3JSAA

Homoserine dehydrogenase from thermoplasma volcanium complexed with nad
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
325
structure length
321
Chain Sequence
MKTINLSIFGLGNVGLNLLRIIRSFNEENRLGLKFNVVFVADSLHSYYNERIDIGKVISYKEKGSLDSLEYESISASEALARDFDIVVDATPASADGKKELAFYKETFENGKDVVTANKSGLANFWPEIMEYARSNNRRIRYEATVAGGVPLFSFIDYSVLPSRIKKFRGIVSLTINYFIRELANKREFDDVLSEATKLGIVNYKDDLTGLDAARKSVILCNHLYGSSYRLSDVFYEGILDRSFGKNERLVTETGIVNGKPSAESRIKSLDSNDYLLTLGKGSLGYQLQTDTNGTLNVSDLYDGPYETAGAVMNDLVILSM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray crystal structure of Homoserine dehydrogenase from Thermoplasma volcanium
rcsb
source organism Thermoplasma volcanium
molecule tags Oxidoreductase
molecule keywords Homoserine dehydrogenase
total genus 109
structure length 321
sequence length 325
ec nomenclature
pdb deposition date 2009-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00742 Homoserine_dh Homoserine dehydrogenase
A PF03447 NAD_binding_3 Homoserine dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 3jsaA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3jsaA01
5F1OA 3WQSB 4LSMA 3RUEA 2WD8A 3EK2A 3H5RA 2X9VA 4D44A 5I9NA 2Y99A 2ZK7A 3M1AA 3OJ0A 1UP7A 1TT7A 3ICCA 5F5LA 4IIVA 3QWBA 5L9AA 1A72A 4IDDA 3P19A 1BG6A 5A9RA 3FWZA 1E6EA 4QFCA 4UVGA 4RDIA 1YL5A 2ZYGA 4E2ZA 4LMRA 3DMTA 2FZEA 2YW9A 3ZHBA 4NHEA 1U2GA 2W8ZA 3QWIA 4GPD1 2PKQP 3VH4A 4A26A 4MKXA 3QE3A 4J0FA 2D1YA 4OSPA 5G0UA 3RUFA 3OQ1A 3OBBA 3T7EA 5EMHA 3W8DA 5KJEA 3NT5A 1P3DA 1EFLA 4J1TA 4CPDA 4ZQFA 4LISA 3F4LA 3BIOA 3LC1O 1I8TA 1YJ8A 3JQAA 3NDIA 1T4BA 3ZWMA 3CUKA 4B79A 2Z5LA 2ZIZA 5AXDA 4Y67A 4PRKA 2B0JA 4DQVA 3LF1A 2Y0EA 1LI4A 4NR0A 5T57A 2EG9A 2FPPA 5JAZA 1NM5A 4IDAA 3PJFA 1EQ2A 5THKA 1DFHA 4GQAA 2WMDA 2P5YA 4ALLA 5F21A 2DTEA 2BLLA 2D3TA 3GK3A 4DVJA 3QY9A 4KZPA 3BYZA 1JDJA 4WOJA 4BNKA 1YBVA 3IAHA 4YAJA 3VVCA 5L7TA 4RQTA 2R2GA 3RUHA 5A1TA 1R66A 1DAOA 1TI7A 3HZZA 3KXDA 5KOIA 4C7JA 3SLGA 3PP8A 2EIHA 1MB4A 4H15A 4IGEA 4GMFA 4NMHA 1M2WA 4KP7A 3Q2KA 1HZJA 3WGTA 4WK6A 3WBBA 5GZ1A 5TSDA 2FY8A 3AY3A 3IOYA 4OM8A 1I3MA 4JBGA 3W4IA 3LDHA 2YY7A 1UUFA 4LVUA 1P9LA 1E7QA 1Y7TA 2TMDA 2XXJA 5GMOA 5A05A 4L4XA 2P4QA 3ROPA 5KNLA 4A27A 4H7PA 3IKTA 2W90A 2PNFA 2DPHA 4TVOA 1XU9A 4E3ZA 2EEZA 4FOOA 2PZJA 1F17A 1DFGA 3KM0A 4OIMA 5JYFA 3VZPA 5B4TA 2WE8A 5IG2A 3ZGYA 3KV3O 3DBLB 3JQ7B 4RZIA 1XDWA 1B8VA 1DIGA 3RI3A 4YYZA 2NM0A 1E5QA 1ZZEA 1U7TA 1NFRA 3RBZA 4BNWA 4D3SA 4MKZA 5KJFA 2GDZA 3JQBC 2O2YA 2VOJA 3AUSA 3JYQA 3TSCA 4D43A 1CERA 3W4KA 4FB5A 4DPMA 3GZNB 4DIOA 2V65A 4WOKA 3WX0A 5MGBA 4OAQA 3NAQA 5L40A 2EJWA 3PYLA 2GZ2A 4ALMA 4NFSA 2JFFA 1E1KA 2QX7A 3A14A 4Q3DA 1GL3A 1RM4A 2IE0A 3OFSA 4G2NA 4XJTA 3GPIA 4R3NA 1U9JA 1JN0A 1E3IA 5C7LO 3BXXA 3D5QA 3AUUA 4WEOA 3QWAA 2ET6A 1E3LA 2XPCA 2W4QA 3ZU3A 1N7GA 3AUAA 2R00C 5B4VA 3D3WA 4ZQHA 4NBVA 3JD2A 4HNHA 1UR5A 1UXJA 2JHGA 3WTCA 3LSYA 1DJQA 3H2ZA 2UYYA 4URFA 4A03A 1C0IA 2ZYDA 4OSOA 3JQCA 4XGIA 5IFLA 5L51A 4YPOA 3FHLA 2C2YA 5AOVA 1ISIA 4BGIA 4GGOA 3PZRA 3X2FA 4Q3NA 4GAEA 2HK7A 4P4GA 1EBFA 3BMNB 4A73A 2G5CA 5ICMA 1IL0A 4YCAA 1PGNA 2EF1A 4YTEA 1NX6A 3ZW8A 4IZIA 2EW8A 5TLSA 1SZJG 2FSSA 4IBOA 5ER9A 1PGJA 3DZBA 1UP6A 1W0CA 1VL6A 1GYPA 1YJQA 3BAZA 4FS3A 3BA1A 3TZKA 2IRWA 1L7EA 3NX4A 1ZSNA 3K2EA 4RF5A 5IZ4A 4JBIA 3QW2A 1R6DA 2ZB7A 2D5AA 4GLOA 1E6WA 3WNQA 1KYQA 3ANLA 1JU9A 3HB5X 1QYWA 4F3YA 2GCGA 3S2FA 3BTSA 1T2EA 2J3HA 4FJ2A 1I10A 4OQYA 4Q9NA 1K6JA 2C59A 2FPGA 2HJSA 1UAYA 4CLOB 3IP1A 1P45A 4O63O 4B4WA 2I67A 2Y1OA 2FR1A 3DZJA 4I5EA 5C37A 3HNPA 3ZHZA 4KQXA 1MC4A 2ZTUA 4Y6RA 4D42A 4IDFA 1WAMA 3H9GA 1IHYA 2FR0A 4F46A 2W98A 4GLLA 2VHZA 1NTOA 1LC0A 2YFHA 4BQRA 4GWKA 4BKQA 3ZDFA 4YAIA 3L9XA 2UAGA 2Q46A 4PVCA 2IXAA 4L73A 3K9QO 3DQPA 2ZB4A 2QW8A 5THQA 1R12A 3KYDB 3NGXA 4I5DA 3RBVA 1BW9A 4WNCA 4H16A 4W9NC 3CTMA 2Y0DA 3JQBA 1D1TA 4CV0A 2D0IA 4UUNA 3KEQA 4CMEC 4PZDA 5JNLA 4DIBA 4PLPA 4AJOA 2ZJ1A 1HDOA 5IJZA 4CQMB 3OECA 4YBZA 3LK7A 4GX2A 3EVTA 3NEPX 4CQLB 1X7DA 2P9EA 1HE3A 4CMEA 3VPSA 2YYYA 1C1XA 1C0KA 2IXBA 3DHEA 1EVJA 5ICSA 3ZHYA 2OORA 3RSHA 1L1FA 4XYEA 2R00A 2I76A 1BW9B 3DZKA 4S1VA 5EL0A 3LLSA 1P77A 1PJLA 1BTOA 4E30A 4ILKA 2CVQA 3HE3A 1JW9B 3NV9A 4IDCA 3KYCB 3JQGB 2EERA 2HJRA 4J0EA 4CM8A 1K3TA 3ROMA 2Q2VA 1JWBB 1NWHA 1G1AA 3KYBA 3GHHA 3QLJA 1HLPA 3L4BC 4XYGA 1VM6A 3E48A 4BNIA 3LQFA 5F1KA 1GPDG 1ZBQA 3V5NA 1LU9A 3OQ6A 4CLXA 1HDRA 4YA6A 1ZMTA 4TRJA 2UUPA 2D2IA 3WJAA 1HLDA 4HKTA 1DC5A 3E6AA 1GADO 4RPHA 4FOSA 3VPXA 4J3FA 4D7AA 1HDCA 3GGOA 4FGWA 4PLGA 4ROSA 2NVUB 4R41A 2JD1A 2XAAA 1GD1O 4NIMA 3VZQA 4AJ1A 2I9PA 3B70A 5A02A 1SOVA 3AJRA 3DBRA 1IHXA 3PHGA 2C20A 1HWYA 1Q0QA 4WASA 3I6IA 5GZ3A 2X23A 3NRCA 4L4SA 1Q7CA 3KYCA 1WDMA 1U1IA 3I4CA 1LDYA 5HBRA 3IJPA 3S2EA 3GAFA 3GMDA 4DLAA 3H65A 1NNUA 5LCXA 5IDQA 3WGHA 5I9MA 3KLMX 4MVJG 1YH3A 2Y0CA 1NHWA 3WG9A 2JD0A 3VDRA 2Z95A 5IZCC 3INGA 1PX0A 4DQXA 5JSFA 1YKFA 2V6MA 4FBGA 3VOSA 3ZWNA 1EDZA 1YVEI 1EVYA 2C7VA 3FPCA 3FPLA 4M8SA 4RGBA 4YJFB 3SJ7A 4MVJF 4J43A 3GZ4A 1PGOA 2X86A 1Z7BA 3DAGA 4OKIA 4OQZA 3G1TA 1QYVA 3OEWA 3DBRB 3PLRA 3I3OA 2BH9A 3C24A 1I5RA 1K6IA 4MIEA 1C0PA 1TB4A 1H6BA 4IQ0A 1EUDA 2CZCA 4XB2A 2B69A 4KDEA 4J1NA 3TFOA 1PWZA 3ROQA 2C07A 2DBRA 4BKRA 1R0LA 4M55A 1HL3A 2Q50A 3GGPA 3QVWA 1B8PA 3WQQA 5C5IA 1LXCA 1LRJA 1LUAA 3NYWA 5IN5A 4CM6A 4M89A 4BNFA 4K9DA 5ILOA 1QMGA 1NWCA 3KZVA 5KVSA 1QYCA 4TQGA 3CH6A 5A06A 3VKVA 4YDRA 1QSGA 3I6QA 4BNYA 3DTTA 1EUZA 2EKQA 4MP6A 1CETA 2VRCA 1HZZA 4I9HA 1FDSA 1TT5B 3M2PA 4JBHA 4ONEA 4R1TA 4CM8B 5HS6A 3N58A 3UCXA 2GZ1A 3P5SA 2ILTA 3LYLA 3ZH2A 3MJVA 3TOZA 1ADGA 2AMFA 3PHHA 3QHAA 5JXWA 2V7PA 4I9UA 1NFFA 3BMQB 3LC7O 1JVSA 3FRJA 1QG6A 4II3A 1XGKA 2W2KB 4Y8VA 2Q4BA 3MWEB 4FCCA 4DUPA 1ADBA 3ETGA 3FCOA 2GD1O 2OL4A 3NJ4A 4O1MA 4XYLA 2IODA 4GBJA 3KYDA 3DZHA 1DRUA 4W9NA 5TJ9A 1P1RA 5G0TA 4NJOA 1K0UA 1YBMA 1B16A 1UZNA 4UUOA 5TJHA 4XR4A 2IZZA 5CDYA 2VYVD 3IUPA 5HWSA 2PZKA 5AYVA 3W4JA 3BMQA 1N2SA 2X7HA 1RPNA 2PH3A 3JQEA 4GH5A 2P4HX 3K5PA 3E8XA 8ADHA 4NU5A 3CZRA 4QTZA 5DZSA 2UUOA 3WGOA 4NK5A 1Q2XA 1AE1A 4DXHA 2WYWA 4FFOA 3Q6IA 4WECA 1OBFO 2NVBA 3KVOA 3K8ZA 1E77A 4ZICA 2O3UA 5ES3A 5DN9A 2O3JA 4ZGWA 3AK4A 3IDSA 1Y1PA 3Q2IA 4IGFA 3D64A 1KVQA 3U09A 4YVFA 3FTNA 1Y9AA 2BFAA 1FDUA 1E1MA 1UZLA 5DDIP 2X0JA 2QYTA 2AQHA 4P4LA 4WUVA 2GRAA 1VJ1A 3N7UA 4EUFA 4BO3A 4CLRB 4W99A 4FDAA 1GZ4A 2IEDA 2FRDA 4MIOA 2QQ5A 3ADPA 3JQGA 5IN4A 2X5KO 2QYSA 4BO0A 4KWHA 1F14A 2ZATA 2WD7B 4TKMA 4PRLA 3WGIA 1SBYA 3E9QA 3INTA 3JQ9C 4BO6A 1DFIA 5KJ6A 1N7HA 4LCEA 5CG1A 3DL2A 4NJMB 4OYRA 1CEQA 3OM9A 2EHDA 3DFZA 1TLTA 5GZ6A 6ADHA 1X15A 4BKPA 3IL2A 3RUAA 5A9SA 4XJSA 4E5MA 3ONEA 1LDGA 1UXGA 5CEJA 2Q22A 4EUHA 4E4YA 5AQ1A 1UDCA 1LC3A 1HE5A 1IOLA 5DT9A 1BVUA 4FN4A 4W7HA 1HSZA 3SBOA 4CLRA 1ZJYA 5AVOA 2NU9A 4JIGA 2Q4EA 2ZTLA 3QWHA 3V2HA 3OICA 1YONA 4CUJA 4K26A 3JV7A 3C1TA 4HX5A 3H9QA 4CMHA 1ONPA 2J5QA 3A4VA 3I9NA 1XYGA 4NDNE 1X1TA 4YWJA 4TWRA 4CMIB 2WEKA 1V35A 1PU2A 1H9BA 4J1SA 1GCUA 5CDSA 3ANMA 3W8FA 4CV1A 4XYMA 4BGVA 4CLOA 3VPFA 2GASA 1P44A 4DLLA 5CG2A 1LQUA 4OL9A 4AFNA 1LDMA 3KO8A 3JYLA 4R54A 4PG6A 3DOOA 3DWFA 1EDOA 3TF5A 3VH1A 1T2FA 1EUCA 3JYPA 4FC7A 3WXBA 4R68A 1YQXA 4WCDA 1LQTA 5FYDA 2AQKA 2X8LA 2BELA 5AXCA 1PJ4A 4AG3A 1KEVA 3ETEA 4XDYA 4PG7A 4INAA 2V6BA 5T73A 1W6UA 3AFMA 4TVBA 4DBZA 5JDCC 4PLCA 1SPXA 2O3TA 3U3XA 3D3WB 3KLPX 3RFTA 5G0SA 4GVXA 4BMVA 4BO5A 1IUKA 3JQ8B 4OOEA 3WIEA 2Q49A 3VPGA 3PQFA 2GUGA 2JKVA 1ZSYA 1NQ5A 2DPGA 3JQFC 1PIWA 1YB4A 1WDKA 1CQIA 4ZHSA 3E9MA 1MFZA 5A04A 1AXGA 1SEVA 2PZLA 4G5HA 4DPLA 1BHSA 2BI8A 2X58A 3WWZA 3H9JA 3QVXA 5LDHA 4DA9A 1SO8A 1PJQA 2O7SA 2VUSA 1AUPA 2I66A 4BV9A 6LDHA 2BRUA 2YHUA 2OP0A 3IP3A 4LW8A 4OJNA 4A5OA 3DFUA 3ONDA 4CV3A 4EDFA 3CEAA 3HSKA 3IJRA 4YJHA 3HFGA 3UF0A 1WXDA 2VT2A 1ISHA 3RFXA 4R5MA 4BNNA 4B4UA 4NJMA 4LGVA 1IULA 4E2WA 4QO7A 2O23A 3CMMA 1LTHR 3VH2A 5G2OA 3EY4A 3OEYA 4D0RA 2YQ4A 3LU1A 4EBFA 1LDNA 2OMEA 1OZAA 1RWBA 2C82A 1QORA 3OA2A 3GY0A 1WVGA 1LNQA 2A9FA 5TNXA 5JPIA 1GUFA 3AUTA 3GFBA 1H93A 2YFQA 3PHJA 1SB8A 3U62A 1D8AA 1IYZA 2ZB3A 1D3AA 1WP4A 4TMFA 2FSVA 3WFJA 4OO3A 3WYCA 4OXNA 1ORRA 2GSDA 3A28A 1NBOA 4YJHB 3HJAA 1NPDA 5LDGA 4L74A 2J5RA 2FWMX 3HDYA 1M6HA 1U5CA 1P1FA 4BO1A 1KC1A 1RYEA 3UKOA 1DPGA 3SX2A 3CE6A 3GVCA 3V2UA 1ENYA 4AJ4A 2IDZA 1A4IA 4PLHA 4XKJA 4QXMA 5TT0A 2BGLA 2IYPA 4GSKA 1J4AA 3P2YA 2VWPA 4XEHA 2NU6A 4IDBA 1BXZA 4IS3A 4RPLA 3EDMA 3PLNA 5FFFA 3UVEA 4KOAA 5JAMA 4Q3BA 2NTJA 4J4TA 4CQMA 2GYYA 2PH5A 3ZWYA 4PZEA 3PDUA 3CZMA 3PFFA 1YQGA 3TL2A 5I7VA 5JC1A 2E4AA 3AFNA 4RVHA 3UHAA 4R1UA 1I0ZA 4QEDA 1A7KA 1H2HA 3ETDA 4FPXA 4IIUA 4FR5A 1Q7GA 3GUCA 3ZNQA 4MO2A 2VN8A 4E33A 2HMSA 3WQRA 2AHRA 2P68A 5CPBA 1Y5RA 3PYMA 3OETA 4E5PA 3ON5A 1UP4A 4GSLA 3JQ9A 5FEUA 1KIFA 4ZA2A 3R3JA 4YQYA 1UAGA 4G65A 3A9WA 2AEJA 1VSVA 5L3ZA 1E3JA 4OOFA 4RO0A 3RU9A 4AJEA 1FDWA 2CD9A 2X4GA 1GU7A 1YRLA 1ZNQO 4IJUA 4RLHA 2GERA 2DLDA 3EMKA 3D0OA 1MC5A 4MKRA 4HNGA 1QLJA 1YDEA 1E3EA 2BFOA 3WR5A 4UUMA 1CQJA 2VOEA 3E5MA 3T7CA 1H9AA 4BNZA 4CUZA 4WPGA 3EHEA 5BNFA 1HF3A 3DZGA 2DVMA 1W8DA 1KS9A 1HDZA 2Q99A 3DBHB 1HYGA 2FZWA 4I9NA 1B7GO 1EK5A 9LDTA 3GN1A 1YBAA 2A35A 4MVJP 3RVDA 3GDFA 1DHRA 4R16A 4U5QA 4U6SA 4ZQEA 3GC6A 3PHLA 2HMWA 4DC1A 4YRBA 5I8ZA 5TRTA 5L4SA 2JHFA 4CQLA 4KMSA 1B8UA 4BNXA 5K6AC 3F3SA 1MG0A 4RV9A 1IY8A 4E0BA 4YR9A 3DONA 2I3AA 1BXGB 3ZU5A 1AHHA 3O9ZA 2VTEA 3RUCA 4BB5A 2B83A 4IPTA 4DYDA 2DTXA 3B1JA 4Z3DA 5JMWA 1YO6A 5FWNA 3ZCXA 1DHTA 2Y1EA 3BTVA 2OUIA 4D3FA 2Q1SA 3MJEA 2WYUA 1T4DA 2IEBA 2G17A 5BR7A 1T1RA 4L75A 3TDKA 1GAEO 4DREA 3KHUA 5KVVA 1R0KA 2G1UA 3O8QB 3I9MA 4AJJA 4LRTB 3FF4A 3M6IA 3PEFA 2A94A 3F5SA 1K89A 2JD2A 3ZWOA 4BKOA 3AM5A 3L6OO 4XX0A 4I5GA 4HBGA 2G82A 5B37A 4YJGB 3AI3A 1MUUA 2BD0A 1RKXA 2HCTA 1NQTA 2RIRA 5L4NA 1SEPA 3BTOA 3UH1A 2Y68A 4YJDA 5KWEA 5TGDA 3P7MA 4E2YA 3QVSA 2OHXA 3ADOA 4OMUA 2P9CA 4TRMA 2PZMA 3EVNA 2PWZA 1NVMB 3FNHA 4NFYA 1ZIDA 4Z9FA 1LLCA 2UV8A 3VHRA 4Z9YA 5JC8A 4X54A 4HFRA 3ANNA 3RKUA 4WGGA 4WLUA 2AW5A 2PKRA 3L9WA 3TWOA 2Z1NA 2VCYA 1HEUA 5L95A 4C4OA 1R4NA 4D41A 4NBTA 3DOCA 2VUUA 3UCFA 4QUKA 2EGGA 1V3TA 4JNKA 5IAAA 1RM5A 1WZIA 1ZK0A 1R16A 2W2LA 4Z0TA 4N5LA 4KUHA 5JCJD 4EJ0A 3DBVO 1NASA 1EK6A 3JD4A 4MPDA 3TFQA 3DO5A 3AU9A 4GMGA 8LDHA 5BSHA 3B1FA 4YJFA 4BNJA 3KEOA 1R4MA 3WGGA 1O8CA 1FDVA 3TOXA 4PLFA 4XQGA 5CEEA 5AXBA 2CVZA 3PWKA 4WCFB 4EZBA 3O26A 3KSDO 2GO1A 3WGZA 5EPOA 3KUXA 4E5NA 3U4HA 1O6ZA 4DIFA 3C3XA 4IM7A 5G0VA 4MINA 3GVXA 4W7IA 3DHNA 1I2ZA 1ZK2A 3ZWAA 4XD2A 4ZQBA 3CPSA 1G0OA 4I8XA 4U8GA 1ZO8A 4DLBA 3WB9A 1NQAO 4WEQA 3RUDA 1ZW1A 4CMAA 2YV2A 3FD8A 3PK0A 5ITWA 3V1TC 1UH5A 1U5AA 4CODB 1VLLA 3CSDA 5U1PA 3S55A 2OZPA 2DQ4A 4RPGA 2J3JA 5F3RA 1V9LA 1E5LA 4D3DA 4GI2A 2XOXA 2J5KA 4BO2A 1P1HA 4OHUA 3RIHA 4QO8A 4CMIA 3OJFA 4TRRA 1O95A 2B5WA 5MDHA 1IZ0A 3PYXA 1CRWG 3WGYA 3GA0A 5AXAA 1V8BA 3U4DA 2VTDA 3UGKA 1O94A 4Q39A 5T8KA 1LLQA 4I5FA 4B4VA 1Q7BA 2VZ9A 3OJLA 4BO7A 1BXKA 1U28A 3LT4A 5JMPA 4EUEA 2OFPA 3GNSA 3TZ6A 1PZEA 3R0IA 4TROA 4WLFA 4YT4A 2WYVA 4BV8A 1BWSA 3TL3A 1KY4A 1DOHA 1K6XA 2PFGA 3OSUA 2YZ7A 2Y66A 3OIFA 3DAPA 5KTKA 1HT0A 5B1YA 4O59O 1X0VA 3UAGA 3UCEA 2F1KA 3H9UA 4YXFA 4YAKA 1GEEA 3KSZO 1W73A 4PLZA 1U2DA 3NT2A 1OC4A 1TVEA 1X13A 3QWFA 4JJFA 4M87A 1DRWA 4MVJE 1DIHA 5L53A 1XIVA 3L07A 1I3NA 1QRRA 3QA9A 4CMGA 4DGSA 3PZBA 2A4KA 1M67A 1TXGA 4WKGA 1HKUA 1ENPA 1LEHA 2HK8A 3C7DB 4AJ2A 4DRYA 4NBUA 3SVTA 5ILGA 3UW3A 2BGKA 3PWZA 3I52A 5H82A 1GUZA 1KVRA 2Y67A 4RF4A 1YDWA 2F00A 2NV6A 4ND2A 3LC2O 1KBZA 3WTBA 2EV9A 2PGDA 2J3KA 3JQDA 2ZCUA 4RF2A 3WNVA 3OHSX 2VYVA 4UEOA 1J49A 1WDLA 1SNYA 2NACA 1QLHA 3I9JA 5H83A 4XRRA 1Q0HA 1VE9A 4YJGA 5KJ1A 2RAFA 4CM9D 4PG8A 1E1LA 3IQDB 4MIYA 3ULKA 3ZWXA 4WCFA 3U4CA 3H3JA 3H9EO 3KOUA 1IB6A 4XQCA 1IPFA 4D79A 2ZTMA 1ML3A 1KETA 2CUKA 1SMKA 4EEZA 4RPJA 1GYQA 4GL4A 4JXKA 3Q1LA 4U0JA 3OIDA 4PLVA 3NTRA 1DIRA 1JAYA 2AE2A 2FR8A 3FNEA 3LZ6A 1NVGA 2WSBA 2DAPA 3WDSA 2CVOA 1PZFA 1T1SA 4Z6KA 3CMCO 1J5PA 1PJTA 3GG2A 3V8BA 4N54A 2B4TO 3FNFA 4ITUA 1AN9A 2YUTA 3KETA 1IPEA 3I9OA 1H6DA 3WLFA 1AGNA 3WBFA 1WNTA 3Q9NA 3FR8A 2YHIB 4BL5A 3UOGA 4WLEA 4AJHA 1VRWA 5GY7A 3PPIA 1X0XA 2EP7A 3PJEA 4BNUA 3HN2A 3ENNA 3H5NA 3AI1A 3I5MA 4XGNA 3WOHA 4YT2A 1T25A 2O4CA 2BFMA 4GWGA 2NNLD 4RVFA 4JP2A 4ZRMA 5G4KA 5JFOA 4DYVA 4WE3A 3ZV3A 3BTUA 2VYND 1DO8A 1I01A 5CHEA 1CF2O 3NDRA 4FC6A 4R69A 4LSWA 3BZUA 3JTMA 4ALNA 1GR0A 1CWUA 1W4ZA 1CDOA 3DDNA 4AICA 3C7AA 3SC4A 4L0QA 1VPDA 4R1SA 3OA0A 5A3VA 2JJYA 3ITKA 4A0SA 1HTBA 1Z6ZA 1PQPA 4O5OA 1D7OA 4ALIA 3R6DA 4D45A 1QP8A 1PL6A 1L7DA 2JCVA 2WDZA 3G79A 3UFXA 2Q1UA 4FD3A 4XB1A 4UEKA 3JD0A 3VZSA 4L8VA 1ZUD1 2C5AA 1KERA 2J6IA 4WCFC 3ZWPA 3V1UA 3DMTC 2VRCD 4JGBA 3C1OA 2I3GA 1PJSA 3RUIA 1JKIA 1JAXA 2ZTVA 2QZ9A 4WJZA 3IIEA 3KBOA 2ZB8A 2Q1TA 1LRLA 5G4KB 4LMPA 2ZKLA 1P1KA 3GNTA 1LX6A 2B36A 1I2BA 2YDYA 2DFDA 1UZMA 3AU8A 4LVCA 4J9VA 2BHLA 1H6AA 3MJTA 2PA3A 5DBFA 1WMAA 3S8MA 1JWAB 3C8MA 1IE3A 5A9SB 2PLAA 4MP3A 1ZCJA 4TRNA 3FBTA 5L45A 1U8FO 3EZYA 1WZEA 4Z0PA 4N5MA 4WLNA 2NQTA 1ZEJA 1I2CA 2DBQA 5EQFA 3GZNA 3DC2A 4GKVA 4MVJA 5U4QA 2CFCA 1CYDA 1GZ3A 3QQPA 4BIIA 1YL6A 1YXMA 3RC9A 2E6UX 1A27A 1YS4A 2J3IA 2GF2A 1E7RA 4HUJA 3ROKA 7MDHA 1E7YA 5CFZA 4FQ8A 2NVUA 1QV6A 1E7WA 4ND3A 1NVTA 3WS7A 4AJPA 1LDEA 1UDBA 2HKIA 4FFPA 1N92A 1P74A 3SLKA 3LT0A 4CV2A 1EEHA 2RHCA 1Y8QB 2AQIA 3TZCA 4MJLA 3WSVA 5C7OO 2POQX 5F1PA 3BMOB 4JROA 1DXYA 2AEFA 2P5UA 4YQZA 2DU8A 4IQ8A 3K2BA 1ENOA 1HE4A 3JYNA 2FPIA 3U5TA 3JD3A 2VHYA 4XIJA 2JFHA 1E92A 3PQEA 1OMOA 1AHIA 2X1HA 4PLWA 4YACA 5FF9A 4TZTA 2GN8A 2VWHA 5CDGA 3R3SA 3ZHXA 5EESA 4CMJA 5JCXA 4OXYA 3ZN2A 2Z1MA 4N5NA 3GPDG 3MTGA 4E5YA 1O5IA 2X6TA 3VAZA 3DZIA 1RYDA 4CM5A 4TKLA 1YGYA 3GDOA 1BVRA 3ZW9A 3RC2A 5BNIA 5G0WA 1Y8RB 9LDBA 3DB2A 3GLQA 3T4XA 3NTQA 4DMMA 5IZCA 4MVJD 1F8FA 2VZ0A 2O7QA 1ZKMA 4PN3A 4IINA 1R4MB 1OAAA 4XGKA 1RM3A 1PWXA 4BQPA 3W1VA 1U4SA 4XQ9A 2NU7A 3A1NA 1ISFA 2C5EA 1HRDA 5BSEA 4HFMA 4BNGA 1DIBA 4RJTA 3VZRA 1JKJA 3BHJA 5TIIA 1M66A 4A2CA 1DC3A 1NPTO 1NAHA 2TMGA 4MVJI 4IUYA 3RAJA 3QIVA 3LT1A 3LT2A 4O6VA 3OP4A 3F6YA 3HFSA 2HRZA 4J7CA 5DBIA 4FJ0A 3VPHA 1PS8A 4ZRNA 1FK8A 3ZV5A 2RCYA 3ZWVA 4ID9A 4J4HA 3ZU4A 1A9YA 1GPJA 2BF7A 4AJIA 4BGEA 3AI2A 3H7AA 1JTVA 3E9NA 3QVTA 2AEMA 4U6QA 1G0NA 1DRVA 4BMSA 2R6JA 5COBA 3PGXA 3I83A 1QYDA 4UUPA 1D4FA 1PTJA 1ISGA 3G49A 1HDXA 1WMBA 2UDPA 3R1IA 1E7SA 1Z82A 1EMDA 3M1LA 3PI7A 3PRJA 4UVDA 2BKAA 2CSUA 3PIIA 1C0LA 1H0KA 3HHPA 3EGOA 5I7EA 3RC1A 3H4VA 3Q11A 5C3MA 4RZHA 5A5EA 3S2IA 1DEHA 3DEYX 1E6UA 3EZLA 1PZGA 4GX1A 3RD5A 1I33A 3TRIA 3NUGA 4QSMA 2B5VA 4CMKA 3VKUA 4PLTA 3NT4A 3S1LA 2V6GA 1VC2A 2WJPA 3HUDA 3E03A 1DB3A 4E5KA 1O9BA 3MJCA 1EVZA 4RDHA 3T4EA 4R01A 3WIDA 4RCVA 1MGOA 2CDAA 1LJ8A 3FWNA 2VNSA 3PQDA 4W6ZA 1GZ6A 3RKRA 4HXYA 3I9LA 4EW6A 3GN2A 4NBRA 3MOIA 4BNMA 5HS4A 4J4BA 1I36A 4IJVA 4CLEA 5T8KC 3G0OA 2HMVA 5DCYA 4B8WA 1O0SA 4MVJH 3MJ4A 3EAGA 4E6PA 1CIVA 4EJ6A 4OGWA 4IZHA 1C14A 2VHXA 1LSSA 3IS3A 5CAEA 2E82A 3F46A 2G76A 1GQYA 1EFKA 3ASUA 5DP2A 4RVDA 4R3WA 4RPKA 4Y6SA 3DBLA 5A9TA 3ZI0A 4YT8A 2OBYA 1QYXA 5K9ZA 3NTOA 3GDGA 1BSVA 2I99A 4B7XA 1XQ6A 2C54A 4Y6PA 1WLYA 1YB1A 5M6DA 2HO5A 2Y93A 2B37A 1JKFA 1DLIA 3GR6A 4JN6B 1I3KA 1XG5A 3GEMA 3L6DA 4N7RA 4CLHA 1ZK3A 1E0DA 5I9LA 5HRUA 4DPKA 4EGFA 4F6CA 5A5FA 4RL6A 1B14A 3NJ8A 3FN4A 3AOGA 3AM3A 2I65A 2Q2WA 5KCZA 5JAIA 2FN7A 1HYEA 2RH4A 1F06A 3A06A 4WLVA 3G3EA 3PVZA 4RVUA 4C7KA 2VT3A 4ND1A 1PL7A 5CDUA 1EBUA 2AG5A 1ARZA 3HQ4O 3WSWA 4HADA 3I1JA 4Z3KA 1PZHA 4LK3A 4AL4A 3WWYA 3ZZNA 3C1AA 2WTBA 4CJXA 5JY1A 1NP3A 1B3RA 4M54A 2X0IA 4NG5A 4D0SA 3ITDA 4HFJA 4EEXA 1WWKA 4Z9XA 1R37A 3PGJA 1Y8RA 2QRLA 4OXKA 5A3JA 1ADFA 2O3QA 3G17A 1BRMA 3K92A 3OJEA 1OFGA 1I3LA 2E49A 3RROA 4ZU3A 4B3JA 4UEJA 3GVHA 4I1IA 1HSOA 3VH3A 3BHMA 1YE3A 1FF9A 1I32A 2BFPA 4UULA 5DULA 3ZV6A 1M6WA 2HRBA 2YV3A 2H6EA 3U4IA 3WYEA 3KB6A 1XKQA 3KRTA 2YJZA 3EW7A 4L76A 3B1KA 4IQGA 4M49A 3PJGA 1ONNA 3GUYA 5KJCA 1ZXLA 5G4LA 5JBIA 5TX7A 1GYRA 1Y6JA 1JLLA 1KY5A 2HU2A 1UXKA 4BUCA 5C7IO 3PJDA 1AXEA 1XSEA 3H8VA 1U8XX 2GPTA 3WGQA 1A5ZA 1A71A 1HXHA 4E31A 4DQUA 4IJKA 1OC2A 2DTDA 5HTOA 2O4UX 1T26A 2Y1GA 3V1YA 4CMBA 1MA0A 3BMCA 3GFGA 3TZHA 3INRA 3ZNNA 1ZEMA 1DBVO 1LRKA 2DM6A 5JY6A 2I5PO 2HLPA 2IYOA 4HY3A 4BGUA 4DTIA 5I7FA 1GCOA 3JQ6A 3WMXA 1BDMA 2D4AA 3L4BA 3K73O 5JYEA 4GVLA 4RQUA 1EE2A 1ADCA 2O48X 2EWMA 2VYNA 1MX3A 1GDHA 3DOJA 3JYOA 5T6BA 3V2GA 1Z74A 4PCVA 3OH8A 5DOVA 4CL3A 1ZFNA 4ZQGA 4BNHA 4CLDA 3FSRA 1F0YA 1V6AA 2C29D 3HDJA 4NBWA 3D7LA 1G6KA 2XF8A 4ALJA 3L77A 4FFNA 1ZXBA 5J23A 4K6FA 4J7UA 4JK3A 3VTZA 4HP8A 4JLWA 4XCVA 4L9RA 3MWDB 4II2A 3WLEA 2G0TA 2O3SA 2QIOA 2CMDA 3E18A 3TJRA 2AQ8A 1DAPA 1QXSA 1LLDA 2B4QA 2VRBA 3JQFA 3O03A 4I08A 4UREA 2Y05A 4IDEA 2RHRA 2VZ8A 3IMFA 4E21A 1F12A 1QKIA 1PGPA 4JJIA 4YB8A 3WICA 4LN1A 1KOLA 4U0KA 5DNAA 1MXFA 2UVDA 2DBVO 2NTNA 3B20A 4PVDA 1X7GA 1UXHA 2AXQA 1VL8A 2OOSA 3JQ7A 2FMUA 2PTGA 2V6FA 4UVHA 1GUYA 2RBEA 4S3MA 4FSHA 2PD6A 4NFHA 3GH3A 1B2LA 2DFVA 4CM4A 1F8GA 4GKBA 4R5HA 3VTFA 4G81A 4PFJA 4AJLA 4BO4A 3CXRA 3DXFA 3F5QA 5JW6A 3WFIA 4CM1A 1DLJA 4K28A 2NWQA 5CP8A 1NR7A 1J6UA 5B12A 3KTDA 2QZZA 1OI7A 4XWYA 1B15A 4IY1A 1ISMA 4UAGA 2BI7A 3UN1A 3EYWA 4Q3EA 5T67A 1ENZA 1TA4A 2QRKA 1LSOA 4WLOA 4EYEA 1XWFA 2PR2A 5TF4A 1S7CA 2DBZA 1NQOA 3W6UA 3AOEC 3KSUA 4BO9A 2X5OA 4BNLA 1ULSA 3L6EA 1LSUA 3AY7A 1HDGO 3X2EA 3CKYA 4FGSA 2HUNA 2PGJA 3ABIA 3N74A 4CMCA 2ZJ0A 5KVCA 4ZD6A 3COSA 3D4OA 3AOEA 3D1LA 3I9KA 1SCUA 1PGQA 1GY8A 1ISJA 1PJ2A 2W2KA 4O0LA 3VVBA 5K6AA 3LF2A 1MLDA 1GV1A 1DJNA 4HFNA 3RFVA 2JAHA 5F5NA 3OIGA 1A7AA 3GEGA 1A4UA 3PWSA 1ZMOA 3F47A 2E37A 3CINA 2X9GA 3FBGA 4NI5A 4CL8A 4IJWA 1U3VA 3MZ0A 3Q3CA 4AJKA 3WYBA 1K2WA 1ZJZA 2PV7A 3GVIA 3PIDA 5ITVA 1DDOA 4RORA 5BT9A 3GVPA 3NGLA 1GFSA 2Y1FA 4YRDA 3GT0A 1XCBA 2NU8A 2NLOA 4J49A 4K1LA 4P4NA 2E48A 1VJ0A 4FFMA 3U0BA 1I30A 2BMAA 3PHIA 1PEDA 2GN6A 4F6LA 4FFRA 4QECA 5EERA 1SOWA 1MV8A 3HB4X 2LDBA 1PQWA 4BKUA 2CNBA 3DHYA 1U3WA 2EJVA 2LDXA 4J2OA 4HWKA 2AG8A 1VKOA 4U7WA 4ND5A 4YEDA 4RVSA 4XYBA 3F1LA 4IXTA 3TZQA 3SXPA 2O50A 4EJMA 4KUGA 3P2OA 1Y5MA 1NFQA 4FW8A 4MDHA 5EINA 1YWGO 5CEFA 2VWQA 1I24A 2P2SA 1TT5A 2YV1A 4J6FA 3UXYA 3FNGA 1GV0A 1XQ1A 4P38A 2VWGA 3K96A 4CR7A 3ZU2A 5A03A 2IZ0A 3IC5A 5TQVA 1WPQA 4Q3AA 2GZ3A 2DT5A 1KVUA 3OMLA 5TC4A 4NPCA 1H5QA 3ICPA 5JDIA 4OKNA 4H3VA 1E3WB 5J9GA 4XIYA 2FOIA 3I23A 1JA9A 4BHTA 4B3IA 1E3SA 1DC4A 2VNAA 4XQEA 3WJ7A 4D46A 3HN7A 5BNTA 1P33A 1NXQA 2DUUA 2C0CA 2H5LA 4P22A 3Q9UA 5DP1A 1P1IA 2QG4A 3GQVA 3BMOA 5TS3A 2CF5A 5I7SA 2ZQYA 3GHYA 2HK9A 1N1GA 4ND4A 4FJ1A 1KVSA 4KTVE 4IS2A 4B8ZA 1IZ9A 2IZ1A 2X9NA 4GX5A 1E7MA 3HADA 2HMUA 4NU6A 1XELA 5L4LA 1LBEA 2X0RA 5DCUA 4B4OA 3WMWA 2H63A 2GN4A 1JVBA 5FI3A 3GGGA 2PD4A 3MTJA 1OOEA 2Q1WA 3S2GA 2GNAA 3JCZA 3VC7A 4QX6A 1GQ2A 3QSGA 4KQWA 3O4RA 4J91A 4R1NA 3ZNOA 1HDYA 3IUSA 1FJHA 4RF3A 3E1KA 3JD1A 4FIZA 1MFPA 4CR6A 3RASA 3ZV4A 3C85A 2YHIA 2JL1A 4ZJUA 2CF6A 1ZK1A 2OXIA 3OJOA 4QT0A 3BMCB 4BOYA 3AY6A 1ZVMA 4W4TA 1P1JA 3G1UA 1Z7EA 5BSGA 1EVIA 3OQBA 1P0FA 1Y9EA 1QV7A 2D8AA 2NTVA 2Y1CA 2PY6A 3M2TA 2B4RO 3AWDA 1Z75A 2J8ZA 3DAFA 3ORFA 2VQ3A 4MOWA 3E82A 4EI2A 5JCJA 2DKNA 4JCOA 5JYDA 3I4FA 1C1DA 3LLVA 1H6CA 4CM7A 2HQ1A 3PDJA 3HWRA 1MP0A 5JAQA 5ADHA 2O3RA 3D4PA 3DZFA 1YOVB 5EQDA 1C3VA 2H9IA 4DWVA 4NK4A 3RJ5A 3GRPA 4MP8A 5B4UA 2JAPA 1Y81A 1R0SA 1PR9A 4KUEA 4AVYA 4E12A 2O2SA 2HAEA 4M86A 4B7UA 3GMSA 4R4JA 4YAGA 2VHWA 2CY0A 4NNJA 2Q3EA 2SCUA 4GGPA 1V3VA 2P9GA 3W8EA 3W6ZA 1BMDA 2NUAA 1T24A 5KVQA 3BHIA 3GF4A 1SB9A 1RM0A 1T2AA 5DOZA 4NH4A 3FTPA 4J16A 4PGFA 5U9CA 3GEDA 1U7HA 4QFDA 3TN7A 4BB6A 1GEGA 1YOVA 3TQHA 4Y9DA 4L4RA 5H81A 3H2SA 1N8KA 5JE8A 1U3TA 4CR8A 4BS9A 1SAYA 2GLXA 4Q3CA 4Y98A 4ZN6A 3H5AA 5ENVA 1VL0A 1CJCA 1PJBA 5ER6A 4IMRA 4NZ9A 5DF1A 3MEQA 3U49A 2ZYAA 4YRAA 4UVIA 1MG5A 3SC6A 4JQCA 5HM8A 1LLUA 4KDFA 4M1QA 1U4OA 4BMNA 2OBNA 3F1KA 3LVFO 5KKCA 5BQFA 1MXHA 5JS6A 3DBHA 4GX0A 3D5TA 3GNQA 2QRJA 5A4DA 2PK3A 1V3UA 1P0CA 5CPFA 1NR1A 3B6ZA 2WWRA 2ZCVA 2VHVA 3K31A 4E13A 1HE2A 1PJ3A 4OH1A 3F9IA 2DC1A 1PQUA 1E1NA 3RU7A 2C7GA 5KIAA 3RCBA 4PZCA 3AW9A 1ONOA 5T5QA 4LRSB 4XRGA 1ID1A 1K5HA 2PD3A 2VUTA 4ZVVA 1Y8QA 3UICA 5JDCA 1X14A 1PL8A 3ONFA 2PGLA 1WW8A 1XR3A 2DUWA 1H94A 1VJTA 2HSDA 1P31A 4ESOA 1ULUA 1XU7A 2YDXA 3PTZA 4XA8A 1C1DB 4PLYA 1VKNA 1PR3A 2RH8A 4R9SA 3L4SO 2NQ8A 4J2HA 2GGSA 1LSJA 4AJNA 2AA3A 2WM3A 3IKVA 2D59A 2P91A 5ENDA 4PIVA 3K6JA 4CQMD 1R15A 5CDTA 5DCWA 4QQRA 1T2DA 4NQZA 3FI9A 4DC0A 3NDJA 3RJ9A 2Q45A 3GRKA 1C1XB 4LCJA 1M76A 1NPYA 5I8WA 5KKAA 3BMNA 3DR3A 3MJSA 1UDAA 3ST7A 3EUWA 2WD7A 3HG7A 2XXBA 5L7WA 2A92A 3ZWWA 3MOGA 1NAIA 1FXSA 3PFWO 4R9RA 4TZKA 1DC6A 3AM4A 1ZSVA 3CIFA 1KEUA 1PS0A 1QR6A 4IMPA 3L0DA 1YQDA 2X5JO 1M75A 3DMYA 4J9UE 1BGVA 1N9GB 5JLAA 3JQAB 3ZNPA 1XLTA 4KWIA 1KEWA 3TPCA 1R4NB 2Q2QA 4XZ3A 1B26A 2YQ5A 4CM3A 1NYTA 3D4NA 1A9ZA 3VDQA 5IF3A 4JJGA 2EKLA 3GAZA 3PXXA 3H6KA 1GQQA 4E2XA 4BVAA 1EQUA 3ZWCA 1EZ4A 2FHSA 4J1QA 1BDBA 3O8QA 4F45A 2EXXA 3OF2A 4TSKA 3JSAA 3D3EA 1NHGA 5IXYA 2JCXA 1N9GA 3O38A 4JX8A 2CDBA 5DBGA 1LA2A 4ALKA 1S6YA 3F4BA 4PG4A 3QJ5A 4RVGA 4B7CA 2HMTA 5IXSA 1EE9A 4E32A 2CDCA 3SEFA 1HETA 2EGHA 2X22A 5IDYA 5COAA 1ZK4A 5IDXA 3TNLA 4JP3A 1KC3A 2HDHA 1FMCA 1Z73A 4HV4A 1ZH8A 1Q1NA 2D5CA 3JQ8A 4FFLA 4K6CA 5HA5A 1YL7A 2EW2A 1X1EA 4PG5A 4P8RA 3QV1A 1RJWA 4YAEA 2OGUA 3RBXA 1Q0LA 4W82A 4B3HA 3ENKA 5T64A 4J90A 1BXGA 5FI5A 1T2CA 4BNVA 4DBVO 1TEHA 2EP5A 3FR7A 4J7XA 1N5DA 5COQA 4A7PA 2X0NA 4DMLA 1UJMA 5L7YA 4EITA 3GG9A 3C7CB 3NKLA 4XDZA 1KVTA 1PS9A 1B0AA 4YT5A 1PSDA 2C2XA 3HDQA 1HYHA 5EIOA 3U9LA 4DL9A 2ZQZA 1N1EA 4CUKA 4Z0HO 1YB5A 2H1SA 5JO9A 1J0XO 3H3FA 3EC7A 3UUWA 1FDTA 4IDGA 2GN9A 4MVJM 1H2BA 3RC7A 2BGMA 2OO5A 3DTYA 1U3UA 5IDWA 2WE7A 4BO8A 1DSSG 5JO0A 3Q0EA 1E3WA 4XR9A 3RQSA 4UVEA 3QRWA 3HDHA 2I6TA 3SJUA 5JYAA 3GOHA 4IXWA 1VSUA 2PKQO 1DIAA 1O89A 2JCYA 5BSFA 1PJCA 4CM9A 2EKPA 1UXIA 3K30A 2QHXA 4CM4B 4R51A 1KEPA 3ZWBA 5TT1A 4KTTE 3MCVA 3E5RA 1JQBA 1Z45A 2Y1DA 4BNTA 2NADA 2FP4A 2AE1A 1D1SA 1XHLA 7ADHA 2JFGA 2B35A 1XEAA 1SC6A 4N18A 3RWBA 3QP9A 5LC1A 4A10A 1B3BA 1LDBA 2W2LD 5K0ZA 2NSDA 4WNIA 3QVOA 5JDIC 1XA0A 1VI2A 2GR9A 3JQAD 4RLSA 5EN4A 3STHA 1X7HA 2OP1A 2NVWA 1V0JA 3ASVA 1GTMA 5EJ2A
chains in the Genus database with same CATH superfamily
4NYIR 1BU5A 1PD0A 2XNHA 3V4RA 3OT5A 5AI4A 4D44A 2QUIA 2J6CA 2Y99A 3BRCA 3BBPA 4DIMA 3D3QA 4IEFB 1R6UA 4F0JA 5F5LA 2H54A 3KOXA 3MJDA 1RTKA 4MWBA 5H8WA 3Q5EA 1A72A 2ZI4A 3VVLA 1QDLB 3IIMA 5LA6B 1JPVA 1MJNA 3FWZA 4PYNA 3PCXA 4GMHA 4RV5A 3MWYW 5CTJA 5K3CA 4A8TA 2ZI9A 2ZRCA 2XRFA 2F3TA 3KNZA 4FBMA 4J0IA 4M0KA 2OPBA 4UXJA 1DZ3A 2ZSHA 3FYUC 4NHEA 3LKVA 5IKEA 4RMGA 2CFSA 2IA5A 1G8GA 3QWIA 4MQBA 2PKQP 4H6XA 4HLQB 2F3QA 3TSYA 4A26A 4MKXA 1ZVVA 2C5LA 3A9CA 1O94C 3HEBA 1Q3KA 1IMJA 3FVRA 1JJAA 4J0FA 4OSPA 2H4FA 3OQ1A 4U39A 1KR5A 4YRPA 2GQ0A 3L1KA 4KVZA 4PEVA 5KJEA 3RRXA 5G1PA 5CITA 5C51B 1SKQA 3CLVA 3CNLA 4J1TA 3T1HB 1W4BA 4ZQFA 4G4IA 4L0DA 1D5CA 3R8CA 2A57A 2PHZA 5FA5A 5GWXA 1YBHA 1T4BA 5IF9A 2B30A 4BECA 1D6MA 3LBYA 2Z5LA 2O1WA 2ZIZA 3H2IA 1QPBA 2J3QA 5FWAA 5AXDA 5HFJA 5K6RA 4AKIA 2Y0EA 2YQZA 3D1JA 4MWOA 1NBIA 3BORA 3QVGB 2EG9A 1YD7A 1T2NA 2CL5A 4HGRA 4IDAA 5DASA 3VAYA 4HDNB 3ZK7A 1EQ2A 3ZVLA 3COJA 1DFHA 4FZ5A 3DFMA 5TS2A 4GQAA 1CBUA 2WWVD 2WMDA 2X42A 4B4KA 4JBYA 4R0MA 5HZMA 1PLJA 2I4RA 1U5BA 2VHQA 2E4YA 2JLXA 3OUTA 2ZRLA 3BFPA 3R7AA 3TL6A 2DTEA 2ZBPA 2BLLA 3QPUA 4M9RA 3A37A 3UA4A 3C5WP 3GK3A 4B35A 1DKNA 1QGYA 1ZIXA 4MGZR 2CBZA 3RLIA 1XXHB 2CMKA 4BNKA 3AMVA 5L7TA 4IVQA 1TZCA 4NNPA 1WKCA 4V3BA 1R66A 5BN3A 1TI7A 3HZZA 3SLGA 3L40A 3PP8A 2JJMA 3RYFB 2NYVA 1MB4A 1L9KA 4IGEA 5H80A 2DT8A 4MXDA 4NMHA 1M2WA 3DT6A 4KP7A 3FTEA 1Q12A 4WUTA 4G25A 2QRMA 2HDNB 1RZUA 2YJTD 1ZWKA 3DMFA 4AZ3A 4HH0A 1JDBC 4MW4A 1RAEA 3AP3A 3AY3A 4OM8A 2C7QA 3GARA 4X1YB 3QEMB 1AURA 4OAOA 3W4IA 5ESWA 2QVYX 1F6BA 2PZ8A 2QAGA 5MF6A 1P9LA 2PR7A 3C3JA 3D6AA 5CA1F 2UZAA 3C1UA 3L43A 2P4QA 3ROPA 3OX4A 1ZG3A 4GEKA 3TIXB 2W90A 3HPRA 1W2WB 3QJGA 1XU9A 4E3ZA 5EVCA 1YRAA 3KAPA 1DQSA 3C43A 4JL5A 3AG6A 3N6RA 3IA7A 1W5BA 2EJUA 2D0PB 2QUZA 1DFGA 3A1WA 5C4MA 2WE8A 2WTMA 2NUTB 4QRHA 3ZGYA 3FLBA 2AS0A 2D5LA 4EOGA 3OUZA 3G5TA 2IYRA 3MGAA 4HNAA 1DIGA 1I6KA 3RI3A 3PS9A 3RS9A 2UZ3A 4CN8A 1UFRA 3RBZA 2JJ1D 4D3SA 5KJFA 4LYFA 5F23A 2OXEA 3JQBC 2XIJA 4DA8A 2QLNA 3AUSA 3JYQA 2GKOA 2A0KA 1P91A 5MFPA 3TZEA 1CRZA 1CERA 3V6LA 1ESNA 4GSYA 3W4KA 4FB5A 2CLEB 2V65A 1ZGHA 5AVTA 4ZTBA 5M04A 2GZ2A 3UGQA 4C7OB 2QX7A 5EEGA 2ISCA 4ZIRA 1VGQA 1RI1A 2P2DA 4ETIA 4LDNA 1Q1QA 3GPIA 4MR7A 1U9JA 1JN0A 1D7AA 3BXXA 4RD4A 5EUQB 3O8DA 4DV1B 3ZVNA 2Q2OA 1KI9A 1AKWA 4QGGA 3UYKA 3QWAA 1E3LA 3F4KA 1UPXA 2YZGA 4LXGA 5AHWA 1UBKS 2R00C 4I5IA 4Y9SA 3X1JA 1JXQA 1RWXA 3JD2A 4UNQA 1BMFA 4ZQHA 3X44A 5B4VA 3R9WA 3IPAA 3HB9A 5REQB 1FQOA 3AJEA 1Q21A 1QPGA 3LSYA 3H2ZA 2EFJA 1YFKA 4A03A 2I4IA 2FX5A 2QMHA 4TZ6A 3CVJA 4QASA 4UE2A 5L51A 3JQCA 2A1TS 5DMHA 3OFVA 1LPAB 4P92A 3RANA 3T54A 4BGIA 1F8YA 2BR3A 2QTNA 5TXGA 4Q3NA 3KEGA 1PP4A 2JBAB 4GAEA 4NE2A 2AHOA 1NUTA 1KQNA 2HK7A 4ZREA 3S7TA 1JLSA 3T5BA 2ZPAA 2BFEA 4A73A 5GJVC 4DMRA 4KH1A 2AOTA 2WYOA 2EF1A 3CEJA 3Q1KA 3FGPA 3OEHA 4B6SA 1KY2A 4P1ZA 1PDOA 4ENRA 1PGJA 3QU7A 1C4KA 1YJQA 4KODA 1U0GA 3NXSA 4FGUA 2CDNA 3KSBC 5J43A 1DTWA 3OX2A 3SXUA 3TZKA 2IRWA 1PSWA 1ZH4A 1ZSNA 1SIOA 1XVTA 2YYAA 4QELA 3VMMA 4BVBA 5DSTA 1WJGA 3P2MA 4MR7B 1KOJA 2QNIA 3ETCA 4GLOA 1PVOA 3P26A 3TNFA 1E6WA 5EIHA 2ETVA 3DAYA 2F8MA 3ANLA 4P3YA 1L5NA 3T3EA 3Q8MA 1JLKA 3S2FA 1EFVB 3R7FA 3BTSA 1UDWA 1Y1KE 3IDZA 1HM5A 2HX1A 2XAUA 4GE3A 1TMOA 2ZVPX 3BKXA 3ESZA 4CLOB 4OK5A 1Y9ZA 3EA0A 1P45A 3DMPA 1KKMA 2I67A 5M3BA 1CD5A 5C37A 4KW7A 5KPDA 1QVZA 4I3HA 1CZKA 1KSGA 2IY8A 2AJ8A 2ACEA 4IDFA 1EFTA 3NEYA 3SYMA 5DHPA 1M0EA 3A4IA 2WM9B 5FJIA 4F46A 3GQBA 4TLMB 4HQNA 2VHZA 1VBNA 2XGOA 3Q7IA 4BQRA 5EJ8A 1G8JA 4I6EA 4BKQA 4YAIA 1Z08A 4GI5A 4PVCA 4L73A 3BSYA 4MHOA 4ETMA 3DTVB 2QW8A 5JRZA 2BF4A 1KMIY 4EUNA 3RBVA 1KHHA 1BW9A 3FNRA 3PWTA 2BKVA 3QLTA 4FILA 4B85A 2Y0DA 4RGQA 2GN0A 3THWA 3B9QA 3I2FA 1CR2A 4FTWA 4IWXA 4Q34A 3ZY5A 3G5AA 2FZ4A 3D0QA 2PX4A 3P9QA 4G2TA 3C4VA 4B6JA 4AUMA 4W63A 3I2IA 4CMEC 3LA8A 1O94D 2ZJ1A 1XMSA 1BA2A 5C1DA 3FVVA 4ZOEA 4CQMB 3OECA 4EG7A 5TVKA 3LK7A 2NXEA 2R66A 2GEJA 3Q3HA 2IZ6A 1G8HA 1W9HA 1HE3A 1VOTA 1GTG1 3FVTA 4JQOA 1JIKA 1FRFS 2EL9A 2D5BA 3DCYA 3E7DA 3DP9A 3KZCA 4UQLA 4LQLA 3RSHA 4XYEA 5FL7A 1BW9B 1RJEA 1R8QA 4GC9A 5F7ZA 1CDDA 4N7MA 4RKEA 2ZM6B 3ILYA 3MGGA 4D6YA 1P77A 1PJLA 2ATCA 2AYZA 2JCGA 2RKWA 3TAUA 5JTTA 2CVQA 2WHEA 2BCGY 3MWKA 3OURA 3VKWA 2O05A 5J2TB 3NPMA 1MR3F 2EBHX 1MX1A 2EERA 4HB3A 4CM8A 2AK3A 2Q2VA 3ROMA 1JWBB 2QN3A 4BEVA 1J99A 1RXSA 4MW5A 3WL8A 3KYBA 1G21A 1P39A 4F4HA 3GHHA 3CNOA 5LMNB 2QM0A 2J09A 4LF5B 1MAAA 1VM6A 5BQOA 5MGNA 4PX3A 4AUEA 3V5NA 1LU9A 1C3JA 2E4XA 3I1IA 4DBLC 4KQEA 4Z4HA 1HDRA 3QI7A 1RRGA 4YA6A 4K6MA 3U7EB 3GJYA 3OBIA 3DVAA 4BVGA 4TRJA 5BSRA 1VXOA 4ZTZB 1VBFA 3UKJA 5BV2P 1G2IA 5IJ0B 4KHZA 5DLYA 3QUSA 5HZGA 5KCMA 2C2KA 4HKTA 1DC5A 2AOTB 2O9JA 4RPHA 2Q3JA 4QZVA 2OLJA 3W7VA 3C6ZA 4OTZA 5K3OA 2W9XA 4FOLA 1XN4A 3L6CA 2FU5C 1M0SA 3C8UA 3FUCA 4CNQA 2XH8A 3PE3A 4NIMA 2XAAA 1OFIA 3A1FA 3RADC 2I9PA 4OHWA 5AUNB 4S04A 5A02A 1ZRHA 2FN3A 4HDMB 3DBRA 3NBMA 5LKAA 2CKDA 2Q1YA 1R10A 4XPIA 5LBTA 5CCEA 3LHFA 5GZ3A 2W8BA 5J2UB 3WNBA 4AP5A 1V1JA 2LIVA 5J2TA 4FYMA 3WJ2A 5HBRA 1M34A 4RKRA 4WVFA 1J0EA 5FEMA 3GAFA 3GMDA 4WFIA 1RBYA 4DLAA 5LCXA 4JS0A 4UZEA 5I9MA 4B83A 1I1HA 3CEPB 3G2HA 2X2PA 1N2CA 1M2HA 2Y0CA 4A4DA 5C81A 5MN4A 5EQJB 4DF3A 4YCMA 4FLMA 5JSFA 5CVTA 3MMNA 1MRZA 4E11A 1MQSA 4U8HA 4ZAWA 3ZWNA 4TV8F 4RGBA 2R4TA 4M8SA 1KJIA 1H05A 1L7BA 2WSSD 4FQ7A 4YJFB 4MVJF 1J0AA 4J43A 3PPXA 2X86A 2QX6A 3R0XA 4M9XA 4ASUA 3AEKA 2IHNA 1QYVA 3BGOS 1WXFA 4JLDA 3K9FC 4F7DA 1PSZA 1X86B 3PNOA 4KJZA 4MIEA 2H07A 3PKIA 4IQ0A 1IUPA 3VSCA 4WAUA 4KDEA 3N5KA 4ROTA 3QFTA 2C07A 5BSVA 1TJ4A 1R0LA 1X70A 4XIGS 3QE2A 4V0QA 5D2CA 3OOYA 4LCBA 5IN5A 5K03A 2CBXA 3DDSA 3NBXX 4M89A 1TGYA 3PEWA 4FE3A 2VSXA 3ITEA 3NDPA 4D9NA 1QYCA 4L0MA 1QSGA 5EMKA 3KAKA 3PEEA 3QNWA 5LZ5A 2EZ8A 1KTIA 4LXYA 1W7AA 4N5HX 4HRYA 1P1CA 1L8LA 3P0FA 1R0RE 3M2PA 3KLNA 4MX8A 2ZZMA 4ONEA 4KBFA 2FG7C 4Q0MA 1FCJA 4O2AA 4X90A 4CUZA 4LFAB 3H84A 2GZ1A 4DMCA 3P5SA 1EFPA 2CXRA 2VZLA 2QJFA 4EAAA 2AMFA 1MRSA 1FSSA 1NFFA 1VYHA 3KT6A 3BMQB 2IKQA 4J0KA 2JGMA 3E3LA 4Q3KA 2NX2A 3ZDBA 2PU5A 3WAGA 2Q4BA 1BFUA 3NHMA 4MHSA 5C5EA 2VXYA 3ETGA 5F76A 2O8BA 2Z57A 2GD1O 1XNHA 2GAJA 2OL4A 3GFQA 4MRSA 1EWKA 4EARA 2FPNA 5BOSA 4O1MA 3MLBA 2XCRB 2PA0A 5FV7A 3T6KA 4W9NA 5H9VA 5LPNA 2ZG6A 3C8ZA 1TYEB 2KPOA 4M38A 3AFHA 4EKEA 3T9CA 1XLWA 5FB3A 3SZ3A 4UUOA 5AM4A 2NGRA 2XQVA 4G0WA 1GZ5A 2P3OA 2FWPA 5HIJA 1G4UR 4R2JA 3TTVA 4GQIA 4BFLA 2JGIA 3GIWA 2PZKA 5AYVA 1XP5A 4UHEA 3IAEA 1RPNA 3JQEA 3AO0B 3IXQA 2VJLA 3AI7A 2DUMA 1PDVA 3CZRA 4DCOA 4QTZA 1SOAA 3R7SA 2UUOA 3WGOA 3RVBA 1Q2XA 4U7DA 4DXHA 3CSUA 2YHSA 3C6BA 4Q4JA 1FVFA 5ISMA 4LMAA 4ZICA 1W5FA 2O3UA 3VKHA 4RTSA 1N0WA 3JS5A 5DN9A 2FK7A 4N6NA 3HH8A 3AK4A 2W71A 3O21A 1FUEA 3K70C 4QDJA 1KVQA 2AJDA 1EGMB 4KQHA 4YVFA 3WWOA 1Y9AA 4P0QB 1FDUA 1EG7A 1XL0A 1ZI8A 2XUPA 2NSYA 5DDIP 2X0JA 3JATB 1KOFA 3VU9B 2CSXA 3GRUA 4P4LA 4YDHB 5DWQA 1KA9H 4WUVA 5DW0A 1EP2B 2LCIA 1Z33A 4HTFB 2FW7A 3SWWA 4AKHA 3NOOA 3ZY3A 3JQGA 3S28A 2YKGA 1P0PA 3ECCA 2RI1A 4FGKA 4AX4A 4BEJA 3AR4A 2PQ6A 5ALOA 3K15A 4TKMA 2OVBA 4PRLA 4N47A 3FUTA 3LNCA 4U3JB 5H3CA 2NPFA 1SBYA 1VGRA 2VP9A 1CY4A 4WACA 3PD7A 5ERXA 3JQ9C 5B3KA 2G9RA 2VHEA 1R8XA 2REBA 1KI2A 4ML3A 1EI9A 2IEYA 1GZUA 2ACWA 3BF8A 3TUTA 3KPYA 5BR8B 2YXDA 3LD9A 4B6QA 1FP2A 2WJWA 1XV5A 3OM9A 4CL2A 3I0ZA 4OUKX 1SN7A 5SV2A 4IAOA 1X15A 1KMNA 1RQ7A 4CNBA 4D82A 1P6UA 2OM2A 3BL6A 1O95C 1C30A 3DTNA 4PRYA 2IJGX 1U3FA 2I8CA 4LNUA 1JG6A 2L82A 2UYGA 3L0CA 3OTOB 2QQGA 2AJTA 4KBGA 3AM1A 1BE6A 2ZJAA 2C4HA 3R24A 3LBAA 4N3BA 4EUHA 1FIUA 4HT3B 2IFTA 3CR8A 4BBAA 2ZPTX 4E4YA 1LC3A 1E9AA 1IOLA 2OC9A 3O31A 1E3QA 4POOA 2IEGA 4PF1A 4FN4A 1T9GR 2Q41A 2FETA 5AVOA 2FGJA 3CNNA 5BN4A 1OFVA 3GLHA 3V2HA 5C5CA 1RS0A 1T8TA 5LJIA 4CUJA 3IMGA 1Z5NA 4HX5A 4RZQA 4IH1A 2I6QA 3GRAA 1TC2A 2PAFA 2QRVA 2J5QA 3I9NA 2X1LA 3E0XA 5AK3A 5EP3A 3OTWA 4YALA 5CURA 4BLSA 1X1TA 4TMXA 4CMIB 3PD0A 1V35A 5JG7A 2XDAA 2GAIA 4E22A 1Y1TA 2RHGB 5H3LA 3BXZA 4EMSA 2CT8A 2BGJA 2Q5EA 2PT5A 1TJYA 3FSJX 4LOIA 1SHZA 2GASA 1ADJA 4WDQA 1C4OA 1Z5ZA 1KYYA 2CHVA 5E95A 5CG2A 5KDDA 3DLTA 3GBPA 2V9PA 1LDMA 1RQRA 4GZMA 1FU7A 5BWNA 3UMYA 1I0IA 4PFKA 4F3RA 1LS6A 1FXWF 1EUCA 3IDFA 1Z7WA 3H5WA 3KR9A 3WXBA 4R68A 1OLXB 1J9GA 1EBBA 1EHYA 1Z2CA 3GCZA 1YQXA 3IT2A 3I62A 3K35A 5AK6A 2AQKA 1RVV1 5AXCA 1J70A 4P0TA 3BWXA 4XDYA 3ZHOA 5FTNA 2CYAA 2XTMA 3ZXIA 3AUJB 721PA 4M8LA 4TS1A 1W6UA 4TVBA 2Q4TA 4M1TA 5CLLA 5JDCC 1OA0A 2FMFA 4PNHA 1CB7A 3KLPX 3RFTA 1SVUA 4RENA 1OGJA 1LPPA 2FH5B 5G0SA 1DBSA 3T7IA 1EM8A 3U7QB 2H3EA 1TO6A 3PQ5A 4R8VA 3VR3D 2GUGA 4FYVA 1UBLS 4C3VA 1N3YA 2CLFB 1WSDA 1ZSYA 2QZSA 1U2QA 1U7XA 4CKWB 4RIFA 1PIWA 2GK3A 4ZZ2A 3LY8A 1WDKA 3K6SA 3OWXA 3OZAA 4WL0A 1EGHA 3Q7PA 3H2YA 2PZLA 2CNNA 1VG1A 4G5HA 2X58A 3W9BA 2E5WA 2RKOA 3GLUA 4HWGA 4DYHA 5B3JC 4OP1A 1IY2A 3QVXA 1C9DB 4GPIB 2D6FA 1YC5A 3W8RA 2GHIA 4QAJA 5JZOA 2CLKB 2Q0XA 4M99A 4OFXA 5A6SA 1KDPA 2VT6A 2BRUA 1C3LA 2JI4A 3ZZMA 4MS4B 1KJQA 3HSKA 2QVCA 4UQPA 1SD2A 2FPRA 3UF0A 1EKXA 5FWXB 3B7GA 3D8BA 3ICWA 3RFXA 1WBJB 4R5MA 2I71A 4IHJF 4RTLA 3GLKA 4Z53A 1RWWA 2P79A 1W5TA 3O1LA 4NJMA 3S5JA 3FOFC 4X3CA 4E2WA 4QO7A 5IANA 2O23A 4RCZA 4MYHA 3AILA 1NBMA 4RVCA 3YASA 3BSFA 3VKFA 4KQ1A 3VH2A 4X84A 3OEYA 2CLMB 4MKHA 2YQ4A 1MH1A 3ESXA 1B6SA 1KZ9A 1NF2A 3I12A 5EE9A 4BJ3A 4L3OA 3STVA 4EBFA 5K4AA 3MHTA 1RLUA 4FEGA 2C82A 3QF4B 4R7GA 1DAGA 4Z4IA 1LNQA 2W6CX 5TNXA 2YS6A 1GUFA 4FYXA 1G7CA 2WIFA 5F77A 3VYTB 3AUTA 5JHGB 3MSCA 3V1NA 3IJEB 1KI6B 3D7RA 1D8AA 1IYZA 3LWDA 1WY5A 4GI1A 1HRKA 2AV6A 1WP4A 1RJ9B 3EGCA 4EHFA 1KNQA 3NANA 3WFJA 5BQ3A 1WVMA 2PWYA 3WYCA 4J16C 4OO3A 4BUJA 3A4MA 4L7VA 4Q7QA 1RWVA 3LQQA 2X1VA 3X1DA 1U0OC 3AIOA 3TE7A 1O6CA 4NS4A 5EAIA 3NFRA 2QRVB 4JGIA 2J5RA 4C0HA 2FSPA 3EX7C 3ZE0B 1W0KD 2WZBA 4BO1A 3OWOA 4NPAA 1NG9A 1NW7A 1QONA 1TUIA 1Z28A 4LYJA 4XJXA 3ACBA 4JT8A 3KOZA 3FLAA 1L5HB 4QXMA 3DLBA 2WR8A 3B5IA 3VNAA 5LYJA 2VWPA 4CIDA 2H00A 1NNEA 4IS3A 2JIZD 1LY1A 2Q07A 3MMXA 3PLNA 4MYDA 4KOAA 1YZUA 2VDLB 3TUJC 2NTJA 1E2FA 4ZZ1A 2N0SA 2V9CA 3IXMA 4PZEA 2ZAOA 2FWIA 3TRDA 3TL2A 3PFFA 4ETWA 1UMKA 3EXFA 5SY4A 3U3ZA 5I7VA 4C4XA 3O8OB 1JIXA 3AFNA 4RYLA 5JD3A 2ORVA 3PVSA 4IIGA 1A7KA 1H2HA 1US8A 3AZOA 4FPXA 2MYUA 4IIUA 4MYSA 2VDWB 4ESHA 5G02A 4NV0A 5KWJA 2Y0PA 3KVRA 4UAVA 3L6UA 4Q1BA 2WDPA 2P68A 3P9IA 2YVQA 4AF8A 1CQXA 2BSXA 4AY2A 5TPWA 2ZR7A 3DDUA 3GPBA 4JWKA 3DZ2B 2XYHA 5E8RA 1G38A 1BCRA 3JQ9A 1KIFA 4ZA2A 2QPTA 3R3JA 1UAGA 3WGUA 1WCIB 5FTJA 4UE6A 5L3ZA 1LVHA 3MB8A 4R0VA 3RU9A 2OCLA 1HUQA 2J30A 4AJEA 1G1MA 3AKEA 1GU7A 3AVTA 1NLZA 2MOKA 1R9GA 2XVMA 4IJUA 5D6NA 4G41A 3RHFA 1MC5A 3DL0A 1FP7A 4W5NA 3O4JA 4C4YA 4RAQA 4HNGA 1K68A 3CG4A 3R20A 4FDLA 3MHPA 4C5CA 4JY7A 4ND7A 1TYCA 3N3BC 2DY1A 1QOQB 4QDKA 1K08A 3PR1A 1CQJA 3K1JA 1SIWA 4BQSA 3HI4A 4YXWD 4J3JA 2CL6X 2R6CA 2ZRPA 2ZYVX 4ZVQA 4IIJB 4XOUA 1JYSA 2H7YA 2OZLB 2ERYA 3RREA 1Z4QA 3LLCA 4OFWA 1QHHB 5CCDA 3PI6A 1PWYE 1KS9A 4YGXB 5KUTA 3KUKA 1HYGA 2CXXA 1SXJA 1H4TA 1RQXA 2FZWA 4K9OA 3VFDA 9LDTA 4MVJP 4R16A 4ZANA 3GLTA 4G9EA 2UZ1B 3IEIA 3PHLA 4DQLA 2WKQA 1PZNA 3R0VA 3W5DA 3JWPA 5K6AC 4KMSA 1B8UA 3ZUPA 5F64A 2KSQA 2QV7A 1MG0A 1R6TA 2PVCA 3E3OA 3KSRA 3DONA 3ZU5A 3NJRA 3O9ZA 1DTSA 5K0GA 2B83A 4IPTA 1FTQA 3E9DA 3WRWA 3HXQA 4N39A 2DTXA 2EWWA 5IKXA 2V7QA 5CRIA 1DHTA 2Y1EA 5C1IA 4F5DA 2XXAB 1U1CA 3P0EA 4U7TB 5I7HA 2FSVC 2WYUA 4ZVPA 1RJ9A 1YIDA 3ZCVA 3KHUA 4KI7A 5EFOA 3QEAZ 1S8OA 4Q7MB 2I2WA 1BE1A 2OE2A 3ILVA 3FF4A 3PEUA 4CDNA 2ZI3A 3AESA 2K6GA 3DV2A 8OHMA 4RKYA 4QBTA 1JZSA 2YWGA 2VNHA 1K89A 2XUAA 3QKSA 3T52A 3IEVA 4I3GA 1E8MA 3R5TA 4I5GA 4NESA 2G82A 3GJTA 1K1EA 4LDRA 3E9EA 3STTA 1D4ZA 1RKXA 4NG4A 1OFUA 3VO1A 1P72A 2RIRA 3KWLA 4NU8X 4X9XA 3VDNB 5L4NA 1G66A 4LHXA 1YNOA 3BTOA 3ZCQA 3RSFA 1YQ9A 1Z5GA 1P4RA 4JUCA 4F5YA 2W83A 3I30X 1C7ZA 3P7MA 2Z2XA 4UNSA 2V7VA 1N4AA 4QIHA 2WJZB 3AIMA 4B84A 2V4MA 4JB0A 2JFUA 1AIPA 4AUNA 5LD2B 4Z9FA 1U2SA 1ZIDA 3ENVA 4GZLA 3VHRA 1HZZC 3HCNA 4GOND 5JC8A 2PRJA 3B3QA 4TQAA 3ANNA 2BGTA 3JRWA 2C3OA 1CRQA 3BS4A 2ON6A 2AW5A 4MHTA 1T8WA 2VCYA 2WM2A 1HEUA 2Z1NA 4HTFA 2X76A 2H8GA 1OH7A 3SQXA 2PSFA 5KNDH 2YV5A 4UHBA 4JYZA 4NBTA 3HXOA 4PCAA 4QUKA 2FF7A 5EJIA 4AX8A 1V3TA 2P1ZA 4JNKA 5IAAA 2C3PA 1ZD9A 4BQNA 4ZCIA 5CIYA 1QFZA 1G9SA 4YI5A 2LW7A 3SE0A 3B8HA 4YUYA 3PC3A 3D02A 1HORA 1CQWA 4MPDA 3VPDA 3AU9A 1ZC4A 2NV0A 1WU8A 7GPBA 3AZPA 1DARA 3N05A 2BJWA 4UD2A 3QYAA 2CHEA 1O8CA 3H04A 1WXWA 2D0DA 1JQKA 1TF5A 4PLFA 5EIFA 4DQKA 2YVKA 1I7CB 4GLFA 3NBKA 5IT4A 3CUTA 2G9QA 4JC8A 4JB2A 2NYRA 4WCFB 3OPYA 3I72A 1LTQA 5E9QA 4I99A 3IT0A 1D2NA 1FMLA 1PBTA 1ZAYA 3EPBB 3HM9A 2HTEA 5EPOA 2WVAA 1U5BB 2IK8A 1IZYA 2QZPA 3L1IA 4E5NA 4QVIA 4DIFA 2IYLD 4ZAYA 2P3QA 3A1EA 1IEVA 1FVOA 1E99A 3AETB 5DT2A 5G0VA 4DWJA 3DLPX 3JWIA 1A3CA 2P0YA 4X95A 4DDVA 1E63A 4MYRA 4W7IA 1DKPA 4BP8A 2VCEA 3EIXA 2JAQA 1I2ZA 2DPLA 4U9IS 3O4VA 3KB1A 3URMA 3CPSA 3CVUA 1R74A 1IXRC 2CL7X 2PXHA 2QLJA 1ZO8A 2WJHA 4KLNA 4UTZA 4BCCA 3WP1B 4DSAA 2H1HA 3IBGA 2YY6A 4FNOA 2OBXA 1NQAO 2B92A 4GNKA 1LBHA 2E9SA 2YV2A 2YY5A 1VKZA 2FOXA 4IO0A 4MWDA 4EUSA 5LL6P 5ITWA 1VCIA 3V1TC 1UH5A 1YZLA 1HFEL 1A98A 1MTZA 4ESEA 1OU4A 3K7EA 4YCDA 4RTOA 3VR5H 1OD6A 2JLSA 3J7AC 3S55A 4D6PA 2J3JA 1M7HA 5F3RA 2F1HA 4CCYB 4P7FA 2J32A 4GI2A 4RD0A 2FNAA 3OPNA 1CNMA 3STYA 4DRXA 5J4VA 3CVWA 3OJFA 3C7TA 1B41A 4HF7A 3PYXA 2GWHA 2WKWA 3BL5A 1Z2AA 2QTZA 2I6GA 3UGKA 4Q39A 3HYTA 4HQOA 1XAIA 4YS6A 5CVUA 3COVA 3D6JA 4JVSB 3SHWA 2IUYA 3HL4A 3Q7QA 4AZWA 2R4QA 3LH5A 4DV6B 1KH2A 2FEMA 1BXKA 1U28A 3LT4A 1GLNA 5LU8A 1N2CB 4JEIA 4TM7A 2GSWA 4EUEA 4JT2A 3TZ6A 4WLFA 5LNK6 3A25A 4EY8A 1FFAA 2LGJA 2WYVA 2O2GA 3HRIA 1L5LA 4YT4A 2JKZA 3CX3A 5JMOA 4BV8A 4NOJA 3I04A 3TL3A 2PE5A 1KY4A 3ISVA 1K6XA 2PFGA 1PE0A 3Q4GA 4AY4A 4YUXA 3DAPA 3JASB 4Z0NA 1XCPA 2XV1A 1QYRA 3CM0A 3Q10A 1CVRA 1SVLA 1E4YA 3AC0A 2FKNA 3DZ4B 2G0AA 3AHFA 3BCRA 3H9UA 4OL0A 4RZSA 1K86A 5DXJA 3R44A 3W05A 4GOJA 5D84A 3UA3A 3UMFA 1U2DA 2H3HA 1PFWA 3HS3A 4PC6A 5SZJA 3L7OA 4C0QC 4EZEA 2L42A 4JJFA 5JSZA 3T34A 3EIHA 2XNKA 2O8VA 3PXEA 4MVJE 3WISA 4RA6A 5KSOA 5L53A 3M6XA 1I3NA 2CUZA 2IPNA 2VBIA 3PIRA 4H7DA 4A0FA 4O2RA 4CMGA 2Q62A 4ZT7A 2CE7A 1TXGA 2B82A 4WKGA 4IDPA 4Q7EA 4PQEA 2XCOA 4Y9TA 2HK8A 3C7DB 3F49S 3MCTA 5EZSA 5F5XA 4RSRA 4NBUA 3RVRA 3W6PA 1L4NA 3GLFB 3UW3A 2C1ZA 2BGKA 2OC4A 1SY7A 3PWZA 3I52A 4G9GA 4FI3C 1KVRA 4RF4A 1EXWA 3HMKA 1A88A 1DELA 3WTBA 4PPYA 1EEXB 3OU6A 4CF6A 5LOVF 4IOLA 4GUDA 1AUXA 3WYGA 1A9XA 4OBWA 1J49A 5BYJA 1XJ0A 1JB9A 1QLHA 1SUDA 3I9JA 4MQ4A 2BFFA 1NMZA 3NHSA 4V03A 5FOVA 2XTNA 4I4NA 4JFRA 4A2QA 3GCDA 3KD3A 3QK7A 4ISCA 4PG8A 4CM9D 4YH1A 3R3HA 4MIYA 5B3JA 3OJXA 4JU9A 3C74A 1CHDA 2FMHA 4WCFA 4YFVA 3DE1X 5ALZA 3H3JA 4M1EA 5DRYA 4DWWA 3TD6A 1ML3A 1J2EA 1KETA 3B12A 3IUQA 5AI0A 5LLSA 3QKRB 5IS2A 1U3DA 2FG5A 3FB4A 4RPJA 3TDMA 4EEZA 4JXKA 1GL7A 2FYTA 4UNPA 2AE2A 4ISBA 2XTAA 1DL5A 3EW9A 4TV9A 1VBMA 4LY3A 1QIMA 5F2KA 1NVGA 1ZD3A 4YLYA 4KWCA 1T1SA 2A3NA 3S1AA 3LXXA 4F86A 3U4MA 3GG2A 1FFYA 2GCIA 1NIPA 1TYDE 1TRHA 1RAAA 1X8KA 3NNDA 1M1YE 4IF6A 4BC0A 1RKVA 3FCAA 4ITUA 4BN5A 1AN9A 2YUTA 2OGSA 3SSNA 1IPEA 3I9OA 1ZUWA 1DBRA 2DQSA 4KL8S 4HC4A 1Z35A 2XJ4A 3Q9NA 3FR8A 2DH6A 2K4MA 4WY5A 3LPCA 4Y0VA 2FUG6 3S27A 3UOGA 5K8IA 2D06A 5EMJA 5I7RA 1VRWA 3O90A 4D98A 4XJVA 1W46A 2Z0MA 2M32A 2P67A 2V6IA 4BXOA 2ZI7A 2PLRA 4XGNA 1JDUA 2FF5A 2JA2A 4G0OA 1T25A 2O4CA 1EK1A 4HDRA 4Q4LA 4ZDIA 3PQ4A 5EFZA 1F0PA 3EZ6A 4RHTA 4CM1A 4WXYB 3NTXA 2QR3A 4R69A 4EWLA 4DN6A 2AX3A 3BK1A 3G59A 1L7AA 2WFLA 5DHTA 2CZGA 3L0ZA 2AG0A 3ABQB 3LWNA 3THXB 4P2GA 1W4ZA 1CDOA 4JENA 3SC4A 1UMCB 2GCNA 4L0QA 1KE1A 3OA0A 4DILA 4BVFA 2RI6A 2JJYA 2P2CA 3GEBA 1IEXA 1KNXA 4A0SA 2VPWA 1Z6ZA 1W6RA 1HLGA 4X7MA 4DDKA 3A04A 2CZQA 2ZIXA 1DXOA 3KVYA 2A9OA 1PEAA 2R68A 2Y4OA 3AHCA 1QP8A 4X0EA 2WDZA 4N7JA 3OZXA 4ZRDA 2Q1UA 4FYPA 1O08A 4QPZA 4FD3A 5CT8A 2JFZA 2DSNA 3QM1A 1KERA 3I92A 3MSXA 4NZMA 5FWDA 1WPGA 5B1DA 3V1UA 4G37A 3O47A 3A6ZA 1O96B 2GD2A 3MD9A 1T3HA 1PJSA 3RUIA 5FQNA 2ID8A 3WO0A 1JAXA 4G01B 2TYSB 2ZTVA 3LTNC 1N78A 4C05A 3BRQA 3KBOA 2ZB8A 3G8AA 1N0IA 1BFDA 3DZ7B 2VPQA 3B1WA 1LRLA 8GPBA 5IAJA 4LMPA 1W47A 3WKBA 1W59A 1JFVA 3BKWA 1A9XB 4JI7B 2W93A 2DFDA 3I8OA 3QQ5A 2H2WA 4FE7A 3IE1A 1YTLA 2WV9A 2Q5CA 2BHLA 2ZRNA 5JAHA 1H6AA 3KJQA 2PA3A 3CRW1 2OFFA 1MOPA 5A9SB 3IERA 5JASA 1Y6RA 1ODLA 3MCZA 3BXPA 2VKQA 5L45A 3V4ZA 1IJBA 4J2TA 1H0HA 2J0UB 3VDMA 1M10A 1I2CA 3QFRA 4D81A 4JP1A 3NZEA 4H08A 5FR1A 5BN1A 4MVJA 1SBHA 1ST2A 2PX3A 13PKA 1FS4A 1U1DA 2C84A 4BIIA 4CIWA 1NNSA 1YXMA 4JAVC 2E6UX 4CZ2A 1A27A 4Y30A 1YS4A 4UTXA 2CCGA 1RNLA 2DE0X 3G2PA 2BFCB 3B3FA 2QF7A 3DVAB 3M9WA 4NY1A 3WHIA 3PXBA 4KE6A 3KG2A 2R86A 1AKQA 3TLGB 5IKMA 2IEZA 1E7YA 1KK1A 1PFYA 1IVSA 2P41A 4XCXA 3A4TA 4HAZA 4FQ8A 2CMHA 3IP5A 1FL9A 4MI6A 3RRBA 1T15A 2VNJA 1XK6A 3H2GA 3M4YA 3SHTA 3TI7A 3WS7A 5CMLA 3O0DA 4BMPB 1EFAA 4OHKA 4FFPA 1N92A 5E2BA 1G8MA 1PLKA 1Z0ZA 1XA4A 2ZRDA 3MT8A 5AI9A 4IILA 4R9VA 4H0CA 4I36A 1J5EB 4H6WA 4ENWA 1QTIA 1SIUA 2Q6TA 4JROA 4R3UC 1SQ5A 3G2KA 5CB0A 2P5UA 3AL3A 1ENOA 3JYNA 2FPIA 2I7TA 2YWBA 1GDDA 3DWEX 3O9MA 4M8KA 3IP7A 3JD3A 3IP8A 4KZKA 1K4YA 2PS0A 4XIJA 4DIUA 1IBLB 3LOPA 3CEHA 4YQEA 3PQEA 1T5DX 3U7FB 2GO7A 2HSZA 2OYCA 4TYWA 1L3IA 4PLWA 4YACA 4OBEA 5BWBA 2C4TA 3LPLA 5KTMA 5LOVB 3K1AB 1C50A 4N0QA 1KFBB 3R6GA 1QRDA 1QGDA 2P40A 3EWAA 1QZUA 4KGZA 3RRZA 4OXYA 3E4CA 2Z1MA 3O7MA 3GPDG 5IHPA 3MTGA 2A30A 5BPFA 4ILEA 1U81A 3TSOA 1N75A 3OF3A 2C4UA 1YB7A 2FFHA 4KEAA 4KYVA 3UEOA 3HU3A 2OCBA 4C21A 1EXDA 1GGKA 1QGED 5G0WA 9LDBA 3OE5A 1JMYA 3ZCSA 2Z1DA 5FNVF 2FPXA 3P0RA 3T4XA 4L07A 4BMOB 3TINA 1F8FA 3EDOA 4W5HA 2VZ0A 4ZKDA 2YASA 4G5XA 4LGMA 2JZOA 3C7KA 5IM4A 3AEQA 1QBKC 2P77A 1BJKA 3IAM1 5F73A 4QULA 3TECE 4BQPA 4YMGA 2ZIGA 1QTRA 3EF3A 3GQBB 5DGDA 2NUBA 4QD3A 5EMMA 2HLNA 3JR3A 3ZBPA 1M8FA 3WADA 1GP2A 4FIDA 4JB3A 1KPGA 1QO0A 1A8SA 3HN6A 4JYAB 1O3YA 1TVMA 2C5EA 2GD6A 2J3DA 2QG6A 4NS1A 4IXMA 3LKBA 4P84A 4TS3A 5CDFA 3OPMA 3HV2A 3P5BA 4HFMA 5KYUA 4MW6A 821PA 4BNGA 1OHHA 4OI2A 1P60A 2FFJA 1LK5A 1CULC 3VZRA 4N41A 1SUPA 4FS8A 1JKJA 1Q92A 1F6DA 1CP3A 2JARA 3MMPA 3HKBB 1KP9A 1Q0RA 2ECOA 1DC3A 1NPTO 4IR7A 4K88A 4L4UA 4RJLA 4ZZ3A 4MVJI 3B9RA 3WK9A 1XZNA 3E84A 3PQ2A 1B74A 4WD3A 1ZM3A 1CZOA 2O5CA 2HRZA 4A9AA 1JG2A 4D02A 1A2BA 4EHIA 2JLAA 2R8PA 2FSHA 4MITA 3TEFA 5CW2A 4IV8A 2RSLA 1JE0A 3LP6A 4ID9A 4URZR 5EHQA 3ZV5A 2BF7A 1WX1A 3ZU4A 2C97A 3C4QA 4ARAA 4EG6A 1AO0A 4GBMA 4P6VF 3WK8A 1CEYA 3ZLBA 3H7AA 3WE7A 1O4WA 1JTVA 5BRAA 4OF4A 4UPDA 4AXBA 4AB1A 4ERXA 5AM5A 1QYDA 3O8RA 4KXWA 4BZPA 1Z6PA 4QYIA 1WMBA 4R84A 3W34A 3CO0S 1X7WA 2IU0A 3PI7A 3FPFA 3T15A 3PRJA 4UVDA 8ATCA 1JH9A 3RHZA 1C0LA 4HL6A 3RIYA 1Y3FE 3OMWA 3RC1A 5I7EA 2F7SA 1P4AA 1P7YA 1PUJA 2C2HA 5L3SB 1A76A 4RZHA 3QE0A 1BS2A 1JQEA 2FQXA 2J48A 1UM8A 4GX1A 3DAOA 2HV8A 2YIVX 3TRIA 3PQCA 4L5AA 3HA5A 4QSMA 1ZD2P 2AOVA 4PLTA 3NT4A 3VKUA 3S1LA 1VC2A 2N1MA 1N5IA 1Z0UA 3IELA 4F4DA 2WU3A 3H1FA 1DB3A 3EVEA 3OLQA 3EP5B 2DKFA 2R8XA 2VJMA 1E9EA 1O9BA 3EDQA 1NRIA 3FLEA 3VPCA 1P0IA 3RK4A 4D9GA 3UIEA 1BQEA 3GWZA 3T4EA 2CDAA 3I4LA 4IXDA 5BURA 3FWNA 2ZBEA 3PQDA 1BCSA 3LLUA 5I6DA 4HXYA 3FRHA 4JKYA 4NCJA 4BVJA 1KI4A 1ZD4A 3E9YA 3LLMA 4BNDB 1L9XA 3O73A 2C42A 1ZA1A 3Q88A 3EIFA 5DCYA 3UJ8A 1U6JA 2VSNA 5AW6A 1Q16A 2W11A 5KTRA 2WNIA 3T5AA 3IS3A 5CAEA 2KLBA 4R9UC 5FUXA 3W9YA 1IN7A 3ASUA 4BO8A 4Q7JB 3JPWA 2G9ZA 1FP1D 1VIAA 1Z62A 2EIXA 1ZNWA 3DBLA