3JSAA

Homoserine dehydrogenase from thermoplasma volcanium complexed with nad
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
325
structure length
321
Chain Sequence
MKTINLSIFGLGNVGLNLLRIIRSFNEENRLGLKFNVVFVADSLHSYYNERIDIGKVISYKEKGSLDSLEYESISASEALARDFDIVVDATPASADGKKELAFYKETFENGKDVVTANKSGLANFWPEIMEYARSNNRRIRYEATVAGGVPLFSFIDYSVLPSRIKKFRGIVSLTINYFIRELANKREFDDVLSEATKLGIVNYKDDLTGLDAARKSVILCNHLYGSSYRLSDVFYEGILDRSFGKNERLVTETGIVNGKPSAESRIKSLDSNDYLLTLGKGSLGYQLQTDTNGTLNVSDLYDGPYETAGAVMNDLVILSM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Homoserine dehydrogenase
publication title X-ray crystal structure of Homoserine dehydrogenase from Thermoplasma volcanium
rcsb
source organism Thermoplasma volcanium
molecule tags Oxidoreductase
total genus 109
structure length 321
sequence length 325
ec nomenclature
pdb deposition date 2009-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00742 Homoserine_dh Homoserine dehydrogenase
A PF03447 NAD_binding_3 Homoserine dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 3jsaA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3jsaA01
2OUIA 3I4CA 2C82A 1P1FA 4IZHA 1UDAA 1V0JA 3SC6A 3TOXA 4IMPA 1PZFA 1Y7TA 1DIGA 2NVUA 2PD4A 4S3MA 4ZQEA 4ND1A 1ISHA 1MA0A 4B4VA 2UDPA 1LEHA 4BO7A 1Z7BA 2B5WA 4EI2A 2WD8A 1WWKA 1RJWA 5ITVA 3JYOA 5CEFA 1E1MA 1GV1A 1U2GA 2PA3A 3PWKA 1KY4A 3JD4A 1GYRA 1SO8A 4TRMA 4WE3A 1KOLA 4CLOA 3ROPA 3PZBA 4TKLA 1ZH8A 2J3JA 2YW9A 3NTQA 1EVYA 5IN5A 5KVSA 2IYOA 5IZCA 4E32A 4L74A 3ICPA 1IHYA 1C0IA 2X86A 2RHRA 3P2YA 3T7CA 1UXKA 4XIJA 4D46A 5B4TA 4MINA 1A9ZA 1C1XA 3VVBA 1LC3A 4MOWA 3DOJA 5FF9A 2O4UX 1KEWA 4ZQBA 3WLFA 3RC2A 4J1SA 4IQ0A 1TEHA 3HSKA 1A71A 3JQAB 3WBBA 3WGHA 3ADPA 4FJ1A 4YAEA 3RI3A 1NTOA 2PKQO 3BMNA 2B37A 1PJ3A 2QX7A 4U6QA 3S2FA 4MKXA 4UUMA 1U8XX 4AJ1A 4XWYA 4RLSA 2B4RO 1A5ZA 1JDJA 4EDFA 1Z73A 1GDHA 5A4DA 1UXHA 5KKCA 3O4RA 3PDJA 3G0OA 5A3VA 3AOEA 1CIVA 1X1TA 1ISJA 1KVRA 3K96A 1LC0A 4CR8A 4LMPA 8LDHA 3VTFA 3KEQA 4GX0A 3LC2O 1X0VA 2UUOA 3F4LA 5G4KB 1LTHR 4NDNE 2BHLA 2X9GA 4EW6A 1IPEA 2X0RA 4JROA 1DRWA 2VRCD 3DQPA 3L6DA 4IQGA 4WUVA 1V9LA 1HETA 4XYGA 2EWMA 2O3QA 1ULUA 2FOIA 3U62A 1U7HA 2B4QA 1ENOA 1JN0A 2NU8A 1QV7A 4AICA 2X5KO 2HK8A 5ENVA 1EVJA 3ZW9A 2YZ7A 1GFSA 1E6WA 2P4HX 3L77A 3P7MA 3CSDA 1Y8QA 1ZMTA 2PD3A 1YS4A 3FNFA 4P4GA 3GZNB 4BKOA 4QSMA 1UAGA 3BZUA 2Y1DA 4O1MA 3QHAA 3OSUA 4RZIA 3ZWOA 4K26A 4GWKA 1E3EA 4FFRA 4K6CA 5H83A 3UVEA 1LRKA 1YJQA 2WM3A 1SZJG 5K9ZA 2AXQA 5G0WA 3EMKA 1TB4A 4HFNA 4RF4A 1V3VA 3WGIA 3ZU3A 4G5HA 4A7PA 4Q3DA 1UJMA 4M86A 4MIEA 4GWGA 3JYNA 4J4HA 5HA5A 2G0TA 1SOVA 3WOHA 2OOSA 5JYDA 4J1QA 4AJIA 4YJHB 1MG5A 1WLYA 1U1IA 2I9PA 3QWAA 1PEDA 4CMEA 2JAHA 4PVCA 1XWFA 4FPXA 4ZQFA 3MOIA 1CRWG 4WNIA 3TZHA 2YJZA 4XGNA 4JN6B 4IDGA 5H82A 3TWOA 3AY7A 2V6GA 5JY1A 3VKVA 2YDYA 5CDGA 2O3RA 4BNUA 4XX0A 1OC4A 4NNJA 4BL5A 4RVFA 4B4UA 4K9DA 2GGSA 1ML3A 1O0SA 2DPGA 2EXXA 2VWGA 1I30A 4DBVO 3CPSA 2WWRA 1DAPA 1W8DA 3NGXA 3PRJA 5ER9A 5HWSA 2FSVA 1O89A 2X4GA 4XD2A 2XAAA 1DIHA 1GU7A 5I9MA 3GT0A 3JD0A 4XDYA 4HBGA 1DPGA 3AI3A 4DIOA 3HN7A 3D3EA 1PS9A 5HM8A 1DXYA 2HRZA 4FIZA 1ZK3A 1A27A 2UAGA 4AJEA 4FC7A 3PJGA 5JYFA 2FZWA 3G49A 1Q7BA 1ZZEA 1ZJYA 2OP0A 5IG2A 3PYMA 1VPDA 2HDHA 1I3KA 3UFXA 1Y8RA 1T1RA 3JQCA 3QE3A 2A9FA 1U9JA 4J4BA 3GPDG 3RAJA 4A2CA 4IDDA 1HYHA 3B1JA 2LDBA 3ZHYA 3C1AA 4YBZA 5JDCC 1K0UA 1VE9A 4XR9A 3DMTA 5KJ6A 1ORRA 3S2GA 3OEYA 4AJLA 5M6DA 3GFGA 2DTEA 4OOFA 5JCJA 5KVCA 4OHUA 1VM6A 2NSDA 2PNFA 1FDTA 4CMCA 1ZK2A 3M1AA 5EESA 3GFBA 2HK9A 3NJ8A 4CLXA 1ZFNA 2WE8A 1E1NA 5L3ZA 4J49A 4AG3A 5EIOA 5AQ1A 2GZ2A 3V1YA 3LDHA 3RKUA 1A4UA 1VI2A 2F00A 4I9UA 1KVUA 4MPDA 2ILTA 1HF3A 5TSDA 3FR8A 3RBZA 3FBGA 1R0LA 3PHJA 1VL6A 3DC2A 4DQVA 3VC7A 4JGBA 4J2OA 4PLGA 3JQ7A 4WLEA 2PZKA 3I1JA 1T2CA 1YWGO 2GN6A 1SB9A 1T25A 3GEDA 4M89A 3RWBA 2JD0A 4D79A 4LGVA 1WW8A 4CUJA 3V2UA 4J4TA 3VPXA 1LBEA 1R4NA 1UZNA 1Y81A 4A27A 1FF9A 2D8AA 3WGOA 1GUYA 2EW8A 1IZ0A 4CM8A 3F46A 2Q1SA 4L4XA 4QTZA 3WG9A 2GUGA 4PZCA 2G82A 4PN3A 1EK6A 1XU7A 2RBEA 3H6KA 1RM0A 3N7UA 3WB9A 1SB8A 3NT5A 2Z95A 2DFDA 1RM5A 3IMFA 1VJ0A 1LA2A 5A04A 4AJ4A 5LCXA 1BW9B 4R69A 4RF3A 2VHYA 3ZHXA 3L9XA 4CUKA 2BGKA 1GUZA 4W7HA 3FD8A 4RQUA 4Q39A 3D4PA 3RIHA 5U9CA 5GZ6A 3GMSA 1LSOA 4Q3EA 1X13A 4XQ9A 3ZV4A 5A9RA 3ONEA 3LLSA 4GLOA 4E13A 3GH3A 2J8ZA 3ZV5A 3WWZA 1NR1A 2JHGA 2I5PO 2NU7A 2FHSA 2WE7A 3K2EA 3QVTA 4RPGA 3VDQA 4HNHA 4J7CA 4BS9A 4I08A 4WK6A 4IZIA 4L73A 1U7TA 3NDJA 3ZI0A 3WTCA 4TRRA 2YHIB 3O26A 4LSMA 2CD9A 5C7LO 1W73A 5GMOA 4ZICA 2Q22A 1M2WA 2NLOA 2NTNA 2EKLA 3FBTA 3GZ4A 3HB4X 2CF6A 4J2HA 3BIOA 3RROA 3M1LA 4IDCA 2BELA 1PL7A 2R6JA 3D4OA 4KZPA 4BNGA 1U4OA 4PFJA 5HRUA 6ADHA 1R15A 4U5QA 5BSEA 1HE4A 3ICCA 3RC7A 2H5LA 2RHCA 1GPJA 4CLOB 4CR7A 4PCVA 4TZKA 1ZNQO 2PWZA 5F3RA 1OI7A 4UVDA 1WMAA 3P5SA 1WVGA 2VZ0A 2B0JA 4EYEA 1NQOA 1YH3A 4RDIA 1KS9A 4Q9NA 1NPDA 3BYZA 3HN2A 3F3SA 2Y68A 3WGTA 2WSBA 4ND2A 1N2SA 3KTDA 4XYMA 3KXDA 2DTXA 2Q1WA 4QEDA 4UUOA 1PJTA 3B20A 3I6IA 4GAEA 3VHRA 5IF3A 3M2TA 2YYYA 1WPQA 2ZYAA 2J3IA 1YL7A 3JQAD 3LSYA 3GNTA 1QORA 1CWUA 4FJ2A 4GMFA 4AJKA 4XZ3A 1KBZA 3ZV6A 1WXDA 1ZKMA 1W6UA 3JQ9C 4BGVA 1BXZA 2UUPA 2O4CA 4OO3A 1SEPA 4FR5A 4JJIA 5JNLA 5A05A 4CQLB 4OM8A 3IKTA 4CLDA 2BFAA 1A4IA 1JVSA 1QLJA 1DHRA 3KEOA 1E7YA 3ORFA 2Y67A 3ROQA 2BI7A 5J9GA 3VKUA 3U5TA 4R5MA 1BXKA 1E7WA 1Z74A 4OXKA 1YB5A 4ZVVA 1P74A 4YWJA 1C0KA 4NI5A 4RL6A 1NYTA 3KYCA 2X22A 4HY3A 1RWBA 4ND5A 5TQVA 4FFMA 4J9VA 5L4LA 3A1NA 5C37A 1S7CA 2W2LA 3JYPA 4E33A 3JD3A 4Q3NA 3RQSA 4E5YA 1BSVA 1JWAB 3RBVA 4GVLA 4PIVA 4RPKA 5BSGA 5IDQA 4QFCA 1PWXA 2UYYA 4FFOA 3WGYA 1N1GA 1H6BA 1PL8A 3QLJA 3RUCA 4B79A 3ZWXA 2G76A 4BNYA 1FDVA 4KQXA 3RVDA 3GQVA 1K89A 1HRDA 4DQUA 3D0OA 5KTKA 3JV7A 3OIFA 5ICSA 1BVUA 2C2YA 1UDCA 1Y8QB 4YT5A 1HL3A 4CQMD 4FJ0A 3GC6A 5J23A 3LT4A 5DZSA 1JQBA 4NFSA 4DLAA 1IUKA 1Z82A 3GNSA 4NBTA 1QRRA 5TT0A 4F6LA 3U09A 3AFMA 4IBOA 3OEWA 1PQWA 4FC6A 4JXKA 4KDFA 3C7CB 3PYLA 3ZWYA 1FJHA 4D0RA 4DIBA 1EUDA 1O5IA 1P0FA 2Q3EA 2AEFA 4C7JA 2PLAA 2YFQA 3GN1A 3PTZA 2C0CA 3GA0A 4C7KA 4M87A 2VYVA 1PZHA 3LC1O 4CM4B 2JD1A 1TLTA 3ZHZA 4RPJA 3PFWO 1TVEA 1I3MA 1XCBA 2FR8A 1D8AA 4OKIA 2Q99A 1ZIDA 4PZDA 3EZLA 4CV1A 4DREA 1HSZA 4GPD1 2Y99A 4CMIA 2IDZA 4RVGA 4BQPA 3ANMA 5L45A 2P2SA 3V8BA 1Q2XA 4WCFA 2EJVA 1U3WA 3E48A 2CVOA 2GYYA 4PGFA 1UZLA 3X2EA 1ISIA 4F6CA 3JSAA 4B3HA 5L4SA 3E5MA 1M67A 3H5RA 4B7CA 3TRIA 4E5PA 3OJEA 2FRDA 4KDEA 1GYQA 1F12A 2HQ1A 3OP4A 4Z0TA 1VJ1A 1K6IA 1PL6A 3D3WA 1XR3A 3GF4A 4YACA 5L7TA 2NADA 1SPXA 2RCYA 3DAFA 2HMSA 1ADGA 5ITWA 3ZDFA 3GHYA 2AW5A 5JAMA 3ZWAA 4GGOA 1Y8RB 2GSDA 4MVJP 1SAYA 1F0YA 1UP4A 4J1NA 3E03A 5TNXA 2EGGA 4CLHA 2ZQYA 3A06A 1VKOA 4CM7A 1PTJA 2Y1FA 4J91A 4OL9A 4DGSA 2X8LA 1PJBA 5JAQA 3O38A 4XRGA 2GF2A 3VAZA 1BDMA 1PGQA 4HX5A 3NTOA 3T4XA 4E6PA 3COSA 1T4DA 3ONDA 2H63A 2J3KA 4LCEA 2HAEA 4NR0A 4XR4A 5IAAA 1ONNA 2Q2QA 2WYWA 4DIFA 3GVIA 1R4MB 3NV9A 2AEJA 4DC1A 1RM3A 4FOSA 2CF5A 3Q3CA 4E5KA 3S8MA 3AWDA 4IGEA 2C07A 1N7GA 5DF1A 4M1QA 1M76A 4RF5A 4E4YA 4U8GA 2JFHA 3BMOA 1HSOA 3JQ7B 5F21A 2WJPA 1B14A 4XYLA 5THQA 3V2HA 3SLKA 3GEGA 2VWQA 2P5YA 3AI1A 2HMUA 2YFHA 1CEQA 4HADA 2IZ0A 2V6BA 3NKLA 1C1DA 4IMRA 5F5LA 4CUZA 1D1SA 3LZ6A 5GZ3A 3VZQA 2JAPA 4UREA 1LQTA 4HXYA 2ZATA 3FNHA 5T8KC 4GX5A 3FTPA 3MJSA 2PKRA 4BNHA 5IXSA 4NPCA 1GQ2A 1WZIA 3BA1A 4QT0A 3O9ZA 1YRLA 1UZMA 1Y9AA 3W8FA 1I5RA 2VN8A 5A5EA 2VZ8A 1QV6A 1E77A 3EZYA 1U4SA 4J7XA 1Y1PA 1YDEA 3FR7A 3M6IA 2DVMA 1YQXA 4KUHA 1Q7CA 4G65A 2D4AA 4A0SA 4YAGA 3ULKA 5IDWA 3I52A 2PV7A 4L9RA 1GZ4A 3FTNA 3FRJA 3PHIA 3GY0A 2ZCUA 1NQAO 1X0XA 3DZJA 4MVJM 2J5QA 1PQPA 2UV8A 1P31A 3NDRA 2E6UX 4QO8A 2I66A 3G1UA 2GD1O 2ZJ0A 4ZD6A 3HHPA 1EE9A 3QRWA 4CODB 1P45A 5JS6A 4TRJA 3DDNA 1ADCA 2HU2A 4NMHA 3GEMA 3FHLA 3KV3O 1MP0A 2QYSA 2Y0CA 2HMWA 3ETEA 4BNIA 3KYDA 1DB3A 5KOIA 1N1EA 2Z1MA 4DQXA 1ZMOA 4BNNA 5I9NA 2CVQA 1BMDA 3K8ZA 5KJCA 1YL6A 2Y1GA 2VWHA 2I99A 3OICA 2ZTMA 4B8WA 1I2BA 4FQ8A 3QIVA 3GUYA 2VYND 4E2ZA 2GZ1A 4YDRA 3LVFO 2GN8A 3HDHA 2EP5A 1J6UA 1ZUD1 4UVGA 5LC1A 1W4ZA 4CLRA 5FI5A 4CM3A 4BO4A 2C59A 1NAIA 1U5AA 3U4IA 4J6FA 3RJ9A 2VCYA 1P1RA 3OH8A 4M49A 4RCVA 4DPLA 3Q11A 1LSSA 1SOWA 4MKRA 4BVAA 1B8PA 5JYEA 4FFLA 3D64A 2X58A 1SC6A 3OECA 4DL9A 4BNXA 5T73A 4DWVA 3JQ6A 3KZVA 1PJ2A 1ZK0A 3ROMA 5THKA 4IDEA 4ONEA 1B3RA 4G81A 4F45A 5KVQA 4BMSA 2E37A 4BUCA 1Q0LA 2C5AA 4RVUA 2GZ3A 5ER6A 3RU9A 5KJFA 3KVOA 4I9HA 4IXWA 3KYCB 1H94A 3IL2A 1ZSNA 2DC1A 1X7GA 4DLLA 2QQ5A 3UGKA 8ADHA 1NR7A 5JFOA 3U0BA 2NQTA 1H9BA 1Y5MA 5A9TA 1E3SA 1PWZA 4W7IA 4MVJA 4LSWA 3TPCA 1V6AA 2WYVA 1ENPA 1BHSA 4YJDA 5I9LA 2OBYA 1DEHA 4UVHA 3HB5X 5TX7A 3H65A 3AUUA 4KP7A 1RKXA 3I9NA 3UW3A 2X5JO 5T57A 4Y9DA 3BMQA 4DA9A 3G79A 3HQ4O 2JCYA 3QV1A 4X54A 3QW2A 2NVWA 1HYGA 2BI8A 1T2EA 3GG9A 3KRTA 1NPTO 2IRWA 4OH1A 3HE3A 1JA9A 3OJ0A 5F1KA 1I01A 1UXJA 1CDOA 4ND4A 4OXYA 4A26A 1T2AA 4KWIA 2PD6A 4PRLA 4GX1A 1HDRA 3IOYA 1JKFA 3PLNA 1U28A 3V1TC 1IE3A 5EL0A 5EN4A 3OETA 2DKNA 2WD7A 4PG5A 5F1OA 4ILKA 1LX6A 1HE3A 4AJ2A 5A5FA 4I1IA 1KVTA 5KVVA 5JDCA 3FWZA 3ZWVA 2AMFA 2NU9A 3FSRA 3F5QA 3EK2A 5F5NA 4ZA2A 3WXBA 2WMDA 3HNPA 2Q1TA 4F46A 4YRAA 3VZSA 4Z9XA 1T2FA 2W90A 3KHUA 4Y67A 3TN7A 5B4UA 4D3DA 4EZBA 1XU9A 3OQ1A 2NVBA 3ZV3A 4RV9A 2FP4A 1EVIA 4RVSA 3RSHA 2IZ1A 4GGPA 3I9JA 1ISGA 4KQWA 2BFMA 4NQZA 1LLUA 3JQBC 3WQSB 5L4NA 2QRLA 3VDRA 4G2NA 1XG5A 3D3WB 2DAPA 1R66A 9LDBA 2AA3A 3ZU4A 3AY3A 5BNTA 4CM9A 3V5NA 5K6AA 4AL4A 1I36A 1LLCA 1H2BA 2DBRA 2X9VA 1J5PA 2FR0A 3KLPX 5CPBA 4R4JA 3LF1A 4DMMA 3TJRA 3JQ8A 1CF2O 3H4VA 4YT4A 4CQMB 4W4TA 4E0BA 3HDJA 1DSSG 5C5IA 1N5DA 2X5OA 2Y05A 4FFPA 4LRSB 3WLEA 1XKQA 5DBGA 1GYPA 3OIDA 4FB5A 4Z9YA 2QYTA 1GCOA 4BO0A 1LDNA 3UOGA 5A1TA 2VHVA 1HDGO 2Q2WA 4R1SA 3W8EA 1MV8A 3RFTA 5G0UA 1BXGA 4P4LA 3T4EA 3I9KA 2PTGA 2O7SA 2ZQZA 3MJTA 4HFJA 2D5AA 4Z3KA 1EVZA 4WEOA 4ALLA 3OJOA 1X7HA 1YVEI 1E3JA 1A7KA 1C3VA 3ITDA 2CSUA 3VPGA 2GN9A 4E30A 5L40A 4B7XA 3A9WA 3PJDA 4KTTE 1P1JA 2B4TO 1LNQA 4MP6A 3Q2KA 4IDAA 1ZO8A 3PEFA 1GCUA 5TJ9A 2VUTA 3ETGA 2QRJA 2P9CA 1XQ1A 1TT7A 2HK7A 3LU1A 4JNKA 1YKFA 4XQGA 3ASVA 1E1LA 5JXWA 4DMLA 3OHSX 1DRUA 4J43A 2AQ8A 1NQ5A 5KJEA 2P9EA 4LCJA 1B16A 4QX6A 3GLQA 1CERA 1IULA 3PZRA 1R0SA 1YE3A 3JYLA 3DO5A 1QYCA 5CHEA 3F1LA 1G0OA 4JBGA 2EW2A 5CDYA 2IE0A 5COAA 3FPLA 3H5AA 2B35A 4BO3A 1GZ6A 4J1TA 3PK0A 3ADOA 1NWCA 1P44A 3E9NA 5GZ1A 5I7VA 1CETA 3VPHA 4YJFA 1VL8A 4TVBA 2RH8A 3S2EA 1DC6A 2XXBA 3CH6A 4ALMA 2VQ3A 2DUWA 3JQDA 1PJLA 1QYWA 3W4KA 4J7UA 4UVIA 1P33A 2FZEA 5JW6A 3DZBA 1IL0A 2UVDA 4HNGA 2FY8A 1QMGA 3ON5A 2E49A 3C3XA 1KC1A 2B36A 2O3JA 3QSGA 3HG7A 3VH3A 4BNJA 4YJGA 3KYDB 3P2OA 5TC4A 2Y0DA 3W6UA 3ZWPA 4E12A 1GQQA 4GL4A 1MC4A 1N9GB 1UR5A 4H3VA 4I9NA 3RASA 1EMDA 4YPOA 2J5RA 5F1PA 1Q7GA 3UH1A 2EEZA 1KEPA 5BR7A 1QLHA 3AUAA 4ID9A 4II2A 2BFPA 4P4NA 4E31A 1HKUA 4OSOA 2Q46A 3AOEC 5AOVA 3WR5A 1GR0A 1U8FO 1NQTA 3DL2A 4OXNA 3SC4A 3PIDA 2O23A 1ZCJA 4AJJA 2O3TA 5ADHA 3DB2A 2IYPA 4CLRB 1T4BA 4DRYA 4GBJA 1LJ8A 3ITKA 4R9SA 4GX2A 1PGNA 7MDHA 3JTMA 3G3EA 3KO8A 3QWHA 4H15A 4R1UA 4EUFA 2JFGA 5EQDA 2YDXA 4WNCA 1EFKA 1JAXA 2O7QA 1EDOA 1T24A 3RUIA 1YOVA 3TZCA 3BMCA 2ZIZA 5DCUA 4W9NC 5T5QA 3TZKA 1PSDA 3N58A 3GR6A 3MWDB 2H9IA 3S2IA 3CTMA 3LT0A 4MIOA 3W8DA 2DBZA 1UH5A 2FR1A 4PLVA 4NIMA 4TQGA 2EKPA 2DUUA 2EV9A 2NU6A 3JQGA 3WMXA 4PG4A 2NNLD 3JYQA 4D41A 1JLLA 4NG5A 2VNAA 4IQ8A 3CE6A 3SJUA 4KUGA 2NVUB 2G1UA 3RFVA 3QQPA 2VHWA 2W2LD 2SCUA 3WFIA 3GGGA 3ZWBA 5TT1A 2O2YA 1E5LA 3E9MA 3AU8A 5TJHA 1VJTA 4Y6SA 4A03A 1M66A 1X14A 4L4SA 4NJMA 4FSHA 3WGGA 1X15A 3D5TA 3ZU2A 2O2SA 1E1KA 3LK7A 2AQHA 4RVDA 1X1EA 4JCOA 1Q0QA 1E7SA 4LVCA 5DCYA 1E0DA 3KUXA 4FGWA 3CUKA 3UF0A 4BNVA 4IJUA 3KSZO 3WIDA 2DBQA 4BO9A 3KBOA 2BRUA 1MFZA 3WJAA 4H7PA 1H0KA 4RPHA 1B3BA 2BH9A 4E2XA 2JCVA 4N54A 5AXBA 1C1XB 4OIMA 4OQZA 2R00C 1J4AA 3CKYA 3C1OA 2A35A 2LDXA 5A06A 1PZGA 5GY7A 3WSVA 1I3LA 1P3DA 2X23A 1F8GA 4EEXA 2XOXA 3H9EO 2TMGA 3BMNB 4CR6A 5BQFA 3IQDB 1M75A 1O8CA 3GK3A 2VYVD 1GV0A 3U9LA 2Y0EA 5LDGA 1OFGA 4K6FA 3WDSA 4MO2A 1X7DA 3IAHA 3UXYA 1I3NA 1KEUA 3HDYA 4UEJA 3L4SO 4I8XA 3FNGA 1E6EA 4HP8A 3QWBA 3PJEA 4WGGA 2OZPA 1QYDA 1EDZA 3NUGA 2PGJA 1MG0A 1YBMA 2EIHA 4A5OA 4J0FA 7ADHA 3ZH2A 5JDIC 1VKNA 1NXQA 2VUSA 4LK3A 2P91A 2C29D 3ZNOA 3GPIA 1XEAA 1GUFA 1GAEO 3DONA 1D3AA 5G0SA 5AXCA 5BSHA 2G17A 4MVJF 4NBUA 3OBBA 1SEVA 4OKNA 1ZW1A 5U4QA 4J16A 5DCWA 4WCDA 2X7HA 3LT2A 2EP7A 3CZRA 4RORA 3SLGA 1CQJA 2B69A 4HFMA 1JKIA 4ZU3A 5HTOA 2QZ9A 4ALNA 3SX2A 4YT8A 2EERA 2J3HA 3R6DA 4QXMA 1SNYA 4ALKA 2PY6A 4DLBA 1DJQA 3L6EA 1P1IA 4Y6PA 2FSSA 4L75A 4R1NA 4IIUA 1E3WA 3GG2A 2IZZA 1LLDA 1YB4A 4IUYA 3IJPA 4HFRA 3AOGA 3GNQA 1HE2A 1ZEJA 4KTVE 3C7DB 5JMPA 4CM5A 3G1TA 1XIVA 3QA9A 5DBIA 1H6CA 4YQZA 3ZWMA 4BO6A 1WDMA 2ZCVA 5JO9A 5T64A 2HJSA 3H3JA 1AUPA 1MC5A 2X0IA 5CEJA 1RYEA 2IODA 3H2ZA 1ISMA 2VOJA 4R1TA 1JU9A 5HBRA 4CPDA 4D44A 1UP6A 4XGKA 3EDMA 3E8XA 3DAPA 4L0QA 3K9QO 1D4FA 4YTEA 5I7SA 5FYDA 1PR3A 3VH1A 4DYVA 3H3FA 5B12A 2YY7A 3TDKA 1U3TA 4RQTA 3I9MA 4W82A 3RBXA 5K0ZA 1UAYA 1VSUA 3H9GA 4RDHA 4WOKA 3INGA 4BHTA 3JQAA 1PU2A 3KSDO 4TROA 4IIVA 5HS6A 3WSWA 1LDMA 3K73O 4XKJA 5DNAA 1ARZA 1G0NA 1DBVO 1BDBA 2Z5LA 1KY5A 5KCZA 3AU9A 4OYRA 2GLXA 4ZQHA 4E21A 5TGDA 2I67A 1OOEA 4QUKA 1YO6A 2C5EA 4XQEA 3Q0EA 5B4VA 4WLVA 4NU5A 4CLEA 3BHJA 2CDAA 3H7AA 4WECA 6LDHA 4JBIA 1BTOA 3GMDA 3PQFA 1T2DA 4IXTA 4B4OA 4DPKA 1G1AA 3L9WA 5G4KA 3O8QA 3DFUA 2HCTA 5DN9A 2ZB8A 2I3GA 5T6BA 1YBVA 1XSEA 3CXRA 3WQRA 4PLPA 4PLWA 2FN7A 3ENNA 1OC2A 1LUAA 3GDGA 4PRKA 5AXAA 2D2IA 3IP1A 4IM7A 2VUUA 1V3UA 1T26A 3PFFA 2BLLA 1YB1A 1WNTA 1YJ8A 3AI2A 1NAHA 3VTZA 4YXFA 3DAGA 3NEPX 1XQ6A 4I5FA 5AXDA 4U7WA 1R6DA 2RIRA 3E6AA 3GVPA 5JLAA 2X0NA 1A9YA 2QHXA 4FS3A 4YRBA 3GRKA 4GSKA 3GZNA 4W6ZA 2QRKA 2A92A 1I32A 4WLUA 1OBFO 3K6JA 3RKRA 3VPFA 3PP8A 1JWBB 4FCCA 3BTSA 3ZZNA 4EUEA 2OORA 2F1KA 1K2WA 2AHRA 4II3A 1B7GO 1Z75A 3I3OA 1WAMA 1R4NB 3C24A 3R0IA 2PKQP 1TA4A 1ONOA 1PGOA 2C2XA 3DZIA 3JQEA 4KWHA 4FW8A 4L76A 1F06A 4CM8B 5A3JA 4IINA 4CJXA 5I8WA 1OMOA 2VTEA 3BTVA 4B3JA 1L7EA 4CM6A 4DYDA 4LN1A 3CINA 3LF2A 5IN4A 4ZHSA 4YJHA 4CMKA 3JQFC 3RJ5A 4FOOA 3W4IA 2CZCA 2J6IA 1YONA 5KJ1A 4O0LA 1MGOA 2BMAA 3GAFA 3PWZA 4MVJE 1YOVB 2RAFA 4PLHA 4WKGA 5T67A 1C0LA 3KYBA 2EHDA 4U6SA 1BWSA 1K6XA 3D1LA 3S1LA 2JKVA 2EG9A 2JD2A 3HFSA 3LLVA 1F14A 4GMGA 3EY4A 3V2GA 1DC5A 4Q3CA 3F4BA 4J9UE 2Y1OA 3MTJA 2ZYDA 1DO8A 1F8FA 3EHEA 3IKVA 1ZK4A 4IDFA 5KIAA 2DPHA 2I6TA 5MGBA 2OMEA 2QG4A 2POQX 2GNAA 3EVTA 3L4BC 3SEFA 1HLDA 2W4QA 4J3FA 1UXIA 4BB6A 3B6ZA 4AVYA 3WBFA 1GPDG 2ZK7A 3LQFA 4IPTA 3JCZA 4TVOA 2P68A 2XXJA 3DWFA 5CFZA 1DAOA 3HWRA 3FWNA 4GKVA 5DP2A 3D7LA 1KERA 4BNLA 1F17A 4NJMB 3HUDA 4D42A 4MVJD 1QP8A 1DC3A 3DZKA 1ID1A 4OMUA 4P8RA 1YGYA 1EUZA 4XJSA 4H16A 3KM0A 1FDUA 3AW9A 3PHHA 3UICA 2ZTUA 1Y5RA 3MOGA 4N18A 4R01A 3WYCA 4FFNA 3D5QA 3TQHA 4R51A 3E5RA 5CG1A 1EZ4A 2WYUA 1K3TA 4ITUA 3R3SA 2PH3A 1A72A 4XYEA 4WCFC 1QSGA 2GASA 3B1KA 4U0JA 1FDSA 2R2GA 3UUWA 3ZW8A 1O95A 3AM3A 4IJVA 2J5KA 4ZJUA 2JFFA 2AE2A 5L53A 3F47A 2IXBA 4GQAA 3OA0A 1GTMA 4O59O 1IY8A 2ZKLA 1L1FA 5L7YA 2YQ5A 3H8VA 3WS7A 3B1FA 2Y93A 3TZ6A 3INTA 3EW7A 3DBVO 2ZB3A 1IYZA 4Z6KA 1ENYA 1B2LA 4WASA 3PHLA 4ND3A 4D7AA 2GPTA 3EVNA 5DT9A 5B37A 3H5NA 5ENDA 3TZQA 3I9LA 1LRLA 4BO1A 4NFHA 3MEQA 2YV3A 3PGJA 3PYXA 4F3YA 4ALIA 1GL3A 4Z0PA 3T7EA 1W0CA 4FN4A 3UKOA 3OJFA 4WLNA 4JP3A 4UEOA 5L95A 4TSKA 1MXHA 5IFLA 1JAYA 2X0JA 2BKAA 1NASA 4UAGA 2Y1CA 2CDBA 2CFCA 5G4LA 1V8BA 2NTJA 1LDGA 1FDWA 2NWQA 2AG8A 4TMFA 4BO8A 1NFFA 4Q3AA 4ZRNA 4BNWA 2HO5A 2BD0A 3FF4A 1K6JA 1OAAA 3GN2A 3VZRA 3Q9UA 2DU8A 3CMMA 2BFOA 1HDXA 4PG7A 3GDFA 3IUPA 4E2YA 3STHA 3NT2A 2C20A 2GN4A 2PFGA 1RM4A 3R1IA 3SBOA 4CL3A 3GHHA 1I10A 2ZB7A 3DBLA 2GDZA 3CEAA 3X2FA 4O63O 3MCVA 2DQ4A 2Q50A 4XGIA 1HZJA 3CZMA 4BB5A 4EBFA 4JBHA 2YHIA 3PQDA 2ZJ1A 4RJTA 5FWNA 1Z7EA 1E3WB 3MZ0A 3ST7A 3Q6IA 4BIIA 2H1SA 5AVOA 3DBRA 4NFYA 1B8VA 4PLFA 3M2PA 3WGQA 4R54A 4TRNA 3C8MA 4R3WA 4URFA 4Q3BA 3VPSA 4BO2A 4EJMA 4YVFA 1UXGA 3E82A 2XPCA 3DEYX 3KLMX 4N5MA 4R68A 2JHFA 1O6ZA 3W6ZA 2VYNA 1LQUA 4R16A 4NBWA 4HV4A 3OFSA 4RPLA 3WIEA 4UEKA 2C7VA 3GGPA 1DDOA 4Z9FA 3UHAA 3K2BA 1AXGA 2DFVA 1Q1NA 1NVTA 1ZSVA 1I33A 4AJHA 5DULA 2GR9A 2B83A 5G0VA 2D59A 4CMIB 3F6YA 1TI7A 2EF1A 2Z1NA 3GGOA 2VZ9A 5BNIA 3K5PA 2ZYGA 4WCFB 1A7AA 2EJWA 1AGNA 5C7IO 3GVXA 4ALJA 2I76A 2ZTLA 3RC9A 3OMLA 3INRA 3ETDA 1XGKA 2E48A 4N5NA 2BGLA 3HADA 1RYDA 3LC7O 1DJNA 1PGJA 3EGOA 1HEUA 1AN9A 3KOUA 4UVEA 3DHYA 1DIBA 1SBYA 4CQLA 3DHEA 4LW8A 5FFFA 3RUAA 1HTBA 3IC5A 3ZWCA 3FNEA 4YCAA 1RPNA 1P0CA 1ZJZA 2CMDA 2QIOA 3QWFA 3FI9A 1PS8A 2NUAA 1HDOA 3DMYA 4EUHA 2HSDA 3O8QB 1BGVA 2W98A 2OO5A 4XIYA 3WJ7A 3ASUA 5EMHA 1S6YA 1XDWA 1DIAA 3AUTA 5EQFA 3VH4A 4YEDA 1IHXA 4JJFA 3EC7A 2ZB4A 1AXEA 3ANNA 3WYEA 3DTYA 2PH5A 5FEUA 5JAZA 5JCJD 1HDYA 2D3TA 2NACA 2O3SA 1PZEA 4ZQGA 2IEDA 4W99A 4W9NA 2PGDA 1NNUA 5TLSA 1ZK1A 2X6TA 4NBVA 1P1KA 4PG6A 5IDXA 3NYWA 3CMCO 2HUNA 1O94A 3RD5A 4PLZA 4INAA 3BMOB 4AFNA 3E1KA 2CDCA 5G0TA 4AJPA 1KIFA 3I4FA 4ZN6A 1J0XO 3OQBA 1M6HA 1E3LA 3DZHA 3MTGA 3HDQA 2FWMX 3PXXA 3WTBA 4WJZA 3ZWNA 4XA8A 1C1DB 2V6FA 4I5GA 3A14A 2JCXA 1ULSA 2ET6A 9LDTA 3PLRA 1LDBA 2YV1A 3ZNNA 4L4RA 5JMWA 3TFOA 3AFNA 3VOSA 1MXFA 1XLTA 1LI4A 1NBOA 4M8SA 1R16A 4CM4A 4TKMA 3OJLA 3RUEA 4L8VA 1MB4A 1PJSA 3BHMA 3AUSA 3QY9A 1DC4A 5JY6A 2Q4EA 4P38A 1Q0HA 4A73A 4BKPA 4K28A 4PLYA 4MJLA 2GO1A 1LDEA 3K30A 1HLPA 5JC8A 1JTVA 1UDBA 1HXHA 4YQYA 5CDTA 3NJ4A 4OJNA 2OBNA 4RZHA 5A03A 2R00A 1NP3A 5IJZA 1VLLA 4MVJH 2VRCA 4YYZA 3K31A 4QQRA 5IZCC 3OF2A 4PZEA 1AHIA 1DFGA 3KETA 4S1VA 1SCUA 5B1YA 4R5HA 3F9IA 1I2ZA 3JQ9A 4XEHA 3GVHA 5JCXA 3PI7A 4JJGA 2Y1EA 1WDLA 1WMBA 4RVHA 2JL1A 4Y6RA 3UCXA 2P4QA 1VC2A 1Y6JA 4KUEA 1HT0A 1NHWA 2W2KA 4BV8A 1WDKA 2YQ4A 3FCOA 4CM1A 3E18A 3V1UA 5AYVA 1HYEA 1YBAA 2OHXA 3WICA 3NT4A 2VT3A 4RGBA 5H81A 4IGFA 1LRJA 1XHLA 3IJRA 4BNFA 2D5CA 5I7FA 3WMWA 5JDIA 3FPCA 5I8ZA 4LMRA 1HZZA 2NV6A 3PWSA 1PGPA 3DOCA 1R4MA 3A4VA 4GKBA 2Q4BA 1CJCA 5TS3A 5JC1A 3H9QA 2GCGA 5JYAA 1DRVA 1MUUA 3PDUA 4WOJA 4UUNA 4NHEA 3QVSA 2HMVA 4NH4A 3NDIA 4BNKA 1NFRA 3TOZA 3JD2A 5CPFA 3IIEA 3DBHA 3NAQA 1DHTA 1ZXLA 4P22A 1QG6A 3GVCA 3H9JA 4D0SA 1LDYA 5K6AC 1EBFA 1PJCA 3HJAA 3AY6A 2NQ8A 4DC0A 2JJYA 1D7OA 4NJOA 2WTBA 4BQRA 1Z45A 1FXSA 3ENKA 2O50A 3AM5A 4EGFA 4BMNA 1TT5A 2HRBA 3RUHA 1HDZA 3RU7A 1EK5A 2VRBA 2O48X 1N92A 3U3XA 3OA2A 3BAZA 3RUDA 3U49A 4OQYA 1R37A 1ZSYA 2XF8A 2WEKA 2VNSA 1UUFA 4MVJI 5ILOA 3PJFA 2OL4A 3KB6A 4DBZA 2Q49A 4UULA 4XB1A 1KETA 1N7HA 1YQDA 3P19A 3LYLA 4EITA 1ADFA 3DTTA 3RCBA 2VOEA 3C85A 5JPIA 1CYDA 4EJ6A 1HE5A 4HKTA 5LDHA 1GQYA 3Q1LA 5COQA 1MFPA 5A9SA 4FDAA 4GI2A 1GY8A 5DOVA 3BHIA 3QVXA 1H5QA 4IS3A 3DBLB 4CMEC 5DOZA 3ZNQA 3I9OA 4LISA 2FPGA 2FPIA 3BMQB 1EUCA 3DZGA 4BV9A 2EGHA 2P9GA 4XRRA 2QZZA 4CV3A 1YL5A 1E6UA 1D1TA 1EFLA 4O5OA 2WDZA 1LSUA 3F5SA 3OM9A 1NPYA 4JQCA 2G5CA 2CY0A 4BKUA 4M54A 2AE1A 4R41A 1B26A 3DBRB 3EAGA 1B15A 4EJ0A 5KWEA 3GOHA 1I24A 2BGMA 2Q45A 2YHUA 3QP9A 4XDZA 4BGEA 4BKQA 3RUFA 3CIFA 2OXIA 2HMTA 3UCFA 3IP3A 5EERA 1H6DA 5DDIP 1U3UA 1EQ2A 2WD7B 3BTOA 5JO0A 1E5QA 3TSCA 1G6KA 4Y8VA 2RH4A 1NVMB 4TZTA 4CV2A 3RC1A 2DM6A 2YUTA 2NM0A 5U1PA 4D43A 2I3AA 1ZVMA 1HWYA 4PLCA 2QW8A 1L7DA 4LVUA 4E3ZA 5C3MA 5KKAA 4BNMA 1QKIA 4D3SA 3GAZA 3DMTC 1KVSA 1VRWA 2AG5A 1C0PA 3W1VA 3L07A 3MWEB 1GZ3A 1U2DA 3PQEA 1DLIA 2FPPA 2O3UA 3IS3A 4MVJG 3TF5A 2OFPA 1WZEA 1P77A 4I5EA 1TXGA 3JQ8B 5KNLA 5CDUA 4IJWA 1VSVA 2IEBA 4RLHA 3I23A 4MP3A 5CP8A 4JK3A 5C7OO 1R12A 2DTDA 4E5NA 1QXSA 3O03A 5T8KA 4CL8A 4B8ZA 3JQFA 1GADO 1PJ4A 4BMVA 1T1SA 5I7EA 2VT2A 4N7RA 3NRCA 4NU6A 1P1HA 4QO7A 2CUKA 1I8TA 1ZBQA 4MP8A 4M55A 1BXGB 1SMKA 4MKZA 3WNVA 5ICMA 3WYBA 4BKRA 3PHGA 1XYGA 5EPOA 4IJKA 1DIRA 1XELA 3K92A 3PGXA 4XCVA 3MJEA 1OZAA 2AEMA 5CAEA 4XQCA 5TIIA 2I65A 3ANLA 1QYVA 3PVZA 4HUJA 2X1HA 1P9LA 4XJTA 3HZZA 3QVWA 1YDWA 5BSFA 3SJ7A 1BRMA 1PX0A 4PLTA 1R0KA 1I0ZA 1LLQA 4CMGA 3L4BA 4ROSA 3WX0A 2PK3A 4B4WA 4IY1A 4AJNA 4JIGA 2VWPA 4BOYA 2C7GA 2DLDA 1YXMA 3W4JA 3TNLA 5CG2A 4GSLA 4U0KA 4Y98A 5JSFA 4J90A 3U4CA 4TWRA 3Q2IA 1DFHA 3UAGA 2NTVA 3C7AA 3ZGYA 1ADBA 3OQ6A 1KC3A 5FI3A 4DTIA 5MDHA 3WQQA 3C1TA 1H93A 5CEEA 2DBVO 4KMSA 1K5HA 1Z6ZA 4HWKA 1IPFA 5ES3A 4E2WA 2VHZA 5HS4A 4NK4A 1FMCA 1PIWA 2A4KA 5JAIA 5JBIA 3N74A 2IXAA 4IDBA 4GLLA 4OSPA 4YJFB 3A28A 4RF2A 3E9QA 3OIGA 1NWHA 2ZTVA 5CDSA 3NGLA 1JVBA 3VZPA 2Y66A 2V6MA 3EUWA 3LT1A 5TRTA 3SXPA 4CMAA 1QR6A 1GEEA 3SVTA 2PR2A 3JD1A 4BNZA 4WLOA 2D1YA 3KSUA 3Q9NA 5DP1A 1WP4A 4QECA 4NZ9A 3MJCA 2FMUA 1O9BA 4YJGB 4CQMA 1H6AA 2W2KB 4I5DA 4CMBA 5A02A 2YV2A 4LRTB 3IDSA 1NFQA 4OOEA 1ONPA 2AQIA 2PZLA 1MX3A 4YAIA 1GD1O 2B5VA 4DVJA 4GVXA 4A10A 4MIYA 4D45A 3PIIA 2VTDA 3AK4A 3UN1A 3AJRA 3ZN2A 3BTUA 4CV0A 4NBRA 1DFIA 5L9AA 5BT9A 1AHHA 3L0DA 4BGIA 5IDYA 1H2HA 5L7WA 4FD3A 4YAJA 4JP2A 5ILGA 4R9RA 4XYBA 3TL2A 3IUSA 2EKQA 1N8KA 1LU9A 1E7MA 1NHGA 3BXXA 5TF4A 4AJOA 4E5MA 3G17A 4WEQA 4XB2A 3I83A 3B70A 3DBHB 4J0EA 3ZWWA 4O6VA 3ZU5A 2PGLA 2V65A 1EE2A 1U5CA 3BMCB 4C4OA 4PVDA 4BO5A 1B8UA 4YAKA 2CNBA 3DXFA 4ZGWA 2X9NA 4N5LA 4B7UA 1ENZA 1IZ9A 3F1KA 3DFZA 2E82A 3GRPA 3VVCA 3ABIA 2VHXA 3VH2A 5JE8A 1E7RA 2DT5A 4BGUA 1NVGA 1LXCA 3ZNPA 1TT5B 1UP7A 1DOHA 2OP1A 4DUPA 1EBUA 1KEVA 4DPMA 5BNFA 4ZRMA 1YQGA 3WGZA 3JQGB 2PZMA 1HDCA 3ZCXA 3QJ5A 3DHNA 3I5MA 1PJQA 4ESOA 1E3IA 1EQUA 2H6EA 3GDOA 4MDHA 1Y9EA 3I6QA 4D3FA 1IB6A 1V35A 3R3JA 2AQKA 2HKIA 2TMDA 2PZJA 5A9SB 5COBA 1PQUA 1KVQA 1NX6A 4GH5A 3NTRA 3WWYA 3QVOA 4UUPA 4YR9A 3TL3A 1PR9A 3U4DA 2CVZA 1B0AA 4YT2A 4YA6A 2E4AA 4CMHA 1J49A 1M6WA 1KYQA 3HFGA 3L6OO 3JQBA 2C54A 4B3IA 4OAQA 4CMJA 3MJVA 4NK5A 3ONFA 1FK8A 1GEGA 1E92A 4PG8A 1I2CA 3NX4A 1PS0A 2D0IA 2HLPA 4WLFA 1N9GA 4YB8A 1ZEMA 1AE1A 4R3NA 3WFJA 1XA0A 1MLDA 1LSJA 5EINA 3FN4A 3D4NA 1IOLA 3ROKA 1QYXA 2HJRA 2W8ZA 4Z0HO 1JW9B 2Q1UA 4JLWA 3UCEA 4FGSA 2A94A 3MJ4A 3H9UA 1CQIA 1ISFA 2GRAA 3TFQA 1BVRA 4RO0A 5EJ2A 2GERA 2Q2VA 5DBFA 1H9AA 3DR3A 3H2SA 1U3VA 3PPIA 1EEHA 2V7PA 1BG6A 1V3TA 1NM5A 5IZ4A 5L51A 5G2OA 2OGUA 3QWIA 4FBGA 1E7QA 3GUCA 4YRDA 4Z3DA 5IXYA 3RFXA 4KOAA 1BW9A 1C14A 4WPGA 1DLJA 2BF7A 3WNQA 4EEZA 3AM4A 4BNTA 4K1LA 1VL0A 4IS2A 3DOOA 4JX8A 3EYWA 3ZHBA 3S55A 4OGWA 4QFDA 3U4HA 1ZXBA 1JKJA 3DZFA 4CM9D 4DXHA 2P5UA
chains in the Genus database with same CATH superfamily
2OUIA 5LMNB 3H2JA 1M0SA 2AOUA 2HWYA 1N0UA 3IPXA 3VVMA 3WK7A 1X80B 5AESA 1Q50A 4OLJA 2F1JA 3PXUA 3KXPA 1WDWB 4ZO8A 2P67A 3LUAA 1MEOA 5GWXA 2B94A 3TOXA 4W5QA 1PZFA 2I1WA 2OORC 3QVVA 3V8PA 1RVV1 3G23A 1W581 2NVUA 4S3MA 4EG4A 4M9ZA 4ZMBA 1WB4A 5F77A 2GETA 1MA0A 2XTMA 2HGZA 2W6CX 3UNXA 4BO7A 1E9VA 1H42A 2MU1A 4KV7A 4XLLA 4R2MA 4HEA6 2B5WA 5EGNA 4EI2A 5BQXA 1M83A 4D74A 1E60A 1M2VA 2PGOA 3U81A 4KLZA 4IW3B 5EP3A 3O8RA 3C6MA 4EDHA 4ER5A 1EIWA 2NZVG 2ZRNA 2ZIEA 2CXPA 1JT9A 2PA3A 3QX7A 4BTVA 1RABA 2HXGA 4X1YA 1KY4A 4PANA 4HUTA 2ZVJA 1KOLA 1Z7YA 3PZBA 3DLTA 2JH8A 3L05A 2W2PA 3L7BA 4LJ7A 4TKLA 4XDGA 5CK5A 5CT6A 5IZCA 2L2QA 3RVNA 2LZ0A 5K3CA 1T6ZA 4E32A 5AVSA 5JHGB 3U2QA 3GLIA 1IHYA 1C0IA 2X86A 3T7CA 4GZ5A 4XIJA 5EQJB 4D46A 3BGOS 4EBBA 1A9ZA 4KSBA 2IS1A 5FF9A 2J08A 4XFJA 2O4UX 3K5HA 4ARUA 4N7BA 5EHIA 1TEHA 4AAYA 1A71A 3JQAB 4FCVA 3UWDA 3UWKA 5HOQA 1QRTA 3ADPA 1RVDA 4LJRA 3LY8A 2MSEB 4FJ1A 4YAEA 2R3SA 1BJRE 3EARA 1IBKB 5E1DA 1SUIA 2QX7A 4U6QA 2FQXA 4MKXA 3V4FA 1ZH4A 2RK6A 2ZSBA 5KMGB 1EAMA 1A5ZA 4N0QA 1I6KA 1ADJA 2Y6UA 4Y3UA 5FTMA 4EPYA 4L4UA 1LZKA 4L72A 1GDHA 1WY7A 1ZVQA 4X94A 4YP7A 5A4DA 5KKCA 1NUPA 1CZLA 2E1RA 3G0OA 1RQ2A 3NWBA 4IO0A 1X1TA 4LQ4A 1VE5A 5EXXA 2HW8A 3K96A 3L79A 3T5PA 1X1BA 1YIOA 2JK1A 1R8QA 4QPZA 2CLHB 3GXOA 1GKIA 4TMXA 4UHKA 2WK1A 1QZXA 1LTHR 1TADA 3U7QA 3BE4A 3DVAA 5ETJA 1QF6A 3KT8A 1RHRA 5BSVA 4EW6A 1IPEA 3O4JA 3HY4A 1KFBB 4W8OA 3RAGA 5BWBA 3UKDA 2X0RA 3NWJA 3PGLA 3H0KA 5C81A 4QEKA 2YN0A 3L4JA 2DCUA 3MG9A 3KR1A 3ZOKA 4RTQA 1MO5A 2IBMA 4H6VA 1HETA 4HZGA 4XYGA 2BEUA 2O3QA 2OAEA 4BAUA 1NC3A 1VJGA 5DGDA 2UVPA 4DRXB 1JN0A 2Q3DA 1QV7A 1Z4MA 3P2KA 3Q4GA 1JDUA 2VJBA 4NCBA 5LOVB 1EVJA 1PNOA 2YZ7A 2P4HX 4P9NA 3IP6A 3QF4A 3MCUA 2AI3A 4FKZA 4MV1A 4NS1A 1L7OA 4QQFA 4RZXA 4TL8A 5EP4A 4C0WA 2IH4A 4P4GA 4BKOA 1IB0A 4QSMA 3UPDA 5ALPA 4YDHB 1TEVA 3BZUA 5SZHB 4RZIA 3TLXA 3T1TA 4Q9DA 1J00A 4K26A 1N5OX 3ITNA 7ABPA 5FQOA 2G6TA 4M7RA 3DXZA 5KYNA 1LRKA 1HT3A 1L5WA 4FGUA 2QMZA 1U1FA 3QXCA 4XM2A 1OU4A 1V3VA 2ZSUA 5DTIA 5EVJA 3ZU3A 2GN1A 4XOUA 4MULA 1GRCA 2P2YA 3SQLA 4A7PA 4DIUA 1UJMA 4YUWA 3CRMA 2Z30A 1FYXA 4GWGA 5EZSA 3TTTA 3TVTA 3O9MA 1JKMA 4J4HA 3EEIA 2QN3A 2OR3A 2WFAA 1HX7A 5HA5A 1XTRA 3UJDA 1SOVA 2I6QA 2ERCA 1KWGA 1OX5A 4Q19A 1SOAA 4J1QA 3G2NA 4FNOA 3V4ZA 5JYDA 1WLYA 3ZHVA 4BIMA 3C5CA 2GSWA 4CMEA 4R31A 2IC5A 4FPXA 1TKBA 3ESXA 3RRXA 1MO4A 4FHDA 1SHKA 2EZ9A 3VOTA 2IY8A 4XVCA 4ZYTA 3TZHA 1ZJ6A 2AEEA 2YJZA 5C1BA 1U0RA 1XEXB 2GKOA 4IDGA 3V3TA 2UUBB 4DKXA 3AY7A 1V37A 3FSJX 2MR5A 3ZTYA 4N47A 2GA9A 4XX0A 4NNJA 1GKLA 3HKDB 4YIHA 3MWFA 2QTHA 3RHZA 3OQMA 1TCCA 1QIDA 1TLLA 1O0SA 2H7CA 1WZNA 1Z12A 2VWGA 3EFOB 4DBVO 3CPSA 1DAPA 1T0IA 1WCIA 2QTBA 3PRJA 3QVLA 3VX3A 4BGDA 2HIHA 3TECE 2X4GA 2G7ZA 4GLBA 4I0WB 1GU7A 4LI0A 2JFOA 4XD2A 5FOUA 5I9MA 4FEEA 4LI3X 3EIOA 1V16A 4HBGA 4DIOA 3AI3A 1DPFA 2I3ZA 3HN7A 3ET5A 2ZE8A 2HRZA 4FU0A 1GPYA 2JK0A 3CRW1 2YIJA 4I3HA 1A8QA 1ZK3A 1L0BA 2X42A 1U8AA 2XHZA 1EX7A 3BRCA 4AJEA 3W9SA 3PJGA 4J0QA 4H6WA 3G49A 1I1OA 3I04M 1CUFA 3AKYA 5DSTA 2I1LA 3D1VA 2EQ5A 2RHTA 2R6CA 4RANA 1NXWA 4I50F 1Y8RA 2R44A 2PO5A 3OY7A 2A9FA 3TSOA 5FFMA 1IXYA 4A2CA 1K27A 5NLLA 4IDDA 1HYHA 3B1JA 3ROTA 4ENQA 3C1AA 5FOWA 3UPUA 3IKLA 3HU2A 2O2DA 3DLBA 5ESXA 3M5WA 2BEVA 2QX9A 4JXZA 1LWOA 4NP6A 1RWOA 1VE9A 4BYGA 3NNNA 1L5HB 3DMTA 5KJ6A 1ORRA 2QTCA 1PNQA 4CFYA 1JAHA 1FNCA 4BX9A 2DTEA 4GKKB 1TU0A 4PQGA 4OHUA 1VM6A 2QF7A 4DR3B 1DWOA 3DFIA 4CMCA 3RYTC 1G8HA 2PBZA 3AC0A 1RXCA 3OFKA 3S8EA 3GFBA 3H83A 4WGFA 3L7YA 4M1EA 2WE8A 2OILA 2D1TA 4C08A 1CPYA 3EAQA 2PWYA 4MW2A 5HKOA 5EIOA 4NH0A 2GZ2A 1VI2A 3VR6A 1XZAA 2FPXA 2ZE7A 3QHPA 1YQWA 2F3QA 2JNWA 4WINA 2IQIA 5GINE 3AH8A 1CFJA 5TSDA 1XTBA 4KH0A 3T06B 4BMPB 1GJRA 1ESDA 3RS2A 3VC7A 4DLVA 2RGGA 4DQVA 3JQ7A 4FM9A 3R8FA 1KKUA 1YK1A 5FYQA 3LRXA 4P32A 2JGDA 4BZQA 2H4XA 1RRVA 3JAMA 1DIOB 1W48A 1YWGO 3RWBA 3GEDA 1L7RA 3M6WA 3AUKA 3VPXA 1ZD1A 1A69A 3VJKA 5BWOA 4JJ4A 3R7DA 2P4UA 1A3CA 1W8IA 4N82A 4BMYA 1GP2A 4CM8A 3NAMA 2Q1SA 4L4XA 4QELA 3DV0A 1Y9JA 3UTDA 1WQ4A 4GWLA 2ACWA 4FBMA 4PZCA 4GRDA 4D56A 2RBEA 1IBMB 1RM0A 1J20A 3N7UA 2FLKA 1SHUX 3JZMA 3SBEA 8ATCA 1YR1A 1PR6A 1R8XA 5CX1B 6GPBA 4CIYA 3G5TA 3E4DA 4R40A 1ZD8A 3T7DA 3ZBTA 4GLJA 3HA2A 1EDDA 1SHLA 2NTEA 5EXPA 2QSUA 4B0PA 1L5OA 2BBSA 4RELA 5JARA 2TRSB 4ZZ2A 3BX1A 2G77B 3VU9B 1GUDA 2P9HA 3TPZA 4CU5A 4KGDA 5HRAA 4LF4B 1C0EA 3ABZA 4B44A 5GZ6A 2NSHA 3KUCA 3KUDA 5I7UA 1LPNA 1QZZA 4MUNA 1U9CA 3F3MA 1EBBA 3RRNA 1Y3CE 2YR0A 4LXXA 4Q3EA 5IMBA 2QN9A 3C5VA 4F93B 4Y2JA 2JBAB 3IO3A 2WUFA 3LLSA 4GLOA 3AEXA 4UDXX 1TD1A 4P34A 3ZS9A 4Q1BA 2AN5A 4Z1MD 4I6JA 2ZYVX 5I5GA 3WWZA 1KEKA 4U7GA 1JPUA 1ST2A 2WE7A 1FLVA 3WC4A 3JZIA 1BEZA 4UHDA 4BU0A 4BP9A 4HNHA 2ZOSA 1YI1A 1U7TA 2CFIA 3AZPA 4UDYX 4I81A 4EY4A 2IYUA 1D1PA 3DO8A 3WTCA 3ZIUA 2CD9A 3BHNA 4CTJA 5C7LO 1RWQA 2NX2A 3BICA 4AZ0B 4QIHA 4EG8A 5F3WB 2JJ1A 2OGTA 3FBTA 1PG5A 4U8HA 4W1PA 3O3OB 3RROA 2C7RA 2XD4A 3D4OA 1TMKA 4KZPA 4LWOA 4BNGA 1U4OA 3D8TA 2FU5C 3UMGA 6ADHA 4U5QA 4FCWA 1F4PA 2I2FA 3DE5X 4FYWA 3T3OA 3RC7A 1P0PA 1L5MA 1GPJA 3ML1A 4RMJA 4CLOB 1VBMA 3LBHA 1QUFA 1UANA 2WIAA 4M3NA 4P0TA 4UVDA 1JQLB 1AKRA 1V2HE 2B0JA 2VZ0A 5EIAA 4EYEA 4GU5A 1NVVR 1CUBA 1V5IA 2O8VA 5FOTA 3WGTA 4E46A 5JIBA 3OX3A 1AN0A 2BUAA 3FWKA 1CEXA 4LTNA 2WFLB 1XMPA 4P80A 1PJTA 5JNVA 3QEBZ 3S2ZA 5G40A 5IF3A 3M2TA 1JDBB 5IT4A 2ZYAA 1SPBS 1YL7A 1N6PA 3LSYA 1FYVA 3CLKA 1C1HA 1Y4UA 4AJKA 3OIWA 1KBZA 3GLVA 4ER7A 4ZCRA 2IF2A 3FUXA 3QEJA 1QGZA 2JLRA 5D3MB 3FOWA 2H0QA 4EHKA 2XGJA 3N5KA 2CW5A 3WK6A 4OO3A 4JJIA 4XARA 3ESAA 4FDTA 2QR3A 4TTIA 1SXQA 2W93A 3BK7A 4FZ5A 3IKTA 1J22A 4R83A 3L6CA 1A4IA 1L5GB 4KREA 1GG8A 2AOTA 3IODA 1SBNE 4EQ6A 4UDNA 2ZWPA 3NH9A 4EY6A 3ROQA 5DHRA 4BJ6A 1UQTA 2FFAA 3WK4A 3SJAA 5CA0B 2PVCA 3W2HA 2PXCA 3KUKA 4YV2A 3U5TA 1YHYA 4IWNA 4RVOA 4CCYA 1JXOA 1C9KA 3SHQA 4OXKA 3JVVA 3MNFA 5TV2A 3DGEC 3VHXA 3HYNA 4OB7A 4RL6A 4JA2A 2XB2A 3KYCA 2X22A 3RQIA 2YBDA 1WCV1 4YGXB 4HY3A 1RWBA 2JA2A 4U9UA 1NDUA 1TEXA 3H3XA 4QPDA 5ALXA 5C37A 4M0PA 4MLCA 1S7CA 1T2UA 1RJFA 3JYPA 4O4IB 4PCAA 5I9BA 4E33A 4OQXA 3RQSA 2ZUSA 2VJMA 3LUCA 4GD3Q 3HVHA 5DGXA 3RBVA 3G2QA 4RPKA 3LO5A 2PS0A 4HLUC 1CDZA 1RYFA 5LXTF 2WJGA 1V8OA 3WGYA 1N1GA 3RUCA 3QLJA 1LW6E 4GZLA 2FPWA 4F4HA 3GD5A 3FKJA 4ENUA 5LN1A 2NSJA 2FB9A 4QFMA 1Y3IA 2G40A 2AC4A 4MV8A 4QULA 3JV7A 2C2YA 1YKSA 3VYTB 4K05A 2GZHA 2A9KA 3GC6A 3BH0A 1J9EA 3B3FA 1OH6A 3LT4A 2F9MA 2FJ0A 2HJGA 3WYNA 3T7IA 1YS9A 1V6CA 4FYMA 1VI6A 4PZ0A 1IUKA 1ZU5A 3NHWA 4FYXA 5DX1A 5AW4A 2RJNA 3E3OA 2WMNB 4TYMA 2JLYA 3W9UA 3ZZTA 4ER0A 4L5CA 3HO6A 4GNKA 5TT0A 3AFMA 4E14A 3OEWA 5GONF 3O5AA 4B79A 4KXQA 1YE5A 1NMQA 2XHEA 5H4GA 5KTTA 2O8FB 1FJHA 3DA8A 1EFDN 3MRVA 4D0RA 2C2MA 1O5IA 3PE3A 1RC8A 2B2NA 1XXHB 3SHFA 1FX0A 1R9GA 1G20A 3P27A 2BH2A 3AVOA 4C7JA 1DAFA 3CO0S 5K5EA 1Z06A 2QLFA 3GN1A 3PTZA 4G07A 3AVTA 4C7KA 5J5AA 4M87A 1ORHA 2B1IA 5HZHA 4BTLA 3LC1O 2QW1A 4TS3A 5C0OE 3OFJA 2GBCA 1TLTA 1JG3A 4WOBA 2OAP1 4OHOA 2Y71A 4KHPB 2FPOA 4JT4A 4KXFB 1J25A 4PNZA 4RPJA 4KU4A 2VUIB 3I5YA 1SUWA 3GFFA 4YMIA 1B23P 3AR8A 2Q99A 4PZDA 1YMVA 2IUYA 2PQ2A 3EODA 5PNTA 3J7AC 3OZ7A 1RC1A 1A8HA 2H2AA 4EX7A 1A76A 2BGWA 3ZJXA 2IDZA 3AHCA 4RVGA 5G1OA 2B9VA 5E1MA 4BQPA 5CB0A 5L45A 5JS1A 1YZGA 1Q2XA 4O4HF 3A6EA 1DBIA 1RIIA 1U3WA 1KJWA 3AGQA 3BQNB 3IOCA 4MGYR 4RH1A 1COWD 4TQ9A 5C7YA 4NV0A 2P69A 1XA3A 3IEUA 1JU4A 1H8HA 2VXOA 3IVXA 4F6CA 4NY1A 1JFSA 1QLWA 3JSAA 4B3HA 4EYKA 4EB8A 1B0PA 1VTKA 3H5RA 4Q3LA 1Z83A 2I4LA 2IBTA 3UMBA 3JQRA 1F2UA 2HQ1A 1F12A 4Z0TA 2QMUA 2O1SA 1VJ1A 1Y6FA 1HGXA 1K6IA 1PL6A 1BE8A 1XR3A 3U3ZA 3SFVA 5L7TA 3GLFA 5ECYA 2NADA 4BLSA 2DXIA 2C4KA 2RCYA 3DAFA 4I66A 3D4LA 1Q7RA 1KFCB 1LF0A 3UK2A 1XC7A 5FHQA 2VNHA 2AW5A 2O6HA 3GHYA 3NC4A 2E1PA 4KN6A 2CNOA 4V0LA 3ZWAA 1R3UA 5B36A 4MVJP 1OTXA 1SAYA 2QJWA 2ARKA 4NABA 1IUPA 1GGFA 2W2VA 3A06A 4K03A 1TQ4A 1YDHA 3QOFA 4AUEA 1E79D 4CM7A 4WK4B 3H7IA 1NJ5A 2ZS7A 3QU4A 5BQPA 1P4RA 4LGYA 4PWZA 3IP7A 1N2IA 2GF2A 4QBGB 3PEWA 4G9BA 3NTOA 3T4XA 3THRA 1T8YA 1YU9A 2XTAA 3C6XA 3KKZA 4NR0A 5I4KA 3G89A 5JECA 5IAAA 3EUEA 3W8RA 1ONNA 2WYWA 4DIFA 1QG0A 1R4MB 3NV9A 2AEJA 4TTPA 2YWEA 4EW2A 5BNWA 1YA6A 3CA8A 3Q8XB 2PZBA 1OLUB 4X60A 2VNJA 3VYSB 1NI5A 2JG3A 2PVSA 4ARZA 3S8MA 3TUJC 5DF1A 1RLUA 3R5HA 4HDKA 4EB0A 1DMSA 3L7CA 3KS9A 4U8GA 3BMOA 4IHJF 4ZYUA 4HYQA 3C6KA 3MHTA 4UFPA 2XW6A 1B14A 4IYJA 5LA6A 1ZESA 2VWQA 4DXDA 2V7VA 1CEQA 3BZBA 2IZ0A 5CDFE 3R7AA 3WKAA 5EKXA 1N2HA 4PTLA 5GZ3A 1W1WA 5EIHA 2H9YA 3DE4X 1N6RA 1AMUA 2PT7A 4BV3A 1XZPA 3KVRA 1DQSA 3FNHA 4EJSA 2PPVA 3SN6A 1UM9A 3THWB 2PKRA 4OLHA 4BNHA 1RXSA 5IXSA 3SM3A 3V42A 4WBXC 1ZINA 4BNDA 3JRXA 4OA5A 1ZN9A 4YUYA 5LWQA 4QT0A 3B51X 3O9ZA 4ZYZA 4J3JA 4C01A 2F1HA 2JIZD 3U4MA 2VZ8A 2JS7A 5ADWA 2HYIC 4EVIA 3EZYA 1U4SA 1T8UA 1OAKA 4J7XA 5LP6B 3W3AD 2RD2A 2IVZA 2VT7A 4C88A 1FJ2A 3FR7A 5BSTA 1IVNA 4TKZA 1OI2A 3TUTA 1EJ0A 1ORTA 4MR7B 3FZEA 1BHO1 4YAGA 5IDWA 3I52A 2FLVA 1QJ4A 1E9SA 2PV7A 4DSTA 1IOVA 5CVTA 1GZ4A 2DERA 4AY5A 2V4UA 3RBAA 5F98A 3TLZA 1V95A 2O8CA 3M4XA 1X1QA 3Q3JB 5LZ8A 3L92A 4OJQA 3TFWA 1AX9A 4L15A 2I66A 1CZKA 3LQ2A 3Q7SA 4FZJA 3TQFA 3HL4A 1K97A 2W6NA 3QRWA 4JI1B 5IUKC 5JS6A 2Q2NA 2QAGB 1ADCA 2WICA 5AM0A 5HTKA 3GEMA 5E4YA 5JS8A 1MP0A 2QYSA 4LMBA 1T6YA 3ABQB 3PPXA 1BHJA 5DV9A 1F51E 1YTLA 2NNWB 1TJNA 3PF9A 4D80A 1GSAA 2XOEA 4BNIA 2VA9A 3G9ZA 1OH8A 1OGYA 1K88A 4DWJA 5KOIA 3HMQA 1CX9B 4HB2A 3LOPA 4LF5B 3GRUA 1DBPA 1NDQA 3A6JA 3ABOB 4FI3F 2VWHA 5KCMA 4BLTA 5LM3A 5AQEA 3N1UA 2IITA 1CJTC 5C8VA 3G2IA 4HDMB 2ZTMA 4WN9B 1I2BA 1O1YA 2OVFA 3NHMA 4FQ8A 3CLSC 3MINB 2C9DA 1Z2DA 3P9YA 1XD9A 5F4ZA 5B3JA 5C5EA 1WSDA 3O3NB 4NCIA 2GZ1A 3IOEA 1C3EA 3VGPA 3T3NA 3LVFO 4ZO6A 3SYKA 4C07A 2C2KA 2HSJA 1N5KA 2ZYTX 4AKHA 1CUEA 4WBNB 1YVPA 1UK8A 2HFKA 1P60A 1W4ZA 4OGFA 4CEJB 4BE4A 5G1PA 1ECGA 5AW3A 1DP4A 2HJVA 1QQ5A 3HUFA 4J6FA 4ZVNA 5I51A 4RCVA 2OMKA 5I9IA 3Q11A 1LSSA 1YR3A 3RODA 3VNRA 1B8PA 1GPAA 1YBHA 2JIOA 3M4JA 1V1JA 4YHBA 4YUVA 2H57A 4FFLA 1W59A 1PZXA 2HU5A 1A5BB 3AR6A 4M1YA 5UKDA 4DM4A 1DXOA 4MR9A 2WPDD 2HWKA 3N53A 4DWVA 4EX6A 4GE3A 3KZVA 5CH5A 1GTVA 1ZK0A 3ROMA 1QM5A 2BUCA 2P9BA 4F3CA 3I0MA 1B3RA 4I4CA 4JOQA 3P9XA 2XMZA 2D0DA 1FTNA 1T1EA 3CEHA 1NQVA 3HV2A 3GB9A 4F45A 3IQHX 2HX1A 4KQMA 4AKIA 2PLNA 4ZQCB 4BUCA 2FCAA 1Q0LA 2AIRA 3O93A 3YASA 3OCUA 5BN3B 3PEVA 5EAIA 2X2PA 3A4IA 4I9HA 1Z63A 1H94A 5H16A 3IL2A 3UJBA 2DC1A 4NZNA 1J2RA 2FVXA 2I7XA 3FMPB 1USWA 4NSNA 1I2MA 1DADA 2OO7A 4NMXB 4OFXA 3RJTA 3BXEA 5KYYA 2YNMD 3QPAA 4FMDF 1RXIA 4LJAA 4C4YA 1B74A 1XXHE 3VR3D 3WB0A 1E3SA 3C43A 1MABA 1PWZA 3ND5A 2WF7A 3MMSA 2QLLA 3TB4A 4R8SA 1GDTA 2VJQA 2IV3A 1MR3F 5B2ZA 2NV2B 3EDRA 1ENPA 4OQPA 5CDHA 2OBYA 4RMHA 4NAUA 4X63A 5ALIA 3TMAA 2FWRA 1UBRS 1NF9A 4OBXA 3AUUA 4TT3A 4B9AA 1IY0A 4BVFA 1Z35A 2B3DA 5HKLA 2H29A 5T57A 4RWEA 4Y9DA 4P3OA 5DYWA 3HQ4O 2FEMA 2JCYA 4JITA 4X54A 5J2UA 1AGXA 3BWBA 3EQ7A 4OATA 5A62A 3OTWA 3GG9A 4B8WA 3NHJA 4G9EA 4POOA 5F7XA 1D6JA 3HE3A 2AKEA 1SXIA 1JA9A 2DHQA 3EBOA 2QM8A 1YR9A 1M2FA 1I01A 2JZCA 1CDOA 3ICWA 3HXTA 4R6WA 1T2AA 3KHSA 1SCKA 2W37A 3OOSA 4I4TF 4A26A 2L19A 421PA 5CCXA 2ZI5A 3I01M 1TJ5A 2FK8A 2VQFB 4CBVA 3IMGA 4MV0A 4DG8A 1JKFA 1E2LA 2FN9A 1WPRA 3X1WA 1OHHA 2QRHA 2ZAYA 5EL0A 5ECWA 1YOBA 4E4TA 7AT1A 5KYXA 3ISTA 1U90A 3PPVA 3SVZA 4LZAA 5F1OA 3AJ8A 4F7WA 5AR1A 1PR4A 3SQNA 1KVTA 1MQ8B 1L7PA 5KEIA 1JPJA 1XDSA 3FWZA 3N86A 2AMFA 3PL5A 2UYCA 4OI0A 1R2QA 3F5QA 2R6HA 5F5NA 4YRIA 3TLJA 3IAM6 4MUJA 1LF5A 3A2NA 4JI6B 3M89A 2EFDB 3Q41A 3TNYA 3VSCA 4BEVA 1YFZA 4PYIA 1C3XA 5JH7A 1T2FA 4F21A 1PV2A 3KHUA 3TN7A 4DF3A 1I79B 5B4UA 3FB4A 4D3DA 1KH1A 3WRXC 1A8UA 2X6QA 1NRIA 3WLAA 3L6UA 5CNIA 3E53A 4DG5A 3IEIA 3ZV3A 2WU1A 1K92A 1U2TA 4RVSA 2XCUA 2OB1A 3E2IA 4EP1A 1PVDA 3ZE8A 1ISGA 1A5TA 3A70A 1XYVA 1Q21A 3MWEA 4OK6A 2A7XA 3DWEX 3WQSB 2YVLA 5L4NA 3ZUPA 3VDRA 2B6NA 3D3WB 4FE7A 3AXSA 4MQEB 4WTOA 1VIDA 3FH0A 4E08A 5DNWA 3ZYZA 5E3HA 3A4TA 5K6AA 4AL4A 4D9FA 3IE2A 5EIEA 4B3CA 1A82A 1M5TA 4Q15A 2ZAOA 3T52A 4XOIA 1KJNA 4X7BA 1SWWA 3CH4B 3TJRA 4DJDC 4NBSA 2CB9A 4YT4A 3H4VA 4OHKA 5DBOA 1G21A 4BHTA 1DSSG 3SKXA 3GJXC 3HUTA 4OI1A 2IHNA 1NW4A 1AQIA 3STYA 1P9OA 5CFQA 3BFJA 5IEJA 2X5OA 2YVKA 1JL3A 2Y05A 3M6AA 4KO8A 1RYHA 4LSZA 4NMWA 3WLEA 1GYPA 4HZUA 3OIDA 2PWPA 3L2OB 4Z9YA 2V59A 1LDNA 3V7NA 2YHBA 2QGFA 3KQTA 2VHVA 3O4FA 3NBKA 4IILA 4ENSA 1J42A 1TZBA 3WAJA 2WWXA 1BXGA 1ML4A 3IAS1 2MYUA 4AIIA 1LBQA 4CQJA 2ATIA 2ZQZA 4P83A 3C3BA 2D5AA 4MAAA 1EVZA 3QMWA 4UTXA 5JS2A 4ALLA 2B8JA 1PZNA 2R79A 4OXXA 5AKZA 1EP9A 4O2BA 3IBGA 4V0OA 1ABBA 1C3VA 3GEBA 3ITDA 4P2BA 1ZOSA 1JQJC 3VR6D 4K46A 1I4TD 4RPCA 4P5DA 4Q9LA 1EDEA 1LZLA 3UEOA 4B2YA 3VRHA 4ETIA 3F6SA 1B6TA 2P9YA 4KTTE 2HPHA 4J3NA 2JFXA 2K87A 4WZBA 3I01A 1LNQA 4CKWA 1NV8A 3BOSA 3M3PA 5JYBA 2QGNA 1AVTA 3W3AH 2P9CA 2A9OA 1XQ1A 2F2TA 2VJKA 2WUWE 4DA6A 1AOXA 2HK7A 2NW6A 4QRHA 4COOA 1NXOA 4OUDB 1ULHA 4WVFA 5TQ2A 2ZM6B 2FQQA 3BFPA 4FVTA 2X3YA 1HC7A 4DMLA 1DRUA 2Z3VA 3REOA 3T1VA 3NDBB 4N48A 2AQ8A 2IZ5A 5L3SA 4KR9A 3TAXA 2AG6A 1ZISA 1CY7A 4Q7LA 1W4AA 3DO6A 1B16A 3NHPA 3U3OA 4LQLA 1JLRA 5HM6A 1SU4A 4BE9A 3F3YA 3PZRA 2QM0A 2XA9A 2HQOA 3VYUB 1GQOA 4GOMD 4KGVA 3JYLA 3EY9A 1F7VA 1NXPA 2RH9B 4DIMA 3F1LA 2EW2A 4ZT2A 4O2RA 5HCNA 2QXUA 4PYLA 4B84A 3Q8KA 2HEGA 4R8KA 2D2EA 4PHTA 1NI4B 4URVR 1REQB 3F7MA 3H5AA 5A7FA 4V03A 4J1TA 1HE1C 1HOXA 2ORYA 3ADOA 3OZDA 3PK0A 1DJOA 5AI0A 1C4WA 2WJIA 3MT9A 4OP2A 3V8EA 5GZ1A 4B3FX 5HK9A 1UIRA 2HHCA 1EVQA 1AKYA 3CH6A 3X3HA 5BN5A 4C7VA 5BV0A 1JEQA 3SZRA 1J0DA 1QYWA 1PW7A 1RWWA 4J7UA 3ZD8A 2R2AA 1AY0A 4PPGA 2XNKA 2UVDA 3DQQA 4OI4A 5IPFA 4KQ1A 4PPNA 4AS3A 2E49A 3IHTA 3T0GA 3UA4A 1O77A 1LK7A 1MN6A 3HZHA 2Y76A 4QJBA 1JDBC 1KC1A 2J6HA 1ACMA 3LCVB 1BEUB 2O3JA 3QSGA 4JLVA 3HG7A 1V8ZA 1KPIA 2VP0A 1D6NA 3F8SA 3KCNA 3NBAA 4INJA 1PVVA 2Z43A 5TC4A 4BNJA 3KAQA 3P0EA 4E22A 1QH8B 1V1RA 2JJ1D 2P79A 1N7JA 4G36A 4K87A 1N9GB 2WJZB 5ERGB 1UR5A 4H3VA 4M9QA 5TMPA 1WQ1R 3NHUA 1GRQA 5J58A 4IKPA 4AWAA 3DZ8A 4HPJB 4ID9A 4OLFA 4II2A 4W8GA 3GFVA 2A67A 2BFPA 3KQPA 4P4NA 4DCMA 1HKUA 1E5TA 2Q46A 3NC0C 1VLHA 1GR0A 1NQTA 3LM8A 1KMIY 2WT4A 4B6SA 2OZEA 4S1TA 1D8TA 2WFMA 4AJJA 4WKBA 1OFHA 2X2OA 2ZJYA 5CYGA 5KTYA 1W9MA 5I47A 2FTKE 2OO5C 3AL2A 4DARA 1T4BA 2F4NA 4JQZA 4DNQA 1LJ8A 4C7MA 3FNIA 2FOXA 4F4CA 4H15A 4FZRA 4OA8A 2YIDA 4R1UA 1QVRA 2LE0A 5IVIA 3STTA 1GARA 4MR8B 3R20A 4UCXA 2JFGA 4ZODA 3ROZA 5YASA 5JD3A 2FFBA 4CETA 3ESYA 1EFKA 3LX8A 2O7QA 1GRNA 4MW0A 2YYAA 3OQIB 2IYXA 2QU8A 4PM4A 2CXSA 3IKMB 3DL0A 3TZCA 3BMCA 4DNOA 2PA0A 1LBIA 2PLWA 5H5JA 4B2PA 2ZIZA 2H2WA 5DCUA 1VHJA 2OHHA 2HT6A 2JLQA 2XUAA 4P4TA 1PSDA 1V9SA 3T3GA 5K1ZA 5JROA 2WA2A 1T4CA 3S2IA 1XXLA 2PGAA 1C30B 3LT0A 4MIOA 4UHHA 4PW0A 2DBZA 5I3ZA 1WBJB 3G9UA 2AOUB 4PLVA 1UPBA 4Y2UA 2EV9A 4MB0A 1FJGB 5PGMA 2BBOA 2YUIA 1DARA 1BGWA 3E0QA 3JQGA 4FXPA 4LZNA 4QBIA 3JYQA 4X24A 2G88A 4IQ8A 2P41A 3R7LA 3UFBA 2GPBA 3MT0A 2NVUB 2B8TA 3HJUA 5HJ7A 3R7WB 4D6XA 5EJ8A 3QQPA 3A1WA 5TT1A 4LGMA 1BAPA 2O2YA 3VFDA 4DRZA 3LGAA 2BFNA 3DMNA 3CN9A 3NM4A 1X14A 3KFVA 2Z4RA 1EWTA 1M2VB 4Q6WA 4N0MA 5CYFA 4MWCA 4FSHA 2FMTA 5IX8A 4FOLA 4EAQA 2I54A 1V45E 3IXLA 4BRZA 1HMYA 4BYMA 4PNHA 4QOHA 2V55B 4AI6A 4JCOA 1E7SA 1I1QB 2NZJA 1E0DA 1YDGA 4JEIA 4LVCA 4FHGA 2C9BA 5SYMA 5C53B 3ZD6A 3UF0A 1Q2UA 5CLJA 2YZGA 4R1QA 5FD8A 3KSZO 3GLIB 3R9WA 2BKLA 3RK0A 2G08A 5BR1A 4RPHA 4C1NA 5AXBA 3HFJA 3EJWA 1QFSA 3IQXA 2H2DA 2C2HA 4JB3A 3LNTA 5FTKA 3U31A 1ZWKA 3EXHA 3G68A 4DTCA 4NLLA 2FCRA 4CR6A 1SD5A 1U0TA 4GQBA 3IQDB 5F2EA 2G0NA 4DGQA 1O8CA 3W2TA 1AO0A 2Z8ZA 4MV7A 1U81A 4HDQB 1WKBA 4UFNA 1VIAA 2Y0EA 3PUJA 4GOKA 4WOCA 2NIPA 4HMPA 4HQ6A 4N3BA 1VP3A 3MD0A 3QKTA 5LSAA 4I2NA 1SZDA 4C2TA 2PBRA 4PC2A 5DNYB 1KFKB 1YIAA 2FRXA 2IPOA 4Q9KA 1FNNA 1Z5OA 1EWVA 1U31A 2VP6A 3IAHA 5A7GA 1I3NA 1QIKA 1KEUA 4MQ5A 3TBHA 4I3GA 3C3KA 3HBJA 4QGGA 4B4KA 4PZLA 2W48A 4F9GA 3ZE1B 4HP8A 1OIWA 3QEOA 3QWBA 3U7QB 5JBNA 3L8EA 3PJEA 3HGTA 1S4MA 4ZOQI 4B5LA 2W58A 1C1YA 1I2AA 1QYDA 3NUGA 3EEYA 4KR6A 3IR6A 1H8HD 3NG1A 4J0CA 4J0FA 3ZE0B 7ADHA 2KMLA 3PCRB 3NALA 5E2AA 5JDIC 1NXQA 2YJ3A 2OESA 1SCBA 13PKA 1LJUA 2P91A 4YCMA 1D4AA 2BONA 3BS4A 3TK1A 5LWHA 3IWCB 1XEAA 2RGAA 4OXIA 4F0JA 2WTEA 3K1AB 1XPOA 2GJKA 4QHYA 3UY4A 4ZJZA 4ARSA 1Z8NA 2WAXA 1SG0A 2HZ7A 2OOKA 4MYSA 1XMXA 2M6LA 5BSHA 4QPCA 4AKTA 4QYIA 1T8SA 5C34B 3KBBA 4FX5A 5C1PA 2X0FA 1ZW1A 2DQSA 2AZMA 3N2IA 4C4AA 5ES4B 1FLDA 4WCDA 3QKIA 3CZRA 1UFOA 3WLHA 3SLGA 1CQJA 2CXHA 4HFMA 4RD1A 4ZU3A 2G9UA 2XYHA 1GCAA 3RGGA 1G8AA 1IRXA 1ZJ5A 4E88A 3SX2A 2VUHB 1ODTC 3B8EA 3VR6H 4A8TA 2J3HA 4G8JA 4QXMA 3GDWA 1YF3A 1WLSA 2AYXA 2PY6A 3RS0A 3EG5A 4AF8A 4DLBA 4UAJA 2PUAA 3WLIA 4XM0A 4QSHA 2WIBA 1P1IA 4JGIA 4LIPD 3BULA 3I45A 4P3NA 4Y6PA 5J63A 3ZPXA 1NVEA 2FGJA 4QXQA 3GG2A 2IZZA 4DR1B 1CEEA 1YI8A 3LDUA 5F7JA 4BWGA 3GNQA 1ZEJA 1BEEA 1TD9A 3AT1A 4L78A 4CM5A 4PN7A 5DBIA 5BSKA 3ELWA 3C3DA 4YQZA 3E22B 1CZUA 5BWMA 1WDMA 5JO9A 4OU4A 1MC5A 1N8TA 4YCLA 2X0IA 5BYJA 1S2LA 4QUEA 4DLZA 1U6IA 4HPWA 3CG4A 5B1SA 2VOJA 3H6GA 1SHJA 2VDNB 5E7MA 5EHZA 4CPDA 1UP6A 4XGKA 3KL4A 3E8XA 2VT6A 1R5BA 5LP6C 1NQWA 3CO5A 1D4FA 4RACA 3EQ2A 2PSFA 3RTCA 3UAVA 2YY7A 1JJAA 5DGTA 4AY3A 2QPAA 4C6RA 5D7NA 1RQGA 1UAYA 2C5HA 2ZITA 5K3AA 3TLGA 4D9BA 3DVLA 3R5FA 1WG8A 4RY2A 4Z3OA 4TMWA 1XTIA 4AMBA 3KSDO 5B3AA 3OTGA 2KM1A 4YQFA 4R2XA 4Q05A 1HDIA 4RHYA 2J1LA 3C5WP 5DNAA 3ZZ1A 1BDBA 1P7PA 1WCIB 1KY5A 2YMPA 1T8RA 2QAGC 1ZOPA 2Z83A 4D6YA 2QRZA 5GGYA 5KCZA 3IR5A 1BX3A 3GRVA 5I7HA 5TGDA 3JX9A 1YGPA 3OLQA 3MYRA 1YO6A 3PF8A 1Z26A 5SY9A 5TVOB 1Q91A 3HEBA 3QVJA 4NU5A 4TLAA 3BL8A 3KKLA 4CLEA 3BHJA 2CDAA 4PGHA 5BXQC 4GI3A 3DAOA 4RMIA 5B3KA 3GMDA 3PNLA 3IBSA 1T2DA 1OJ7A 4B4OA 4Y18A 2HSGA 4W8HA 4BZWA 1Z4KA 1TW3A 1OB5A 1GLVA 2ZJ6A 4W63A 4BLVA 4IJ6A 2HCTA 4RK1A 3TTWA 2I3GA 4IXMA 1YBVA 1XSEA 2XYGA 4M21A 4DEYA 4EZIA 4EL0A 4PLWA 4F3NA 4XPZA 3IILA 1YK0A 1LUAA 4ZYWA 3GDGA 4PRKA 1UKYA 1OW3B 4FB4A 3RT7A 2BEVB 1E1YA 1IIBA 1WD5A 2EZUA 1RHMA 3IP1A 4JZYA 4X92A 5DLYA 5C5CA 1T26A 4HYTA 1TM1E 2A1UA 1RTTA 2IIVA 5TF0A 1YB1A 5F2KA 4UM8B 3O8DA 3DUFA 1S96A 3C3YA 4I50A 3T3PB 1AS0A 1XZLA 1H2YA 4FE4A 3K15A 4W9RA 3WHKA 1M72A 3PNQA 1A04A 4U7WA 1SK8A 4Y0VA 1HLFA 3ZVRA 3UV7A 1FP6A 4DT1A 1DCKA 1WNFA 1QDUA 2H17A 4D0NA 5MN6A 1AMNA 2VEOA 2IF0A 3IULA 3BSFA 4FS3A 4IR7A 4LHEA 2C1ZA 3GRKA 4YRBA 2GH1A 4MKIA 1SCIA 3LCUA 1HDEA 1L8AA 4I1PA 4OXRA 3WLPA 3K6JA 1Y98A 2P6NA 3ZQJA 3ESRA 1JWBB 1KI6A 2JGDB 1KARA 2VXBA 3EIQA 3GYBA 3STVA 3W5HA 4E1BA 5D8DA 1K2WA 4II3A 1H8EA 1QV9A 2HA3A 1NE7A 2A5YB 2HHLA 3ESDA 1W0JD 3X1MA 2PKQP 2C2XA 3FTCA 1PGOA 3MXTA 5ULLA 3I92A 3WBJA 1G3QA 1ITZA 3ZDYB 2WHPB 4CM8B 4CJXA 5JWRA 3MM4A 3B1WA 3L7IA 1VA4A 3DV0B 1UOPA 1YZKA 3DVSX 4GI7A 4DMRA 1KOGA 2R6ZA 2MYTA 4LN1A 3AJAA 4ZHSA 4OYLA 2ZSIA 2HBYA 3JQFC 3RJ5A 1O6CA 4X71A 2CZCA 1JHXA 1OVGA 2B8NA 2HU8A 2OK7A 3QK7A 3WIVA 2FZCA 1MGOA 3GAFA 3PRHA 1QHFA 2P30A 2JGMA 2V5UA 4MVJE 1YOVB 2WJVA 4HAVA 4HS4A 2BSQA 5CW2A 4YY3B 5DRYA 3VJRA 3WOVA 4QYSA 4WKGA 4KX3A 4DMCA 3KYBA 4MCIA 4NENB 2ZR9A 2EHDA 4YRTA 5HILA 5DH9A 1EK1A 1SBZA 3NHYA 1Y6ZA 5IJXA 1KRWA 1IEXA 1RRKA 4KAXA 4RK6A 4S24A 2EG9A 5HFNA 3S1LA 4JLNA 3V2GA 4GMGA 3VHLB 2JGJA 1DC5A 4F7DA 3OE7A 5K20A 2BOVA 1F8XA 4S2EA 5E0KB 3IXQA 3IKVA 3RVJA 2J48A 2NU6B 3BJEA 4IDFA 5KIAA 5E9QA 2QG4A 4D9JA 2AC2A 1W85B 1RLMA 3GLIE 2EU8A 5A2GA 2CUZA 2D62A 2VJCA 1JU3A 3U9SA 3WV5A 1HLDA 2OG1A 2VF4X 2VBCA 3B6ZA 4G9GA 1OT5A