3JSAA

Homoserine dehydrogenase from thermoplasma volcanium complexed with nad
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
325
structure length
321
Chain Sequence
b'MKTINLSIFGLGNVGLNLLRIIRSFNEENRLGLKFNVVFVADSLHSYYNERIDIGKVISYKEKGSLDSLEYESISASEALARDFDIVVDATPASADGKKELAFYKETFENGKDVVTANKSGLANFWPEIMEYARSNNRRIRYEATVAGGVPLFSFIDYSVLPSRIKKFRGIVSLTINYFIRELANKREFDDVLSEATKLGIVNYKDDLTGLDAARKSVILCNHLYGSSYRLSDVFYEGILDRSFGKNERLVTETGIVNGKPSAESRIKSLDSNDYLLTLGKGSLGYQLQTDTNGTLNVSDLYDGPYETAGAVMNDLVILSM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Homoserine dehydrogenase
publication title X-ray crystal structure of Homoserine dehydrogenase from Thermoplasma volcanium
rcsb
source organism Thermoplasma volcanium
molecule tags Oxidoreductase
total genus 109
structure length 321
sequence length 325
ec nomenclature
pdb deposition date 2009-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00742 Homoserine_dh Homoserine dehydrogenase
A PF03447 NAD_binding_3 Homoserine dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 3jsaA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3jsaA01
3QWBA 3ZV4A 1LRKA 1ULSA 2Y0EA 2Y1OA 2VHYA 4DQUA 4PLTA 3MJCA 2GN8A 2P9GA 2Q50A 5AXCA 4KWHA 4UVEA 4KP7A 2BF7A 2DM6A 4IZHA 1UXIA 1XLTA 4Y98A 2NVUA 3VH3A 2NLOA 5KJFA 1CQIA 4OGWA 3BIOA 2NTNA 3JD2A 9LDTA 1ENZA 1SC6A 2NU7A 1L7EA 1PJTA 2OHXA 3VDQA 3VH1A 3OJEA 4UUMA 1ZXLA 5KVSA 5JAQA 1N8KA 1T25A 3BTSA 1RM3A 1BHSA 3D3WA 4WUVA 2Q1SA 5KWEA 3GUCA 3OQ6A 4PZEA 4EEZA 3AWDA 4YCAA 5C7OO 5AOVA 1LSSA 2OP1A 4OXYA 4ALIA 4GGPA 1DJNA 1ZSVA 4LSMA 1FDTA 4C7KA 3DZJA 1Y8RB 3IAHA 2IODA 5A04A 2QIOA 4WLVA 4Q3DA 1C0LA 4Q3AA 2PZJA 3KYDA 1ZK0A 3L4BA 2Y67A 3C1OA 1K0UA 5C7IO 5CDSA 4ZQBA 2IZZA 1LRLA 2FMUA 3UOGA 4CV2A 1UXHA 1FK8A 3U5TA 2P5YA 3DC2A 3GOHA 2NACA 2Q4BA 3CMMA 2HMWA 4PG5A 4IJKA 1T2CA 3VAZA 1L1FA 2WM3A 4ZJUA 3GMDA 2EEZA 3L6EA 5TX7A 3GEGA 1FDUA 2X23A 3LT0A 4W4TA 3FWNA 4DRYA 5G0TA 1LLDA 3KOUA 3DHEA 4AJOA 2JFHA 1Q0QA 5B4UA 5ITWA 1U3WA 3DDNA 3WICA 2RAFA 1B8UA 5IZCA 3C7DB 1KVTA 4XB2A 4CV0A 4DC1A 2VT3A 3Q2KA 3QRWA 4CV3A 5I7VA 4WLEA 5GY7A 5TF4A 3OQBA 3JV7A 2VZ8A 3RUFA 4RVHA 3RUHA 2ZCUA 2NQ8A 4ZVVA 2OBNA 3OA0A 2HMSA 4CLDA 2W2LD 4DMLA 1U5CA 4LRTB 2VUUA 4XZ3A 1G0NA 1YGYA 2DTEA 3CPSA 4O59O 1PJSA 3AU9A 3VOSA 1N7HA 3D64A 4IY1A 4BO3A 3GFGA 5IXYA 2GNAA 1C1XB 2O23A 3I9NA 3LDHA 2UUOA 4LW8A 2JD2A 1ZEMA 4E5PA 1U3VA 2YV3A 1YS4A 1EK6A 2WD7A 4IQGA 4IDBA 3KV3O 1TVEA 1X7GA 2CY0A 3H3FA 1DHRA 2Y05A 3GRPA 3VPFA 3QHAA 5EPOA 5JDCA 4BNIA 4B3IA 4YRBA 4EUFA 3S1LA 4B4VA 1TEHA 3GDFA 1NPDA 4QO8A 3LC2O 2Q49A 3TJRA 4PCVA 1HE4A 3S2FA 1K6JA 3RUCA 3VZQA 3WQQA 4EUEA 4PLCA 1W6UA 3L9XA 3FF4A 3RJ9A 1U9JA 1KEUA 2PKRA 4M1QA 3QVOA 2HRBA 4GI2A 3WLFA 2CVZA 3P19A 5EJ2A 4H3VA 1YH3A 4E33A 3X2FA 4UVGA 3WGGA 4ONEA 1B15A 5ENDA 4P8RA 2VYNA 4NQZA 2XOXA 1I3NA 3K5PA 3VTFA 4RO0A 1H2BA 1OFGA 4WK6A 2X5OA 4U7WA 4CUZA 1PJQA 4U6QA 4BNLA 1LQTA 1DOHA 4YJHA 4TRJA 1WP4A 5AXAA 1VRWA 3PI7A 2WMDA 2OFPA 4UVHA 3V1YA 3BTUA 4K1LA 3O9ZA 1VC2A 2V7PA 1ZMTA 1K3TA 1XQ1A 4L73A 5IN5A 2VUTA 1I32A 3JQ6A 1JN0A 1U7TA 5F5NA 3DOOA 4I8XA 3HZZA 3IDSA 1I0ZA 3DBHA 3Q9NA 3DBHB 1R15A 1IULA 4GX1A 4BMSA 1I3MA 5LDGA 4YT4A 2IXBA 4JX8A 4HFJA 3ZWBA 5B12A 1D8AA 3V1TC 3JQGA 4GMGA 4DGSA 1XQ6A 3BMQB 3QVTA 4LRSB 1TT7A 4A26A 1M76A 2NNLD 4TKLA 3GA0A 3A9WA 3GNQA 1ADGA 1GZ6A 4E5KA 3WS7A 3EVTA 1ISMA 4KUGA 3NJ4A 3AFMA 1ZSNA 4BNTA 1ML3A 1KERA 1KY5A 1QR6A 2Q99A 4XYMA 5DP2A 3E18A 1BG6A 1NQTA 2Y0DA 2FN7A 4TRMA 3INGA 5JPIA 1V3VA 3TSCA 3WGTA 4A73A 2EW2A 3EZLA 1MA0A 2GN6A 3E6AA 2YW9A 5JCXA 1W73A 3VPXA 3O8QA 1ZZEA 3O8QB 3JQFC 1LC0A 2BKAA 3HDHA 3UH1A 4IM7A 4DYVA 3IC5A 2AA3A 1LLQA 4Z6KA 3U09A 3I3OA 1WW8A 2PR2A 3IP1A 4I9UA 1KETA 1X14A 3PP8A 4CLOB 3AW9A 2BFOA 3KSUA 3B6ZA 1HEUA 4BVAA 3KTDA 1NAIA 5FI3A 3I4CA 1SEVA 3SLGA 4WLNA 4FFNA 3TN7A 1ISIA 3JQ7B 5THKA 3QV1A 3H5AA 1U1IA 2PK3A 1T4BA 1R0LA 2AQIA 4HX5A 5JXWA 4W6ZA 4KOAA 4EJMA 1NXQA 4D0SA 4IDAA 1R37A 4R3WA 3L07A 2P5UA 1BDBA 4YQYA 4CMEC 1C3VA 1SB9A 1YOVA 3RC9A 1YOVB 3CZMA 1AUPA 4Z0HO 1GL3A 1I2ZA 4IPTA 2PWZA 1EZ4A 4G2NA 1SZJG 2YZ7A 3GHHA 3PHIA 4OL9A 2X58A 4DQXA 3WNQA 4WCFA 4WCFB 3C1AA 2PKQO 4D3FA 1PJ3A 2CZCA 4BNMA 4YXFA 1ZK4A 3KRTA 1B8VA 4FFMA 3L4BC 4BIIA 3NX4A 3O26A 2B5WA 3QA9A 2B83A 5A9RA 5CFZA 4NPCA 3NTRA 5IJZA 1F17A 2D0IA 4CL3A 1SNYA 2P4HX 3CUKA 4JIGA 4BUCA 1JAYA 1O89A 1JKJA 1NHGA 4II3A 1U4OA 2CUKA 4E0BA 1GCOA 2VCYA 4FQ8A 5JCJD 3JQ9A 3ENKA 1LX6A 1AN9A 4UVDA 4RGBA 3PGJA 4FFLA 4GX2A 4TSKA 1UAGA 1GCUA 5ES3A 3BXXA 3JYNA 3DMTA 4FOOA 5L3ZA 2VWPA 4IMPA 1CYDA 4DPLA 1J6UA 2WE7A 3D0OA 4D46A 4MP3A 1U3TA 2BLLA 2YDYA 4XQGA 1PGNA 3KLPX 3TL3A 4F6CA 4YRAA 2Y68A 2Q45A 1QXSA 1TB4A 3RUDA 4F3YA 4NHEA 2QRLA 1BVUA 1NYTA 4O6VA 3QW2A 2LDXA 3AFNA 5FI5A 4YJFA 4YJFB 2E82A 1VSVA 5AYVA 1PJ2A 1YB4A 2CDAA 1NBOA 4ALLA 2YHUA 1LUAA 2UV8A 5CP8A 1H2HA 4CLEA 2YHIB 4BNGA 3L4SO 1Z75A 5I9LA 1C0IA 4BOYA 4BL5A 1E1KA 3JYQA 4GGOA 1JU9A 5KKCA 1B8PA 3DOJA 5COBA 1ZCJA 3VTZA 3DWFA 3I5MA 3EAGA 3ZWNA 5CAEA 2PGLA 4RPHA 1R4NA 2BFAA 3HG7A 3OICA 4OM8A 3BMNA 5A1TA 3VDRA 1R0SA 4JNKA 1E1MA 5G0SA 3RROA 3LLVA 3GEMA 1KC1A 3VPSA 3E5MA 1J49A 4UUOA 1GU7A 5CEEA 5T8KA 3A06A 3CZRA 2EERA 1E6WA 3HDQA 1V3TA 1VL0A 4N5NA 4P4GA 5FF9A 3TOZA 1PJCA 4D42A 5L4NA 4HNGA 4CR7A 1LDMA 4A2CA 3QVSA 1IPEA 1LC3A 4ALKA 4JBHA 1NQ5A 3ZN2A 4AJ1A 4LVCA 4FPXA 5JY1A 2D1YA 5A9TA 1XDWA 3RFTA 5BR7A 3OJFA 5TSDA 5FWNA 3DMYA 5HS6A 1I2BA 2R6JA 1U7HA 3OQ1A 1YDWA 3ZWPA 4A10A 4J7CA 4JQCA 3UHAA 3IL2A 4I1IA 2GUGA 2EKQA 3IJPA 2ZJ0A 3K6JA 1FXSA 4FFOA 5BSGA 4N5MA 4BO0A 1FDVA 5GZ3A 5JMPA 4XDYA 2OZPA 1R66A 4XGKA 2I3GA 4J1NA 4GL4A 5HRUA 5K6AA 1JVSA 1M6WA 3KYCA 4CJXA 4XQCA 3TZKA 3SVTA 4CM3A 1DFIA 3WGYA 2F00A 1KIFA 1BWSA 3DHNA 2PZKA 1D7OA 3F5SA 3GUYA 3LT2A 3PJEA 4IUYA 3RKRA 3QWHA 5F1PA 1NR1A 2P68A 5THQA 5DP1A 2HO5A 3D4NA 5CG2A 3GGGA 1IYZA 4R1SA 4BGVA 1K6IA 3PLRA 2GGSA 3V8BA 3PJDA 1PS8A 2ZQYA 3U9LA 4I5DA 4K26A 4W7HA 1NWHA 4LSWA 2FPGA 5COQA 4L4SA 1SPXA 4ND4A 2O2SA 3VH4A 1WDMA 1YE3A 3H9GA 1U8FO 1E3IA 3V2HA 9LDBA 4E5NA 5JSFA 1L7DA 4B4OA 4CMJA 4MPDA 4QUKA 1WMAA 3R1IA 3NT4A 3HQ4O 4KUEA 1DDOA 5TNXA 4GAEA 5KOIA 1GADO 1PSDA 5KJEA 4ZGWA 3MOIA 5IDQA 1YXMA 4J43A 5JFOA 3LVFO 2QW8A 1W4ZA 4IJWA 4C7JA 4JBIA 2W4QA 3OSUA 3I6IA 4JJGA 1NASA 3GGPA 1GQ2A 4WOJA 2E37A 2CSUA 3DZHA 5EERA 2JCXA 2BGKA 2QYTA 4M89A 4YB8A 4R5MA 4Y9DA 1S7CA 1Z6ZA 1P0FA 3C7CB 1HE5A 2FR8A 1IUKA 3PZBA 3D4PA 3NRCA 4BQRA 1F8GA 2FY8A 3H5RA 4XWYA 4BNJA 4BB6A 5BNIA 4GKVA 1A9YA 3WYCA 3A4VA 3BHMA 1EVYA 1D3AA 1PZHA 1QORA 1TT5B 1PQUA 2EP7A 4DBVO 2WYVA 3OIGA 4DBZA 5C5IA 1Q7CA 5JAIA 3A28A 1HF3A 2B0JA 3PDUA 2BI8A 1P45A 1MC4A 3LC1O 1V9LA 2D3TA 2NU8A 4FC6A 1M75A 4ZA2A 2D5CA 2GLXA 3OF2A 3H2SA 3KXDA 5HS4A 2X0NA 2JAHA 1ORRA 2F1KA 4R4JA 4D7AA 1W8DA 3HNPA 2J8ZA 1P3DA 2FZEA 2Y99A 1KEWA 5C3MA 1SAYA 2X0IA 4J16A 2A94A 4WOKA 4HP8A 3RC1A 1E6EA 2DUUA 3R0IA 3ZNQA 2O3TA 4XRGA 4TQGA 2DBRA 1UXGA 2JJYA 1DB3A 3UFXA 1VE9A 4AVYA 3BA1A 4FFPA 4NG5A 5JE8A 4MIEA 4F46A 5L51A 4Y6RA 4DWVA 2AE1A 1DIRA 3DMTC 1QYXA 1JLLA 3TQHA 3H8VA 4G65A 1GYRA 4XJTA 3V2GA 2HAEA 2VHXA 5HBRA 3H65A 1BXGA 3OEWA 3L0DA 2P9CA 3NJ8A 3OEYA 1KVQA 2C2XA 3ZV3A 4TROA 2Y66A 5F21A 1ZNQO 2DQ4A 4E2XA 3RFVA 1RWBA 3UCXA 3G1TA 4R9RA 4CM4B 3K2EA 1DRWA 4AJJA 2IRWA 3BTOA 2ZTLA 2G5CA 1M6HA 3MEQA 4J7XA 1RM5A 3ZV5A 3GHYA 2ZYDA 1N9GA 1PGQA 4CLRB 3ASVA 4JJIA 1QSGA 3OFSA 1R4MA 1R4MB 5CPBA 2EKLA 1DFGA 3FSRA 4FW8A 5TQVA 4AICA 5L7YA 4F45A 4J91A 4FJ1A 1KEVA 4DXHA 3FTNA 3DBRB 4D45A 3P2YA 4ALNA 4UVIA 3OA2A 4AJKA 5B37A 1I30A 3DZBA 2PGJA 4NZ9A 2PFGA 3F46A 3QIVA 2EXXA 5J9GA 2QQ5A 3HB5X 4IIVA 1IPFA 4BNZA 1I3LA 4OSPA 2J5QA 4LMRA 3FNEA 3WGOA 4K28A 2VT2A 3AOEA 5MGBA 1B14A 5L45A 4NBUA 3CE6A 5T8KC 1BDMA 1VL8A 1Y8QA 2EHDA 5L7TA 1LDEA 4L8VA 3W8FA 6LDHA 1DAPA 2ZTVA 4BV9A 2RHCA 1CWUA 3ENNA 4RF2A 2TMDA 3WBFA 3AI3A 1IHYA 2E6UX 1LDBA 1T1SA 1HYGA 1O95A 3Q3CA 4FR5A 5TLSA 2Z1NA 2Y93A 1OOEA 3KBOA 3PJFA 4EDFA 1T2AA 2VWHA 3ANNA 3PRJA 4NI5A 3W6UA 2X5JO 3AI2A 3JSAA 4S3MA 1QYDA 4MVJP 5JYEA 4OMUA 3OBBA 2PZMA 3ICCA 5K6AC 2VQ3A 2Y0CA 1MXHA 1GYPA 2P91A 1P33A 1MV8A 3MJTA 4NBTA 3SXPA 3QVWA 2D59A 3DBVO 2YV2A 5JYAA 1UXKA 1YL5A 4Z9FA 4MVJA 4YT2A 4ZHSA 4O5OA 3W8EA 4E30A 3GZ4A 3WIEA 1PJBA 4W82A 2DVMA 1DHTA 4I5EA 4ID9A 3GMSA 1PGOA 5CDYA 4GWKA 4JN6B 3JQAA 3JQAB 4Q3NA 2VYVA 4R3NA 1UH5A 5L40A 4R5HA 3EVNA 2QG4A 4A03A 3RC2A 3WGIA 3GR6A 4XKJA 3F3SA 3I9MA 4NBWA 4J1TA 4X54A 1IE3A 1Q7GA 3EC7A 1CIVA 2RIRA 4MVJE 3H5NA 4G5HA 3TNLA 3PXXA 3TOXA 4RL6A 3NGXA 2A4KA 4NU5A 1M2WA 3EZYA 3HJAA 3TFOA 2X5KO 3ZGYA 1Y8RA 1ZXBA 2HU2A 4PLFA 4PZDA 1E6UA 1E7YA 2HMVA 3WWYA 4PVDA 2JKVA 4MP6A 3UICA 4BO5A 4A5OA 1I2CA 5COAA 4MIYA 4ROSA 4C4OA 2G0TA 3U4IA 4TKMA 4FCCA 3FD8A 3BYZA 4R1NA 5IFLA 1LI4A 3PWSA 3EYWA 4J49A 1BGVA 4BMNA 4EGFA 3JD4A 4IDDA 2FPPA 4EBFA 3OJOA 5M6DA 2VYND 1YDEA 1NFRA 4Y8VA 1PU2A 1YJQA 3LT1A 3ZWXA 4BNNA 4AJIA 2NTVA 4YYZA 4H16A 1NTOA 3QY9A 1KBZA 1UP7A 2EV9A 5ADHA 1PR3A 4QSMA 4BB5A 4QX6A 3RWBA 4J4BA 4S1VA 4CMCA 1I3KA 3PVZA 1ZK1A 3Q0EA 1JDJA 4I9HA 3JQEA 2CMDA 1PGPA 3HDJA 2FZWA 5I7EA 1Q1NA 1QMGA 5AXBA 3KZVA 1PIWA 4J0EA 3NGLA 3HHPA 1DIGA 3N7UA 4OHUA 1WPQA 2ILTA 4BV8A 4D41A 5JW6A 2IE0A 1TXGA 4WEOA 2DTXA 2GRAA 1WAMA 3G0OA 3JQ8B 2QX7A 5JLAA 1MG5A 1KY4A 2Q1TA 3WG9A 1FJHA 5IZ4A 5KTKA 3OMLA 4PLYA 1NFQA 1C1XA 1NVGA 2JAPA 3ZWVA 2DAPA 4BS9A 3I9JA 5I7FA 4OJNA 1PJ4A 3GRKA 4BO7A 4D3DA 3UVEA 3PQDA 3FN4A 1PTJA 3OP4A 3U0BA 4YR9A 1M67A 1D1SA 1DRUA 1PS9A 2ZYGA 4E31A 1OC4A 4XX0A 4CM9A 2EG9A 4YWJA 2HJSA 3COSA 1JQBA 3DO5A 5DN9A 2G76A 1U3UA 2HKIA 4IJVA 1EFLA 2LDBA 3DTTA 3AJRA 3TZHA 4E2YA 1U2DA 1UDAA 3ZU4A 1UJMA 2ZTUA 3ETEA 1HZJA 1YJ8A 3DZKA 2JHGA 3SJUA 4R51A 2FR0A 4M54A 4XJSA 1U28A 3AU8A 1FDWA 4IDGA 4MDHA 5J23A 1SMKA 3M1LA 1RKXA 4YAIA 5DT9A 4F6LA 4CLHA 3WOHA 3F9IA 3L6DA 5JDIC 2X0JA 5HA5A 5CPFA 4BMVA 3MOGA 2JL1A 4BNVA 1MXFA 3I1JA 3DOCA 3H9QA 3I6QA 3IJRA 4YRDA 2PD6A 5DOVA 4MVJH 4N54A 3ZHXA 1EDZA 4KQXA 2WWRA 1VJTA 2BHLA 2FSVA 2OORA 2AE2A 1S6YA 4LGVA 4PLWA 2C59A 2X0RA 4HXYA 3IKVA 4TWRA 2OBYA 3PWZA 1BSVA 1EVJA 1MX3A 2EW8A 2R2GA 3UW3A 3FBTA 1IL0A 1O6ZA 1AHHA 2G17A 1HT0A 2R00A 3RU9A 4XCVA 2PH3A 3GG9A 1E7SA 3Q11A 3W4JA 1B7GO 1N7GA 1DLJA 4MVJG 2A35A 2ET6A 2VRCA 3AUSA 3HFGA 3HE3A 4DLLA 3GDGA 1P9LA 4NR0A 4MVJF 1ZK3A 3BMQA 3TFQA 4OQZA 4BNHA 5KVCA 1N92A 4Q39A 5CEFA 3A14A 4O0LA 1XIVA 2PNFA 1O9BA 1X1TA 4NFHA 5AVOA 3GZNA 3GZNB 2POQX 5BSHA 1P74A 4HFRA 2PTGA 5I9MA 2V6FA 2OMEA 4PN3A 4R69A 3IP3A 4G81A 3ONDA 3RUAA 4A7PA 3DBLB 5HWSA 3TPCA 5IXSA 2I76A 4FN4A 1ZFNA 1U2GA 2WE8A 3GFBA 2JFGA 4DIBA 1G1AA 4OKNA 4XDZA 2NV6A 4Y6SA 2UYYA 3FCOA 3M2PA 4XA8A 1HRDA 1KVSA 3PK0A 4AJPA 5G0UA 4KQWA 4DL9A 2OXIA 4LVUA 4J4TA 2C29D 2GN4A 4CLOA 3AUTA 3JD1A 1ADBA 2DC1A 1E1NA 1ENPA 3GAZA 4WLFA 3RASA 4BKOA 2GN9A 4L0QA 2AEFA 2CDCA 4OSOA 3WBBA 3I9KA 2I99A 1I10A 1E3SA 3FR7A 4YA6A 5FYDA 3VKUA 3JQ7A 4Z0TA 5ILGA 3DL2A 3D5TA 1F0YA 2EF1A 3ADOA 3T7EA 1GPDG 2JD0A 5ER6A 2X1HA 5T73A 1U4SA 3M2TA 4Q3EA 1SCUA 1PZFA 1H6CA 3VC7A 3KM0A 4CMBA 5ITVA 3EHEA 1T24A 1DAOA 3RD5A 1ONNA 1UP6A 1UZNA 1SBYA 4J3FA 3F47A 4UREA 3GVHA 3KETA 2B5VA 3MJEA 3WTCA 5HTOA 4MINA 5DOZA 4MJLA 4EUHA 3ITKA 3AM5A 1E5QA 4R01A 1Q2XA 1UP4A 2OGUA 4AG3A 3QVXA 2C5AA 4HFMA 4CMGA 1LLCA 1VSUA 2UDPA 3BAZA 4DUPA 3U4DA 3FR8A 4PVCA 4RDIA 3PQFA 1YBMA 3B1KA 3H2ZA 3WGHA 1GEEA 3AM3A 2VN8A 4LCEA 5TIIA 4YAGA 5JS6A 2QRJA 2W8ZA 1EQ2A 3WJAA 1F8FA 4ND5A 4YPOA 3RSHA 3KSZO 2VWQA 3F1KA 2O3JA 2GCGA 4RZHA 3UUWA 5CDGA 2WJPA 3W8DA 4IDFA 5BQFA 4HFNA 2VUSA 4RF4A 3ZNPA 1WNTA 4NIMA 1PZGA 5CHEA 1EQUA 4IXTA 1PL6A 3H9EO 4IZIA 5IDYA 1EBFA 4U5QA 4B79A 1SEPA 4PLZA 4U0JA 2YDXA 4CQLB 2PA3A 1ZH8A 4N5LA 3NT2A 1PWZA 5DBIA 4Q3CA 5IZCC 1OAAA 4GLOA 3G79A 1PJLA 1OI7A 4BNKA 1ZUD1 3H3JA 1KS9A 5DCYA 2HK8A 3A1NA 7ADHA 4I08A 3HN2A 4E32A 1E1LA 3GPIA 5BT9A 3Q2IA 4BO6A 1ZSYA 2DTDA 3PQEA 3CIFA 3WTBA 3RCBA 2E49A 1E3WB 2BMAA 1EDOA 2YHIA 4ZQGA 3V2UA 1HDZA 3E82A 1ISGA 2NU6A 4RVDA 4CR6A 3NAQA 5JYDA 2VRBA 3I83A 2I65A 2VWGA 4YEDA 1Y5RA 1HTBA 3QJ5A 2J5KA 5JDCC 4NJOA 4RPJA 4HUJA 4RPKA 4EEXA 4IIUA 1ISJA 4XR4A 3ADPA 1ID1A 2AHRA 4RF5A 1EE2A 4P4LA 1T4DA 3ZZNA 3PDJA 4UAGA 1ZEJA 4PRLA 3UF0A 3GH3A 1HDXA 3FNFA 1FF9A 1MFZA 2OP0A 4ZD6A 1F12A 2PGDA 1U8XX 1CJCA 4MVJI 4IMRA 2HRZA 4IS2A 1GZ4A 1T2EA 2Y1DA 1QV7A 1PQWA 3ZWOA 1PEDA 2DU8A 1EVIA 2RH4A 4IBOA 4TMFA 1JTVA 1P44A 2J6IA 2H5LA 4YACA 1WXDA 1XWFA 3FNHA 4YT5A 1TLTA 1XU9A 1NM5A 4INAA 4D44A 4PRKA 1Q0LA 2YYYA 2E48A 5L95A 4QT0A 1VM6A 2ZKLA 2VHWA 3CINA 3N74A 4FDAA 5EINA 4RF3A 3ABIA 3STHA 5L53A 3X2EA 5JCJA 4UEOA 1J0XO 3G3EA 1GTMA 4AJ2A 5TRTA 4PG6A 3GGOA 1BW9A 3OJ0A 1BW9B 2NU9A 4O1MA 3U4HA 1YRLA 3PHHA 4CL8A 3SEFA 4J0FA 1Z73A 1LA2A 4ZICA 2JFFA 2NM0A 4KDFA 1CRWG 3BZUA 4N18A 1EFKA 2VTEA 2VZ0A 3AI1A 3QSGA 1LSUA 1NQAO 2Z5LA 3GVXA 3DAPA 1IB6A 5G0VA 1DC6A 2GF2A 1GY8A 4ZQHA 1PQPA 5TS3A 3I4FA 3WNVA 1GR0A 3RBVA 1SOWA 2VOJA 3O03A 3UKOA 4YAJA 4CQMD 4GX5A 3DFZA 4PG4A 1GV0A 1QP8A 1PL8A 2O4CA 2O7QA 4CM6A 3GNSA 2HLPA 1VKOA 3GQVA 2P9EA 3OIFA 3ZU2A 3WQRA 3GAFA 2GZ3A 3ORFA 5TC4A 3WYBA 1Y7TA 4W99A 3QLJA 1BMDA 1NQOA 1RYDA 4XIYA 1JWBB 4OIMA 3WQSB 2C7VA 1E5LA 4PG7A 1E7RA 2O48X 1Y6JA 1T26A 3JYPA 4R1TA 4E6PA 2WD8A 4EYEA 2I6TA 4CM5A 5F1KA 2A9FA 3HDYA 4DYDA 4JJFA 2ZATA 1OZAA 4B4WA 3ANLA 1NP3A 4OXKA 4RJTA 1GDHA 3G17A 1A7AA 1F14A 1PZEA 2O3RA 3ETDA 4I9NA 4FFRA 3RUIA 4B7UA 5I9NA 5I8WA 3PYMA 1RJWA 2A92A 1TT5A 1YO6A 1G6KA 2VTDA 1GV1A 4YJGB 2AEJA 3KSDO 4UUPA 3KEQA 1DC4A 4NFYA 4DLBA 5JBIA 2CFCA 1DFHA 1Y9EA 3BHJA 4MKXA 2BFMA 4HBGA 3FBGA 4ILKA 4AJNA 2BRUA 4NU6A 5TGDA 6ADHA 1NFFA 1A4UA 4L9RA 4JK3A 1E7QA 1MLDA 2E4AA 1D4FA 4WCFC 2EGHA 1CEQA 2OUIA 4QECA 3GY0A 1Q0HA 3NDIA 3VKVA 4TZKA 4GVXA 1Y9AA 4RPGA 4JBGA 4LISA 4RVUA 2BGLA 4NBVA 1EUZA 1DSSG 3K9QO 3VVCA 3PHJA 2AW5A 3MJ4A 5FFFA 1ZJYA 3ZNOA 2YY7A 5A9SB 1O5IA 1EVZA 4DQVA 1X7HA 1Z7BA 1P1IA 1FDSA 2HQ1A 4CMHA 1BTOA 2FWMX 2FSSA 3JQ9C 4Z9XA 3GT0A 4FC7A 4KDEA 1GEGA 3V5NA 1LU9A 4DLAA 5A5FA 2GZ1A 4J1QA 2YQ5A 5IF3A 3GPDG 3C24A 4WJZA 4E5YA 1AE1A 3AUAA 3QWFA 3VH2A 4OOFA 4B8ZA 5CEJA 1RM4A 1JAXA 2XXBA 4XGIA 4D43A 3WR5A 2GZ2A 4E5MA 3D3EA 2C2YA 5KCZA 4JGBA 2EIHA 3WXBA 5IAAA 3C3XA 1Z7EA 3WDSA 3L77A 4CM4A 4CQMB 1Y1PA 3BHIA 2D2IA 2QZ9A 4IDEA 3LZ6A 4OKIA 1HWYA 1WWKA 2WDZA 4PLHA 1YONA 1QRRA 4BQPA 3TL2A 4CLRA 3PTZA 2G82A 4IDCA 4AFNA 4CMIB 4RZIA 1VKNA 1QYWA 3KUXA 3ETGA 4OQYA 4CR8A 1GUYA 3H9UA 3ZWWA 2VYVD 1B3BA 4FIZA 2ZQZA 3PFFA 3DBRA 3HWRA 1HZZA 4NFSA 2FR1A 3ZWMA 2C07A 1HE3A 3SBOA 4BGEA 1LRJA 3UCFA 3OHSX 5B4TA 3BMOB 1B16A 3K92A 1I36A 1T2DA 4TRNA 3TRIA 2JD1A 5ILOA 2C20A 1XKQA 2X86A 2HJRA 4ZN6A 3ONFA 1IOLA 1QG6A 5F3RA 5HM8A 2OL4A 2ZTMA 5IG2A 1NVMB 3PYXA 2Q4EA 3ZI0A 3DZFA 1YL7A 3GN2A 1ARZA 5EESA 4M86A 2ZB3A 4QEDA 1SO8A 4Q3BA 3AM4A 4FS3A 4BO4A 5CDUA 3F1LA 3IOYA 3VPHA 1DIHA 2GSDA 1OC2A 4IS3A 5T6BA 1P31A 2SCUA 1D1TA 2Q1WA 1HYHA 4CM8B 1R6DA 4Z9YA 2ZYAA 3GC6A 1V35A 4OXNA 4CMKA 1WMBA 1HDGO 2B4QA 1QYVA 5KVVA 1HKUA 1H6BA 1LJ8A 2Z95A 3AOGA 3PIIA 2PV7A 2Y1CA 4J9VA 4UUNA 4J7UA 4Q9NA 3EUWA 5L9AA 1C1DB 3VHRA 4OH1A 4FBGA 2V65A 1NVTA 1A4IA 5G4KB 5EL0A 4DIOA 2WTBA 1E7MA 1TA4A 3U4CA 4CLXA 2BFPA 5I8ZA 5CDTA 1LNQA 1GFSA 4R68A 4OYRA 3INRA 1H6DA 3LC7O 2CF6A 1Z45A 3ICPA 4U6SA 5DDIP 4NJMB 4BNXA 4ZRNA 4Y67A 4RORA 4AJEA 2X7HA 1BXZA 4IXWA 3C7AA 2VHVA 4A27A 4YDRA 3JQFA 4TVBA 2H63A 4CUJA 1HSOA 4YAKA 3K2BA 4FOSA 2YJZA 5F1OA 3CH6A 2DLDA 3UCEA 1NPYA 4M55A 4R54A 3HUDA 2FRDA 1NHWA 4BO9A 2NUAA 1GPJA 2DBQA 4JP3A 1T1RA 3JCZA 1KVUA 2PY6A 4P38A 1NR7A 4CM9D 2NVUB 2VHZA 2D4AA 3ZHBA 4Z3DA 3CTMA 5IDXA 4NMHA 2DUWA 3WSWA 4KMSA 5A02A 2IZ1A 1H0KA 3EY4A 3VZRA 3I9OA 4XQEA 1UDBA 3LK7A 2O2YA 4CMEA 2B4TO 2DBVO 3ANMA 3ZWCA 1B2LA 5JYFA 3D3WB 4RQUA 4L74A 4BNUA 1YQGA 4GPD1 4WEQA 4D3SA 1P1RA 4K6CA 5JC1A 4XYBA 4J6FA 3ASUA 3PJGA 1ZJZA 1WZIA 1ENOA 1XU7A 3ONEA 4M8SA 3WGZA 3DONA 1LEHA 1X1EA 2UVDA 3WB9A 1A71A 3DXFA 4QQRA 1X0VA 1MUUA 4BKUA 1VJ1A 1E92A 3KYDB 1M66A 4UEJA 3GVIA 5KNLA 4XIJA 4L4RA 4E2WA 4XYLA 3TDKA 1A27A 3WIDA 1JVBA 1QV6A 3C85A 1IHXA 1UUFA 2FPIA 1RPNA 4DIFA 2UUPA 3IS3A 4IQ0A 3BMCA 3KEOA 3BMCB 4PLPA 4GSLA 1B0AA 1NWCA 2NVBA 2W2KA 2W2KB 1HDRA 1YQXA 2VRCD 5L4LA 1X13A 3JQ8A 3KB6A 3KYBA 2AQ8A 4B3JA 5TJHA 1NAHA 4RLSA 4JXKA 3K31A 2GD1O 5A4DA 1I8TA 4KWIA 2DFVA 2I67A 5C7LO 2ZK7A 1IZ9A 2UAGA 1YL6A 2RBEA 3FI9A 1WVGA 2BH9A 1P1HA 4B8WA 4XEHA 1WZEA 3LT4A 2I5PO 4TRRA 2XPCA 4M87A 1DXYA 4AJHA 3NTQA 3CXRA 4PZCA 3PEFA 4RLHA 3ZWYA 1P77A 3D7LA 1UZMA 4IGEA 1CERA 2WD7B 3TF5A 3E8XA 3Q9UA 3CKYA 5DZSA 2CDBA 5U1PA 4BGIA 4KTTE 3KLMX 3NDRA 3WFIA 1DEHA 4GWGA 3ST7A 5K0ZA 5JAZA 3QQPA 2D8AA 4PLVA 5JAMA 5L7WA 2O3SA 2X22A 3LU1A 4R9SA 3S2IA 3ULKA 4M49A 3W1VA 5EMHA 5KVQA 3AY6A 3EGOA 4ITUA 4DA9A 2HCTA 2AQHA 1GD1O 4U8GA 3FPLA 4RV9A 1O8CA 4XD2A 1MP0A 2HDHA 4NK4A 2V6MA 3S2EA 4DMMA 4RVFA 4Z3KA 3HSKA 1R0KA 2VNSA 1PGJA 4DTIA 2FHSA 5ICMA 3K73O 2DT5A 3KO8A 1QLHA 5GZ1A 1DJQA 3T4EA 4HY3A 2QZZA 3NKLA 1UXJA 1K89A 3S55A 1ADCA 2RHRA 4IQ8A 2HUNA 3N58A 3PHLA 3DB2A 2X8LA 3GVCA 3IMFA 3ROKA 1CQJA 4E3ZA 4CODB 4YJHB 5IN4A 3NTOA 3LSYA 3AOEC 4XR9A 2AMFA 3AY7A 3ZHYA 5JO0A 3MTGA 2P4QA 1LDGA 3OM9A 2GDZA 3H6KA 4N7RA 3GNTA 3ROPA 3GG2A 4YQZA 4K9DA 2X9GA 3R3JA 4L76A 1ZBQA 4QFCA 3H7AA 1LDNA 2TMGA 1XGKA 4NDNE 1PS0A 2W2LA 4W9NA 4J9UE 1G0OA 3TZ6A 4TVOA 5H83A 1DLIA 1ZO8A 1XHLA 2CVQA 2YV1A 3DBLA 4H15A 3WGQA 1KC3A 3W4KA 1GYQA 5LDHA 3O4RA 1N5DA 2EP5A 1GQQA 1ZMOA 3JQGB 4ESOA 1A5ZA 1RM0A 2O3QA 2Y1GA 1O0SA 3NV9A 3ZV6A 3GDOA 2ZB4A 3T7CA 1WLYA 2HSDA 2B4RO 4W7IA 3TWOA 3I9LA 1R12A 3NUGA 1GUFA 1V8BA 4MP8A 2PH5A 2BELA 2Y1EA 3RC7A 3PYLA 1EK5A 2EWMA 5C37A 1I01A 3RVDA 2QYSA 5A05A 3AY3A 1QLJA 3D4OA 1EE9A 4XYGA 1ZIDA 1DRVA 1VLLA 5LC1A 1HDYA 2HK9A 2HK7A 4MKRA 2HMUA 1IY8A 3JQBA 5DCUA 2EKPA 4KTVE 1K6XA 2DPGA 4D79A 2BI7A 3DTYA 8ADHA 2XF8A 5G4LA 1E7WA 3PFWO 3DZGA 5JNLA 2WYWA 2V6GA 4NBRA 1J5PA 4WLOA 2Y1FA 4FD3A 4R41A 3M1AA 1VL6A 4FJ0A 1DC3A 3RFXA 3TZCA 4MKZA 3KVOA 3AK4A 2C54A 2PZLA 4EZBA 2H9IA 4GBJA 3DEYX 4URFA 3EK2A 4ND1A 5H82A 1MFPA 4BKRA 5FEUA 5TT1A 2G1UA 4ND3A 2IYOA 4RPLA 3TZQA 2B36A 4P22A 1X15A 2Q46A 2NADA 2GO1A 2VZ9A 3ZNNA 1HXHA 2OO5A 3VZPA 3RU7A 1C14A 4PGFA 5F5LA 1V3UA 3MWDB 4MOWA 3DR3A 1SOVA 3RKUA 3UGKA 3GEDA 4J90A 3B20A 3E1KA 4BHTA 2J3IA 5BNTA 4GLLA 3GK3A 3ZCXA 3F4LA 3E5RA 4RVGA 2JCYA 3JTMA 1Y81A 3E9NA 2IYPA 1DPGA 3K30A 3PGXA 1DIAA 3ZWAA 4K6FA 2IDZA 2FP4A 4BO8A 3QP9A 1A9ZA 3Q1LA 4DPMA 4CQLA 4WCDA 1LQUA 3CMCO 3RBZA 5G2OA 4TZTA 3G49A 4ALJA 3RBXA 4BKQA 1HDCA 1HSZA 4PLGA 5LCXA 4J2HA 1HDOA 4R16A 4LK3A 1A72A 1YBAA 2DPHA 3RJ5A 3I52A 1Z74A 2ZB8A 3ZW8A 2RH8A 1EBUA 1XYGA 1ONPA 4E12A 2Z1MA 4FGSA 2PLAA 1GUZA 5B1YA 3LF2A 1E3WA 2J3JA 3T4XA 5DCWA 1P1JA 5ICSA 4ND2A 1UR5A 4WLUA 4XYEA 3RAJA 1LSOA 3B1FA 3JD3A 3PIDA 3GLQA 3C1TA 1RYEA 2AEMA 5IDWA 4I5GA 4JCOA 2NVWA 3CSDA 1H9AA 3WJ7A 5CG1A 3ZH2A 1YBVA 1MC5A 1XR3A 2J5RA 2YQ4A 3D5QA 2EJWA 3HB4X 2C5EA 4MIOA 3UN1A 3ITDA 4IINA 1CDOA 4IGFA 1EEHA 4JROA 3I23A 4RCVA 4XB1A 2I3AA 3HFSA 1LLUA 4QO7A 2D5AA 2CD9A 4A0SA 2CNBA 1R16A 2W90A 4ALMA 2OOSA 3PPIA 4WGGA 1R4NB 4EJ6A 5A5EA 3NDJA 5T67A 3B1JA 3BMNB 4XGNA 3V1UA 2C7GA 3DHYA 1HYEA 4GSKA 3UAGA 3LLSA 3Q6IA 4ZQFA 2GPTA 1YB5A 4DC0A 4MVJM 1XA0A 2AG5A 1PX0A 1LTHR 1W0CA 1QKIA 1IZ0A 4BNFA 1XELA 1XG5A 4L75A 1HE2A 2Q2QA 4J4HA 4O63O 1C0KA 1JKFA 3NYWA 3WSVA 3P7MA 1ULUA 1E3JA 2Q3EA 3VZSA 1DBVO 1JKIA 1GAEO 2C0CA 4NK5A 4BNYA 3SJ7A 3JQDA 4LN1A 1N1EA 4B7XA 3E9QA 2IXAA 5A06A 3O38A 1X0XA 3SC6A 4E21A 3U3XA 3B70A 1MB4A 5L4SA 1SB8A 2YFHA 2B35A 5I7SA 2R00C 4GVLA 5A3VA 4Z0PA 3NEPX 1ISFA 4L4XA 5T5QA 3SX2A 4QTZA 3RIHA 1T2FA 4U0KA 3SLKA 2I66A 5JY6A 1F06A 2EGGA 5JMWA 3QWIA 2X4GA 2Q1UA 4YJDA 4RDHA 3IIEA 2AXQA 3KYCB 3MJSA 5G0WA 4GKBA 4B4UA 3OJLA 2YUTA 3ROMA 4MO2A 1Y5MA 4BO2A 4DPKA 1VI2A 1YVEI 1J4AA 3JD0A 4NNJA 1E3LA 1YQDA 1AXEA 2ZCVA 3DQPA 2PD4A 4RVSA 1E0DA 3P2OA 5U4QA 2HMTA 2GASA 2PD3A 2Q2VA 4W9NC 1N1GA 3DAFA 1H94A 3M6IA 4WE3A 1KYQA 5AXDA 4PFJA 3HN7A 1CF2O 1FMCA 4WKGA 3ROQA 4WNIA 5KJ6A 4GQAA 4HWKA 3VVBA 5JC8A 5KJ1A 2P2SA 1LSJA 3LQFA 1JWAB 2WSBA 3PHGA 2PKQP 1MG0A 3F4BA 4FGWA 2X9NA 4JLWA 1O94A 4FSHA 2X6TA 4OOEA 3FPCA 2NTJA 2WEKA 4J2OA 4WPGA 3LYLA 3U49A 1H6AA 1B26A 1K2WA 1I5RA 3G1UA 3DAGA 1H5QA 2CVOA 4FB5A 1DO8A 1EMDA 3WYEA 1P1FA 4WECA 3E03A 3PLNA 3SC4A 1PR9A 2WYUA 4QFDA 3ZU5A 3DFUA 1ZVMA 4EJ0A 2YFQA 3CEAA 3JQBC 2B37A 2QHXA 1LBEA 4YVFA 3FWZA 1U5AA 5BNFA 4CM7A 1OBFO 2XAAA 1XEAA 1X7DA 5K9ZA 2GYYA 2J3HA 4ZRMA 1ISHA 1BRMA 3C8MA 5ENVA 3E48A 5TJ9A 2O50A 4YJGA 1AGNA 2O3UA 5AQ1A 2DKNA 1ZKMA 3W6ZA 4J1SA 4CM1A 3PWKA 1Z82A 3GF4A 3K96A 5DNAA 3EDMA 3S8MA 1HLPA 4LMPA 2IEDA 4Y6PA 1V6AA 4PIVA 3AUUA 3OECA 1VJ0A 4WNCA 3F6YA 3H4VA 4B3HA 3FNGA 1E3EA 4EITA 4CMAA 2IEBA 4BO1A 5T64A 4YBZA 3MTJA 4XRRA 3ZU3A 2C82A 2NWQA 1DC5A 5BSFA 5U9CA 1YKFA 4I5FA 1ADFA 2B69A 1ZK2A 4P4NA 4AJLA 5A9SA 4DVJA 1E77A 1BVRA 1HETA 3FTPA 4QXMA 3MWEB 3KHUA 5EN4A 3JYLA 4BGUA 4E4YA 5EQFA 3MZ0A 1C0PA 3WMWA 3K8ZA 5ER9A 3OETA 4UULA 2DFDA 2V6BA 1UAYA 1V0JA 3QE3A 5KKAA 4CUKA 3VPGA 1DIBA 3LF1A 2EJVA 4LCJA 4WASA 3ON5A 3RI3A 4YAEA 1PL7A 3EW7A 4OO3A 3WX0A 1A7KA 5DULA 3FHLA 2H1SA 2FOIA 1GQYA 3L9WA 1UDCA 4RQTA 1UZLA 2AG8A 1KOLA 4CQMA 1BXKA 3R3SA 4HKTA 4MVJD 2I9PA 1KVRA 2VNAA 4EI2A 2GERA 5KIAA 3WMXA 1XSEA 4CMIA 4KZPA 1EUDA 4PG8A 4HNHA 3OH8A 2DBZA 3IQDB 1H9BA 4BKPA 1WDKA 4DREA 2Q2WA 1BXGB 1JW9B 2QRKA 3RUEA 3MJVA 3JQAD 1NPTO 5DBFA 4UEKA 4GMFA 1HL3A 5BSEA 2O4UX 4CV1A 1I33A 3HADA 3ZDFA 2CF5A 4GX0A 3UXYA 2O7SA 5MDHA 5KJCA 1NX6A 4NH4A 2ZIZA 2JCVA 7MDHA 5JDIA 3BMOA 5DF1A 1EUCA 4E2ZA 3WFJA 1TI7A 1N9GB 3JQCA 5T57A 2RCYA 4ZU3A 3IUSA 1QYCA 1PWXA 2Q22A 4OAQA 1LXCA 1N2SA 1LDYA 3F5QA 3E9MA 1I24A 2X9VA 4R1UA 5A3JA 1VPDA 3W4IA 2BD0A 2J3KA 1YWGO 5EIOA 1P0CA 1WDLA 5GZ6A 3IKTA 4E13A 1XCBA 3PZRA 4IJUA 4B7CA 4CM8A 2GR9A 4YTEA 4AJ4A 3WLEA 3DZIA 1HLDA 3GN1A 1OMOA 3EMKA 2AQKA 5H81A 1CETA 5EQDA 3MCVA 1B3RA 1YB1A 3P5SA 1JA9A 4CPDA 3BTVA 1ONOA 1KEPA 5A03A 1Y8QB 5DBGA 1K5HA 1C1DA 1AXGA 4FJ2A 2W98A 4ZQEA 4HADA 1Q7BA 2VOEA 2XXJA 3QWAA 5G4KA 2ZJ1A 5JO9A 4H7PA 2NQTA 4JP2A 3ZW9A 4II2A 4D0RA 3INTA 3OIDA 1P1KA 3JYOA 2BGMA 3R6DA 3U62A 3D1LA 3FRJA 5GMOA 4AL4A 4BNWA 5B4VA 4XQ9A 1GZ3A 1NNUA 4EW6A 1ZW1A 2JHFA 4NJMA 3L6OO 2H6EA 3S2GA 3NT5A 1MGOA 2IZ0A 3H9JA 3IUPA 4GH5A 3RQSA 2NSDA 4HV4A 4YT8A 4KUHA 5TT0A 8LDHA 1AHIA 3GVPA 1ENYA 3ZHZA 3WWZA 1H93A 2ZB7A
chains in the Genus database with same CATH superfamily
2GEVA 1ULSA 4JR2A 4XFJA 4DQUA 1VKRA 4QYTA 4ZV7A 4FZRA 1SVSA 3OEEA 4Y6OA 4K3UA 4M0LA 4KWHA 4XM1A 4U7FA 5KYUB 2DM6A 4MUBA 3TNDA 5JECA 5KJFA 1DCKA 4QATA 3AGPA 1H5NA 3W8RA 2OO3A 2NTNA 4QQFA 2XTJA 2NU7A 3CLSD 1L7EA 5GPBA 1AHPA 1RZ3A 3RREA 1EWRA 1NN1A 4UUMA 1ZXLA 1E2IA 4TXMA 2ZUTA 4EGQA 1CBUA 1N8KA 4Y7DA 3UPTA 1RHQA 5LMZA 2BSAA 1RM3A 1BHSA 1KMMA 1T3SA 1E79D 2YIVX 3MLAA 2IEIA 3OQ6A 3OT1A 2QUZA 1PUXA 2Y0BA 1J9ZA 3FZNA 5JNVA 2ESRA 2YXEA 2H4HA 3CNEA 4QWMA 2XE6A 4NJEB 4UDYX 4LC0A 3W3ZB 2JI7A 1YJ5A 5DI3A 4EB3A 1DJNA 1ZSVA 4LSMA 2G9QA 4BUJA 1RLUA 3IAHA 4R8VA 2IODA 5EAIA 1YT5A 5A04A 3IVAA 5BWBA 2QUKA 1U8EA 3BXGA 2JFYA 5IUKC 5BOSA 2O59A 4Q3AA 2VI5A 5FHQA 3ELWA 4E1BA 2A5YB 1ZK0A 2FCRA 2FN3A 3PNSA 1RHUA 2FPUA 1K0UA 1M7BA 3OIWA 2OGTA 4NCIA 4PANA 1WHSA 4ZQBA 4B6OA 2IK8A 2ZBQA 5C8ZA 5CDSA 2FMUA 1U0EA 5JPDA 4RXMA 3UOGA 3OT4A 1UXHA 1FK8A 3KT3A 1EPUA 3M6LA 5DHRA 1AGYA 4Q4AA 3PUJA 2P5YA 1E2KA 5EIWA 3JVDA 1APBA 2QRMA 3AHFA 1T0BA 3MXOA 1CUGA 1N6LA 3I3SR 3TMAA 4Q9JA 2HMWA 5TPWB 4JC0A 3E3MA 2JGRA 3WGJA 2WM3A 4H7IA 2FPPB 4UPDA 4DJFC 3QOXA 3TRHA 1BFUA 1R8JA 1FDUA 3LT5A 1XYYA 3LT0A 4W4TA 3UXMA 4MEBA 3L3BA 4DRYA 3N1UA 1NG1A 4EYQA 3ERCA 3S0JA 4V0QA 3VKHA 3Q1KA 3F7TA 4MRPA 3N8HA 3TDMA 1D09A 2JIRA 2RAFA 3CBGA 3AX6A 3ZCUA 5H81A 4QTTB 2KI5A 1II8A 2YW2A 1AKTA 2C84A 2RGAA 3Q2KA 4NU8X 4BMZA 4YRRA 5LNK6 2O5RA 5AW0A 5TF4A 3OQBA 2JJ1D 3QVVA 4RVHA 2K5UA 1U7UA 2NQ8A 2PUBA 2OBNA 5AK4A 1QH0A 2BDUA 3F6SA 4P7FA 1IRXA 1XHEA 2JC3A 1QF9A 3M7IA 4UATA 5AJUA 1F2UB 4BWFB 4DMLA 3QKRA 1NP6A 4MGEA 4PIMA 2QJWA 1UMBB 1YGYA 1YNOA 3J80A 3YASA 3BGDA 1J7JA 2PV0A 5EMLA 5DW3A 1N7HA 5E1OA 3F7NA 3EXIB 2GNAA 4LJ5A 3C70A 3WLRA 4BBAA 2GBLA 3REQA 3T52A 1JEYB 1ZEMA 2QPAA 1B74A 2YV3A 1E64A 3KEFA 3WGKA 2J45A 1WZCA 4IDBA 3OKAA 3KPYA 1CT9A 3D6NB 3G9QA 3MC1A 2YWRA 4D98A 1JXAA 1XJCA 3RGWS 4MQFA 3GRPA 4ZI3A 2V55B 2P4UA 3UXEA 3OURA 5EPOA 5JDCA 3CH7A 3ZDAA 3ZJXA 3G23A 5LVAA 121PA 3H99A 1JXMA 3GDFA 4NHOA 1VGVA 4QO8A 1YRWA 1ECJA 3LC2O 1EUQA 1D07A 1NQXA 1ZD9A 3S2FA 3VVLA 5FWXB 2HSJA 3DGEC 2PVSA 1BOOA 1Z6AA 3TK1A 2IBSA 2Q6TA 8MHTA 3M6VA 3RJ9A 1KEUA 2PKRA 1IUOA 3EC1A 5ELXA 3ZOZA 3OFJA 5AW5A 4Y18A 5EJ2A 2O2ZA 4LHZA 4E33A 1OAKA 1XU4A 4X93A 5HVNA 4KGZA 1B15A 3UTDA 2QLTA 3UPDA 3VFDA 4DV4B 3PGA1 4UHJA 1A1VA 3L0BA 3R20A 3SQWA 3OZCA 1QHYA 3HUEA 5IVHA 2W93A 4X7MA 3HZOA 1XTRA 4DV5B 1L5HB 4ASUA 4RO0A 1OFGA 2RK4A 5JNSA 2G8NA 4JMPA 4PM4A 4U6QA 4ZO7A 4CUZA 3K70B 1LQTA 2N1BA 2E4XA 4QU0A 4YJHA 5AKKA 3RVPA 3PHCA 3UG6A 4ER6A 2Z2XA 5AXAA 2GBPA 1IEWA 2W8BA 1VRWA 5A0FA 1MEJA 1GXSA 3QJGA 1E5VA 2WMDA 3TG2A 1GZHB 1H2YA 3L0PA 3ET4A 3A4NA 1LZLA 2MSKA 3AVVA 4E22A 3E7FA 2AUTA 1ZMTA 1J99A 1NONA 1BEEA 3O8BA 3QK7A 4L73A 1TKAA 1ZD2P 4LYEA 5HJ2A 1JN0A 4KNVA 4DCMA 3SZLA 3BS4A 4RLQA 5CTJA 5EJ9A 4UFPA 1M10A 3LKVA 4JB0A 1P2UA 1JQ5A 1XZNA 3HZZA 1RCUA 3EP5B 2RGYA 3DBHA 2J59A 3IP6A 3Q85A 4NS4A 4L9SA 3SAJA 2VDJA 4EECA 1AIPA 2GBGA 3EWAA 3M6WA 4JX8A 4KG7A 3EWSA 1YR8A 3V1TC 3SJAA 1HY3A 3KEMA 4DC9A 4QD3A 1JHXA 4LRSB 1GPKA 1TT7A 1R5NA 2Q5FA 3HY4A 5DN6A 3BE5A 5B1IA 2QUAA 4TKLA 2D62A 3GA0A 3LQQA 1ZD5A 3DUFA 4A2PA 1GZ6A 2LPMA 4PFKA 1JHQA 1ISMA 1YR3A 2Q5HA 3NJ4A 3LS2A 4OHPA 2H2DA 1TZKA 1H2XA 1Z4QA 4ED9A 3SSOA 3CZ9A 1E9FA 4ZV4A 5JPIA 3TIFA 1WKBA 3R5XA 2ZJ3A 1PW5A 3TSCA 4J0DA 4A73A 3AJ9A 2EW2A 3R5JA 2ZE6A 1JMVA 5BXYA 1PNRA 3D59A 1K7EB 4Y2UA 3QE9Y 4AY5A 2QI9C 2V7QA 1SOUA 4Q00A 4C0JA 2E89A 1H4TA 1Z25A 2GPYA 1LC0A 1Z0FA 1PT8A 2BKAA 1JHAA 3G2QA 1T1IA 3MMSA 4H77A 4JJKA 3UH1A 1OBCA 4HDQB 4QM6A 3LPNA 5BW4A 2MU1A 3UIEA 2PMDA 4AECA 2FLVA 2H9AA 1KETA 2R5FA 4RK1A 4JSRA 5FPHA 2YWJA 3KSUA 1UPUA 4FYJA 4JDPA 1HQYE 3WV5A 4UQLA 1LVGA 1IUNA 3TLGA 2Q4TA 3RYFB 4PNPA 3QXGA 1NAIA 2RI6A 1SEVA 2CJPA 3BJIC 4ZYYA 1U0RA 1KJ8A 1E89A 1WB4A 3ECAA 4HVTA 4HHEA 3HVKA 4B32A 1ZGBA 1ZH4A 1TLLA 2Q8PA 4FCVA 1R0LA 4U7HA 3L0CA 3Q10A 3SWWA 4ENVA 1UJBA 2V7WA 2WP0A 2GXAA 3IFSA 3UUEA 1QWOA 1A2QA 2OZLA 2PMWB 4KQJA 4PO3X 4W6ZA 4KOAA 2WICA 3CRRA 2FW0A 1XTSA 3L0IB 5E8RA 3MTEA 1ZCFA 1JL3A 4D0SA 4CTOA 4R3WA 5AW4A 2FSHA 3L43A 3NVDA 5JT1A 1O03A 5CUQA 1SB9A 3NHLA 3IT1A 3KJFA 1YOVB 3L1IA 2PMEA 3KYIB 4IWYA 1AUPA 1GL3A 1E6CA 3QPVA 1CXZA 4IPTA 2YJ5A 1UFQA 2CBXA 2R8BA 2XB2A 3RC3A 3O47A 3DBIA 2Q41A 1FNNA 2QLNA 4G26A 1Z6GA 2VPIA 2QUBA 5F1YA 1G2OA 2X58A 2YYAA 1YULA 2O57A 1G3QA 1PG0A 4QG7A 1TF5A 1UOPA 2AXPA 4MV4A 4JYCA 4RKEA 4N3CA 4WCFA 3UJBA 3C1AA 4D3FA 1K2VN 2CZCA 1QE5A 4OHBA 1GAJA 5IT4A 4LF7B 4ACAA 2XT9A 3KRTA 5C1DA 1QANA 3WP0A 4I6GA 2R1UA 1JE0A 4BIIA 2ZSHA 3FTCA 1IBKB 1X7ZB 5A9RA 5CFZA 5L8VA 2ZJ6A 1RI3A 3NASA 1L0BA 5IJZA 1TU3A 2QP9X 1RJFA 3L1KA 3LPDA 3SZ3A 4BUCA 2YWEA 2VP0A 3PUZA 4TV9B 4D9EA 2CUKA 1DNPA 3VA7A 2Y9MB 2GPWA 1FSPA 4V0RA 3FJYA 4TYPA 2QZJA 5JCJD 5K03A 1U6IA 4RGBA 3UA3A 2LWIA 3LYHA 3LBYA 5BVGB 5L3SB 2XZTA 4L8YA 3BXXA 3IMCA 4RABA 1QIGA 4FOOA 2IDJA 1QHXA 5L3ZA 4IMPA 2WM9B 621PA 4DPLA 1D6JA 2WE7A 2JGEA 1BEUB 4D46A 1EGQA 4R81A 2HU5A 1E4EB 1R9JA 5KOJB 1U3TA 2BLLA 2C0PA 2NUPA 2XV1A 3KLPX 3O82A 4YRFA 3TL3A 1ZM3A 2Y68A 4LHSA 2Q6IA 3TQFA 2GX6A 4FGKA 4AX4A 4CIWA 1ZNWA 4F3YA 1VDMA 4NHEA 4J0QA 3S70A 4JLVA 5FORA 2FEAA 1Q1AA 3B2QA 2JGDA 3MTBA 1VBNA 4ARVA 2XMGA 5DHUA 1A9QA 1NYTA 2BMEA 1FFSA 1CF4A 3GPCA 1RWWA 4U39A 1A5AB 2YIMA 4YJFB 1KWGA 4GBMA 1JFTA 3QU9A 1VSVA 5FFMA 5LQDA 1ADYA 1NBOA 2CDAA 3TQTA 3SYKA 1GRVA 1V4VA 5I4KA 2JANA 2PKWA 1JTEA 5CP8A 3PQ8A 1M2EA 5J4YA 1VMDA 1AVTA 1BO6A 1KJIA 3L4SO 1SK9A 1Z75A 1C0IA 3IBYA 4WZAE 5IDVA 4BX3A 4GGOA 1E9VA 2NU6B 3A4TA 1XCGB 1XMQB 4UNIA 2BBWA 2ZBDA 4HRVA 3DWFA 4PNHA 3RIYA 4GI1A 5AI9A 1BDJA 3H6HA 1T3TA 2PGLA 5JEEA 3HG7A 4BMDA 3OICA 4ZANA 2C2GA 4JLDA 1HEIA 5FPQA 4D4JA 2WT9A 4IOMA 5EHQA 1FFBA 1R0SA 1J2UA 3A4MA 3R2JA 1VJ5A 2IIQA 1E1MA 3DNMA 4P4SA 4G5FA 1QO0A 1DAKA 1G98A 1M0TA 2X9LA 3GLUA 3OCXA 1WNFA 3TQCA 2H92A 3MGKA 5CEEA 3A06A 2EERA 1E6WA 3HDQA 1V3TA 1DBWA 1VL0A 2DHQA 2LR0A 4N5NA 2QRPA 4P4GA 3TOZA 2YQZA 1PJCA 4WOBA 1GLNA 3DZ2B 2EWVA 2JZCA 2Z9BA 4GOOD 1XD9A 4S24A 1LDMA 4ZRDA 2GZHA 3QVSA 1AN0A 1IPEA 2X1MA 3CW2A 1FJ2A 1LC3A 4RM2A 5BN3A 3NW9A 1MR3F 5I4IA 2HMYB 3ORYA 4PWZA 3ISVA 2C83A 3RFTA 3WBJA 1DS6A 5BR7A 1UPBA 2ZJ4A 4AMZA 4W5RA 1FPQA 2VJMB 2QAJA 3C3DA 3AVPA 3NTVA 4DXAA 1U7HA 5EWJA 5K99A 1XPRA 1QTIA 2PO5A 1JYFA 3DW1X 4ZJYA 4DR6B 4O8CA 1GIAA 3IL2A 3QFFA 5AOCA 2FRXA 1KQGA 2V45A 3IJPA 4P81A 2B34A 1FXSA 2P0YA 1NE7A 4N5MA 4BO0A 3KLBA 2BFDB 2OZPA 1R66A 2MSLA 3MUOA 4K0RA 3SOPA 5AM1A 1JAZA 1Q15A 3PC2A 4FHZA 2X41A 4CJXA 3BE4A 3SVTA 5FKJA 5K3AA 1GUAA 4WUTA 2F00A 2OKGA 2PZKA 1SCDA 4D6XA 5IJAA 3F5SA 2AC4A 3LT2A 4RGYA 3IE1A 1IVNA 5D8DA 4UFNA 4EDHA 5EXEA 2R8YA 2VDLB 5LB2A 1I72B 3DQZA 1E4YA 4MYRA 1TAUA 5G02A 4OU5A 2OPHA 2HTEA 3QKUA 4QJIA 3V8BA 4YDQA 5LU8A 3MJRA 5FL3A 4EMBA 4W7HA 3RSOA 4P0PB 3SX4A 1GPMA 4L4SA 2CL7X 4R0VA 3U7EB 4W5TA 1KO1A 3AJAA 1XTVA 3S1SA 3DYIA 2XA2A 3H9GA 1CY0A 2Q28A 1NR5A 2WA2A 4HDNA 4XARA 5CX4A 3V2HA 3VSEA 9LDBA 1AMUA 1S9DA 3OY2A 2BGIA 4QIHA 4JYBA 4B4OA 2JGNA 2ZE8A 3HFRA 2BR3A 2P8JA 2P6OA 3R1IA 3IAEA 3VX3A 3HQ4O 1ESCA 1DDOA 4BCBA 4FE7A 2WD9A 1LS1A 4CT0A 3IIJA 5CB0A 2C7PA 1UWVA 1DL5A 2QLLA 4J43A 3T3DA 4TZ0A 4OY3A 4BXOB 1AG9A 4IV5A 2Z3VA 3T5BA 1HYBA 1XXLA 2QW8A 1VBKA 5JNRA 5JVDA 4XFDA 3CUSA 2BCJQ 4TVSA 2CHFA 1JT2A 4KPYA 4G97A 5ITZA 4JLNA 1TTPB 2FJUA 4PZLA 5EERA 4E46A 4CKXA 5KOYA 2I29A 5AI4A 1U81A 4XGRA 3KSAC 1PYGA 1ZX1A 1RR6A 2QQGA 4DR3B 3K72B 5CD1A 1Z6ZA 1UKEA 3C7CB 2FR8A 5ALXA 4QFMA 2RHHA 3ESRA 4JELA 4F4CA 1YR7A 1P4SA 1Z22A 1N2IA 3I45A 3MQ2A 1GNLA 3C3EA 1PZHA 4V0MA 4Y1RB 4M8KA 2X14A 4DBVO 3OIGA 1GPH1 2HWKA 1VCHA 2OO5C 4R83A 4U7GA 3D1VA 4L6IA 5TMEA 5JAIA 2GEJA 4TUYF 1RE0A 1HF3A 2B0JA 4IIFA 1PKXA 5KDOA 2HCJB 2DFNA 3EGCA 1YB2A 2QUJA 3AEQA 1MC4A 3I04A 3G02A 1E0AA 3LC1O 4CNBA 3OFND 4Q66C 4KQMA 2YV4A 2PUCA 2D3TA 1A8QA 3C3PA 2GQ0A 3AKEA 3I2KA 1PR4A 2D5CA 3OF2A 5EIEA 5EJEA 1YJAA 2PAFA 5HS4A 4NICA 1ODLA 3HFJA 2C5SA 1FQOA 1U11A 2UXBB 2NPIA 3AKDA 3TRKA 2GB4A 3HVJA 2X4IA 1D1PA 3QUSA 4D7AA 4WZBB 4U9HS 1KQOA 4G0MA 1ZD3A 2Y99A 4TMZA 3VO1A 6NULA 2OWDA 1AV6A 4FI3F 4BEBA 2WF7A 3KOOA 1Q1QA 3MRSA 2AZ4A 1XRJA 4HP8A 2P9HA 5K4HA 4HT3B 2AF3C 1W5TA 2KX7A 3OX1A 3H18A 5J5CA 4HX2A 2IYUA 1XZMA 3QU2A 4DJ5X 4NX2A 4LXTA 4YS6A 4O2AF 1M7HA 2HM7A 2J9GA 4FFPA 4GPZA 5G1PA 3A3YA 3HB1A 4NG5A 4MIEA 1VJCA 4OHCA 3V8VA 1P17A 1A76A 3BJZA 3EISA 3Q15C 4BYGA 4F46A 3AVWA 4DWVA 2AE1A 2QTVA 3FM9A 1E8MA 4E09A 2OBXA 1XP5A 4XJTA 4LC9A 4MAMA 1AO3A 3V2GA 4C0KA 2VHXA 5LM3A 3FW1A 3BFKA 2AFIE 1VRVA 4PSDA 1EGVB 3ZV3A 4QJ3A 2ZZNA 3GJ0A 5H3LA 2IS6A 4GDFA 4YREA 1HK7A 2I62A 2V5VA 4EJFA 3GJ3A 1DRWA 2IELA 2Q29A 3B6JA 1MQAA 2J7KA 3LRPA 5CNMA 1U99A 1NX9A 1DKLA 3VKWA 1SQGA 3Q5GA 4BJ3A 1R0YA 1EWKA 3VTAA 4BECA 1Q7EA 4WD3A 3NHSA 1N9GA 2OHIA 4FQ7A 4WN9B 4YJKA 4KREA 4MWBA 2J85A 4GOND 4JJIA 4IV0A 4ILEA 3V4VB 4NYJR 4NMWA 3OFSA 1K8XB 1R4MB 1NA5A 4FW8A 4HNTA 4IEIA 5TQVA 3NRJA 2BR4A 2WF9A 3FNIA 1DIOB 4FJ1A 4TYWA 4DTCA 4JT2A 3DBRB 4D45A 2LP4Y 1PL0A 3PEEA 3LA6A 3OQOA 3OA2A 2QXUA 2MYUA 5B37A 3OPXA 1PV2A 3G9UA 2PRJA 3OT5A 4RA9A 4WDQA 3VSDA 1PK7A 1Y6ZA 4S2UA 3TFWA 5LQJA 3HB5X 4KLCA 3CWQA 3MBKA 1IPFA 5GVSA 4G07A 2QT9A 2TECE 3EG9A 4ZI7A 4BNZA 3BT7A 3LA8A 4I50A 4ZCIA 1I3LA 2R66A 3ZQ4A 1MJHA 1R88A 1WS6A 1RP7A 4MA5A 4AURA 2J3EA 9MHTA 2G9ZA 1W8IA 4Q0MA 2VT2A 5MGBA 2NYUA 2SKEA 5L45A 3L4EA 1Q6YA 4NBUA 2EFHB 5T8KC 2FNAA 4BRWA 1Y8QA 1V4BA 2EHDA 5L7TA 1RXVA 1LDEA 3TUXA 2G6BA 2PH1A 2FF7A 2JLBA 5L6LB 4GOKA 5CVTA 1XTPA 1DWQA 4WXMA 4DQDA 1LTKA 2ZTVA 4BV9A 4BP3A 1COWA 1CWUA 1CS0A 2R8PA 1FUIA 1YZGA 1DXOA 2TMDA 3ENNA 4RF2A 1Y9DA 3SS7X 3TIVA 5E2AA 3WNDA 1DX4A 2FE1A 2K7FA 3Q3CA 1K98A 3DDCA 4Q9LA 4FCWA 2YBEA 3R7NA 4IYJA 3KTOA 1T2AA 1VZ2A 4B35A 1FFEA 3F3MA 3IPXA 2AI3A 4OAOA 4NI5A 5IC4A 2X5JO 2R4UA 3JSAA 2AI2A 5IAKA 2RB4A 4PCUA 2QQ0A 3NVMB 1N2OA 5JYEA 4OMUA 2J1LA 5HWSA 2MTBA 2VP2A 2O1WA 4X91A 1ES9A 3NC0C 2PZMA 5B3LA 3EOBI 3DZ5B 4OUDA 1A9PA 4LJ7A 1CUDA 4X1YB 2W6ID 2Y0CA 5DYTA 5K6AC 3BH7A 3TAUA 1EESA 2V96A 2FN8A 2IW3A 1Z5OA 2X40A 4NBTA 2VEDA 5FAKA 4Y0VA 1U0NA 4MW7A 2I9KA 4AQ7A 1UXKA 1Q92A 4RDCA 4Z9FA 1ESMA 1IY9A 1MOZA 1OZGA 5F7XA 1RHMA 2ZYHA 3T4PA 2EFCB 4HB4A 4H3HB 2XYHA 4DLUA 2AN9A 2HLNA 4JUBA 3RVLA 3N2KB 2DFKB 3QLVA 5FFNA 1MVLA 2AWNA 1PGOA 1V43A 1XZIA 4JN6B 1FFXA 2AOUB 2JFOA 1VPTA 1NW9B 2E18A 1J1IA 1I0LA 3DEHA 1U2QA 3JQAB 4R3NA 3OZTA 2OBFA 1UH5A 4NS1A 5EKSA 4HQ0A 4A0FA 3EVNA 2QG4A 3FPSA 2ZUVA 3KOXA 3FOAA 4MYDA 4A03A 5KWSA 2NO1A 2WJVA 4XKJA 3WGIA 3I9MA 1ZNYA 4EF6A 4J1TA 3N2GA 4X54A 3VSCA 5HNKA 1Q7GA 1IDOA 1QG0A 3EC7A 2Q9BA 2RIRA 4MVJE 1XJ0A 3CF4A 4JEHA 4I3HA 5KNCA 1YCHA 1XXHB 2RBKA 1IONA 1N5KA 5K20A 3CZQA 2JLZA 3CUYA 1K63A 1ZXBA 4PZDA 5BW6B 4YH1A 4F2GA 4KR7A 4P7JA 2VDWB 4LY9A 2JKVA 4MP6A 2OYRA 4BO5A 4DJJA 1F6BA 2ODNA 3L06A 1EBBA 5MN6A 1QDUA 4MIYA 1GZ5A 1IEQA 2EFJA 4ROSA 5FT9A 3EPJA 2WPDA 2M9MA 3MD0A 4C76A 3BYZA 2OCPA 4LY3A 1VCIA 4R1NA 5IFLA 2GXSA 1T3LA 3EYWA 1KI2A 1NUQA 4ZO6A 4L5AA 3SEQA 4EY6A 1UJNA 1EWTA 1O5TA 5IP5A 3O1JC 2YZMA 1D03A 1YIOA 2GLUA 1PU2A 5EJIA 1DUSA 1WMSA 3AHDA 2O8NA 1ZONA 4HAVA 3CB4A 1BD4A 3QM1A 3VNRA 4B9AA 3SBEA 3GJXC 3QY9A 2X8AA 4B45A 5ADHA 3FCCA 3DC7A 1WBJB 4GYYA 4ZFNA 5BRJA 2QTGA 1NBEA 3AETB 1LFDB 2YZNA 4QLBA 1PEYA 1WZUA 1BMQA 4PC2A 2RAVA 3PD7A 4AMYA 4BLSA 1I4LD 1ZK1A 1QKJA 2IP4A 3TTXA 3GFOA 3UYKA 4CCYA 4X8MA 2CMDA 1HR0B 4LJLA 2B4AA 3G5AA 1IN4A 1QTNA 1YB6A 1QYRA 4UUAA 3H2IA 1IQPA 1VMIA 3ZLTA 1U0OC 4JJ4A 4WFJA 2XVZA 3JPYA 1KAHA 5CITA 3UBTA 2WJ6A 5ESRA 5AVJA 1TXGA 3W2TA 1E99A 3A3KA 5DNCA 1KK1A 2IPOA 1WAMA 1W581 1QGOA 1PT5A 1QGZA 2ERYA 2HRQA 1YS1X 1KY4A 2Q1TA 4ZXPA 4QASA 3FDFA 4Q82A 3FZYA 3G5MA 1C7IA 1NFQA 3OMLA 1K7CA 2VXOA 2JAPA 3RRMA 2C7QA 1THMA 4DDWA 2XXAA 4Q6BA 2EX1A 2XEXA 2C3PA 2I6QA 2YJTD 5AH0A 3PR1A 3WHKA 3OP4A 1C9JA 4RJJA 1UC5B 2ZYGA 4OFXA 3ZK8A 4H08A 3II6X 4QDTA 4E31A 4XX0A 3SEAA 3BKXA 3P9YA 2EG9A 4BFTA 1NOJA 4FU0A 1E5DA 2JJ2A 1S2LA 4BO8A 2E21A 3LUJA 5ALOA 2G76A 4EHAA 1JEEA 3DTTA 1CUBA 1V8FA 3I0ZA 2ZI3A 4C3UA 6GPBA 1UJMA 1YMQA 4MS3A 3GCDA 3PDIB 1YJ8A 2EFGA 3WK4A 2JHGA 4EJSA 3RIXA 5FLYA 2ACWA 1IPHA 4M54A 5CVVA 3V2IA 4COOA 4XJSA 1CC1S 1KE2A 1FDWA 4ZVLA 5GGXA 4MDHA 1FTSA 2Q3FA 5CFMA 1J2JA 1SHKA 4NMMA 4NOMA 2X15A 2F9MA 3M1LA 2H16A 5J23A 1RKXA 1GRNA 1HA3A 1X94A 3R4CA 4CL2A 1H4QA 1MVOA 1W1WA 5LBIA 3SC2B 3WOHA 3IE2A 3F9IA 5B7GA 1AKYA 2LD4A 4NEGA 4CRWB 1KWKA 2X0JA 4MPPA 5HA5A 2XRZA 3BE6A 4BMVA 3WYAA 2VL7A 3EMVA 1IDN1 1CFJA 1MXFA 3FOCA 4JAVC 3C98A 3DOCA 2P6PA 2GVZC 3H9QA 3IJRA 1MC1A 1ZOPA 1U3CA 2PD6A 4FYXA 2Y9PB 4YRDA 4Z4HA 2BYTA 2J31A 1ML4A 1E62A 1GTRA 4ZVUA 2JFUA 2VPQA 3CRVA 1O4WA 4MVJH 4X63A 1EDZA 1GQSA 4EAQA 2ZM6B 4P2GA 1AUVA 3O1HB 4LV8B 2FSVA 3BWEA 4XPIB 3AVQA 3CZ5A 4IUDS 3M4XA 2DCMA 3DYBA 4KSCA 5F5XA 3T3HA 1P7PA 2X0RA 3W5UA 1ZZGA 3PWZA 5IC5A 1NKVA 1IJKA 1EVJA 1MX3A 2I7VA 4R1PA 3P9QA 3FBTA 4RTNA 2XNJA 4JLJA 2FDXA 4M76B 2D7DA 1IL0A 1VMKA 5KEIA 1PWHA 4JB3A 3GG9A 4HGRA 5TVOB 2PWAA 1B7GO 1N7GA 4IHJB 2ISQA 1YHZA 2ET6A 1RNLA 2VRCA 3AUSA 1CQJB 3HFGA 3HE3A 4F9FA 3UMSA 4MV6A 4RVNA 2IIVA 3DLTA 1Q3TA 4MVJF 3K5WA 4JLMA 1M2OB 4YUVA 2BH2A 3ITNA 3TFQA 3UAYA 1DQSA 4BLVA 4ZAYA 3ZJTA 1SHJA 5CYFA 5CDFA 2BGUA 2AZDA 2PLWA 4O0LA 1FS4A 1W5EA 5LZ8A 4DDTA 2R8XA 3DPUA 1XIVA 3JASA 4X6YA 3D8HA 3GZNB 3TXAA 5TPZD 1BE1A 1YTLA 4UNNA 3E7WA 1BQ4A 3FZGA 4CQJA 4U5XA 2QAGA 4HYEA 2REXB 5AKYA 2KE5A 5CM9C 4G01B 1I7SB 5FTJA 4EY4A 2C88A 3DDZX 3DBLB 4KXQA 3TPCA 3UT5A 1NJ8A 3CF4G 2NX2A 3BL5A 3GJRA 5CXSA 4YP9A 4E14A 3GFBA 3D4LA 4QNRA 3N7AA 4EI7A 1CJUC 4DNOA 4OKNA 1JDZA 3WKCA 4YUXA 4JFRA 3OTIA 3R7AA 4XDZA 3UYLA 3C6BA 3EXEA 4AKGA 3CW9A 4FYPA 4IZOA 1H0RA 3BF7A 3FCOA 2PGNA 3B51X 4O4IB 2IHNA 4UBOA 1ZN7A 4XA8A 3H11A 4R8RA 2O0LA 4A91A 3FPAA 4AS3A 5JNUA 2OXIA 4Q03A 3O84A 4XIGS 1UC8A 4JUFA 4N9WA 3KR9A 4CLOA 1JPJA 3UT6A 4I8DA 4JL5A 3PE3A 5B64A 1THTA 4KXYA 3ZI4A 3RASA 2J67A 4R7GA 3P52A 4P33A 2B9VA 5H4GA 2I2DA 1Q57A 3Q3IA 3VKUA 2H2AA 1RI4A 4M7PA 4W8GA 4XJXA 1BQEA 5ILGA 2PKXA 3KDAA 5CA0A 1E1CA 3D5TA 4FDLA 4G2TA 4GM4A 4MKFA 1KJZA 5CNJA 4TV8B 5ER6A 3ZKWB 1SQ5A 2P1ZA 3B8EA 3MAAC 5K0EA 4F71A 1AQIA 1KYWA 1I80A 4KB5A 1SOMA 1RYHA 3M2TA 3FMIA 1L4GA 2VVTA 1HTWA 1IY2A 3VISA 2WQZA 4OJQA 3W79A 1SCUA 4OQNA 1H6CA 3VC7A 3KM0A 1KK2A 3EHEA 3KZXA 1V4NA 2J30A 4IG4A 1UP6A 4F8JA 3EFEA 1R2QA 1PSZA 4UREA 3HGQA 1RLJA 4MVWA 1B2RA 1CIJA 1MIOB 3T3EA 1JLKA 1L7AA 3NHMA 1SZDA 3MJEA 3WTCA 4DAOA 1BFKA 4I4IA 5IKXA 4MINA 2PJZA 4MJLA 1Q2XA 3ABSB 4H17A 2C98A 4HFMA 2GVNA 1OLXA 1VFPA 2UDPA 1QO0D 3I64A 2NO5A 1MABA 2BGNA 3K71B 3FR8A 4RANA 2DWCA 2IVFA 4RDIA 4KO1S 3H2ZA 3L41A 4MMXB 5EYPA 3TBHA 3UBMA 1L5YA 2WMYA 3X1WA 2OKCA 2J9ZB 3U3OA 1Y7HA 5TIIA 4YUWA 2QYOA 4NULA 4RHTA 2H9YA 2IP1A 2QRJA 2W8ZA 5ALEA 1H3EA 1U8ZA 1F8FA 3K6RA 1SCJA 1XZBA 2CLFB 2VWQA 3PFNA 4EG7A 4Q1EA 4RZHA 1T8UA 3OU2A 3UUWA 3TS1A 1GNVA 4AYXA 3NEAA 4ZK2A 3JW8A 5KQRA 1JUDA 2AD1A 4HFNA 3GGSA 1TTHA 2IOYA 1MEOA 1M34B 2RC6A 3E9YA 3ORSA 4MAFA 1EQUA 4IXTA 1YA8A 2N3ZA 3TLZA 4BRSA 1PL6A 1TX4B 4TUYA 5AICA 5IDYA 3JAKB 2XWQA 1X7WA 3N59A 4PLZA 2YDXA 5KINB 2W6ZA 1ZH8A 2PLRA 5AKGA 3HRKA 4Q3CA 1Z2DA 1OAAA 2R48A 4KZKA 1W36C 3NOXA 2D5LA 3SX0A 1OJLA 4AKHA 4KHZA 4P93A 3LDUA 2JKYA 3MRVA 1NRWA 2QTRA 2R84A 2ZIWB 4GOLD 5I7OA 2EZTA 1KS9A 3H1GA 3QHQA 3FUTA 3W78A 4DGQA 1BD3A 2JASA 2XF2A 4MUJA 4QYMA 4DV6B 4BMCA 4MDFA 3HN2A 2M6KA 1E1LA 3O31A 4DCGA 3Q2IA 5IJXA 1JIVA 2ZUFA 3ORQA 4C6TB 3PQEA 2O2JA 3CIFA 1WB9A 1VPEA 1RRKA 3KSMA 1JSRA 1AX9A 3RCBA 1KZYC 4F3KA 3W5AA 4V3BA 1QNFA 2PEYA 2NUTA 2WTXA 3ZDEA 4JYAB 1M6NA 1L5OA 2ZRNA 4PZAA 2FFJA 4EY3A 4X60A 1JEAA 3O8OB 3E82A 5AIBA 3UWSA 1DAEA 2B2CA 3G5TA 4H7KA 2PSFA 5A7GA 1IQUA 3PU6A 3T6KA 3U1VA 5LXTF 4CG0A 3BXHA 5EJ4A 2XWJI 4OFBA 2B3TA 5IULC 2F55A 2G7ZA 5H02A 4RC9A 1BE6A 3VR3D 3W5BA 2YZ2A 1QDEA 4HLDA 3Q8MA 3DKPA 3QJ5A 3CURA 5JDCC 2HU7A 4IXNA 3HPRA 3G68A 3KPJA 3Q9LA 3EJ6A 5KO2A 1QPZA 4EEXA 3ADPA 1ID1A 1RIIA 5BSVA 1O77A 2ILVA 2GKSA 1P91A 4EO9A 5C4MA 5AVSA 2LNDA 4BLUA 4JOCA 3ZZNA 2HA6A 2C2ZA 5J63A 4LFBB 4F2WA 2GTPA 1N2EA 4ERXA 2LZ0A 1HDXA 1WCYA 3FNFA 4NCKA 1YU9A 1KYZA 4GUDA 1WU7A 1YZYA 1C5KA 4MVJI 4OBBA 1G38A 4ZOCA 2UZ3A 4I3GA 3RRNA 2QZPA 3H1EA 2FCAA 2JHAA 1CE8B 4P1ZA 4U9IS 1E2GA 3EQ8A 3IJ5A 1PEDA 2AR7A 2C5FA 2DU8A 2G36A 3ILYA 5FNVF 4EY8A 1CYEA 5B3KA 1N5JA 1P44A 3FGPA 2ORIA 3ZLJA 2DGDA 5AKLA 4ZDWA 5C80A 1SOAA 1YDMA 3L6BA 3OZDA 3BDVA 4RQBA 4YT5A 2Q2NA 3IR6A 4I6EA 4P80A 1NM5A 4INAA 1AKMA 1T1EA 1TVMA 3VYWA 2BCEA 2EAUA 1D2HA 3H5TA 5GV7A 5AR1A 2W48A 1Y9JA 5BSRA 1N5IA 4F4UA 2ZKLA 1PR5A 4FDAA 1D4AA 4DVGA 1MU0A 1NL3A 1OX6A 2YJ4A 1X7YB 1Y8ZA 4ZYVA 1IEVA 3IA2A 4REQB 3KKLA 1U3GA 3IUMA 4NZYA 1JR3E 3FPEA 3RV4A 4C6SA 1GTMA 2P1RA 2VH1A 5FULA 3T5GA 3ZBUA 1ZJ6A 3DTNA 1M5TA 3W9BA 1M1NB 4QRDA 2Q0QA 1BW9B 1R9NA 2NU9A 2ZWAA 1QHHA 3CH5A 3PQCA 3X1KA 3B12A 3KK0A 3PHHA 2JLUA 5K2OA 2CLDX 4ZMRA 1ATZA 5IKEA 1BE8A 4BBPA 4CL8A 5FBRB 1AS0A 2I34A 5DXJA 1FP1D 3H2HA 2NYVA 2OG2A 1JLMA 2G83A 2ZBFA 5JALA 4HXFB 4Y9UA 2PKCA 2O8DA 2VPWA 1FTWA 3UWOA 4D8XA 3HXOA 4L85A 2AFHA 5D01A 3L46A 3PQ6A 4MUEA 4ENSA 4C03A 4X66B 1LSUA 3TDNA 2Z5LA 5JJKA 3DAPA 1GQOA 1ZOLA 3T3PB 3WHIA 5JTUA 3VKFA 2NO4A 3I4FA 3HCBA 1GR0A 3RBVA 4UUBA 5K8JB 4KXWA 2QJOA 2HRRA 5ISMA 5LMCA 3V7WA 4YAJA 3RSLA 4CQMD 7AT1A 2NO9A 4RTRA 4PG4A 2BGWA 2JBAB 1FRVA 3ESZA 2QA5A 3GLGB 1REQA 3DF7A 4YRLA 3ZU2A 3GQVA 3OIFA 2E7ZA 2ETXA 2F9LA 1RJ9A 2FEOA 3MAGA 1N1MA 3WQRA 3GAFA 3W1WA 3ORFA 2JH3A 3GLIE 4PFQA 4JLPA 4DMCA 1I2MA 3PUIA 4LJSA 2C8VA 2BFCA 2D0OB 3L01A 4TTJA 4W99A 4LJ6A 4RE5A 3OUZA 2N1MA 4MGZR 2IHYA 4OIMA 2JAQA 2G9NA 1Y6JA 1PCXA 1T26A 1GG8A 1YQEA 4ZVOA 4E6PA 1BKDR 1U65A 4KR0A 2NZJA 1F8YA 4M88A 2A9FA 5F1KA 3UO8B 3BFXA 1MA3A 1X1BA 3ASYA 1OZAA 3PQ5A 1D8TA 1ETUA 4JJFA 3WZLA 1OXSC 3ANLA 4B4WA 4C7XA 3ZJVA 1NP3A 2HFJA 5DNDA 1DXQA 5DRYA 2GJ4A 3O3CA 1OI2A 4HI0E 3TXYA 3I01M 1FMTA 2QRZA 3PYMA 1BYIA 1LQ2A 1RJWA 2MSDB 4ZVRA 4FHDA 2Z2IA 1O0BA 5FUBA 3MCWA 1WUYA 3T3GA 4CI9A 4YCSA 1NUHA 3LV8A 1YQ9A 2QUHA 4DR2B 5B6IA 5I3CA 4C0BA 2O0HA 7REQB 5EIBC 2C3MA 2QD4A 1O57A 3K4QA 4MVCA 2CFCA 1M8FA 4NNOA 4ZEXA 3ZIAD 2CHQA 1Y9EA 4EUKA 2BLNA 2GTHA 3E84A 4GO1A 5C1BA 2J9FA 4EFDA 3N9IA 4Y9SA 3O2JA 3EAFA 2OCIA 3R44A 1FSSA 1JQAA 3X1JA 1QIEA 4JK3A 1Z2NX 1GGHA 1X19A 3M89A 1YBFA 2FDCA 1WBBA 3LIPA 4PBRA 1O3YA 4RSMA 3BIWA 4WCFC 2O54A 4G9BA 4PW0A 4R6XA 4G0UA 3DR5A 1NXTA 5K8TA 3NDIA 1NVUQ 3M9WA 1ACMA 4UZFA 4RULA 1NNSA 2Z08A 5B3AA 1V7CA 1JGTA 2E4WA 4RVUA 2ERXA 5LLTA 1YF3A 4XVUA 1DSSG 3LXXA 2OSBA 2LE0A 1CEYA 3PHJA 3RIMA 1FYEA 1ZJYA 3PICA 2FMTA 1J09A 5A9SB 1COWD 1EVZA 3GDWA 1X7HA 2G5GX 2Q8QA 3DCYA 1P1IA 3OWXA 1OCEA 2V3CC 1WU8A 3Q7QA 1KFJB 3QI2A 4KDEA 4YJ2F 3TTSA 1I7CB 2F3RA 2F7SA 4CKWB 1UOOA 1N0UA 5EJ6A 4BC1A 3C24A 1MO6A 4PHGA 2XHEA 4Q6WA 3VGPA 4OOFA 3W6NA 4OHKA 5ALMA 1XE3A 1WCIA 4H1HA 2IEAA 1JAXA 2O8BA 1GTG1 4ESHA 3QFHA 4B7ZA 2I7TA 3SE7A 4KGVA 1CUAA 3FCSB 2OO7A 3G9TA 2JIPA 3MVEA 4G0NA 1Y1PA 3FFXA 5IC6A 5BWLA 3BHIA 2Q1XA 1G8KA 4QJ5A 5AVRA 2QZ9A 4X84A 4Y2PA 1WHTA 5E4TA 3EHDA 1BS1A 1JLHA 3LZ6A 1WWKA 4OKIA 4P36A 3ZXSA 4BQPA 1HDIA 5KWJA 4IDQA 3JVIA 4MR7B 5B1HA 3ZDZB 3AY0A 1IK6A 5KTYA 3E70C 4ZTUB 3ETGA 4OQYA 4CR8A 4U2GA 4E4RA 1C9KA 4J0KA 2WJ4A 3DZ4B 1YQUA 3B7GA 2R6DA 3PENA 2H2HA 2ECPA 4MGYR 3WI7A 3ZWWA 2WW8A 3GELA 1G17A 4RNCA 2H4XA 3HWRA 4WA8A 4D9GA 1NUSA 4DSAA 4NFSA 2FR1A 3AJDA 1HE3A 4I9FA 2GJKA 3WLNA 1Q0PA 2H00A 4RGQA 4OI4A 1AC5A 521PA 2QTFA 3RHZA 3LPLA 4MMYB 2P11A 3OHSX 4COKA 2NSYA 3BMOB 4ARSA 3K92A 1XDDA 1Z5ZA 1TYAE 4GVPA 3QFSA 5K0CA 3K7EA 3STYA 3H9BA 3K0EA