8A 4R8FA 2LGRA 3PB4X 2WZNA 4A37A 2V77A 4OC2A 1ARMA 5HXDA 4P10A 4OP4A 4OKOA 1HDUA 4PXCA 1GYTA 2ACFA 2Q51A 4OIWA 4NFRA 4PXBA 1VIXA 4P4IA 2ANPA 2EEEA 4OC4A 4KYBA 2VL1A 4TU0A 2OOTA 1AYEA 1ARLA 3S9LA 2L8RA 3SIHA 2PJ5A 4A38A 1LAPA 5HOLA 2ABZA 3I1UA 2ZEHA 5CPAA 4PPZA 2PJ7A 4NGMA 2ZEPA 4F8ZA 4GVVA 1Y0YA 2ZEOA 4MCSA 1M4LA 3SJEA 2XEIA 3H8GA 1Z5RA 4CPAA 1CP7A 4J5QA 3WT4A 1FT7A 1IGBA
chains in the Genus database with same CATH superfamily
3D67A 2Z3PA 3R9EA 4IHMA 1EE3P 4MHDA 4B6ZA 2B3UA 4MBUA 5D8NA 5J1QA 4UFXA 1BPMA 5KTAA 1QSMA 5K8PA 1QSOA 4DUKA 3KHXA 4CGLA 2AFCA 4X2TA 2RB7A 4MHYA 1KWMA 2PDOA 3TFYA 4CRYB 2R1IA 3DNSA 2J8NA 4K30A 4NF1A 5AG6A 3EWRA 3SIIA 2HUZA 4P44A 4ZY1A 1YW6A 4I49A 2XEFA 1TKHA 1IOFA 2GIVA 4A33A 4PK3A 1IYLA 2R98A 3D7GA 4PXDA 2NSMA 2PJAA 2ZPAA 1XEBA 4CYNA 4JGKA 1BO4A 4JD6A 5FSZA 5G20A 4FAIA 5G21A 2Z3LA 2HC9A 2PCUA 1TXRA 3DSBA 1L0CA 3FB3A 4C7HA 4KOSA 3EY5A 3R9FA 2DF5A 3B3TA 1ZG7A 4AG9A 5DS0A 2YNCA 3TT2A 3T90A 2HV2A 4UCPA 3EC4A 5BWAB 3BJ8A 3LD2A 4UFVA 4R76A 4KOUA 2Q4ZA 2B5GB 2YGWA 4R3LA 1IOIA 5JQ4A 3FMCA 3KKWA 3NFZA 3D2PA 4CAXA 2JEWA 5LRKA 4ONWA 5E96A 3ETIA 3FNCA 1ELLP 4OLLA 1VKCA 1ZR5A 1ZLHA 5FSVA 1U6MA 3EWQA 4UEFA 2PIZA 3B2YA 2VXKA 3LWUA 4O23A 4LQGA 4YGOA 3VWDA 2X47A 1M4GA 4PXEA 4R6TA 3RO0A 2V8GA 1PUAA 3QB8A 4B13A 1HDQA 4FUUA 2PSWA 4DJLA 2Z3KA 4OC5A 3NE8A 4C2YA 2EK8A 3GQEA 4A2ZA 4UWJA 2FAVA 3BXMA 4CS0B 4LQ6A 5CBMA 2CNTA 4QC6A 4UIBA 2CTBA 3R95A 3TO6A 2FT0A 2OZUA 3PB9X 3FECA 3TCVA 2JBKA 2RNKA 2H5MA 5F49A 4MFJA 3TE4A 1FY7A 4MFLA 2PJBA 2V8DA 3B3WA 4HPSA 4KSFA 2Q0YA 4W9YA 1F2OA 4UWIA 4H6ZA 1QSNA 1XIXA 4GXHA 3G8WA 1VHSA 1ZLIA 5JPHA 5LYFA 3EWOA 3KR4A 4NGTA 4RUHA 4YFJA 3NA6A 5HMNA 3S6GA 1LRZA 3D4UA 1TF9A 3D68A 1VHEA 4BD9A 3SI2A 3D8PA 5HIHA 2GANA 3FXTA 2IJZA 1QMUA 1RTQA 1JQGA 4KOXA 2C27A 3KL9A 2PJ3A 2CY2A 5K8NA 3DR6A 3I9SA 4C68A 1SPVA 4AB7A 4NSQA 4U5YA 1ELMP 2C6CA 3DGVA 4AG7A 1A2ZA 1IY7A 1S7LA 4UF4A 2EBJA 1IU8A 2BOAA 2FE7A 2FL4A 4WWVA 4R87A 3EJGA 1S3ZA 3K9TA 3H8FA 3V38A 1NSAA 1XBUA 4MFZA 5HVFA 1CM0A 2GU2A 4F0XA 1CG2A 3RNZA 5JGFA 1B87A 4OADA 1IB1E 5FSXA 3Q71A 4JJXA 4JLYA 5EC4A 4EFDA 1YSJA 1TF8A 1YVKA 2OB0A 3PEIA 2DXQA 1IYKA 1RO5A 1RXTA 1S7NA 4M85A 4UCNA 2G3AA 5IB9A 1DTDA 2PC1A 3KQXA 2J8RA 2ODFA 2FG1A 2PE3A 5F48A 4MFKA 2AFZA 3TX8A 1ZO0A 3PB6X 1YW4A 3IWWA 4PV6A 2ZW5A 4OC0A 2J9AA 1XMBA 2I79A 4ETKA 2R7HA 4OC3A 4MHPA 3R96A 1LAMA 3IGRA 3PBBA 4F6AA 4RN7A 3F0AA 2AFOA 3PB7X 4CGOA 3MN8A 1YREA 4A32A 3CZXA 3KASA 3SIJA 3ZZIA 5J8CA 1R57A 1TIQA 3FJUA 4K0CA 4PQAA 4XPDC 3L2NA 3VARA 3CXSA 4P6YA 3GPOA 4M3SA 5D29A 4F9VA 3KGQA 4M6IA 5AG5A 4YRHA 1XJOA 1Y0RA 5FVJA 3SXOA 4CGPA 5KTDA 3D66A 2G9DA 4XNHB 3IJ3A 3IC1A 4MCPA 3R1KA 2PJ2A 1BAVA 1AMPA 4KVME 1Z8TA 2FXFA 4P45A 1CPSA 1YQEA 1PU9A 1V0CA 5EMIA 5THWA 3W6SA 4CAVA 3JUWA 1QQ9A 4CYQA 2P6EA 5C88A 2F7VA 1MJ9A 3H8EA 3JVNA 2DPSA 3FX6A 4AVBA 4AVAA 2IMOA 2B4BA 4Q7AA 3EWPA 4RI1A 1B6BA 5IX3A 2X7BA 2Q4VA 2GREA 4AVCA 3F8KA 4B14A 4KUBA 8CPAA 2EK9A 3BJ7A 4CRZB 2Q04A 4R3KA 1S5KA 2PVWA 3WR7A 2PJ4A 2ZELA 4CGNA 1R3NA 4NGQA 2ZEDA 3V7ZA 3SJGA 3IFEA 1OBRA 3EW5A 3EKEA 2BO9A 5F09A 1YLOA 1KUYA 3CPAA 2GLFA 4B5PB 4NCZA 4CAEA 1X12A 3S6HA 2Q43A 2O53A 1LOKA 2HQYA 3DDDA 1M4DA 1CPXA 1YMEA 3G3SA 3IEHA 3SI1A 2FXKA 4J3GA 5HVGA 1X10A 1F57A 1N71A 2Q7BA 3WC7A 1UWYA 2A4NA 2KCWA 3PRTA 4P4JA 3NH4A 5CB5A 2EUIA 4C7IA 3PP9A 3WABA 5JM6A 2PRQA 3TOBA 3KR5A 2Z0ZA 4GUAA 1LFWA 3KZWA 3SIGA 1YR0A 4IUSA 4TNUA 3FYNA 4X8IA 4HNXB 3PFOA 4PSWA 4UIAA 2CNMA 3JZTA 5DWNA 5H86A 4XPLA 4Y49B 4U9ZA 4RS2A 1LCPA 2VZYA 3FEEA 5G1ZA 3T9YA 5AILA 2AFUA 3FEDA 4OAEA 1ZR3A 4GM5A 4B5OA 3HUVA 1KUXA 2Z10A 4A31A 5A27A 4ZY0A 4FD4A 2PJ0A 3V45A 2OU2A 3RZAA 2F5IA 4JXQA 3S9MA 2AJ6A 1Y7EA 4ZI6A 2ATRA 3D7HA 3S9NA 3ISZA 4MCQA 4ABLA 3TO7A 5FSYA 2FS5A 2WPXA 5AG7A 2Q7SA 5JH9A 1BLLE 4YWYA 2AFXA 2RC4A 4K3NA 1Y7RA 3EXNA 2W2GA 4FD7A 4P4BA 4R7MA 1IICA 3B35A 5AG4A 3VWEA 1MJAA 5H84A 4P4DA 4F9UA 4D86A 2PJ1A 4JLLA 4MI4A 1Q2CA 4Q38A 4JVVA 1ZG9A 4U9YA 4UCMA 2Y0MA 4ZBGA 4B5PA 4KSAA 1AUGA 2YNDA 4KVOE 1JWQA 1NE9A 4XPDB 1GHEA 2EO8A 4ESSA 3SXNA 1Z8WA 5CMSA 3MGDA 4KORA 3WC6A 2PR1A 2QJ8A 4QUSA 3B7IA 3F5BA 3DR8A 4JYWA 2ZEFA 2ZOGA 1M44A 2IQ6A 2VEZA 2VBQA 4DYOA 2XD7A 3A9LA 4CYOA 3K9UA 1CJWA 2Q44A 2VQYA 4A39A 4FBEA 4YU9A 3E0KA 3FIXA 5LYDA 3W91A 1YD9A 2CXAA 2REEA 5LRGA 1P0HA 3W6XA 5I4MA 3OWCA 3PFEA 1MK4A 2FCKA 3V8IA 2ZOFA 4EVYA 1TKJA 2BL1A 1Y9WA 2PR8A 2GFQA 2RFHA 4A94A 5J8FA 4A30A 4L89A 3CDXA 4Z65A 3DLJA 3ISXA 3VH9A 4XNHC 4WJBA 4NGPA 3IU2A 4KOTA 2PJ9A 4EMEA 3RAMA 4UEEA 5DUSA 3NH8A 5FSUA 2WUUA 1I21A 2G0BA 1NJRA 2BCOA 4OMEA 5ELYA 3UY5A 1YGHA 1J4JA 1Y9KA 4R57A 4EWTA 5IV0A 1Z9UA 1S60A 2FVGA 3IIBA 1TKFA 3C26A 2BFRA 3P2FA 4JWPA 3JTKA 4NJQA 2BSWA 1ON0A 3GB0A 4MFPA 4BBHA 2ZW7A 4IF5A 4KS9A 2CTCA 5AGEA 4MY3A 1XRYA 4F0YA 2OH1A 2R8VA 1XFOA 2O28A 4JXRA 2WPWA 3CXQA 1XF8A 2AFMA 3Q6ZA 4NEXA 2DEAA 3B8GA 5CB3A 3ZJ0A 3R9GA 1XE4A 2FSRA 2XEGA 3D7DA 1Z4RA 1DE4C 2P6FA 4KOVA 4ZYQA 3IWGA 4MHZA 4NGRA 4UEZA 2CF4A 2OR4A 2REFA 4A95A 3WC5A 2AFWA 3NH5A 3PZJA 4DNCA 3LMSA 3B3SA 1NSLA 2EVNA 3IIDA 2WYRA 1VHUA 4IQYA 1IIDA 1S7KA 4J5SA 4KSIA 4HNYB 2WSAA 3NE7A 4MRIA 2B3VA 1XMTA 4QBJA 3TTHA 4GVWA 3CXPA 1Z8LA 2NMTA 1R43A 1Z8XA 2JDCA 2Z3OA 2ZXVA 3D7FA 3MRUA 2BFQA 2VRIA 1YLEA 2VI7A 4G1PA 4II9A 1TY8A 2JDDA 1HEEA 3S6FA 3GLJA 1I1DA 3BI1A 3CPXA 2PJCA 4KOWA 1YK3A 2NYQA 2JZFA 3GUXA 4B10A 4CAWA 2YNCC 4H89A 1HJZA 1I12A 1VGYA 2D4OA 4JZ0A 3SJFA 5K8OA 2EWBA 3JRUA 1NMTA 3FF3A 3H4QA 4Y49C 3SJXA 1Q7LA 4P4FA 5DWMA 1ZG8A 1Q2DA 1WK4A 2C6PA 4IAVA 4ZX9A 1M4IA 4CGMA 1Q2YA 2OZHA 2PIYA 4KOYA 3BI0A 3K2KA 4GS4A 1OZPA 4J5RA 4E2AA 1PCAA 4FWUA 1TXZA 2C6GA 2PJ6A 2XEJA 4H2KA 2OZGA 3GPGA 2ZEMA 1FNOA 1LANA 5ISVA 3BHXA 4PK2A 3BLNA 1S7FA 4L8AA 2AFSA 1WWZA 4ABKA 1VHOA 3KQZA 4MCRA 2BUEA 3N5FA 2ZENA 1SQHA 4ZGYB 4KLWA 4KLVA 2HB6A 4UFWA 2JBJA 5EBVA 4ORFA 2ZW6A 4XPKA 3SHPA 5HVHA 4HKFA 4E0AA 3IO1A 1BPNA 2F8HA 3PBEA 4H6UA 2ZEEA 4E8OA 2V8VA 4FD5A 1UFHA 6CPAA 5E3BA 4M6HA 1P4NA 1YX0A 4LX9A 1CP6A 2QMLA 4MJ8A 3KI9A 4NJRA 4ONUA 4P4EA 1Z2LA 2B4DB 3GY9A 1F2PA 4J4ZA 2PVVA 3B3VA 2P6GA 4MXUA 5C82A 3CT9A 4C2XA 2O4HA 3GPQA 4IK2A 4NGNA 1QSTA 3S6KA 7CPAA 4X3RA 3QNVA 4NGSA 4M6GA 2QVPA 2J8MA 3T8WA 3TC8A 2PJ8A 3PB8X 3GQOA 3V2BA 4OIDA 3EO4A 3N7ZA 3IU1A 3VATA 1KZFA 4BMHA 1Z4EA 3D3SA 3FRMA 3SI0A 3RBUA 5F46A 4UMLA 4QVTA 2Z3NA 3TO9A 2WCTA 3HLPA 4KVXA 3H5ZA 4OC1A 1PYTB 4PSXA 4B11A 4MHNA 4ZY2A 1CX8A 2QYVA 5K8MA 4KZTA 3I3GA 2Z3MA 2V8HA 2AE6A 2QECA 3FVLA 4C2ZA 5LYLA 2JZEA 4AXVA 4ETJA 2CIJA 3KHZA 3IIFA 3LODA 4FD6A 3EFAA 2I3CA 3B3CA 2JEVA 2C1CA 2IL4A 5LYIA 5GCNA 1CBXA 4MMOA 4CYPA 3VFQA 5LRJA 3EJFA 1H8LA 4JCAA 2GLJA 2DX6A 4HNWB 4KUAA 3FH4A 2POKA 4UBRA 4TWEA 4X5KA 2ZEGA 5KTCA 2FIAA 4ZX8A 3D2MA 2G3TA 4R8FA 2LGRA 3PB4X 2CNSA 2K5TA 2WZNA 4A37A 2V77A 3QAHA 2Q4YA 2B58A 2PQ8A 1ARMA 4OC2A 5HXDA 4P10A 4Q36A 4OP4A 4OKOA 2KQVA 1HDUA 5A28A 1KUVA 3P2HA 4PXCA 5HH1A 3TOAA 4MY0A 2D4PA 1GYTA 2ZW4A 3GYAA 2ACFA 2Q51A 4OIWA 3FBUA 1XOVA 4LUAA 4NFRA 1MJBA 4PXBA 1VIXA 2PRBA 4P4IA 2ANPA 1K4JA 2EEEA 5IB0A 2I00A 4OC4A 4KYBA 2VL1A 4TU0A 2ARHA 3PGPA 4R9MA 1AYEA 1ARLA 2BEIA 2OOTA 5I0CA 2L8RA 4B12A 3SIHA 3RYOA 3S9LA 2GE3A 2PJ5A 4A38A 3QAYA 1LAPA 5HOLA 2ABZA 3GKRA 3I1UA 3GIUA 5F47A 2FIWA 4MFQA 2YNEA 2ZEHA 2Z11A 5G22A 5CPAA 4PPZA 3LACA 2PJ7A 4NGMA 2JLMA 2QIRA 2ZEPA 4UA3A 5CNPA 4GVVA 1YVOA 4CAFA 2VZZA 4F8ZA 2DPTA 1BOBA 1Y0YA 2JZDA 2ZEOA 1M4LA 4MCSA 3SJEA 2B5GA 2XEIA 3H8GA 1Z5RA 4CPAA 1CP7A 3IWEA 4J5QA 3WT4A 2B4DA 4NXYA 1QSRA 4BINA 2P0WA 4QB9A 1FT7A 1IGBA 1M1DA
chains in the Genus database with same CATH topology
3D67A 4IHMA 1EE3P 4B6ZA 5D8NA 1BPMA 5K8PA 4DUKA 3KHXA 2AFCA 4X2TA 2RB7A 4MHYA 1KWMA 3EWRA 3SIIA 4P44A 4ZY1A 1YW6A 2XEFA 1TKHA 3D7GA 4PXDA 2NSMA 2PJAA 4FAIA 4JGKA 5FSZA 2HC9A 2PCUA 1TXRA 3B3TA 1ZG7A 5DS0A 4R76A 2Q4ZA 3FMCA 3NFZA 2JEWA 5LRKA 4ONWA 3ETIA 1ELLP 1ZR5A 1ZLHA 5FSVA 3EWQA 4UEFA 2PIZA 3B2YA 3LWUA 4O23A 4LQGA 2X47A 4PXEA 4R6TA 2V8GA 1HDQA 4FUUA 4DJLA 4OC5A 2EK8A 3GQEA 2FAVA 3BXMA 5CBMA 4UIBA 2CTBA 3PB9X 3FECA 2JBKA 5J1QA 2PJBA 2V8DA 3B3WA 4W9YA 1F2OA 1ZLIA 5LYFA 3EWOA 3KR4A 4NGTA 4RUHA 3NA6A 3D4UA 1TF9A 3D68A 1VHEA 4BD9A 3SI2A 5HIHA 2IJZA 1QMUA 1RTQA 1JQGA 3KL9A 2PJ3A 5K8NA 1SPVA 1ELMP 2C6CA 3DGVA 1IY7A 4UF4A 2BOAA 4WWVA 3EJGA 3K9TA 3H8FA 3V38A 1NSAA 1XBUA 5HVFA 2GU2A 1CG2A 5JGFA 5FSXA 3Q71A 4EFDA 1YSJA 1TF8A 3PEIA 5IB9A 1DTDA 3KQXA 2PE3A 3TX8A 2FG1A 2AFZA 3PB6X 1YW4A 3IWWA 4OC0A 2J9AA 1XMBA 4ETKA 4OC3A 4MHPA 1LAMA 3PBBA 2AFOA 3PB7X 3MN8A 3KASA 3SIJA 3FJUA 4K0CA 4PQAA 3L2NA 3VARA 4P6YA 3GPOA 5D29A 4F9VA 3KGQA 1XJOA 1Y0RA 3D66A 2G9DA 3IJ3A 3IC1A 4MCPA 2PJ2A 1BAVA 1AMPA 4P45A 1CPSA 5THWA 1QQ9A 2F7VA 3H8EA 3FX6A 2IMOA 4Q7AA 3EWPA 2GREA 8CPAA 2EK9A 2PVWA 2PJ4A 2ZELA 1R3NA 4NGQA 2ZEDA 3V7ZA 3SJGA 3IFEA 1OBRA 3EW5A 3EKEA 2BO9A 5F09A 1YLOA 3CPAA 2GLFA 2Q43A 2O53A 1LOKA 3SI1A 3IEHA 1CPXA 1YMEA 2FXKA 5HVGA 1F57A 3WC7A 1UWYA 3PRTA 4P4JA 3NH4A 5CB5A 3WABA 5JM6A 2PRQA 3KR5A 4GUAA 1LFWA 3KZWA 3SIGA 4TNUA 4X8IA 3PFOA 4UIAA 3JZTA 1LCPA 3FEEA 5AILA 2AFUA 3FEDA 1ZR3A 4GM5A 3HUVA 4ZY0A 2PJ0A 3V45A 3RZAA 3S9NA 3S9MA 1Y7EA 4ZI6A 3D7HA 3ISZA 4MCQA 4ABLA 5FSYA 5JH9A 1BLLE 4YWYA 2AFXA 4K3NA 4P4BA 4R7MA 3B35A 4P4DA 4F9UA 4D86A 2PJ1A 4JLLA 4JVVA 1ZG9A 4ESSA 3WC6A 5CMSA 2QJ8A 3B7IA 4JYWA 2ZEFA 2ZOGA 2IQ6A 4DYOA 2XD7A 4FBEA 4A39A 4YU9A 5LYDA 1YD9A 5LRGA 5I4MA 3PFEA 2ZOFA 1TKJA 2RFHA 4A94A 3CDXA 4Z65A 3DLJA 3ISXA 3VH9A 4WJBA 4NGPA 2PJ9A 4EMEA 3RAMA 4UEEA 5DUSA 3NH8A 5FSUA 1NJRA 2BCOA 4OMEA 5ELYA 4EWTA 2FVGA 3IIBA 1TKFA 2BFRA 4NJQA 3GB0A 2CTCA 1XRYA 1XFOA 2AFMA 3Q6ZA 2DEAA 5CB3A 2XEGA 3D7DA 1DE4C 4ZYQA 4MHZA 4UEZA 4NGRA 2CF4A 2OR4A 3WC5A 2AFWA 3NH5A 3LMSA 3B3SA 3IIDA 2WYRA 1VHUA 4IQYA 4KSIA 4J5SA 4MRIA 4GVWA 1Z8LA 3D7FA 1R43A 3MRUA 4G1PA 2BFQA 2VRIA 1TY8A 1HEEA 3GLJA 3BI1A 3CPXA 2PJCA 2NYQA 3GUXA 1HJZA 1VGYA 4JZ0A 3SJFA 5K8OA 2EWBA 3JRUA 3FF3A 3SJXA 1Q7LA 4P4FA 1ZG8A 2C6PA 4IAVA 4ZX9A 2PIYA 3BI0A 3K2KA 4J5RA 1PCAA 4FWUA 1TXZA 2C6GA 2PJ6A 2XEJA 4H2KA 3GPGA 2ZEMA 1FNOA 1LANA 3BHXA 2AFSA 4ABKA 1VHOA 3KQZA 4MCRA 3N5FA 2ZENA 2HB6A 2JBJA 5HVHA 3IO1A 1BPNA 2F8HA 3PBEA 2ZEEA 2V8VA 6CPAA 5E3BA 3TC8A 4NJRA 1CP6A 4P4EA 3KI9A 1Z2LA 1F2PA 4J4ZA 2PVVA 3B3VA 4MXUA 3CT9A 2O4HA 3GPQA 4IK2A 4NGNA 7CPAA 4X3RA 3QNVA 4NGSA 2QVPA 3T8WA 2PJ8A 3PB8X 3GQOA 3V2BA 4OIDA 3VATA 3SI0A 3RBUA 4UMLA 3HLPA 4OC1A 1PYTB 4MHNA 4ZY2A 1CX8A 2QYVA 5K8MA 5LYLA 2V8HA 3FVLA 4AXVA 4ETJA 2CIJA 3KHZA 3IIFA 2I3CA 3B3CA 2C1CA 5LYIA 1CBXA 4MMOA 3VFQA 5LRJA 3EJFA 1H8LA 4JCAA 2GLJA 2DX6A 3FH4A 2POKA 4TWEA 2ZEGA 4ZX8A 4R8FA 2LGRA 3PB4X 2WZNA 4A37A 2V77A 4OC2A 1ARMA 5HXDA 4P10A 4OP4A 4OKOA 1HDUA 4PXCA 1GYTA 2ACFA 2Q51A 4OIWA 4NFRA 4PXBA 1VIXA 4P4IA 2ANPA 2EEEA 4OC4A 4KYBA 2VL1A 4TU0A 2OOTA 1AYEA 1ARLA 3S9LA 2L8RA 3SIHA 2PJ5A 4A38A 1LAPA 5HOLA 2ABZA 3I1UA 2ZEHA 5CPAA 4PPZA 2PJ7A 4NGMA 2ZEPA 4F8ZA 4GVVA 1Y0YA 2ZEOA 4MCSA 1M4LA 3SJEA 2XEIA 3H8GA 1Z5RA 4CPAA 1CP7A 4J5QA 3WT4A 1FT7A 1IGBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D67 A;  4IHM A;  1EE3 P;  4B6Z A;  5D8N A;  1BPM A;  5K8P A;  4DUK A;  3KHX A;  2AFC A;  4X2T A;  2RB7 A;  4MHY A;  1KWM A;  3EWR A;  3SII A;  4P44 A;  4ZY1 A;  1YW6 A;  2XEF A;  1TKH A;  3D7G A;  4PXD A;  2NSM A;  2PJA A;  4FAI A;  4JGK A;  5FSZ A;  2HC9 A;  2PCU A;  1TXR A;  3B3T A;  1ZG7 A;  5DS0 A;  4R76 A;  2Q4Z A;  3FMC A;  3NFZ A;  2JEW A;  5LRK A;  4ONW A;  3ETI A;  1ELL P;  1ZR5 A;  1ZLH A;  5FSV A;  3EWQ A;  4UEF A;  2PIZ A;  3B2Y A;  3LWU A;  4O23 A;  4LQG A;  2X47 A;  4PXE A;  4R6T A;  2V8G A;  1HDQ A;  4FUU A;  4DJL A;  4OC5 A;  2EK8 A;  3GQE A;  2FAV A;  3BXM A;  5CBM A;  4UIB A;  2CTB A;  3PB9 X;  3FEC A;  2JBK A;  5J1Q A;  2PJB A;  2V8D A;  3B3W A;  4W9Y A;  1F2O A;  1ZLI A;  5LYF A;  3EWO A;  3KR4 A;  4NGT A;  4RUH A;  3NA6 A;  3D4U A;  1TF9 A;  3D68 A;  1VHE A;  4BD9 A;  3SI2 A;  5HIH A;  2IJZ A;  1QMU A;  1RTQ A;  1JQG A;  3KL9 A;  2PJ3 A;  5K8N A;  1SPV A;  1ELM P;  2C6C A;  3DGV A;  1IY7 A;  4UF4 A;  2BOA A;  4WWV A;  3EJG A;  3K9T A;  3H8F A;  3V38 A;  1NSA A;  1XBU A;  5HVF A;  2GU2 A;  1CG2 A;  5JGF A;  5FSX A;  3Q71 A;  4EFD A;  1YSJ A;  1TF8 A;  3PEI A;  5IB9 A;  1DTD A;  3KQX A;  2PE3 A;  3TX8 A;  2FG1 A;  2AFZ A;  3PB6 X;  1YW4 A;  3IWW A;  4OC0 A;  2J9A A;  1XMB A;  4ETK A;  4OC3 A;  4MHP A;  1LAM A;  3PBB A;  2AFO A;  3PB7 X;  3MN8 A;  3KAS A;  3SIJ A;  3FJU A;  4K0C A;  4PQA A;  3L2N A;  3VAR A;  4P6Y A;  3GPO A;  5D29 A;  4F9V A;  3KGQ A;  1XJO A;  1Y0R A;  3D66 A;  2G9D A;  3IJ3 A;  3IC1 A;  4MCP A;  2PJ2 A;  1BAV A;  1AMP A;  4P45 A;  1CPS A;  5THW A;  1QQ9 A;  2F7V A;  3H8E A;  3FX6 A;  2IMO A;  4Q7A A;  3EWP A;  2GRE A;  8CPA A;  2EK9 A;  2PVW A;  2PJ4 A;  2ZEL A;  1R3N A;  4NGQ A;  2ZED A;  3V7Z A;  3SJG A;  3IFE A;  1OBR A;  3EW5 A;  3EKE A;  2BO9 A;  5F09 A;  1YLO A;  3CPA A;  2GLF A;  2Q43 A;  2O53 A;  1LOK A;  3SI1 A;  3IEH A;  1CPX A;  1YME A;  2FXK A;  5HVG A;  1F57 A;  3WC7 A;  1UWY A;  3PRT A;  4P4J A;  3NH4 A;  5CB5 A;  3WAB A;  5JM6 A;  2PRQ A;  3KR5 A;  4GUA A;  1LFW A;  3KZW A;  3SIG A;  4TNU A;  4X8I A;  3PFO A;  4UIA A;  3JZT A;  1LCP A;  3FEE A;  5AIL A;  2AFU A;  3FED A;  1ZR3 A;  4GM5 A;  3HUV A;  4ZY0 A;  2PJ0 A;  3V45 A;  3RZA A;  3S9N A;  3S9M A;  1Y7E A;  4ZI6 A;  3D7H A;  3ISZ A;  4MCQ A;  4ABL A;  5FSY A;  5JH9 A;  1BLL E;  4YWY A;  2AFX A;  4K3N A;  4P4B A;  4R7M A;  3B35 A;  4P4D A;  4F9U A;  4D86 A;  2PJ1 A;  4JLL A;  4JVV A;  1ZG9 A;  4ESS A;  3WC6 A;  5CMS A;  2QJ8 A;  3B7I A;  4JYW A;  2ZEF A;  2ZOG A;  2IQ6 A;  4DYO A;  2XD7 A;  4FBE A;  4A39 A;  4YU9 A;  5LYD A;  1YD9 A;  5LRG A;  5I4M A;  3PFE A;  2ZOF A;  1TKJ A;  2RFH A;  4A94 A;  3CDX A;  4Z65 A;  3DLJ A;  3ISX A;  3VH9 A;  4WJB A;  4NGP A;  2PJ9 A;  4EME A;  3RAM A;  4UEE A;  5DUS A;  3NH8 A;  5FSU A;  1NJR A;  2BCO A;  4OME A;  5ELY A;  4EWT A;  2FVG A;  3IIB A;  1TKF A;  2BFR A;  4NJQ A;  3GB0 A;  2CTC A;  1XRY A;  1XFO A;  2AFM A;  3Q6Z A;  2DEA A;  5CB3 A;  2XEG A;  3D7D A;  1DE4 C;  4ZYQ A;  4MHZ A;  4UEZ A;  4NGR A;  2CF4 A;  2OR4 A;  3WC5 A;  2AFW A;  3NH5 A;  3LMS A;  3B3S A;  3IID A;  2WYR A;  1VHU A;  4IQY A;  4KSI A;  4J5S A;  4MRI A;  4GVW A;  1Z8L A;  3D7F A;  1R43 A;  3MRU A;  4G1P A;  2BFQ A;  2VRI A;  1TY8 A;  1HEE A;  3GLJ A;  3BI1 A;  3CPX A;  2PJC A;  2NYQ A;  3GUX A;  1HJZ A;  1VGY A;  4JZ0 A;  3SJF A;  5K8O A;  2EWB A;  3JRU A;  3FF3 A;  3SJX A;  1Q7L A;  4P4F A;  1ZG8 A;  2C6P A;  4IAV A;  4ZX9 A;  2PIY A;  3BI0 A;  3K2K A;  4J5R A;  1PCA A;  4FWU A;  1TXZ A;  2C6G A;  2PJ6 A;  2XEJ A;  4H2K A;  3GPG A;  2ZEM A;  1FNO A;  1LAN A;  3BHX A;  2AFS A;  4ABK A;  1VHO A;  3KQZ A;  4MCR A;  3N5F A;  2ZEN A;  2HB6 A;  2JBJ A;  5HVH A;  3IO1 A;  1BPN A;  2F8H A;  3PBE A;  2ZEE A;  2V8V A;  6CPA A;  5E3B A;  3TC8 A;  4NJR A;  1CP6 A;  4P4E A;  3KI9 A;  1Z2L A;  1F2P A;  4J4Z A;  2PVV A;  3B3V A;  4MXU A;  3CT9 A;  2O4H A;  3GPQ A;  4IK2 A;  4NGN A;  7CPA A;  4X3R A;  3QNV A;  4NGS A;  2QVP A;  3T8W A;  2PJ8 A;  3PB8 X;  3GQO A;  3V2B A;  4OID A;  3VAT A;  3SI0 A;  3RBU A;  4UML A;  3HLP A;  4OC1 A;  1PYT B;  4MHN A;  4ZY2 A;  1CX8 A;  2QYV A;  5K8M A;  5LYL A;  2V8H A;  3FVL A;  4AXV A;  4ETJ A;  2CIJ A;  3KHZ A;  3IIF A;  2I3C A;  3B3C A;  2C1C A;  5LYI A;  1CBX A;  4MMO A;  3VFQ A;  5LRJ A;  3EJF A;  1H8L A;  4JCA A;  2GLJ A;  2DX6 A;  3FH4 A;  2POK A;  4TWE A;  2ZEG A;  4ZX8 A;  4R8F A;  2LGR A;  3PB4 X;  2WZN A;  4A37 A;  2V77 A;  4OC2 A;  1ARM A;  5HXD A;  4P10 A;  4OP4 A;  4OKO A;  1HDU A;  4PXC A;  1GYT A;  2ACF A;  2Q51 A;  4OIW A;  4NFR A;  4PXB A;  1VIX A;  4P4I A;  2ANP A;  2EEE A;  4OC4 A;  4KYB A;  2VL1 A;  4TU0 A;  2OOT A;  1AYE A;  1ARL A;  3S9L A;  2L8R A;  3SIH A;  2PJ5 A;  4A38 A;  1LAP A;  5HOL A;  2ABZ A;  3I1U A;  2ZEH A;  5CPA A;  4PPZ A;  2PJ7 A;  4NGM A;  2ZEP A;  4F8Z A;  4GVV A;  1Y0Y A;  2ZEO A;  4MCS A;  1M4L A;  3SJE A;  2XEI A;  3H8G A;  1Z5R A;  4CPA A;  1CP7 A;  4J5Q A;  3WT4 A;  1FT7 A;  1IGB A; 
#chains in the Genus database with same CATH topology
 3D67 A;  2Z3P A;  3R9E A;  4IHM A;  1EE3 P;  4MHD A;  4B6Z A;  2B3U A;  4MBU A;  5D8N A;  5J1Q A;  4UFX A;  1BPM A;  5KTA A;  1QSM A;  5K8P A;  1QSO A;  4DUK A;  3KHX A;  4CGL A;  2AFC A;  4X2T A;  2RB7 A;  4MHY A;  1KWM A;  2PDO A;  3TFY A;  4CRY B;  2R1I A;  3DNS A;  2J8N A;  4K30 A;  4NF1 A;  5AG6 A;  3EWR A;  3SII A;  2HUZ A;  4P44 A;  4ZY1 A;  1YW6 A;  4I49 A;  2XEF A;  1TKH A;  1IOF A;  2GIV A;  4A33 A;  4PK3 A;  1IYL A;  2R98 A;  3D7G A;  4PXD A;  2NSM A;  2PJA A;  2ZPA A;  1XEB A;  4CYN A;  4JGK A;  1BO4 A;  4JD6 A;  5FSZ A;  5G20 A;  4FAI A;  5G21 A;  2Z3L A;  2HC9 A;  2PCU A;  1TXR A;  3DSB A;  1L0C A;  3FB3 A;  4C7H A;  4KOS A;  3EY5 A;  3R9F A;  2DF5 A;  3B3T A;  1ZG7 A;  4AG9 A;  5DS0 A;  2YNC A;  3TT2 A;  3T90 A;  2HV2 A;  4UCP A;  3EC4 A;  5BWA B;  3BJ8 A;  3LD2 A;  4UFV A;  4R76 A;  4KOU A;  2Q4Z A;  2B5G B;  2YGW A;  4R3L A;  1IOI A;  5JQ4 A;  3FMC A;  3KKW A;  3NFZ A;  3D2P A;  4CAX A;  2JEW A;  5LRK A;  4ONW A;  5E96 A;  3ETI A;  3FNC A;  1ELL P;  4OLL A;  1VKC A;  1ZR5 A;  1ZLH A;  5FSV A;  1U6M A;  3EWQ A;  4UEF A;  2PIZ A;  3B2Y A;  2VXK A;  3LWU A;  4O23 A;  4LQG A;  4YGO A;  3VWD A;  2X47 A;  1M4G A;  4PXE A;  4R6T A;  3RO0 A;  2V8G A;  1PUA A;  3QB8 A;  4B13 A;  1HDQ A;  4FUU A;  2PSW A;  4DJL A;  2Z3K A;  4OC5 A;  3NE8 A;  4C2Y A;  2EK8 A;  3GQE A;  4A2Z A;  4UWJ A;  2FAV A;  3BXM A;  4CS0 B;  4LQ6 A;  5CBM A;  2CNT A;  4QC6 A;  4UIB A;  2CTB A;  3R95 A;  3TO6 A;  2FT0 A;  2OZU A;  3PB9 X;  3FEC A;  3TCV A;  2JBK A;  2RNK A;  2H5M A;  5F49 A;  4MFJ A;  3TE4 A;  1FY7 A;  4MFL A;  2PJB A;  2V8D A;  3B3W A;  4HPS A;  4KSF A;  2Q0Y A;  4W9Y A;  1F2O A;  4UWI A;  4H6Z A;  1QSN A;  1XIX A;  4GXH A;  3G8W A;  1VHS A;  1ZLI A;  5JPH A;  5LYF A;  3EWO A;  3KR4 A;  4NGT A;  4RUH A;  4YFJ A;  3NA6 A;  5HMN A;  3S6G A;  1LRZ A;  3D4U A;  1TF9 A;  3D68 A;  1VHE A;  4BD9 A;  3SI2 A;  3D8P A;  5HIH A;  2GAN A;  3FXT A;  2IJZ A;  1QMU A;  1RTQ A;  1JQG A;  4KOX A;  2C27 A;  3KL9 A;  2PJ3 A;  2CY2 A;  5K8N A;  3DR6 A;  3I9S A;  4C68 A;  1SPV A;  4AB7 A;  4NSQ A;  4U5Y A;  1ELM P;  2C6C A;  3DGV A;  4AG7 A;  1A2Z A;  1IY7 A;  1S7L A;  4UF4 A;  2EBJ A;  1IU8 A;  2BOA A;  2FE7 A;  2FL4 A;  4WWV A;  4R87 A;  3EJG A;  1S3Z A;  3K9T A;  3H8F A;  3V38 A;  1NSA A;  1XBU A;  4MFZ A;  5HVF A;  1CM0 A;  2GU2 A;  4F0X A;  1CG2 A;  3RNZ A;  5JGF A;  1B87 A;  4OAD A;  1IB1 E;  5FSX A;  3Q71 A;  4JJX A;  4JLY A;  5EC4 A;  4EFD A;  1YSJ A;  1TF8 A;  1YVK A;  2OB0 A;  3PEI A;  2DXQ A;  1IYK A;  1RO5 A;  1RXT A;  1S7N A;  4M85 A;  4UCN A;  2G3A A;  5IB9 A;  1DTD A;  2PC1 A;  3KQX A;  2J8R A;  2ODF A;  2FG1 A;  2PE3 A;  5F48 A;  4MFK A;  2AFZ A;  3TX8 A;  1ZO0 A;  3PB6 X;  1YW4 A;  3IWW A;  4PV6 A;  2ZW5 A;  4OC0 A;  2J9A A;  1XMB A;  2I79 A;  4ETK A;  2R7H A;  4OC3 A;  4MHP A;  3R96 A;  1LAM A;  3IGR A;  3PBB A;  4F6A A;  4RN7 A;  3F0A A;  2AFO A;  3PB7 X;  4CGO A;  3MN8 A;  1YRE A;  4A32 A;  3CZX A;  3KAS A;  3SIJ A;  3ZZI A;  5J8C A;  1R57 A;  1TIQ A;  3FJU A;  4K0C A;  4PQA A;  4XPD C;  3L2N A;  3VAR A;  3CXS A;  4P6Y A;  3GPO A;  4M3S A;  5D29 A;  4F9V A;  3KGQ A;  4M6I A;  5AG5 A;  4YRH A;  1XJO A;  1Y0R A;  5FVJ A;  3SXO A;  4CGP A;  5KTD A;  3D66 A;  2G9D A;  4XNH B;  3IJ3 A;  3IC1 A;  4MCP A;  3R1K A;  2PJ2 A;  1BAV A;  1AMP A;  4KVM E;  1Z8T A;  2FXF A;  4P45 A;  1CPS A;  1YQE A;  1PU9 A;  1V0C A;  5EMI A;  5THW A;  3W6S A;  4CAV A;  3JUW A;  1QQ9 A;  4CYQ A;  2P6E A;  5C88 A;  2F7V A;  1MJ9 A;  3H8E A;  3JVN A;  2DPS A;  3FX6 A;  4AVB A;  4AVA A;  2IMO A;  2B4B A;  4Q7A A;  3EWP A;  4RI1 A;  1B6B A;  5IX3 A;  2X7B A;  2Q4V A;  2GRE A;  4AVC A;  3F8K A;  4B14 A;  4KUB A;  8CPA A;  2EK9 A;  3BJ7 A;  4CRZ B;  2Q04 A;  4R3K A;  1S5K A;  2PVW A;  3WR7 A;  2PJ4 A;  2ZEL A;  4CGN A;  1R3N A;  4NGQ A;  2ZED A;  3V7Z A;  3SJG A;  3IFE A;  1OBR A;  3EW5 A;  3EKE A;  2BO9 A;  5F09 A;  1YLO A;  1KUY A;  3CPA A;  2GLF A;  4B5P B;  4NCZ A;  4CAE A;  1X12 A;  3S6H A;  2Q43 A;  2O53 A;  1LOK A;  2HQY A;  3DDD A;  1M4D A;  1CPX A;  1YME A;  3G3S A;  3IEH A;  3SI1 A;  2FXK A;  4J3G A;  5HVG A;  1X10 A;  1F57 A;  1N71 A;  2Q7B A;  3WC7 A;  1UWY A;  2A4N A;  2KCW A;  3PRT A;  4P4J A;  3NH4 A;  5CB5 A;  2EUI A;  4C7I A;  3PP9 A;  3WAB A;  5JM6 A;  2PRQ A;  3TOB A;  3KR5 A;  2Z0Z A;  4GUA A;  1LFW A;  3KZW A;  3SIG A;  1YR0 A;  4IUS A;  4TNU A;  3FYN A;  4X8I A;  4HNX B;  3PFO A;  4PSW A;  4UIA A;  2CNM A;  3JZT A;  5DWN A;  5H86 A;  4XPL A;  4Y49 B;  4U9Z A;  4RS2 A;  1LCP A;  2VZY A;  3FEE A;  5G1Z A;  3T9Y A;  5AIL A;  2AFU A;  3FED A;  4OAE A;  1ZR3 A;  4GM5 A;  4B5O A;  3HUV A;  1KUX A;  2Z10 A;  4A31 A;  5A27 A;  4ZY0 A;  4FD4 A;  2PJ0 A;  3V45 A;  2OU2 A;  3RZA A;  2F5I A;  4JXQ A;  3S9M A;  2AJ6 A;  1Y7E A;  4ZI6 A;  2ATR A;  3D7H A;  3S9N A;  3ISZ A;  4MCQ A;  4ABL A;  3TO7 A;  5FSY A;  2FS5 A;  2WPX A;  5AG7 A;  2Q7S A;  5JH9 A;  1BLL E;  4YWY A;  2AFX A;  2RC4 A;  4K3N A;  1Y7R A;  3EXN A;  2W2G A;  4FD7 A;  4P4B A;  4R7M A;  1IIC A;  3B35 A;  5AG4 A;  3VWE A;  1MJA A;  5H84 A;  4P4D A;  4F9U A;  4D86 A;  2PJ1 A;  4JLL A;  4MI4 A;  1Q2C A;  4Q38 A;  4JVV A;  1ZG9 A;  4U9Y A;  4UCM A;  2Y0M A;  4ZBG A;  4B5P A;  4KSA A;  1AUG A;  2YND A;  4KVO E;  1JWQ A;  1NE9 A;  4XPD B;  1GHE A;  2EO8 A;  4ESS A;  3SXN A;  1Z8W A;  5CMS A;  3MGD A;  4KOR A;  3WC6 A;  2PR1 A;  2QJ8 A;  4QUS A;  3B7I A;  3F5B A;  3DR8 A;  4JYW A;  2ZEF A;  2ZOG A;  1M44 A;  2IQ6 A;  2VEZ A;  2VBQ A;  4DYO A;  2XD7 A;  3A9L A;  4CYO A;  3K9U A;  1CJW A;  2Q44 A;  2VQY A;  4A39 A;  4FBE A;  4YU9 A;  3E0K A;  3FIX A;  5LYD A;  3W91 A;  1YD9 A;  2CXA A;  2REE A;  5LRG A;  1P0H A;  3W6X A;  5I4M A;  3OWC A;  3PFE A;  1MK4 A;  2FCK A;  3V8I A;  2ZOF A;  4EVY A;  1TKJ A;  2BL1 A;  1Y9W A;  2PR8 A;  2GFQ A;  2RFH A;  4A94 A;  5J8F A;  4A30 A;  4L89 A;  3CDX A;  4Z65 A;  3DLJ A;  3ISX A;  3VH9 A;  4XNH C;  4WJB A;  4NGP A;  3IU2 A;  4KOT A;  2PJ9 A;  4EME A;  3RAM A;  4UEE A;  5DUS A;  3NH8 A;  5FSU A;  2WUU A;  1I21 A;  2G0B A;  1NJR A;  2BCO A;  4OME A;  5ELY A;  3UY5 A;  1YGH A;  1J4J A;  1Y9K A;  4R57 A;  4EWT A;  5IV0 A;  1Z9U A;  1S60 A;  2FVG A;  3IIB A;  1TKF A;  3C26 A;  2BFR A;  3P2F A;  4JWP A;  3JTK A;  4NJQ A;  2BSW A;  1ON0 A;  3GB0 A;  4MFP A;  4BBH A;  2ZW7 A;  4IF5 A;  4KS9 A;  2CTC A;  5AGE A;  4MY3 A;  1XRY A;  4F0Y A;  2OH1 A;  2R8V A;  1XFO A;  2O28 A;  4JXR A;  2WPW A;  3CXQ A;  1XF8 A;  2AFM A;  3Q6Z A;  4NEX A;  2DEA A;  3B8G A;  5CB3 A;  3ZJ0 A;  3R9G A;  1XE4 A;  2FSR A;  2XEG A;  3D7D A;  1Z4R A;  1DE4 C;  2P6F A;  4KOV A;  4ZYQ A;  3IWG A;  4MHZ A;  4NGR A;  4UEZ A;  2CF4 A;  2OR4 A;  2REF A;  4A95 A;  3WC5 A;  2AFW A;  3NH5 A;  3PZJ A;  4DNC A;  3LMS A;  3B3S A;  1NSL A;  2EVN A;  3IID A;  2WYR A;  1VHU A;  4IQY A;  1IID A;  1S7K A;  4J5S A;  4KSI A;  4HNY B;  2WSA A;  3NE7 A;  4MRI A;  2B3V A;  1XMT A;  4QBJ A;  3TTH A;  4GVW A;  3CXP A;  1Z8L A;  2NMT A;  1R43 A;  1Z8X A;  2JDC A;  2Z3O A;  2ZXV A;  3D7F A;  3MRU A;  2BFQ A;  2VRI A;  1YLE A;  2VI7 A;  4G1P A;  4II9 A;  1TY8 A;  2JDD A;  1HEE A;  3S6F A;  3GLJ A;  1I1D A;  3BI1 A;  3CPX A;  2PJC A;  4KOW A;  1YK3 A;  2NYQ A;  2JZF A;  3GUX A;  4B10 A;  4CAW A;  2YNC C;  4H89 A;  1HJZ A;  1I12 A;  1VGY A;  2D4O A;  4JZ0 A;  3SJF A;  5K8O A;  2EWB A;  3JRU A;  1NMT A;  3FF3 A;  3H4Q A;  4Y49 C;  3SJX A;  1Q7L A;  4P4F A;  5DWM A;  1ZG8 A;  1Q2D A;  1WK4 A;  2C6P A;  4IAV A;  4ZX9 A;  1M4I A;  4CGM A;  1Q2Y A;  2OZH A;  2PIY A;  4KOY A;  3BI0 A;  3K2K A;  4GS4 A;  1OZP A;  4J5R A;  4E2A A;  1PCA A;  4FWU A;  1TXZ A;  2C6G A;  2PJ6 A;  2XEJ A;  4H2K A;  2OZG A;  3GPG A;  2ZEM A;  1FNO A;  1LAN A;  5ISV A;  3BHX A;  4PK2 A;  3BLN A;  1S7F A;  4L8A A;  2AFS A;  1WWZ A;  4ABK A;  1VHO A;  3KQZ A;  4MCR A;  2BUE A;  3N5F A;  2ZEN A;  1SQH A;  4ZGY B;  4KLW A;  4KLV A;  2HB6 A;  4UFW A;  2JBJ A;  5EBV A;  4ORF A;  2ZW6 A;  4XPK A;  3SHP A;  5HVH A;  4HKF A;  4E0A A;  3IO1 A;  1BPN A;  2F8H A;  3PBE A;  4H6U A;  2ZEE A;  4E8O A;  2V8V A;  4FD5 A;  1UFH A;  6CPA A;  5E3B A;  4M6H A;  1P4N A;  1YX0 A;  4LX9 A;  1CP6 A;  2QML A;  4MJ8 A;  3KI9 A;  4NJR A;  4ONU A;  4P4E A;  1Z2L A;  2B4D B;  3GY9 A;  1F2P A;  4J4Z A;  2PVV A;  3B3V A;  2P6G A;  4MXU A;  5C82 A;  3CT9 A;  4C2X A;  2O4H A;  3GPQ A;  4IK2 A;  4NGN A;  1QST A;  3S6K A;  7CPA A;  4X3R A;  3QNV A;  4NGS A;  4M6G A;  2QVP A;  2J8M A;  3T8W A;  3TC8 A;  2PJ8 A;  3PB8 X;  3GQO A;  3V2B A;  4OID A;  3EO4 A;  3N7Z A;  3IU1 A;  3VAT A;  1KZF A;  4BMH A;  1Z4E A;  3D3S A;  3FRM A;  3SI0 A;  3RBU A;  5F46 A;  4UML A;  4QVT A;  2Z3N A;  3TO9 A;  2WCT A;  3HLP A;  4KVX A;  3H5Z A;  4OC1 A;  1PYT B;  4PSX A;  4B11 A;  4MHN A;  4ZY2 A;  1CX8 A;  2QYV A;  5K8M A;  4KZT A;  3I3G A;  2Z3M A;  2V8H A;  2AE6 A;  2QEC A;  3FVL A;  4C2Z A;  5LYL A;  2JZE A;  4AXV A;  4ETJ A;  2CIJ A;  3KHZ A;  3IIF A;  3LOD A;  4FD6 A;  3EFA A;  2I3C A;  3B3C A;  2JEV A;  2C1C A;  2IL4 A;  5LYI A;  5GCN A;  1CBX A;  4MMO A;  4CYP A;  3VFQ A;  5LRJ A;  3EJF A;  1H8L A;  4JCA A;  2GLJ A;  2DX6 A;  4HNW B;  4KUA A;  3FH4 A;  2POK A;  4UBR A;  4TWE A;  4X5K A;  2ZEG A;  5KTC A;  2FIA A;  4ZX8 A;  3D2M A;  2G3T A;  4R8F A;  2LGR A;  3PB4 X;  2CNS A;  2K5T A;  2WZN A;  4A37 A;  2V77 A;  3QAH A;  2Q4Y A;  2B58 A;  2PQ8 A;  1ARM A;  4OC2 A;  5HXD A;  4P10 A;  4Q36 A;  4OP4 A;  4OKO A;  2KQV A;  1HDU A;  5A28 A;  1KUV A;  3P2H A;  4PXC A;  5HH1 A;  3TOA A;  4MY0 A;  2D4P A;  1GYT A;  2ZW4 A;  3GYA A;  2ACF A;  2Q51 A;  4OIW A;  3FBU A;  1XOV A;  4LUA A;  4NFR A;  1MJB A;  4PXB A;  1VIX A;  2PRB A;  4P4I A;  2ANP A;  1K4J A;  2EEE A;  5IB0 A;  2I00 A;  4OC4 A;  4KYB A;  2VL1 A;  4TU0 A;  2ARH A;  3PGP A;  4R9M A;  1AYE A;  1ARL A;  2BEI A;  2OOT A;  5I0C A;  2L8R A;  4B12 A;  3SIH A;  3RYO A;  3S9L A;  2GE3 A;  2PJ5 A;  4A38 A;  3QAY A;  1LAP A;  5HOL A;  2ABZ A;  3GKR A;  3I1U A;  3GIU A;  5F47 A;  2FIW A;  4MFQ A;  2YNE A;  2ZEH A;  2Z11 A;  5G22 A;  5CPA A;  4PPZ A;  3LAC A;  2PJ7 A;  4NGM A;  2JLM A;  2QIR A;  2ZEP A;  4UA3 A;  5CNP A;  4GVV A;  1YVO A;  4CAF A;  2VZZ A;  4F8Z A;  2DPT A;  1BOB A;  1Y0Y A;  2JZD A;  2ZEO A;  1M4L A;  4MCS A;  3SJE A;  2B5G A;  2XEI A;  3H8G A;  1Z5R A;  4CPA A;  1CP7 A;  3IWE A;  4J5Q A;  3WT4 A;  2B4D A;  4NXY A;  1QSR A;  4BIN A;  2P0W A;  4QB9 A;  1FT7 A;  1IGB A;  1M1D A; 
#chains in the Genus database with same CATH homology
 3D67 A;  4IHM A;  1EE3 P;  4B6Z A;  5D8N A;  1BPM A;  5K8P A;  4DUK A;  3KHX A;  2AFC A;  4X2T A;  2RB7 A;  4MHY A;  1KWM A;  3EWR A;  3SII A;  4P44 A;  4ZY1 A;  1YW6 A;  2XEF A;  1TKH A;  3D7G A;  4PXD A;  2NSM A;  2PJA A;  4FAI A;  4JGK A;  5FSZ A;  2HC9 A;  2PCU A;  1TXR A;  3B3T A;  1ZG7 A;  5DS0 A;  4R76 A;  2Q4Z A;  3FMC A;  3NFZ A;  2JEW A;  5LRK A;  4ONW A;  3ETI A;  1ELL P;  1ZR5 A;  1ZLH A;  5FSV A;  3EWQ A;  4UEF A;  2PIZ A;  3B2Y A;  3LWU A;  4O23 A;  4LQG A;  2X47 A;  4PXE A;  4R6T A;  2V8G A;  1HDQ A;  4FUU A;  4DJL A;  4OC5 A;  2EK8 A;  3GQE A;  2FAV A;  3BXM A;  5CBM A;  4UIB A;  2CTB A;  3PB9 X;  3FEC A;  2JBK A;  5J1Q A;  2PJB A;  2V8D A;  3B3W A;  4W9Y A;  1F2O A;  1ZLI A;  5LYF A;  3EWO A;  3KR4 A;  4NGT A;  4RUH A;  3NA6 A;  3D4U A;  1TF9 A;  3D68 A;  1VHE A;  4BD9 A;  3SI2 A;  5HIH A;  2IJZ A;  1QMU A;  1RTQ A;  1JQG A;  3KL9 A;  2PJ3 A;  5K8N A;  1SPV A;  1ELM P;  2C6C A;  3DGV A;  1IY7 A;  4UF4 A;  2BOA A;  4WWV A;  3EJG A;  3K9T A;  3H8F A;  3V38 A;  1NSA A;  1XBU A;  5HVF A;  2GU2 A;  1CG2 A;  5JGF A;  5FSX A;  3Q71 A;  4EFD A;  1YSJ A;  1TF8 A;  3PEI A;  5IB9 A;  1DTD A;  3KQX A;  2PE3 A;  3TX8 A;  2FG1 A;  2AFZ A;  3PB6 X;  1YW4 A;  3IWW A;  4OC0 A;  2J9A A;  1XMB A;  4ETK A;  4OC3 A;  4MHP A;  1LAM A;  3PBB A;  2AFO A;  3PB7 X;  3MN8 A;  3KAS A;  3SIJ A;  3FJU A;  4K0C A;  4PQA A;  3L2N A;  3VAR A;  4P6Y A;  3GPO A;  5D29 A;  4F9V A;  3KGQ A;  1XJO A;  1Y0R A;  3D66 A;  2G9D A;  3IJ3 A;  3IC1 A;  4MCP A;  2PJ2 A;  1BAV A;  1AMP A;  4P45 A;  1CPS A;  5THW A;  1QQ9 A;  2F7V A;  3H8E A;  3FX6 A;  2IMO A;  4Q7A A;  3EWP A;  2GRE A;  8CPA A;  2EK9 A;  2PVW A;  2PJ4 A;  2ZEL A;  1R3N A;  4NGQ A;  2ZED A;  3V7Z A;  3SJG A;  3IFE A;  1OBR A;  3EW5 A;  3EKE A;  2BO9 A;  5F09 A;  1YLO A;  3CPA A;  2GLF A;  2Q43 A;  2O53 A;  1LOK A;  3SI1 A;  3IEH A;  1CPX A;  1YME A;  2FXK A;  5HVG A;  1F57 A;  3WC7 A;  1UWY A;  3PRT A;  4P4J A;  3NH4 A;  5CB5 A;  3WAB A;  5JM6 A;  2PRQ A;  3KR5 A;  4GUA A;  1LFW A;  3KZW A;  3SIG A;  4TNU A;  4X8I A;  3PFO A;  4UIA A;  3JZT A;  1LCP A;  3FEE A;  5AIL A;  2AFU A;  3FED A;  1ZR3 A;  4GM5 A;  3HUV A;  4ZY0 A;  2PJ0 A;  3V45 A;  3RZA A;  3S9N A;  3S9M A;  1Y7E A;  4ZI6 A;  3D7H A;  3ISZ A;  4MCQ A;  4ABL A;  5FSY A;  5JH9 A;  1BLL E;  4YWY A;  2AFX A;  4K3N A;  4P4B A;  4R7M A;  3B35 A;  4P4D A;  4F9U A;  4D86 A;  2PJ1 A;  4JLL A;  4JVV A;  1ZG9 A;  4ESS A;  3WC6 A;  5CMS A;  2QJ8 A;  3B7I A;  4JYW A;  2ZEF A;  2ZOG A;  2IQ6 A;  4DYO A;  2XD7 A;  4FBE A;  4A39 A;  4YU9 A;  5LYD A;  1YD9 A;  5LRG A;  5I4M A;  3PFE A;  2ZOF A;  1TKJ A;  2RFH A;  4A94 A;  3CDX A;  4Z65 A;  3DLJ A;  3ISX A;  3VH9 A;  4WJB A;  4NGP A;  2PJ9 A;  4EME A;  3RAM A;  4UEE A;  5DUS A;  3NH8 A;  5FSU A;  1NJR A;  2BCO A;  4OME A;  5ELY A;  4EWT A;  2FVG A;  3IIB A;  1TKF A;  2BFR A;  4NJQ A;  3GB0 A;  2CTC A;  1XRY A;  1XFO A;  2AFM A;  3Q6Z A;  2DEA A;  5CB3 A;  2XEG A;  3D7D A;  1DE4 C;  4ZYQ A;  4MHZ A;  4UEZ A;  4NGR A;  2CF4 A;  2OR4 A;  3WC5 A;  2AFW A;  3NH5 A;  3LMS A;  3B3S A;  3IID A;  2WYR A;  1VHU A;  4IQY A;  4KSI A;  4J5S A;  4MRI A;  4GVW A;  1Z8L A;  3D7F A;  1R43 A;  3MRU A;  4G1P A;  2BFQ A;  2VRI A;  1TY8 A;  1HEE A;  3GLJ A;  3BI1 A;  3CPX A;  2PJC A;  2NYQ A;  3GUX A;  1HJZ A;  1VGY A;  4JZ0 A;  3SJF A;  5K8O A;  2EWB A;  3JRU A;  3FF3 A;  3SJX A;  1Q7L A;  4P4F A;  1ZG8 A;  2C6P A;  4IAV A;  4ZX9 A;  2PIY A;  3BI0 A;  3K2K A;  4J5R A;  1PCA A;  4FWU A;  1TXZ A;  2C6G A;  2PJ6 A;  2XEJ A;  4H2K A;  3GPG A;  2ZEM A;  1FNO A;  1LAN A;  3BHX A;  2AFS A;  4ABK A;  1VHO A;  3KQZ A;  4MCR A;  3N5F A;  2ZEN A;  2HB6 A;  2JBJ A;  5HVH A;  3IO1 A;  1BPN A;  2F8H A;  3PBE A;  2ZEE A;  2V8V A;  6CPA A;  5E3B A;  3TC8 A;  4NJR A;  1CP6 A;  4P4E A;  3KI9 A;  1Z2L A;  1F2P A;  4J4Z A;  2PVV A;  3B3V A;  4MXU A;  3CT9 A;  2O4H A;  3GPQ A;  4IK2 A;  4NGN A;  7CPA A;  4X3R A;  3QNV A;  4NGS A;  2QVP A;  3T8W A;  2PJ8 A;  3PB8 X;  3GQO A;  3V2B A;  4OID A;  3VAT A;  3SI0 A;  3RBU A;  4UML A;  3HLP A;  4OC1 A;  1PYT B;  4MHN A;  4ZY2 A;  1CX8 A;  2QYV A;  5K8M A;  5LYL A;  2V8H A;  3FVL A;  4AXV A;  4ETJ A;  2CIJ A;  3KHZ A;  3IIF A;  2I3C A;  3B3C A;  2C1C A;  5LYI A;  1CBX A;  4MMO A;  3VFQ A;  5LRJ A;  3EJF A;  1H8L A;  4JCA A;  2GLJ A;  2DX6 A;  3FH4 A;  2POK A;  4TWE A;  2ZEG A;  4ZX8 A;  4R8F A;  2LGR A;  3PB4 X;  2WZN A;  4A37 A;  2V77 A;  4OC2 A;  1ARM A;  5HXD A;  4P10 A;  4OP4 A;  4OKO A;  1HDU A;  4PXC A;  1GYT A;  2ACF A;  2Q51 A;  4OIW A;  4NFR A;  4PXB A;  1VIX A;  4P4I A;  2ANP A;  2EEE A;  4OC4 A;  4KYB A;  2VL1 A;  4TU0 A;  2OOT A;  1AYE A;  1ARL A;  3S9L A;  2L8R A;  3SIH A;  2PJ5 A;  4A38 A;  1LAP A;  5HOL A;  2ABZ A;  3I1U A;  2ZEH A;  5CPA A;  4PPZ A;  2PJ7 A;  4NGM A;  2ZEP A;  4F8Z A;  4GVV A;  1Y0Y A;  2ZEO A;  4MCS A;  1M4L A;  3SJE A;  2XEI A;  3H8G A;  1Z5R A;  4CPA A;  1CP7 A;  4J5Q A;  3WT4 A;  1FT7 A;  1IGB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...