3JSAA

Homoserine dehydrogenase from thermoplasma volcanium complexed with nad
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
325
structure length
321
Chain Sequence
MKTINLSIFGLGNVGLNLLRIIRSFNEENRLGLKFNVVFVADSLHSYYNERIDIGKVISYKEKGSLDSLEYESISASEALARDFDIVVDATPASADGKKELAFYKETFENGKDVVTANKSGLANFWPEIMEYARSNNRRIRYEATVAGGVPLFSFIDYSVLPSRIKKFRGIVSLTINYFIRELANKREFDDVLSEATKLGIVNYKDDLTGLDAARKSVILCNHLYGSSYRLSDVFYEGILDRSFGKNERLVTETGIVNGKPSAESRIKSLDSNDYLLTLGKGSLGYQLQTDTNGTLNVSDLYDGPYETAGAVMNDLVILSM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Homoserine dehydrogenase
publication title X-ray crystal structure of Homoserine dehydrogenase from Thermoplasma volcanium
rcsb
source organism Thermoplasma volcanium
molecule tags Oxidoreductase
total genus 109
structure length 321
sequence length 325
ec nomenclature
pdb deposition date 2009-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00742 Homoserine_dh Homoserine dehydrogenase
A PF03447 NAD_binding_3 Homoserine dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 3jsaA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3jsaA01
2Y1CA 4PG8A 2GN4A 2VTEA 4W9NC 4YAEA 3ZV3A 1X1TA 3DONA 5TSDA 4BNMA 1TA4A 1U8FO 5GMOA 3ZWWA 5ITWA 1I24A 3WFJA 3PHHA 4NBWA 1GADO 3OJLA 3I23A 2BGLA 4CM4B 2VYVA 3G1TA 5I7VA 1PWXA 4LVUA 1HZZA 3E48A 2PNFA 1XDWA 3HUDA 5TLSA 4UEKA 3BIOA 4W6ZA 1GR0A 1I01A 1E7YA 1VC2A 4WOJA 1I3MA 2PY6A 3TOXA 3HHPA 2Y66A 5IFLA 3IMFA 3U0BA 1I3NA 2B0JA 3ENNA 4UUOA 3FR8A 4YB8A 1P44A 5F1KA 3OH8A 2ZTUA 1R15A 4WECA 4W4TA 1SB9A 1P1JA 3GRKA 1GV1A 2AE2A 1BGVA 4JIGA 4MKRA 5F21A 4B8WA 3CIFA 2P4QA 4RL6A 2C7GA 4CM9A 3KTDA 5GY7A 3BHMA 1LQTA 2XXJA 4WKGA 3NT5A 3VAZA 1JWBB 2VZ8A 1K3TA 1PIWA 1ZUD1 2PA3A 3ZU2A 4A0SA 4I5FA 1TT7A 4OO3A 4CLOB 5K9ZA 4IDDA 1LRLA 3TL3A 2CUKA 4XGKA 1T24A 3COSA 4ZVVA 3W6ZA 3INRA 3VH4A 4UEJA 3GG9A 4DREA 2HJSA 3PJEA 3QWBA 4P38A 5EPOA 4XEHA 2CSUA 1LSSA 4QFDA 3G17A 2Q22A 2O4UX 4RVSA 4WCDA 4YRAA 5COQA 3W4JA 5L40A 3PHJA 4XYLA 1GDHA 4AG3A 4OOEA 1C1DB 4CM7A 1AHHA 1OZAA 4W7HA 3S55A 2CVZA 3ANLA 1C3VA 3JCZA 2X0NA 3QW2A 1CJCA 2I99A 3FWZA 3GN1A 4PLCA 4YDRA 5JO9A 2HQ1A 5T5QA 4Q3EA 4WPGA 4R41A 3TZ6A 3WGHA 1YH3A 3AUTA 5A5FA 2CDBA 2BMAA 2BGMA 5T64A 1QR6A 1F14A 3C1AA 3H6KA 1I2ZA 1N8KA 3WJ7A 3PJFA 3W8EA 1ADCA 4OXKA 1UR5A 2FPPA 2HSDA 3K5PA 1NR7A 3I9LA 3QWIA 4YEDA 3NT2A 5KJ6A 3RC1A 4CR6A 4CM8A 1AGNA 3SX2A 2YW9A 4J2HA 4L4RA 5ER6A 1MV8A 3QV1A 3AI2A 3WGTA 3HWRA 4BVAA 2YHIA 3EW7A 4D3DA 3F46A 4ALMA 5CDGA 1QLHA 5FI3A 2WYUA 4RJTA 3TF5A 4K6FA 3CPSA 2BRUA 2DLDA 1Y9AA 2VOJA 4PLTA 1G1AA 4AFNA 2OORA 5KVQA 5K6AA 2UUOA 2UV8A 3DZJA 3C7CB 4ZU3A 2NM0A 1KEUA 2C2YA 1QV7A 5DBGA 4E3ZA 3NYWA 1ADGA 2NU8A 3PFFA 1NHGA 4BNTA 1QYDA 2VCYA 3V2GA 5KKAA 3M1LA 4WLNA 5C3MA 4U6QA 3UF0A 4Z0PA 4R3WA 4ZHSA 1XQ1A 4J0FA 4CLDA 4GVLA 3AFNA 4KWHA 3CXRA 3I9JA 4JROA 1NFRA 1QYWA 1GQYA 2J5KA 3L9XA 4FOOA 4BNNA 2B83A 1D7OA 4L4SA 5L4SA 2ZQZA 4N7RA 3AY6A 1U8XX 3IJPA 4CLEA 4MO2A 2EW2A 3TJRA 5CPFA 2O50A 3A9WA 3QVSA 4Y8VA 1LDNA 1KVQA 2JCXA 1BHSA 4II2A 4BKOA 1E7MA 1I8TA 3H2ZA 1E1KA 4IPTA 3PQDA 3IKTA 3PWSA 4IDFA 4NPCA 3E9NA 4O1MA 2Y93A 3GF4A 5TJ9A 1Q0LA 3HJAA 4BO0A 1JW9B 5DF1A 5T67A 1OC2A 2DUUA 4D43A 3ZNPA 1HDYA 1QG6A 1KYQA 5A03A 3LC7O 1HYEA 5BSFA 2OMEA 3UFXA 4A03A 5TT0A 4E5PA 4Y98A 3RU7A 1XR3A 2J5QA 3IUPA 1E1MA 1AXEA 5K6AC 3I9OA 1H9BA 1A7KA 5EN4A 3Q1LA 1Z75A 5T8KA 1W6UA 3DFUA 2QRLA 3H5NA 4I5GA 1EEHA 3MCVA 3IIEA 1IUKA 3JQ7B 3OFSA 1BRMA 1JTVA 1UDBA 4ZRNA 1V6AA 3A1NA 4A7PA 2PGLA 2JAHA 3Q11A 3DZGA 4J4BA 4N18A 2QYTA 1YDEA 1IL0A 3NV9A 2AW5A 5TNXA 4R3NA 1HDZA 1Z45A 4TRMA 1QYCA 2WM3A 2YV1A 2Y68A 3RUHA 3TOZA 4GGOA 2HMUA 4ND4A 5G4KB 4URFA 2I5PO 2HRZA 2PKRA 1BXGA 4JBHA 1L1FA 1B26A 1E7WA 5JCXA 4D0SA 1Y8RB 5JDCA 2YHUA 4TRRA 4PCVA 1SOVA 1PJCA 1QXSA 1E6EA 2AQIA 1ZW1A 4PGFA 4TROA 1F0YA 4L9RA 4N5NA 3AW9A 4G81A 2HDHA 1EQ2A 1T2AA 5TS3A 1LNQA 2XOXA 4E6PA 1NBOA 1HSOA 4NDNE 1M75A 3MZ0A 1T2CA 4MVJE 2Y05A 3LYLA 1PJBA 4W7IA 2E6UX 2YDYA 5DNAA 1MFPA 4IINA 3KEQA 3WYBA 1P1KA 1LBEA 3R3SA 4JNKA 4ZQFA 1HF3A 2OBNA 1WP4A 4RVDA 2NNLD 1Z73A 2IXAA 2RCYA 3EAGA 2O7QA 5HS4A 1Y9EA 3H3FA 5T8KC 2VHVA 1IPEA 3PWZA 3SC4A 3B1JA 3ENKA 4RF5A 3F4LA 2FR8A 3OJOA 3KYDA 4RORA 4BV8A 4J1QA 3ASVA 5B4UA 1IY8A 2WD8A 2AE1A 3A4VA 3GVIA 4L73A 4IQ0A 4J4TA 5ICMA 1X1EA 3G1UA 3U4DA 3H9UA 2ZYAA 1LDGA 2WE7A 4B4OA 1YQDA 2ZB4A 1KVUA 4J0EA 4OJNA 4MIOA 1X13A 1ZK3A 3QA9A 3DDNA 5JDCC 3W8FA 4Q3NA 1YDWA 3ZCXA 4XGIA 3JQ6A 3EVTA 5B37A 3NJ8A 4TRJA 4Z3DA 4BNUA 1T4BA 4FS3A 3ETGA 2FPIA 3DBHB 3ZU5A 4BQRA 4GAEA 4C7JA 2HK9A 2BHLA 3NGXA 3GC6A 4P4GA 3R3JA 1OMOA 4L8VA 3TQHA 3GHHA 1LA2A 2F00A 1PU2A 2DT5A 5A5EA 4BNGA 3KLMX 1EE9A 1YRLA 5A4DA 1WDMA 2GSDA 3A06A 3DAPA 1B16A 1Y7TA 4MJLA 5HBRA 1D3AA 3VKUA 4NBVA 4ALNA 3EVNA 1H94A 2RHCA 5JMPA 4BQPA 4BKQA 2VRBA 4E30A 5J23A 3LC1O 5ES3A 3KOUA 5KVSA 4EYEA 1R66A 3CSDA 1GZ4A 4NJOA 4R5MA 2SCUA 4XJTA 1ZK2A 5K0ZA 5DDIP 4CM3A 4BMNA 3DR3A 5G0TA 8ADHA 2Z95A 2YFHA 4CV2A 4JJFA 2WJPA 1PS0A 1BTOA 3QLJA 4PVDA 4NIMA 5CEEA 4BNHA 1WW8A 2GYYA 3RAJA 4JLWA 1ZO8A 2VNSA 2H1SA 4NH4A 1I10A 3I9MA 3D4NA 4L76A 2X5OA 4DC1A 1W73A 3H9GA 4OYRA 3H2SA 4LSMA 1EQUA 5JY6A 4XDYA 3ZWBA 5KKCA 1BDBA 1X0XA 4R9RA 1U2GA 3LF2A 3VTFA 2VWPA 2OBYA 4YAIA 4MVJP 2Y99A 1ENZA 4I9NA 4NFYA 4TKLA 5G0VA 2Q49A 4LRTB 4L75A 4I08A 4XYGA 2CVOA 5FFFA 4RVUA 2BF7A 4WASA 5A3VA 3GA0A 4HFRA 1N1GA 3ONDA 4GX1A 4E32A 1ZMOA 3BMNB 3GDOA 2WSBA 4Y6PA 2NVUB 1VM6A 5CEJA 3H9EO 3B70A 3PXXA 1E6WA 2UDPA 3HDJA 4GL4A 2Y0EA 2GF2A 4QTZA 1GD1O 3MTJA 1DC3A 3GEDA 4ID9A 3RBZA 1C0KA 4IXTA 3F1KA 3ZHXA 3I3OA 5CP8A 1NR1A 4ESOA 2O3SA 2O3JA 4E0BA 3DWFA 2PV7A 2AQKA 2Y1GA 2JCVA 5B4VA 1N5DA 1NVTA 2EP7A 4R4JA 1C1XA 2AA3A 3FNGA 4RO0A 5G0SA 3PIIA 4M86A 4RPJA 3WGQA 2NU6A 4R9SA 3FCOA 4RDIA 3DOCA 2G0TA 1WLYA 4DYDA 3DBVO 2P4HX 3E5MA 3ZH2A 5CDSA 4J6FA 3LLVA 3VKVA 2VWGA 3IQDB 3DXFA 3WNQA 1BXKA 3ZWVA 5DULA 2QX7A 3JYLA 4BHTA 3PP8A 3UCXA 3EZYA 1P74A 3DOJA 3FBTA 5IZ4A 3Q2KA 1WWKA 1DJNA 2YV2A 3ANMA 2W2KB 1I2CA 3CZRA 3HZZA 3RUDA 4YBZA 3AU8A 1BXZA 1E3LA 4IZIA 4IY1A 1U4OA 2O3QA 5CG1A 2ZJ1A 2AQHA 3MJTA 3TSCA 1WXDA 2PFGA 4M55A 1Z6ZA 2D59A 4I5EA 2OZPA 3ORFA 4D7AA 4HKTA 1KEPA 2W2LA 3L0DA 3NDJA 4C4OA 5JYFA 3WMXA 4E2YA 2EGHA 1ZEMA 1O0SA 3BZUA 3N7UA 4UUPA 1A71A 5LDHA 4MIEA 1GCUA 4NR0A 2EIHA 3TZKA 4Q3CA 4BKUA 4C7KA 1PL8A 3JQ9C 1NTOA 3GUYA 3E82A 4YVFA 5DCWA 1LSOA 3RJ9A 2UVDA 4DQXA 3MOGA 4DLLA 4PLFA 5JXWA 2X4GA 3PYLA 5IN5A 2OP1A 1PL7A 3TFQA 2LDBA 3L07A 3PIDA 4TVOA 2PKQP 1ULSA 3WWYA 1TXGA 1UZNA 1H5QA 1P3DA 1T2EA 2GPTA 1PJ2A 3VPSA 3BXXA 2O2YA 1VL0A 3ZNOA 4RLSA 2NU9A 3DZFA 3AWDA 2YDXA 1LLQA 4IDBA 4R68A 4W82A 5T73A 2G5CA 2Q2QA 1S7CA 4DBZA 2OGUA 4IS2A 2IODA 1VSUA 2WYVA 1DFIA 3VHRA 2FRDA 4MIYA 1LDYA 4RZHA 5JCJA 3GVXA 2DPHA 3JYQA 1RPNA 4FFOA 4I1IA 4NBUA 2W8ZA 2DBRA 1R4NB 3F5SA 3GEMA 3GZNA 2GASA 2QZZA 9LDTA 2G1UA 4CQLA 4TRNA 1PGOA 3DHEA 3BTUA 4CMCA 4JCOA 2EERA 1BVUA 2QRKA 1DJQA 5IDXA 1VPDA 2Q50A 8LDHA 1KEVA 3RFVA 3Q9UA 2BFOA 3FRJA 1B3RA 5C5IA 2X5JO 4PG5A 4K28A 2YY7A 3ADOA 4CQMA 1LSUA 1PX0A 4IJWA 4DMLA 3P7MA 1NX6A 1CETA 3TL2A 5KNLA 2P2SA 1H2HA 4DGSA 1YVEI 5A9SA 1W4ZA 4CL8A 5BT9A 3OJEA 4J1SA 4L0QA 3OQ6A 2D5AA 1U1IA 4E33A 5DCYA 1ZXLA 4WEQA 4XB2A 1E3JA 3JQFA 4TWRA 1CYDA 3RI3A 4CM1A 3ZWOA 3AJRA 1U4SA 2CF5A 2FMUA 3WQRA 5DCUA 3OHSX 4OH1A 4XIJA 1SBYA 1EFLA 5IF3A 4JJIA 5FF9A 2NTVA 2O3RA 3VH1A 1F06A 3WNVA 1P9LA 1FDUA 2DQ4A 1BW9B 1KETA 4FJ1A 4XQCA 5JPIA 4XQ9A 2ZKLA 3DO5A 3PLNA 3WOHA 3OM9A 4BV9A 1K0UA 1V3VA 3LF1A 2O3UA 4PZDA 3LU1A 5JW6A 5TF4A 4NU5A 2GLXA 3C1OA 4RPGA 3C7DB 4PLGA 4KUEA 5ENDA 1PJTA 5EL0A 4P4LA 4HFNA 1LEHA 1I36A 3WTBA 2ET6A 3PI7A 3AOEA 1PZHA 4DUPA 2OFPA 2TMGA 3OBBA 1YB5A 3C8MA 4OQYA 3FF4A 5U4QA 2DBVO 3FTNA 4Z9FA 4D79A 3DMYA 4AJEA 2PZLA 3JQAD 3KO8A 5DBFA 3P2OA 2YJZA 1H0KA 3QVOA 2TMDA 1P1IA 1QKIA 3GVPA 4CM5A 4E5YA 3AK4A 1UZLA 4ZGWA 2EWMA 4KQWA 1AN9A 1U5CA 4F6CA 1A7AA 1K89A 3BMQA 5CHEA 3JQFC 1NFQA 4J43A 3ZDFA 4QEDA 3DEYX 2HLPA 1DRVA 1ZIDA 2VHYA 2PWZA 4OHUA 4KUGA 5IDQA 2O4CA 2D2IA 2Z1NA 2W4QA 4CPDA 2G82A 2P5YA 2OUIA 4YPOA 4LVCA 2B36A 1IB6A 1JQBA 2NVWA 3BMOA 3PRJA 1H6CA 3JQCA 2C5EA 3MWDB 3ZWPA 2JD1A 4J49A 1H9AA 1N1EA 1JAXA 4S3MA 1GUFA 3O8QA 2VQ3A 4FGSA 1CIVA 1J5PA 1Q7CA 2JJYA 3F9IA 1T1SA 2D1YA 2H6EA 4TMFA 5CDUA 2E37A 4QSMA 1I32A 2VT3A 3LT1A 1XKQA 5JFOA 5JSFA 1LU9A 5KTKA 1WZIA 3HN2A 4HP8A 4WLUA 4CMEA 1CQIA 3PFWO 1IHYA 2ZTLA 1LLCA 2ZJ0A 3EDMA 2WYWA 1VKOA 2NSDA 3AOEC 1N2SA 3KEOA 3O38A 2BGKA 3LDHA 1IE3A 2OXIA 3WGZA 1RKXA 3AUAA 3TRIA 4AL4A 2J6IA 5L9AA 4UUNA 3RSHA 5M6DA 1O9BA 5EQDA 2V65A 3ZW9A 4DIBA 1J49A 3BAZA 4GSKA 2QRJA 1PZGA 2PTGA 4CM8B 4YCAA 5H83A 2IE0A 3NJ4A 3JQGA 3IUSA 4PG6A 1NVMB 3PDUA 1VRWA 1XCBA 4AJHA 5JC8A 1JWAB 1PR3A 1I2BA 3QE3A 5B12A 1SAYA 2YHIB 2ZCUA 3JQBA 2HMSA 1WPQA 4LRSB 1DXYA 3MJVA 2NQ8A 1TLTA 4PLHA 3OQBA 2VZ0A 5I8WA 2C07A 3I6IA 3AI3A 4U6SA 3C24A 3ROMA 3MWEB 4QUKA 2FN7A 1G0NA 3KRTA 3LVFO 4G65A 3DMTA 1ONOA 2I3GA 3QP9A 4YT5A 3NEPX 4KDEA 4FC6A 4IM7A 3PLRA 4U8GA 4IIUA 3ZU4A 5BSGA 4KZPA 3DFZA 1V8BA 5TT1A 2Q2WA 4IDCA 4CMEC 4PG4A 3V1UA 1M6HA 1FXSA 1HDRA 5IG2A 4JP3A 4TKMA 5TQVA 4WK6A 1DRUA 1RM3A 4BNLA 4Q9NA 5TX7A 4BNKA 1IULA 4UEOA 3KLPX 3I4CA 1KC3A 4EJ0A 3ZV6A 4YWJA 5L7YA 3V8BA 4CV3A 2VZ9A 1GZ3A 3GZ4A 4O6VA 4BO8A 4E13A 1ISJA 4XRRA 1MXHA 2NU7A 4DBVO 2HO5A 3EY4A 1SOWA 5I9MA 4F6LA 5H82A 4Y67A 4A5OA 4FFPA 3NDIA 2XF8A 4LCEA 5G0WA 2PZJA 5CDYA 1NASA 4HFJA 1HDXA 1EE2A 1PZFA 1WZEA 3JQBC 1XLTA 2OO5A 4CMAA 1B15A 4GKBA 4KP7A 3ICPA 4EJ6A 4P4NA 2X0JA 2ZB8A 5FYDA 1LUAA 1XWFA 3DQPA 3K73O 2NV6A 2ZYGA 4YJHA 2G76A 4R1SA 1T2DA 1HLPA 1IPFA 3L6OO 4M49A 2UUPA 3WYEA 4UVHA 1EK5A 2XAAA 3BMCA 3GMDA 1GYQA 2D8AA 4OQZA 4PLPA 4XX0A 4ZICA 1ZJZA 4B7UA 2VUUA 1C0IA 1ZCJA 3RFXA 4FR5A 4BO1A 3AOGA 4NNJA 3U5TA 4YJFA 5T57A 3GDFA 2X0IA 4F45A 3WS7A 4I9UA 5COBA 4E2ZA 4ZD6A 3PHGA 5C7LO 4ALJA 1BXGB 1X15A 3E1KA 1HE4A 1PWZA 3SEFA 3WQQA 4XD2A 5BSEA 3K6JA 1OI7A 3K9QO 1A27A 1LDEA 2CFCA 3GNTA 2DKNA 1NVGA 3NUGA 4OOFA 4MDHA 4CL3A 4WUVA 3UUWA 3ZNQA 5IXSA 2CVQA 1CF2O 3V5NA 2FSSA 3MJCA 3KV3O 1WNTA 4BO7A 1FDVA 1GQ2A 2W90A 1ADFA 3KSZO 4NZ9A 4BMVA 1R16A 2GN9A 4Q3AA 1Q1NA 1ZSVA 3IP3A 1A4UA 1HEUA 4N5LA 4FJ0A 3SBOA 3HDHA 1GFSA 1B8VA 4R1NA 4MVJF 4CMBA 4K9DA 3DBLA 3FHLA 5CAEA 4MVJM 1D1TA 2VWHA 3EK2A 4F3YA 3EHEA 4ZQEA 2D5CA 2VHWA 1AXGA 5MGBA 3LSYA 3GH3A 4PZEA 2WMDA 4ILKA 1YJ8A 3E18A 3FR7A 4RQTA 2X58A 4BO5A 1X7GA 5EERA 1DFHA 3KYDB 1F8FA 4IBOA 1GY8A 3MJ4A 2PZMA 3G49A 5EQFA 1M76A 2NWQA 2VNAA 2B4TO 5KJFA 4NJMA 3WGYA 5B1YA 5L51A 4N54A 1DAPA 4NQZA 4XDZA 3W4KA 4BGVA 4EZBA 3OP4A 3ZHZA 5AVOA 3ITKA 4YXFA 4ALIA 1N9GA 1XELA 4LK3A 3M2TA 4UVEA 2Y1FA 3AY3A 5JAIA 1GEEA 5JAMA 4Z6KA 1CDOA 1GCOA 1Z7BA 3PEFA 4TQGA 3UCEA 4I8XA 4JK3A 4QO8A 2EXXA 4TVBA 3GNSA 1Z7EA 1AUPA 2P9CA 2PR2A 2X9GA 5IZCA 4J1NA 1VL8A 2YV3A 2HMVA 3K31A 3IS3A 5A06A 1G0OA 1P77A 4RVFA 1ADBA 2AEFA 1SEVA 4J7CA 1UXJA 4B7XA 1WAMA 3S2GA 3ZZNA 4LSWA 3PZRA 2Y1OA 3OEYA 4OL9A 4AJLA 3HE3A 4PLYA 3VZPA 4DLAA 1U7TA 1RWBA 1P0FA 2J3KA 2X22A 4RV9A 4H7PA 3V1TC 2O2SA 3QY9A 1FDTA 1HL3A 3WWZA 4DWVA 1VJ1A 3ZV5A 5A9RA 3WGIA 3N58A 4BIIA 5DOZA 1OBFO 4D0RA 1FF9A 1DLIA 2X7HA 1KERA 3IOYA 1HZJA 2X1HA 4KUHA 3VDRA 5FEUA 3WFIA 1ZH8A 1Y1PA 4CLHA 4R54A 2Q45A 5A3JA 3JYNA 4FN4A 1HRDA 3EYWA 1XU7A 1MX3A 1DO8A 1DFGA 2E82A 4IGFA 1YQXA 5JLAA 1O94A 1QRRA 5U1PA 1W0CA 5L53A 1ZMTA 1B8UA 2JFGA 1S6YA 2YUTA 3ZWXA 1R0KA 2DBQA 5FI5A 3OSUA 1SB8A 3WICA 4IZHA 3KM0A 4GH5A 2VOEA 4TZKA 4XQEA 1Y5RA 2NADA 4CLRA 1LQUA 3G0OA 1LC0A 1BMDA 5IJZA 3ONEA 3KSDO 3I9KA 4Z0TA 4R01A 1NAHA 4YA6A 2GNAA 3NTOA 1FDWA 1U3WA 1M6WA 2ZTVA 1DPGA 1B2LA 1DAOA 2Y67A 4EITA 1UP7A 4LGVA 4FDAA 4E2XA 2FZWA 5G2OA 1U28A 4YJGA 1UUFA 4CM6A 3ETDA 4TSKA 1EUDA 1UAYA 3INGA 1H6AA 1SZJG 2XPCA 4NHEA 4YAGA 1VSVA 2F1KA 1P1HA 3K2BA 1YB4A 4FQ8A 1E7SA 4FFLA 4Y9DA 5L7WA 1ZNQO 1E5QA 1C14A 1QYVA 4NBTA 3PYXA 2B69A 1V3UA 3KUXA 1ID1A 2QQ5A 3OETA 4Z3KA 1C1XB 3H5RA 1QLJA 4GX5A 3TZCA 2CD9A 3RIHA 2X9NA 3ETEA 3U4HA 2Q1SA 1I30A 3QQPA 1MLDA 3D1LA 3SC6A 3QRWA 4RGBA 5G0UA 3Q6IA 1ONPA 4KTTE 4ND1A 4BNZA 5GZ3A 3Q3CA 3M6IA 2A4KA 2V6GA 1Y8QA 3KBOA 2YQ5A 3P19A 3HN7A 3DAGA 3D7LA 5JC1A 5JY1A 2EJVA 2DFDA 2A35A 3LT0A 3VH2A 4O5OA 3IAHA 3GDGA 4OSPA 1VJTA 2Y1DA 3C1TA 2AMFA 1PGNA 5BR7A 4LMPA 2VWQA 1PL6A 2IEBA 3WGOA 2C82A 5B4TA 3UH1A 4BO9A 2AG8A 3QSGA 4W99A 2AEMA 2BI7A 1PZEA 3SLKA 1Y6JA 4FOSA 5HRUA 1K5HA 4U0JA 4BO3A 2P91A 3HFGA 4XR4A 3HDQA 3DHNA 3WTCA 4P8RA 3A14A 2V6MA 3SJUA 3TN7A 1E77A 1ZBQA 4AJKA 3H7AA 3CE6A 2JCYA 3INTA 3B20A 1ZEJA 3DL2A 2QG4A 4ALKA 4BO4A 2BFPA 2RHRA 5KVVA 2IYOA 4GWKA 4UUMA 5KOIA 4OAQA 2AXQA 3GY0A 3SJ7A 1RM4A 1OC4A 4DQUA 1LLDA 2A9FA 1QP8A 5GZ6A 1U5AA 2P9GA 5DBIA 4AJOA 5JNLA 1LX6A 5FWNA 3E03A 4U5QA 3ONFA 4E5NA 4DC0A 3ZV4A 1ISHA 4BMSA 3WQSB 3DZKA 3GZNB 5ILGA 3JQ8A 1YWGO 1F8GA 4CQLB 4R51A 1YS4A 2YZ7A 4FGWA 1I33A 1RYDA 1MB4A 1UXHA 4RPKA 4DQVA 5ENVA 2BLLA 4UAGA 3DHYA 5DP1A 5BSHA 2EKPA 2YYYA 3IDSA 3JYPA 4ND3A 3KZVA 5JAQA 5BNIA 4IS3A 3C3XA 3B1KA 2P5UA 3O4RA 4CQMB 3UVEA 4BO2A 5JO0A 3NKLA 1R4MA 2YQ4A 4CODB 4B4VA 4O59O 3CTMA 1HDOA 3E9QA 1B3BA 3MTGA 5A9SB 3E6AA 2B4QA 2Q4EA 4G2NA 1U3TA 3T7CA 4JX8A 5J9GA 3RBVA 4INAA 1NHWA 4MVJH 4IUYA 3T4EA 3LT4A 2PLAA 2JHFA 2DPGA 2AEJA 1NFFA 1SO8A 3L77A 4MVJG 4IMRA 3L4BA 4JXKA 3F4BA 4KTVE 4J2OA 2GN8A 4R1UA 2QYSA 1KC1A 1LI4A 1ORRA 3KETA 1FDSA 3JQDA 3U49A 2VYND 1XSEA 4YTEA 1U3VA 4XYBA 1XYGA 2IDZA 3FPLA 4H15A 4RF2A 2V6FA 3QHAA 1AE1A 3JTMA 4YRDA 5KCZA 4QXMA 1A4IA 1PGJA 4DIFA 2QW8A 4KOAA 3K8ZA 5JYEA 2HRBA 1DSSG 3C7AA 1EVJA 3Q9NA 1JDJA 2J5RA 5U9CA 3X2EA 2I3AA 1ZK1A 2OOSA 4XA8A 2VT2A 2WWRA 1DBVO 5BNTA 2YFQA 2Q1UA 2EKQA 1YL7A 5T6BA 5KJ1A 3OIFA 1Q7GA 2R6JA 4CUKA 2NTJA 5F1PA 4PLWA 2DUWA 3IL2A 1HE3A 1WMAA 1X7HA 4EI2A 5KVCA 1EVZA 3C85A 3WJAA 1EK6A 4GGPA 3DC2A 3RFTA 5L45A 1UJMA 3WLFA 1NPDA 2ZCVA 2DTDA 3PTZA 3ITDA 1EZ4A 5H81A 3JD0A 3Q0EA 3CZMA 4ND2A 3NRCA 2GN6A 1JU9A 2W98A 4IQ8A 2PGDA 3QVXA 1KY4A 1X14A 2E49A 2VHZA 1M2WA 3BMQB 5AYVA 2X86A 1BSVA 4CMGA 4RPLA 4PLZA 3ROQA 1R0SA 3U09A 3STHA 4MVJD 3D4PA 3L4BC 1R12A 3OICA 3E5RA 1QV6A 4WLEA 4CMKA 4MINA 1HT0A 2DBZA 1Q0HA 2RBEA 3BMOB 1UXGA 3OMLA 4M54A 5JMWA 1DLJA 1ULUA 1KS9A 2CDCA 5A9TA 3PGXA 5TJHA 1HLDA 2C0CA 3ROKA 3O8QB 3ROPA 1SEPA 2C29D 3ZW8A 4ND5A 2A94A 1DB3A 3GAZA 5I9NA 3GG2A 4LN1A 3JD1A 2IXBA 4BNWA 1TT5B 3LLSA 3U4CA 1MC4A 4JP2A 4EDFA 3GK3A 3LZ6A 1E92A 3G79A 1GQQA 2VYVD 2RIRA 3TPCA 1TI7A 1CRWG 5F3RA 4J7UA 2RH8A 3PJGA 5ITVA 4GBJA 1Q0QA 2BD0A 4ZQBA 4Z9YA 1T2FA 3FI9A 2JKVA 4ZRMA 1XG5A 4B4WA 2OL4A 1X7DA 5ER9A 4HNGA 3NT4A 1DIRA 4IDEA 2NLOA 3GT0A 1YB1A 2X9VA 3F47A 4KQXA 2LDXA 1KIFA 4WLOA 3LC2O 2X8LA 1LTHR 3OJFA 3RVDA 1RYEA 1UDAA 4BL5A 3EMKA 3A28A 2HAEA 3LK7A 4PFJA 3JQGB 3BTVA 3PVZA 5A05A 2PKQO 3QVWA 2WTBA 3CKYA 3WSWA 2FR1A 3I6QA 3V2HA 1BVRA 3TWOA 4IJUA 1E3WA 2QZ9A 1LDMA 2ZIZA 2HMTA 2BFMA 1EBUA 4YT4A 4XZ3A 3CINA 3DAFA 1EDOA 4CMJA 5L4LA 3OF2A 1EVIA 1E1LA 4ALLA 1UAGA 1DRWA 4EGFA 4YJDA 1PS8A 1MUUA 4MP8A 1IYZA 4CUZA 3E8XA 4OMUA 1QMGA 2EV9A 4BNIA 4IDAA 4MKXA 3HADA 4EEZA 5A04A 1YXMA 5IDYA 1KVRA 4OIMA 3W4IA 4PRLA 4RZIA 4NK5A 1TT5A 1PQUA 1UH5A 1T26A 1TEHA 4FFMA 3O26A 3OJ0A 3M2PA 3WLEA 1YBAA 3P2YA 3D3WA 2PD6A 3FNHA 2WD7A 2HJRA 1MA0A 4UVGA 2EF1A 1LSJA 1PEDA 3D4OA 4PN3A 2H63A 1NWHA 1PJQA 3RCBA 1P45A 3WSVA 3MEQA 4DL9A 1ENOA 1YE3A 3I4FA 4N5MA 4P22A 1E7QA 1H2BA 5TRTA 1GPJA 4DYVA 3Q2IA 2Y0DA 4KMSA 3WGGA 1N7HA 4J1TA 3PQFA 1P1FA 3L4SO 1M67A 3DZHA 3AUSA 5HS6A 4BOYA 3V2UA 3DBRA 3RQSA 1VE9A 3WMWA 3VPXA 1PS9A 1SMKA 4JGBA 2CDAA 2PD3A 4GQAA 3QWAA 4PRKA 3RKRA 4D45A 1C0PA 1HXHA 1E0DA 4KDFA 3O9ZA 2FWMX 2HU2A 1NM5A 4NG5A 2X23A 4YJHB 4AJNA 3IC5A 4LMRA 5COAA 2NACA 1SNYA 3ABIA 3VPGA 1VKNA 1VJ0A 5L4NA 4IIVA 4A73A 3GGOA 3MOIA 1M66A 1WDKA 1A9ZA 3BMCB 3GGGA 4XWYA 4DIOA 1GYPA 3S2IA 1GEGA 3GPIA 2O7SA 1U2DA 3JQAA 3GLQA 3O03A 4DRYA 1Y5MA 2PH5A 1HKUA 4BB6A 4YJFB 1RM5A 2G17A 1DIGA 4I9HA 1B14A 3L6EA 1R37A 1U7HA 2GO1A 4FD3A 4HWKA 4D3SA 4FBGA 3QWFA 4PZCA 2CZCA 3D64A 1ISGA 4BNVA 3UKOA 4J16A 4RCVA 1FMCA 3WBFA 1R6DA 4E4YA 4NMHA 5JS6A 4IQGA 4B79A 3D5TA 3EGOA 4DLBA 4QX6A 1PJSA 3E9MA 2ZQYA 5IXYA 4XKJA 3KYCA 4CMIA 3GN2A 3JYOA 3PWKA 3I52A 4J9UE 3T7EA 4EJMA 4XB1A 1DHTA 1ZK4A 1JLLA 5THQA 5I7EA 4BGUA 1HE2A 4E5MA 4PVCA 2J3HA 4K26A 3PYMA 1SC6A 4D3FA 1PQPA 2EJWA 2FHSA 3AU9A 4YR9A 1I0ZA 2ZTMA 2DTEA 1DIHA 1LXCA 2Q2VA 3DBLB 5DZSA 4CM4A 5EINA 1KVTA 3U62A 4A2CA 1KOLA 1IOLA 3F6YA 2I76A 3GOHA 5JAZA 4ITUA 3HFSA 1QSGA 2JAPA 3IP1A 4UREA 3WR5A 5KJCA 4RF3A 3DMTC 4BNYA 4YAJA 3HDYA 2E48A 1OOEA 1PJ4A 4XCVA 1ISMA 4R5HA 4B8ZA 1IHXA 2P9EA 1KEWA 2EHDA 1IZ0A 3NDRA 4AJ1A 2GRAA 1K6IA 3JD2A 2IRWA 4M8SA 1JN0A 3VDQA 4NJMB 1ZFNA 1DHRA 5BQFA 4QECA 2WE8A 3WYCA 1UP4A 4A10A 4GSLA 1K6JA 3GVCA 4DVJA 1KVSA 4CLOA 2QIOA 4D46A 4Z9XA 4CV0A 4CR7A 2FSVA 3RKUA 1U3UA 2CNBA 2FOIA 1YL6A 1N9GB 1NXQA 5I8ZA 3VPFA 4E12A 4BS9A 7ADHA 1NNUA 3GRPA 2EG9A 3KHUA 2FR0A 2JD2A 4JBIA 4WCFB 1YGYA 3ASUA 3GUCA 4NU6A 3EC7A 1IZ9A 4EW6A 2AHRA 2B4RO 3UAGA 4M87A 1C1DA 3ANNA 4WE3A 3I9NA 5CPBA 2ZATA 1GL3A 1QYXA 4CLXA 4J7XA 5G4LA 4CV1A 3RC7A 2I6TA 1ONNA 4IGEA 1BWSA 3AM4A 1P31A 4RQUA 3OA2A 2FZEA 4K1LA 4MP3A 1LC3A 1LRKA 3ULKA 1HWYA 3JSAA 4J9VA 4BNFA 3HQ4O 1E5LA 1PQWA 2J8ZA 2HK7A 2BKAA 3UGKA 4GI2A 2GZ1A 4B4UA 4UVIA 2WDZA 1NWCA 4ZN6A 2C59A 2Q1TA 4ZA2A 2I67A 3PGJA 2JFFA 4YRBA 3OIGA 4E31A 2CMDA 3OEWA 5JYDA 3FSRA 1T1RA 2DM6A 2VUSA 4DPKA 4O63O 2PK3A 1ENYA 3BTSA 3TZHA 5LCXA 3RUFA 4WOKA 2IZZA 1L7DA 1HDCA 4BGEA 3NTRA 3OQ1A 3WIEA 3UN1A 4EUHA 1E1NA 2C54A 1GYRA 1YBMA 3R1IA 1P0CA 1FK8A 1HE5A 2C20A 5F5NA 4RVGA 5HTOA 2ZB3A 4BKPA 4KWIA 1NQ5A 3OECA 4WCFA 3H65A 2J3JA 4CLRB 1V3TA 4R16A 1NQAO 2VHXA 3JD3A 3PHLA 2NTNA 3B1FA 4GPD1 1J6UA 1FJHA 3VH3A 1J0XO 4NI5A 1PTJA 2UAGA 1PGQA 4JQCA 1PGPA 4UULA 2UYYA 5DP2A 2EP5A 5JBIA 2O48X 4GKVA 1JVSA 1CERA 4B3IA 4YJGB 3QJ5A 2Z5LA 3HSKA 3CMCO 1ZKMA 4H3VA 2E4AA 3ZWAA 3L6DA 4JJGA 4J91A 4WGGA 5KIAA 2X0RA 3BHIA 4LCJA 5CG2A 4FIZA 4QFCA 2B35A 4JBGA 3KVOA 4CJXA 2IZ0A 3ZNNA 1R0LA 1EDZA 1XA0A 2EEZA 1AHIA 2ZYDA 3N74A 4ONEA 4AJJA 3GFBA 3RWBA 1O95A 2X5KO 1ZSYA 4M89A 1GU7A 1K6XA 1PJLA 5ILOA 4BNJA 1OFGA 2R2GA 4GMFA 1L7EA 2VN8A 4MVJI 3FD8A 2RAFA 2FPGA 4FC7A 3GHYA 5AXAA 2GCGA 1DIAA 4O0LA 3ZN2A 2NQTA 1LDBA 4K6CA 1Y8QB 1NQTA 3MJEA 5IN4A 1NPYA 2EW8A 4GX0A 4E5KA 1ZSNA 2GUGA 3JQ7A 5EIOA 1YOVB 4RPHA 3FBGA 4WCFC 3U9LA 2Q46A 1VI2A 2Q1WA 4IDGA 3VTZA 2Y0CA 4BGIA 3NGLA 1EVYA 1B8PA 3UCFA 4BNXA 1WVGA 5IZCC 4IJVA 4ZJUA 4A27A 5MDHA 4U0KA 2P68A 3BYZA 1ZK0A 3DZIA 5G4KA 3UHAA 4HFMA 2R00A 1E3EA 2XXBA 1Z82A 2VRCD 4IJKA 1Y8RA 3R0IA 7MDHA 3S1LA 4GLOA 3R6DA 5JE8A 3W1VA 4BKRA 3MJSA 4Y6SA 5DT9A 4BO6A 2AQ8A 3B6ZA 2V7PA 3RBXA 3DOOA 3HB4X 4WEOA 3HG7A 4BUCA 2GDZA 3HB5X 3X2FA 4WNCA 3KXDA 3AUUA 4CMHA 2D0IA 1PJ3A 4ZQGA 4B3JA 3GFGA 1D1SA 1JKJA 5L7TA 3TFOA 3PZBA 3RU9A 4XR9A 3OA0A 5TC4A 2A92A 3VZSA 4FCCA 1E3IA 1ZVMA 3T4XA 3ZHYA 4HADA 1HETA 4B7CA 4TZTA 2HMWA 4HNHA 4YAKA 2CY0A 3AFMA 1NP3A 4YQYA 3U3XA 1MC5A 2I65A 3JQ8B 3GAFA 4L4XA 3RROA 3S8MA 1QORA 4YT2A 2GZ2A 2GD1O 1O6ZA 1MGOA 2H5LA 4PG7A 2Z1MA 3F5QA 3ON5A 4OSOA 2W2LD 1YOVA 1PR9A 1J4AA 3D3EA 3UW3A 3LQFA 5F1OA 2I9PA 1U9JA 3ZGYA 1I3LA 4XRGA 1V9LA 3RASA 1NPTO 2CF6A 1R4MB 4H16A 3WIDA 3DTTA 1HDGO 2R00C 1W8DA 4OXYA 2C5AA 2X6TA 5TGDA 4EBFA 4XQGA 1B7GO 4II3A 3ZWMA 5HA5A 4DPLA 1JVBA 1P33A 5BNFA 1DC5A 1KY5A 3H4VA 3U4IA 4GWGA 4Q3BA 3SXPA 1N7GA 3RJ5A 3PDJA 3DB2A 3CMMA 1UXKA 3DBHA 3P5SA 4FPXA 2BELA 2ZK7A 1DC4A 5AXDA 3JQEA 1D8AA 5AQ1A 5JCJD 1MFZA 3H9JA 1WDLA 1I5RA 1YBVA 4NK4A 5C37A 2DAPA 4DA9A 5LDGA 1UP6A 1V0JA 4IXWA 5C7IO 4HBGA 2FP4A 5IDWA 4NFSA 1CEQA 1SCUA 4CR8A 1GUYA 3JQ9A 2HK8A 2J3IA 2C7VA 3TDKA 1ML3A 4IMPA 2DTXA 4AJ2A 1YKFA 2VRCA 5ADHA 2VUTA 5EESA 4FFRA 4FB5A 4GX2A 1O8CA 4MPDA 5JYAA 4CQMD 4DTIA 5CFZA 4OM8A 3FTPA 1V35A 1WMBA 3FN4A 3ZWCA 3G3EA 1SPXA 3JD4A 6LDHA 6ADHA 3PK0A 1H93A 3RUCA 1GTMA 3NX4A 3VZRA 3I5MA 4U7WA 2VTDA 3GNQA 2B37A 4QT0A 4WJZA 4UVDA 3PQEA 3H5AA 4MOWA 3QVTA 4Q39A 3GMSA 4ROSA 3WX0A 1O89A 4YYZA 2IEDA 3SVTA 4OXNA 1GPDG 1LRJA 4L74A 4RF4A 3GEGA 2EKLA 4YACA 2D3TA 5L95A 5HM8A 4LISA 3VOSA 4EUEA 4I5DA 1MP0A 4ZQHA 1N92A 1G6KA 4DXHA 2PD4A 1NQOA 1EFKA 1ZZEA 3KSUA 1ISIA 1NYTA 4A26A 4YT8A 2DC1A 2OHXA 4S1VA 1KBZA 1VL6A 3WXBA 4B3HA 3F1LA 2RH4A 1DOHA 1YO6A 1RJWA 4E2WA 3BMNA 2NVUA 4YQZA 3FPCA 1JKFA 3OIDA 1OAAA 3TZQA 2HCTA 1DC6A 3FNEA 1DIBA 4R1TA 5C7OO 1MG0A 1K2WA 2BH9A 5ICSA 3H3JA 2NVBA 3IJRA 4FJ2A 5LC1A 4EEXA 3PPIA 4XYMA 5AXCA 5A02A 1E6UA 1D4FA 1GV0A 1YJQA 3BTOA 2O23A 3WBBA 3K96A 4HV4A 2WEKA 2C2XA 2FY8A 5DOVA 3WDSA 3D5QA 1EUZA 1CQJA 1Y81A 4G5HA 1MXFA 1GZ6A 4DMMA 3D0OA 9LDBA 1XIVA 1BG6A 2EGGA 4PIVA 2GGSA 5EMHA 3K2EA 4OGWA 1ZJYA 2BI8A 2IZ1A 1EMDA 3DZBA 3ST7A 3BHJA 4F46A 1E3SA 2OP0A 3PHIA 2PH3A 1ENPA 3KYBA 4GVXA 2W2KA 4HY3A 1X0VA 1LJ8A 2B5VA 1HSZA 3H9QA 5GZ1A 1B0AA 1E3WB 3EZLA 5AOVA 5EJ2A 1Q2XA 2ILTA 3NAQA 2GERA 5HWSA 5THKA 3GR6A 5A1TA 4Z0HO 4NFHA 3RUAA 2POQX 1ARZA 3S2FA 4M1QA 3M1AA 4J90A 4D44A 1A72A 2AG5A 2JL1A 3ZU3A 2QHXA 5F5LA 3VVCA 4AJ4A 3LT2A 1YL5A 1XQ6A 3UOGA 3VC7A 2JHGA 1O5IA 1TB4A 3NTQA 3ICCA 3UXYA 3GPDG 3AI1A 5I7FA 1XU9A 1YONA 3VVBA 3VZQA 4AJPA 1JA9A 4X54A 1VLLA 1UZMA 4FFNA 1PSDA 3CEAA 1HTBA 4RDHA 2GZ3A 1P1RA 3PJDA 3V1YA 2I66A 4J4HA 4XYEA 1UDCA 3I83A 5KWEA 2DFVA 1T4DA 4AJIA 3WB9A 5JDIA 4Y6RA 2JFHA 3WG9A 3GQVA 3D3WB 1DDOA 2WD7B 1BDMA 4RVHA 1JAYA 2DVMA 1RM0A 4OKNA 5IAAA 4GLLA 1H6BA 3K30A 3IKVA 4MKZA 1A5ZA 2HKIA 4DPMA 4E21A 5TIIA 3SLGA 3GGPA 4D42A 3AY7A 4R69A 4D41A 4QO7A 2VYNA 4HXYA 1YQGA 4WLFA 1ZXBA 1NAIA 4JN6B 1H6DA 2ZB7A 4XIYA 2Q3EA 4XGNA 1E7RA 4HX5A 1GUZA 3BA1A 4QQRA 3UICA 4CM9D 4FW8A 5I7SA 2B5WA 4W9NA 1R4NA 4FSHA 2GR9A 3DBRB 3H8VA 4AICA 1JKIA 2H9IA 1HYGA 1T25A 1C0LA 2PGJA 4XJSA 4LW8A 3W8DA 4CUJA 2HUNA 2JD0A 3ZWNA 1I3KA 3CH6A 4GMGA 4NBRA 2Q99A 5CDTA 3ZI0A 3JV7A 3RC9A 3RC2A 2O3TA 2V6BA 1UXIA 4OKIA 3ZWYA 3S2EA 3TNLA 3CUKA 1F12A 3RUEA 3ZHBA 4AVYA 1DEHA 3I1JA 5CEFA 3AM3A 1EUCA 1ISFA 2IYPA 1A9YA 3L9WA 3FNFA 4PLVA 3QWHA 3QIVA 5I9LA 3JQAB 1EBFA 1XGKA 2D4AA 1F17A 3K92A 3EUWA 3KB6A 3RUIA 4BB5A 3VPHA 3F3SA 1TVEA 4WLVA 1LLUA 4EUFA 1XHLA 3FWNA 5JDIC 2Q4BA 3RD5A 5L3ZA 1HYHA 3W6UA 2Y1EA 2PZKA 3AM5A 4MP6A 5DN9A 1GAEO 5KJEA 3GVHA 4MVJA 4WNIA 1CWUA 3DTYA 2NUAA 1BW9A 1MG5A 5AXBA 3KYCB 4CMIB 2BFAA 3ADPA 4RLHA 1Z74A 1XEAA 1Q7BA 4J3FA 2DU8A 4HUJA 4Q3DA 3HNPA
chains in the Genus database with same CATH superfamily
1EM6A 1DWQA 1LPBB 4MQ4A 4PG8A 1J33A 1E5DA 1O96B 4OIFA 3ZV3A 1KHHA 3AGQA 4YAEA 3WGVA 4F5YA 5I01A 3IUJA 1HOTA 2R5NA 1XF1A 4X1YA 3HVIA 5GMOA 2Q2OA 2OC4A 1T1JA 2Q5EA 3HFJA 4L08A 4K6MA 3L4JA 1XTPA 4NBWA 1MT0A 3QZUA 1TLFA 3NHLA 2CLSA 5I7VA 5B6JA 4LAFA 3ZZ0A 1W8IA 4LVUA 1LTQA 5CNMA 4BJHB 1XTVA 4M8IA 3U17A 5TLSA 4UEKA 4GWLA 3NNSA 1KKUA 1QO9A 1RJGA 1YBFA 5CW1A 1KAGA 1W1WA 1RKUA 1ZH0A 3QKRB 3QTTA 4WOJA 2DJIA 4MCHA 2XT9A 1NVBA 2PY6A 2ZWOA 1IQ0A 4GS5A 3TIIA 3HXMA 1T0HB 2OHFA 5IFLA 3EYAA 1I3NA 2B0JA 5L3RA 4JI6B 3FR8A 4EYQA 4F60A 3K9FC 3D6VA 4IO1A 1P44A 4YB8A 5F1KA 2VP4A 1J9GA 1R15A 4WECA 4W4TA 4KB5A 3ZHTA 3GRKA 2OZLB 4OHXA 2VQFB 1CVRA 5HUHA 2EX0A 2P4QA 4RL6A 4CM9A 3ER6A 2EFJA 3Q0IA 1LD3A 3EAQA 5IT5A 3VHLB 1ZUD1 5JD4A 2PA3A 2ZU0C 3V9PA 3QOWA 1KE1A 1LRLA 2CUKA 2XA9A 3OT4A 3COSA 2J0EA 3A70A 3CS3A 4LHZA 5K8LA 3INRA 3L7KA 3L2OB 3QOXA 1G3MA 4GC5A 1XWWA 3RKSA 3TSZA 4TT3A 3NS7A 4XM0A 1FJXA 1AKYA 4MAMA 2GEBA 5JNUA 3M34A 2QLFA 1N25A 2CSUA 3FVRA 3VC3A 2NSYA 4LZOA 5HK8A 3L6UA 2O4UX 1QDLB 3BF7A 3FZEA 4WCDA 4MVYA 4BB9A 3HRIA 5L40A 4XYLA 4RL4A 1GDHA 2OSVA 4AG3A 4HWTA 4DCNA 1NUPA 3U26A 4HGQA 1I6WA 3FSGA 1WY5A 3ANLA 2R751 3GN1A 3CFYA 3KCNA 4YDRA 2J7PD 2PH7A 3UMMA 3LTNC 2A67A 5E6UB 1CB7A 1JV2B 4C3ZA 4F5WA 3MTQA 3AUTA 5LD2C 1NM5C 1TJ4A 3LLUA 4B6GA 5T64A 1QR6A 3NHWA 2Q7DA 4JR1A 4C20A 3T52A 3SU8A 5KNDA 1OFUA 3WJ7A 4GEKA 5LU8A 4OXKA 2XNDD 3K5PA 3QWIA 3I9LA 4BPRA 3CRNA 1N33B 5KJ6A 5C18A 4C0SA 4O4IB 2WABA 1QKKA 2OXTA 4MCAA 1OH7A 2WTUA 4GSYA 1WRBA 1E9RA 2YW9A 4J2HA 1MB3A 1XZHA 3ZY2A 3QV1A 1S9DA 4NS1A 4D99A 5AUNB 2BSQA 3R0ZA 1GTJ1 1N3BA 2OWDA 5HFNA 1NLFA 2YHIA 1EWVA 3PL5A 3F46A 4ALMA 5IP5A 1DAHA 4GPZA 5CDGA 1EINA 3VHQA 4L4UA 1CG6A 4YO8A 3T3DA 3WXMA 1XF9A 5F5XA 3KB2A 5KYWA 2BRUA 2GZRA 5J47A 2NXCA 3BHNA 5CXSA 2VOJA 4PLTA 3GLUA 3MCUA 2J9FB 2AJBA 2OORA 3JAWA 2NYUA 3MWEA 4LCBA 4UOEA 3VVLA 4S35A 1K92A 2C2YA 1BX3A 1QV7A 3JZMA 5AVZA 4X65B 3BGVA 5EFZA 1QQTA 3NWJA 5TPWB 3D02A 5BWLA 1A8IA 1MAVA 1X1CA 2WT9A 3KQPA 1ITZA 3V7UA 3M1LA 4R84A 4NDAA 1EEXB 2F6RA 4U6QA 4W8OA 3UMVA 4ZHSA 1GIAA 3C3JA 4W5OA 2WU0A 3ECCA 4J0FA 1X9HA 3H1AA 2FH5B 3ZJTA 1Q1BA 2ZBQA 3I9JA 1NFRA 3PV0A 4RNDB 4BEJA 4FOOA 1OR8A 3SJAA 1VGRA 4LBWA 4B83A 3KOOA 1RMYA 2HJHA 3AY6A 3UAXA 3IJPA 5EHGA 4MO2A 1AS2A 2EW2A 2ONKA 5CPFA 2O50A 1J42A 2C99A 1JEOA 1ZM3A 2G8LA 3A9WA 5HMMA 1LDNA 4II2A 3CE9A 3U6KA 1EAYA 3AEUB 1E7MA 2FZ4A 5A4FS 3H2ZA 4IGIA 3QEBZ 2IOFK 2P11A 4QQNA 2EQBA 4L9AA 4Y7CA 3E9NA 3NG1A 2FV8A 1SVMA 2Y93A 1NN3A 3C87A 3UAWA 3HJAA 1LCIA 2C98A 4HO1X 1TRKA 4Q34A 3HY6A 1P3JA 5LA6A 1KBQA 1NJ1A 1OC2A 1OXKB 4LRQA 1OV6A 5PNTA 4D43A 2YZMA 4DJ5X 3ES9A 1W85B 4QFBA 4U9UA 4Y2SA 4BVFA 1O94D 1KYQA 2V4MA 2W6NA 4OUDB 3WGJA 4WXMA 4NCNA 4E5PA 1F8UA 3OZUA 3AVVA 1SKUA 1XR3A 5AI9A 1L5FA 1TADA 1WE2A 2HMYB 1E1MA 3ND7A 4ZCIA 1P9OA 1YA6A 2FDCA 1NULA 4H1UA 2ABWA 5LLDA 5FFNA 1P75A 4HDNB 5LQCA 4Q47A 1O6BA 4UQOA 3HVRA 5FWYB 1P7CA 1U94A 3LVQE 1CRQA 5T8KA 2XUKA 3NQ41 3Q4GA 3MCVA 1IUKA 1O0CA 1BRMA 2ZYVX 4UXIA 4A7PA 3W04A 4DIKA 4QKQA 4J4BA 4JEHA 3P2IA 1U0JA 1MOPA 2ZU6A 3O2NA 4CKEA 4DAEA 2AK3A 2I34A 4OVKA 4DF3A 4G56A 1QYCA 2WM3A 3HUFA 1I4TD 3HMKA 2BDEA 2Y68A 1YUMA 2PIAA 2R5WA 2VDUE 2WJGA 2NX2A 4ND4A 2Z58A 4LBYA 3ZTYA 4IP0A 1W5BA 2I5PO 2FEWB 2G1KA 3GV0A 1BXGA 2WU1A 4JBHA 3SOZA 5EYPA 5GM1A 3VGJA 3VR5A 3TQIA 4DLWA 4EKEA 2XXAA 2OYSA 1LW7A 4U3JA 2BGNA 3F2IA 2YNMC 2IVFA 1L4LA 4JOCA 3CEPB 2YHUA 4TRRA 4EO4A 4KPFC 1YZUA 1E6EA 2Q0SA 2AOXA 3LPAA 3T41A 2UXBB 2O2EA 1Y4ZA 2IY7A 3RUPA 4WKBA 2QD1A 4FYJA 3KNZA 3AW9A 4G81A 4Q1BA 1K7CA 1OXTA 1Q14A 1RAGA 5G1PA 3NHPA 4NDNE 3BGOS 4KFUA 4F3TA 2E85A 3MZ0A 1T2CA 3LYLA 5AMXA 2C2BA 3W9UA 3C3BA 1PJBA 1X2EA 1L5GB 3SEAA 3X1WA 1Z7GA 4AYWA 3UATA 4WGFA 1MFPA 1JKJB 4R2LA 2P6UA 4B3SB 1JQKA 3A1EA 3H1FA 3EXEB 4PQGA 3WMEA 3WYBA 3A37A 3R3SA 4LX0A 1TJNA 4JJ7A 1WP4A 2PT9A 1RWKA 2YJNA 5EJGA 3RK4A 3JQRA 4D6PA 4X8MA 3QBVA 3DEKA 3EAGA 3TQFA 3UA3A 5HS4A 3H3FA 4GOLD 1Y63A 1HL7A 4HNRA 4K9SA 4BQFA 4RF5A 4UNQA 5H9WA 3OJOA 2GD0A 3A3KA 2J3QA 3A26A 3KYDA 1SOAA 4D26A 1IY8A 4KPYA 4G0XA 2AE1A 3A4VA 3N0WA 2G9ZA 3MBKA 1F3OA 1REQA 4J03A 1H1LB 2H2GA 3G1UA 2OT3B 3U4DA 1GNLA 1Z29A 3C8ZA 2CV2A 5ETJA 3LFTA 5TMEA 5LB2A 1LDGA 1UBSB 2WE7A 4HAVA 1L8AA 4DIUA 5JEDA 3NB0A 4HN2A 5JH7A 4QJBA 3FPKA 2IYZA 3H19A 4MIOA 1ZK3A 3QA9A 4EL5A 3KWJA 2A30A 5DN6A 1SURA 1Z0JA 4NONA 3RYFA 3JQ6A 2W11A 3M70A 2X3UA 7AT1A 3K0BA 3NJ8A 3A36A 2PKCA 5JNRA 4Z3DA 2HQOA 4BNUA 4FS3A 2KWIA 2BFEA 1FYXA 1JZTA 1UJNA 3T3EA 1K0FA 4BQRA 1UEIA 3DPUA 2HK9A 2E7ZA 4K5QA 4P4GA 4AXBA 4MQUA 5KO2A 3F67A 2ZI9A 4L8VA 1J22A 2X9LA 3GHHA 3TQHA 2C2GA 3GLVA 3RDPA 3RS9A 1JXQA 1S7GA 2AI3A 2RHHA 2REQA 5EKSA 4Y6QA 1P62B 3SS7X 3OIVA 2GXSA 2OUKA 2RGCA 1L4GA 3LC0A 4BNGA 5BXQC 5CU7A 3SD7A 1YRLA 5A4DA 4X7PA 2BZ1A 3TTUA 5BOSB 2IYSA 4ZVSA 2Z56A 4BFVA 2JG3A 1B16A 1X94A 1MH9A 4G0OA 1V5GA 2V1XA 3GX1A 4FK8A 5IAJA 3RAFC 3TLGA 4BMZA 3B5EA 3VKUA 1ML4A 3IAS6 5BQOA 3JR3A 4BKQA 3E9CA 1RBMA 4Y2QA 5J59A 1RLMA 4HSGA 1OFIA 4MRAA 3KTFA 4EYEA 3FDFA 2E3JA 2GCOA 3R41A 4J0HA 4BAGA 4R5MA 4XJTA 5K0ZA 1WPXA 2FF7A 4BN5A 2Z95A 3Q40A 1NXTA 4BEVA 5EJ4A 5J43A 4NCBA 3ORHA 3U3DA 1SULA 4JP8A 2QP9X 3SVLA 3E22A 2HHAA 2VBFA 4NIMA 5ISMA 4NXMB 4AY5A 3DLAA 4R31A 3ESYA 4C4SA 4JFAA 4N6OA 3TW3A 2JIZA 2GYYA 1EESA 1ZO8A 3HCEA 5DTRA 5BQXA 4WESA 3KYJB 1TPZA 2PRYA 4NH4A 4AROA 4LHXA 1H9CA 3SF0A 3D6JA 3D4NA 4L76A 3WYNA 4DC1A 4LMBA 1YS7A 1E1DA 3IOBA 5HRCA 4QBIA 1EQUA 1AKUA 2ZRFA 4ZJZA 3WDMA 1BDHA 1L7MA 1E2PA 4R9RA 4C03A 4TKVA 3VTFA 1J0BA 1MO3A 2OBYA 4ON9A 4MVJP 2Y99A 4I9NA 3H9BA 4TKLA 2Q49A 1OW3B 3KJGA 4KJXA 1FNBA 4TWJA 5JAHA 4L75A 4I08A 1E6MA 1ZM4A 2C5BA 4HB3A 4QDZA 2BF7A 3GARA 5FFFA 5DX8A 5IJAA 5IVIA 4GX1A 1E1RA 1GU1A 4ZJPA 5LYYA 4IDQA 4Y6PA 2NVUB 1XN1A 2PRKA 2XD9A 3DHWC 3H9EO 3AKYA 3CT6A 4AKTA 1M2OA 5AVRA 1E6WA 2BM1A 3UANA 1UZAA 3DD1A 2RHBA 4G8BA 5EJ5A 4IIJF 5DYNA 4AKGA 2GM5A 3T1HB 3VTAA 4AZ3B 2FUEA 2GF2A 3LMKA 4OFBA 3VSDA 4C05A 1NBIA 5B6PA 1NUHA 4LSZA 4DE5A 4LJ7A 2AMVA 1RHQA 5CJ2A 4H7FA 3HYCA 1DC3A 5K8CA 1HK7A 4ID9A 3VTKA 3DWGA 1KP3A 4DNQA 4IXTA 3F1KA 3K1ZA 4JJKA 3I3OA 5MN6A 1XTBA 4LJ9A 1A8HA 1NR1A 1X92A 4JUBA 4A2QA 1M6EX 2NZ2A 3TD6A 1D0SA 5D51S 1RYYA 4HD8A 1WB6A 2JCVA 4R1LA 4IEEA 1NVTA 2EP7A 2AA3A 4WKCA 2PVSA 3UT0A 1KHTA 1Y80A 1GCIA 2ZR9A 3WGQA 4RLFA 3THYA 3VR3D 4QYXA 2K5UA 2FEPA 2QTFA 4RDIA 1KZYC 4UHDA 5CDSA 1RRGA 4FIDA 1PVDA 1U4NA 3S8YA 1K75A 3L7YA 1BC5A 5DRYA 1S2MA 2GO7A 4L9SA 3URKA 2OBLA 1BXKA 4C6TB 2K2WA 5JHGB 2QX7A 3DCYA 4ZXPA 3R4VA 3V1LA 4EY3A 4KR3A 1CJMA 3DOJA 3FBTA 5IZ4A 2YV2A 1WWKA 1DQZA 3ANMA 4FXPA 4ZTBA 3SCZA 4UPVA 4XD7D 4JVLA 2O0MA 3HZZA 3TVYA 5I4KA 4NYJR 1BXZA 3GCGA 4IZIA 2XCOA 4NNPA 5HHTA 3ZU6A 5CG1A 2ZJ1A 1THMA 5ALEA 1BQ4A 3B6EA 1W2HA 4OHZA 2BEVA 3TJMA 3KLBA 1XDBA 1XA4A 1Z6ZA 1G4AE 3FZQA 1NOIA 4HXEB 4UZSA 1RXWA 1T2UA 1JJIA 4I5EA 2QTHA 2OZPA 5JHHB 3G7SA 1GOTA 2J08A 2QZPA 2WF6A 3OTHA 4L1KA 4HKTA 1FS6A 1KEPA 1NG1A 5E0OA 3ZHQA 2B2CA 1NT2A 3WMXA 4LECA 3E7XA 3ETLA 5CT4A 4AN1A 1KBOA 4E2YA 3N7UA 2R6CA 4BBAA 4UUPA 1GZHB 2XVYA 3H2YA 4NR0A 1GCUA 3T1QA 1A8UA 3LXXA 3IILA 4C7MA 1PSWA 3AT1A 3ZOKA 1JKMA 4DV5B 1PL8A 2GK4A 3JQ9C 5HJ2A 3VSCA 5KSPA 1IY9A 3GUYA 5DLEA 4QPJC 5FOWA 5DCWA 1D2RA 1FW8A 3RRBA 5JXWA 2DHCA 2B94A 3L0YA 1CR0A 5KQMA 1B42A 1ZUWA 2VJQA 5IWAB 5IN5A 2VQ6A 1OGJA 1N3YA 2OP1A 3OOJA 2XMGA 1FY2A 1ULSA 1IEVA 1TXGA 3GU3A 4FYMA 1T2EA 3IPCA 4YCLA 3HI6A 2CV0A 2YHAA 4RUKA 4UNPA 3VPSA 3BXXA 3C3PA 2G77B 4OBXA 1VSTA 3TE7A 5I9TA 3ZNOA 1DOZA 4RLSA 1ILWA 3DZFA 1DELA 1G21A 1RVV1 4IDBA 2J30A 4TTJA 3U13A 1J70A 1K5GA 2OGUA 4HEA6 5I8PA 2ODTX 1YE8A 1LDYA 3LX8A 1Y7IA 5JCJA 3GLGA 3B1WA 4WA8A 5P8WA 2AW3A 3BDAA 5FBHA 621PA 1KJ8A 2DPHA 2Q3HA 5DNVA 1DAMA 1BEUB 1SZPA 3WLKX 4N01A 2FVXA 2QRVB 4K7JA 3ET5A 5HZMA 2EVWX 5ALJA 3N0TA 2DBRA 5ECWA 1DWUA 2VFAA 3FKSA 3NV7A 4ZI7A 3C5HA 2GASA 1L8QA 4V02A 1II0A 2C2OA 1XAJA 5AWFC 4QUDA 4CQLA 1PGOA 1UPBA 5LP1A 3BTUA 4DCSA 1C7EA 3Q87B 2UU9B 4R2XA 1JECA 1VPDA 2XCRB 1CQZA 3OMXA 1MJNA 3UT6A 3U9SA 1WEHA 2IEAA 4G2TA 3CX6A 3UMGA 2P9QA 3IUNA 4ND8A 4LXGA 1I9CA 2IXTA 2Q6IA 2QN9A 4OU4A 3WISA 4RS4A 3OLXA 1NX6A 3K16A 3NM4A 2W2NA 1CETA 3P7MA 4JC4A 3P0IA 4OQFA 4P92A 3AR7A 5CUQA 4YLEA 5J4LA 4IVQA 5A9SA 4GZ6A 4CL8A 3OJEA 2IYTA 4J1SA 4UU8A 1DCFA 3R7BA 1AN0A 1TMOA 3UUGA 2AJDA 1A95A 3SDSA 3R44A 3RNOA 5I5EA 3HK2A 2EFGA 1MHMB 2ZIAA 1UM8A 5FPPA 4QVKA 4CM1A 3RI3A 2P78A 1FFXA 3JATA 3C5VA 3GRCA 1X1RA 3KHTA 3ZWOA 5IF9A 3UJNA 2F1RA 3WGUA 2JFZA 3OHSX 1QIEA 2DPLA 3QIAA 5FF9A 1P1BA 3G2JA 2NTVA 3R3WA 4FZ5A 2O3RA 4I50B 4U02A 4LXQA 5EXTA 1FDUA 3X1MA 3HSSA 4G41A 4FJ1A 4M9QA 3V4SA 1JR2A 1QLWA 1XZ8A 5JPIA 2ZKLA 3PLNA 3A6ZA 1RQNA 3OM9A 2WTAA 4WKOA 4BDTA 4PHFA 2A33A 4FSXA 3DKPA 3LF1A 3LU1A 1M5RA 2I2BA 5CXXA 3FNBA 4YMWA 3W7VA 1GAJA 3TUTA 1QK5A 3N53A 3L7OA 1ZRSA 4WT7A 4MWCA 3C1OA 4FW9A 3EWSA 5KNDH 1QPZA 3HGQA 3P9SA 4ZMSA 4DARA 2C9CA 1Q0SA 1W88A 2MMGA 3RRXA 3ZEIA 4P4LA 3FCXA 2WKPA 3WLTA 1KARA 4IEFB 4ITRC 1I36A 3FBWA 3WTBA 3TQRA 1C3JA 1WVMA 3CNOA 3S1SA 1WKVA 2VATA 3AOEA 4QU8A 4AWBA 1PZHA 3WKCA 1D2CA 4K9MA 3OOEA 2ZVJA 3LW7A 4TMTA 4Z2YA 2D3WA 3AHJA 4NOKA 4EPVA 2QTBA 5IBCA 1V9CA 4OQYA 2XUAA 4AP9A 1XBTA 2XI4A 2UXCB 2DBVO 5HG0A 1YFZA 3DCJA 3DMYA 4KLNA 2PZLA 3KTAB 1ORWA 1YZNA 3EDRA 3OVMA 3UMCA 4D8XA 2XHZA 1M1UA 3P9PA 1V11A 1XK6A 1H0KA 2RGXA 4RH3A 5DK6A 3LA8A 3L43A 3NEJA 1P1IA 1QKIA 1T6ZA 3FVQA 6REQB 1KI3A 3AK4A 5ALHA 5B7GA 4A1OA 2EWMA 5JCZA 4KQWA 1U7WA 1I5EA 2NXWA 1A7AA 1FNSA 4F6CA 5B3JA 4G0PA 5K0FA 3LY9A 4QEDA 2YJTD 3DEYX 5FI1B 2ATVA 5CYGA 5IAEA 1ZIDA 2I1LA 4RTOA 2AUTA 3A6GA 2PWZA 4B09A 1ISPA 2O5VA 1UJ6A 2W4QA 3JAKB 3RS3A 3OLVA 1LWNA 4B31A 4CZ2A 4EUSA 1T36B 3GYGA 2AWNA 4YPOA 3DKIA 3K9GA 4KBYA 1MO2A 4YY3B 2GZHA 4TLMB 1I7CB 4AT1A 2C5EA 1QFXA 2VAMA 1L5VA 3F5MA 3LWZA 4KIJA 3U1TA 3SR0A 2NVOA 4BYGA 1GL7A 2FEAA 4J49A 4KO1S 3ADCA 5DYTA 3KKPA 4D82A 2RGBA 3T1NA 1RC1A 5I47A 3NUQA 3V00A 4PZ0A 2VXCA 3H87A 3OPYA 4JLMA 4S0ZA 3SXUB 1N7IA 2GEKA 4IH1A 5IC6A 1T1SA 2H6EA 4I2VA 3FMPB 1Z0IA 1OX4B 2DFPA 5T6MA 3EGCA 1DEKA 2UVPB 1DBPA 3ESAA 3FETA 4N0MA 1YAJA 4P4SB 1XKQA 4OQLA 1IXRC 2H4FA 1WZIA 4WLUA 3PICA 2ZIXB 4C3UA 3BQ9A 1IHYA 2H06A 4PYIA 2P2YA 4KXXA 1D6SA 3GJSA 1N2SA 3KEOA 5T4HA 2JGLA 3K9BA 3Q5EA 5KHAA 3AUAA 4X1OA 4AL4A 2FZCA 5CD1A 4X7BA 2J6IA 4Z4GA 1KJIA 3CZ9A 1RE1A 4LY6A 4Z7JA 4TUYA 3C45A 4F2DA 3L0BA 5EQDA 1G2QA 2HT1A 4R8VA 1EFVB 1J49A 4IVPA 3FOAA 3T5BA 4W5HA 2YWDA 3BAZA 1YVRA 3M83A 10MHA 2IYLD 5J2TA 4A0RA 4CM8B 5F9FA 5AVJA 2BW0A 4I4TA 2QD2A 1ZWLA 2ZDHA 5F2EA 3AHHA 1KYTA 1CF9A 4AJHA 1JHOA 4PRYA 1PR3A 3QE3A 4ENPA 2YZNA 3JQBA 4UAVA 5CT6A 1WPQA 3UWMA 2Y3IA 2H1HA 5LQMA 1DAKA 3E7WA 1NV9A 3Q7QA 5FO0A 3HR4A 2V4UA 1J1ZA 1GG9A 2MSWA 2OZEA 4F12A 1CJSA 2E5FA 4B17A 4U6SA 3C24A 1A9OA 5GQSA 2GTIA 3BIXA 3ROMA 4KNYA 3NHYA 2FN7A 1K86A 1SBNE 1LV8A 4FS8A 3KRTA 1GKLA 5GP1A 2DPYA 3GRYA 3GXOA 3PDHA 4NX2A 1VHDA 4J29A 3S5UA 3VMMA 1N57A 2J9XB 3W79A 3PLRA 1EWKA 2GJSA 2G8NA 3ZU4A 1NYLA 2A1TR 2FPNA 4XDHA 1JX6A 1QDUA 2NZ8A 1Q6YA 3TKAA 1S8NA 3JASB 2AZMA 3V4OA 2OV1A 3DFZA 1V8BA 2CMKA 2CHVA 1BAPA 2H5JA 4WD3A 2G1PA 3OWXA 2X4DA 4IDCA 3V1UA 2IOYA 4KX5A 1FXSA 1HDRA 3UMBA 3MT7A 4JP3A 3SZRA 4TKMA 4ZEVA 2WWXA 3I04A 4CKBB 2FSGA 3PPVA 1Y48E 4HB4A 5HIJA 1CVLA 3TTXA 4AWAA 3H0WB 4EECA 3KYIB 1IDOA 4UEOA 3WE7A 2XADA 2VF7A 3EQ6A 5GINE 4U7TB 3DCIA 1M0WA 1XCPA 3U3MA 3DXYA 2I2WA 3CVYA 4BO8A 3ZJVA 5B1HA 1C9MA 3QLTA 1MXHA 2XB8A 1EDBA 3LBYA 4CHGA 2B4YA 2NU7A 4DBVO 2HO5A 3EY4A 1SOWA 3TS1A 1JWLA 3D0QA 2K2QB 5H82A 4ZPJA 3ZXUB 2FWPA 1NUAA 1KY2A 1Z0FA 2YWXA 2ZPTX 3MUNA 3N86A 3PX2A 4HFJA 4LF6B 4X7MA 5DHRA 1EE2A 1PZFA 4E22A 5CTAA 4ESVA 4CMAA 4D56A 4DCCA 3NO4A 1FP6A 1XD2B 1RYZA 1ZISA 4MV0A 1QHHA 4P4NA 2ZB8A 1A9XA 3F8SA 3FCCA 4URUR 2BR5A 1T1IA 3UFXB 1D9XA 1OXXK 4JLOA 3UHOA 3K73O 1MIHA 2WHEA 2J41A 3NRBA 4CTMA 2QJOA 5CFOA 2NUPA 3MILA 4BLWA 2G76A 5KDOA 1HLPA 2IUSA 4D8YA 3QPWA 4C3VA 4KN8A 2Q9UA 4PN7A 3LDAA 3ACBA 3L49A 1P81A 3LWBA 2H31A 4JQZA 3KSBC 3EVGA 1C2TA 2J46A 2YR0A 4ZICA 2BTQA 3DDCA 3E61A 4UFNA 4XX0A 1B8OA 3AR2A 1ESZA 2VUIB 4L51A 2E6KA 1MO4A 2WIFA 3CLRC 2OYRA 3TTTA 1H3NA 1XYVA 2EBWA 3U5TA 3NWPA 4YJFA 4KH1A 2AK2A 1UAAA 2AFIB 3PNPA 1PLKA 3TIVA 2HZ7A 4E2ZA 4YUZA 3EF1A 4NAVA 2WG1A 1PHRA 3G5TA 3H5TA 4CKYA 5JRJA 3SQWA 1N2JA 2OG2A 3L18A 3HVUA 4QHYA 3RIYA 4WN9B 3H3XA 1HE4A 2WUFA 4GM1A 4N0DA 5FFMA 5CFRA 3WQQA 5B55A 5BSEA 4YDSA 1Z33A 3K9QO 3MMNA 5KU1A 1T10A 6AT1A 1P3Y1 2A0YA 4FFBB 4WZBA 1MT3A 1JHMA 2IZ6A 4HGRA 2DKNA 2PL9A 4R1PA 5EEGA 3V1KA 1GR1A 1W4LA 2PBRA 3RW9A 3UHFA 4D6YA 3BJMA 2IE8A 5PGMA 3ZNQA 4H1VA 3CBGA 3KV3O 3NBFA 4PFQA 1FDVA 4J0QA 1JKXA 2ID4A 2HGSA 2J0QA 4KNVA 3NTXA 4NZ9A 1R16A 4HGPA 5ESRA 1Q1NA 2FFAA 1XLTC 4GM0A 1GPKA 1ZSVA 1XRNA 3M89A 3WJ1A 1Q0UA 3RTEA 1B73A 3QJYA 4B3MB 4F04A 3E2IA 4R1NA 4ZCLA 1MENA 4I50F 2BBWA 2G80A 2WMNB 4K9DA 1JIQA 3DCNA 4OI2A 4R2WA 3ELBA 3GP8A 2ZUDA 2ZT5A 3IWDB 3M6FA 3VKWA 4ABYA 4QGGA 1T9GS 1POWA 1VB5A 4OXRA 3EK2A 1P2SA 1CVIA 1Z15A 2AC4A 2RHDA 5BRNA 4Q4CA 5JXJA 5LLTA 2HW8A 2GJ8A 3HO1A 4MW5A 4LDZA 1AXGA 4R2MA 1L5KA 4PZUA 5JNVA 3CZCA 2WMDA 3EBPA 5CM9C 3ICEA 3TTVA 3FHOA 3WLJA 4HDSB 1E0AA 2ACVA 5EERA 3RSFA 1U6KA 4DQ0A 1DFHA 4TQUS 2KW5A 1F8FA 2DSNA 3CCBA 2N0SA 3F5DA 1GY8A 4W5WA 2FPKA 2XNDA 2EP8A 4JJEA 4EX6A 1DTWA 3G49A 3QU7A 5MHTA 4MB0A 1YNOA 3GWGA 4PAGA 5JASA 2O8EB 3CISA 4UZEA 3HBLA 5B1YA 5L51A 1A69A 2ZT7A 4NQZA 4F86A 1WEKA 4BGVA 3WL4A 5IVPA 1OXUA 1M2HA 3PQ4A 2OQIA 4J0JA 5IT0A 5C4IA 4GR9A 1YQQA 3E3OA 4ZO4A 3ZTWA 4X0EA 1K7FB 4Q7JB 1N9GA 2G07A 2GOYA 2IU6A 3IDOA 4X1KB 1ZUNA 4UVEA 2Y1LA 3FCYA 2Z2XA 1UOQA 1QTRA 3KHKA 4N49A 4LFBB 3FOEC 1N2GA 3WKEA 2FPIB 4ZV7A 1P4AA 1U0FA 2A57A 1GLGA 4K9QA 3UCEA 2QX6A 2CUZA 3I6BA 5ED0A 1DNPA 1EFPB 1PFUA 3ELYA 3GEPA 1AUPA 2P9CA 5BURA 1U1GA 1VL8A 3ESCA 2HMVA 4BASA 3OKPA 1OB5A 2WTXA 2W43A 3G8AA 3I9FA 3TECE 4US1R 4YRNA 3B5IA 5DO9A 2O1SA 3PR2B 2R44A 3AUFA 4B7XA 2C5HA 4PS1A 3O2SB 3A9VA 4NV1A 1WAMA 3P94A 4HWRA 3S2GA 4O2AB 2Q3DA 4YRPA 1PF7E 1GGMA 3WL5A 4OL9A 1UJCA 1WB4A 3QU9A 4DLAA 1P4HA 1O1YA 1U7TA 2FXVA 2J3KA 4G5SA 3R9XA 1T0IA 2O2SA 1HL3A 5DGHA 1SC9A 1EGVB 2XNCA 3OY2A 3PCRB 4FNOA 1CDEA 4PGMA 5CX4A 1L1QA 3ZV5A 4L8WB 4LDNA 1ZY2A 2Q2NA 1J00A 4GRIA 4KLAA 5E6SA 2WFLA 4N5HX 1NNI1 4OX9Y 3LH5A 2WWIA 1O7JA 5D3MA 1QP0A 2GFIA 3LHIA 3TB6A 3K1AA 3SLRA 4KUHA 2X1HA 1FVXA 5FPKA 2GEUA 2PWPA 1ZH8A 1GPLA 3F5FA 3LDGA 4TKUB 2IH2A 2GYWA 2B9VA 2IA5A 4N82A 3GCDA 2Q45A 1E2DA 1ZMXA 1NF2A 1W87A 2NXNA 1HRDA 3H8WA 1NUUA 1I3CA 1MX3A 2RI6A 3SX0A 3RGGA 1DO8A 2E82A 5EKXA 3ERCA 2OYCA 2FSFA 1O94A 3JX9A 4CBVA 4BQOA 1TKAA 1XZBA 1TIPA 1TNDA 1HOXA 2CFTA 1USWA 3IALA 4L15A 4HH4A 4YV1A 1YZFA 1CUEA 1JFRA 2DBQA 2YUTA 4HJXA 3DGFC 3OSUA 3ZWXA 5I7WA 4NICA 3UK6A 4B75A 1W4AA 1NKVA 4ECEA 1QMHA 1DKPA 2Q5LA 3R74A 3UTDA 4HK4A 1YQTA 4XQEA 2CMGA 3T1TA 4EGAA 1IH8A 2PSHA 3MFYA 3STWA 1LQUA 1BMDA 2XQGA 3O4VA 5IJZA 3ZHCA 2WQZA 5FA8A 1MNAA 1O97C 4RHEA 1QR2A 2GYVA 1FDWA 3B2NA 3H0KA 3L7AA 4M0EA 5I5GA 4UPEA 4DV0B 3HWSA 3OLYA 1ZJ5A 4Y2HA 1B2LA 5F12A 1YHNA 1FFBA 2Y67A 3LM8A 4MHTA 1DQYA 1LNZA 3R7WB 4CIVA 2WJ3A 4FDAA 3PEEA 1O6CA 1OAOA 3ENWA 4QOFA 4AO7A 3AKCA 1UUFA 1ICIA 4RTMA 2CK3D 3ETDA 3QPUA 4TSKA 3V7YA 4WXEA 1H6AA 2XPCA 4AQDA 4DJDC 1VSVA 2F1KA 1QK4A 2DUMA 2IOFA 4FDMA 4HDRA 4FQ8A 4QEZA 3X1ZA 4BWYA 4PZYA 1ZNQO 4UNRA 3CT4A 3O6VA 3I28A 1QG4A 2B69A 1V3UA 3HUEA 5IVKA 3DQQA 2WVAA 4WX2B 4Z3KA 3EEQA 4V0ME 5U4XA 3ZLTA 4GX5A 3FDZB 3PX7A 3N2KA 3L3BA 3LUKA 3RIHA 1G8JA 3IPRA 1GAWA 2X9NA 1RHMA 5IC5A 4HXFB 4D1YA 4Q21A 1FU4A 4GPIB 4OP2A 1MLDA 2PTHA 1TE2A 3R5JA 1RQXA 3KLOA 1GGJA 3NBYC 3TR0A 521PA 5TGZA 2CV1A 2DZDA 4GOKA 1P4RA 5C34B 3TO5A 1M2JA 5JXGA 4ND1A 4JXJA 3IWCB 4W5QA 2GF9A 4AZVA 4Y9UA 4MO9A 4BNZA 3WA6A 2ECQA 3S5JA 4CDGA 4HHEA 3M6IA 2V6GA 4UM9B 4H3KB 5KHLB 4KSBA 2QL7A 2EGUA 3OPVA 1L6RA 2I4TA 4CG1A 2Z04A 1S2DA 1NQUA 1U8TA 1TVKA 2DFDA 3DE7X 3LT0A 3VH2A 1MX5A 1DT5A 1RZUA 3IAHA 3UBMA 1VJ5A 3RS0A 3I5XA 1V4BA 3OPQA 1XTUA 2AF3C 3DZ2B 1R0YA 2Y1DA 3C1TA 3UXEA 1NP7A 1J2RA 1PL6A 1S1MA 1BOOA 3C8DA 3WGOA 4LS3A 5B4TA 1KJYA 4S2UA 4FWBA 4L5YA 4ZO9A 1O2DA 5HDBB 3TLEA 4BO9A 4BUJA 2AG8A 2DXIA 4DDUA 5HIMA 1GUBA 1S3SA 1TIKA 3KSMA 1US8A 5K2OA 3FNRA 1K5HA 2I71A 3IBSA 3RREA 3PXAA 4ZRDA 3SN6A 1OASA 2I87A 2QXYA 2DBYA 4FHEA 2I6XA 1P0MA 1IN7A 1GG5A 5D3QA 2ZE7A 2GZDA 3IE0A 1AKQA 1S8FA 4ZVQA 3BXEA 3QV2A 4IO0A 5B3AA 3ZGLA 1TAUA 3SJUA 2B78A 2ZUWA 5DK4A 2A3NA 1CF4A 4UM7A 3H7AA 1FMFA 3UPDA 3RYHB 2JCYA 2VSQA 3RFCA 3OLCX 4PCUA 1CC1S 1ESCA 3INTA 4GYKA 3RK1A 4GKKB 1IQRA 3DL2A 4D9MA 4YV7A 2XB9A 3TNJA 1AMNA 1A04A 3KQMA 4BMOB 1H4TA 4Q03A 2ODBA 3ELWA 5KOIA 1N8SA 4E2FA 3BZWA 3SJ7A 2XGMA 2WG0A 2A9FA 3ZKWA 4V1CI 5DBIA 2C3YA 4AN0A 4AK1A 1PBTA 1J2JA 1MEOA 1X70A 4KEAA 3BCRA 4KKXB 4HPWA 4U5QA 1ZH2A 1JQJC 1KO1A 2IDMA 4YMIA 1TM1E 3WDLA 3FGPA 2DGDA 2YHBA 4YROA 1U5BA 2D7JA 4I55B 4N7MA 3I01A 4YJ2B 6ABPA 2Z8XA 1FU8A 1Q1ZA 2OO7A 3IBYA 1WF6A 3GZNB 3B52X 1RKVA 1ZD5A 1E2UA 3EMBA 2R6HA 3EXG2 5TDHA 1N5KA 3I73A 2ZYSA 4C7VA 1JSZA 1QVZA 3DH0A 4TOIA 4DLSA 2PDAA 4UAGA 5J1TB 3B3AA 2P67A 2YYYA 3IDSA 3JYPA 1L3CA 2RONA 4D3YA 4C21A 4CQMB 1VECA 3BF8A 4V0NA 3NKLA 1JNYA 4BE9A 4FHCA 1JIVA 2C7OA 1JAZA 2A1UB 2JLYA 4QREA 5D6OA 3E6AA 1ZWKA 4RTRA 4ZYLA 2RH9B 1FZTA 1NVAA 3OZVA 4IUCS 4LWOA 3IHLA 3T7CA 4JX8A 5J9GA 4IIBA 2VH2A 2WICA 3ILVA 1Q0ZA 1IRXA 2BZGA 1YQEA 5GJWC 3LT4A 2JHFA 3W5IA 2KM1A 2VDPB 4ARCA 3EGWA 4B85A 3L77A 1PUJA 1ADYA 3HR7A 4IMRA 4AS3A 1DGQA 4E51A 2FN3A 2QYSA 4MR8A 4PM4A 1XRQA 5FDFA 1YRAA 2PSEA 4QTTB 1OLXA 1OROA 4PNPA 2VYND 4J0GA 4Q9JA 4BVJA 1U3VA 3OOWA 2IDZA 2O9JA 2ZYTX 4GECA 1XJWA 4XPIA 3FY4A 3K9CA 4TL7A 3U0VA 1J1IA 4LA4A 2I7TA 1ZIPA 3QHAA 2H9AA 4G1CA 3B82A 3NORA 1ZMBA 4I3HA 2NUTA 4PEVA 5REQB 5KCZA 3QMVA 2RGWA 3TUJC 3KXPA 2JAQA 3EGVA 3KT3A 4B82A 2I2FA 2C2MA 2CVFA 1VYHA 3HVJA 5JYEA 2H2DA 3HU2A 1DSSG 5FWXA 3RIGA 5IK2D 5JS8A 5FTJA 4W9RA 1J39A 1A1VA 3CZQA 1U0GA 2J5RA 5B64A 4BX0A 1AT1A 3K0SA 2JK1A 4Q6WA 1G19A 2IHBA 1IHDA 3OWHA 4OMFG 4ZVRA 1GGNA 2I3AA 1ZK1A 3I30X 4G09A 4PIPA 4R8LA 4V2UA 2J9GA 2WWRA 4XA8A 5KYUB 5BNTA 2HV9A 4C2UA 2Q1UA 3TGLA 1A8PA 1YL7A 2PKYX 5T6BA 5LIPA 1S2OA 2F4NA 3RYIA 2R6JA 4TZ0A 1I7MB 3IL2A 3OZ7A 1HE3A 1LTKA 1WMAA 1X7HA 3E27A 5KVCA 1EVZA 4KR2A 1EK6A 3DC2A 4O2AF 1RC0A 1UJMA 2VRWA 3MGAA 3O75A 3A7DA 3VA7A 3PTZA 4G25A 2IY8A 4OQQA 5H81A 1F1JA 2OK7A 3JD0A 4K9NA 7MHTA 3CZMA 3EXG1 4ND2A 3VR3A 4BWVA 1QS0B 2W2QA 1VPTA 3RYTC 1CY2A 2IS1A 1JU9A 3RH0A 1UPAA 3I5UA 4KQ9A 4LBZA 4CCWA 3QVXA 3ELDA 1J2TA 1UOPA 1M2WA 1YZHA 3UJ6A 3O92A 4CMGA 4HZUB 4BEWA 4BC0A 2IYFA 3K30A 3ODGA 4TV9B 1NIJA 4K2HA 3U09A 3STHA 2PSSA 2C42A 3QA3E 4CIXA 1ZCFA 1R0ZA 3LCUA 1USVA 4I6GA 3KSRA 5LP6A 3N70A 4KI7A 1WHSB 4XD7A 1W5FA 2DBZA 1Q0HA 5JMWA 3OT1A 1RHRA 2R1TB 4CEHA 2Z2KA 1UMKA 3F0TA 1GKIA 1NY6A 1IFXA 3PRHA 5FJIA 3VC2A 3O8OA 2B7CA 3PGXA 4L2IB 3X1YA 2VHEA 2C0CA 3M82A 4KLZA 4KXUA 2M6SA 4YPFA 3K8OE 3ROKA 4DLYA 2J32A 1Q92A 1Q20A 3W5BA 4NG4A 3ZW8A 4ND5A 4JXZA 2A94A 3H18A 3QELB 1DB3A 2ZSHA 5DSXA 4C6SA 2WTNA 4BNWA 4F4IA 1ESEA 2Q3JA 4HI0E 5HFJA 3T61A 3U4CA 1N6RA 3WWEA 1FA9A 2ICAA 1JF8A 2RIRA 3OO0A 3PGA1 3X2SA 4MW9A 1EWTA 1A7UA 5GJVC 4TTAA 1YF3A 1IHPA 1KZ6A 2D0DA 3JWIA 4J7UA 3G85A 4GVPA 4GBJA 5BV2P 4Z9YA 3BICA 1T2FA 3FI9A 5KSZA 1NVXQ 4ZRMA 4CNBA 4B4WA 3EGDB 2CJFA 2O7RA 4M0MA 3NT4A 3PUKA 4HATA 3D2LA 5EWMB 1ILEA 2GD2A 2NLOA 1YRWA 1JYSA 2RARA 5EVJA 3W2FA 4KQXA 2B7BA 1KIAA 5EHZA 1QK3A 2JHAA 4EB3A 4WERA 2GPNA 3RVSA 3RVDA 3FXAA 4G5QA 1SFRA 3HXQA 3A28A