3JSJA

Crystal structure of a putative tetr-transcriptional regulator (sav143) from streptomyces avermitilis ma-4680 at 2.10 a resolution
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
184
structure length
184
Chain Sequence
b'KQSPRERLLEAAAALTYRDGVGIGVEALCKAAGVSKRSMYQLFESKDELLAASLKERSAAFVAKALPPADDGRSPRERILYVFERVESQAGAPDFQGCRYLAVQIELKDQAHPASRVAYQIKADLMAFFRSEAERGGASDPDLLARQLILVFDGASARAGIGADNLTGLIVPTLTTLLDAADMH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative TetR-family transcriptional regulator
publication title Crystal structure of Putative transcriptional regulator (NP_821317.1) from Streptomyces avermitilis MA-4680 at 2.10 A resolution
rcsb
source organism Streptomyces avermitilis ma-4680
molecule tags Transcription
total genus 68
structure length 184
sequence length 184
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3jsjA00
4M3BA 5EYRA 3PM1A 4JKZA 2UXPA 3HIMA 2OI8A 3VW0A 5K7HA 2NS7A 5F27A 2PZ9A 3SDGA 5FKOA 3NXCA 2W53A 3BHQA 5GPCA 3GEUA 4ACIA 3BQZA 4CGRA 2WV1A 3E7QA 1Z0XA 5J1RA 2YVEA 4L62A 3S5RA 3QQAA 2VKEA 2FQ4A 3ANGA 3VOKA 3LHQA 4HKUA 1U9NA 4PXIA 2GBYA 2HYJA 3BR2A 2GUHA 2O7TA 3BTJA 2GENA 5J1YA 3HGGA 5J3LA 3CWRA 3O60A 4I76A 2ID3A 5IPAA 2RAEA 2ZCNA 4GFLA 1UI5A 3PASA 2G7LA 3BT9A 2Y2ZA 3BTLA 3VIBA 2QKOA 3TP0A 2UXUA 2FD5A 4B1RA 2XRLA 3CRJA 2NS8A 4AF5A 3BTIA 2QOPA 5F1JA 3EUPA 5FKNA 3VW2A 3G1LA 2RHAA 3C07A 3B6AA 4JYKA 5K7FA 4M3FA 1A6IA 3QBMA 2QIBA 3BJBA 2G7GA 2XPWA 2ZOYA 3JSJA 5F0CA 5HBUA 4JL3A 5CXIA 2V57A 1VI0A 3PPBA 5FKKA 3ZQHA 4MXMA 3AQSA 3LSRA 2OPTA 1JTYA 2HYTA 3O8HA 2ZCXA 3HE0A 3O8GA 4ICHA 4D7MA 3RH2A 5K58A 1SGMA 3F1BA 2VKVA 3CDLA 5GPAA 3C2BA 1JT6A 4B3AA 2IAIA 3KKDA 5H9TA 2HQ5A 3G7RA 1T33A 3HTJA 4GCKA 5F0HA 2RASA 3MVPA 5EZGA 5F04A 4ME9A 3HTHA 3TP3A 3ZQLA 1BJZA 4AC0A 2O7OA 2X9DA 3BR3A 3AQTA 3BR5A 2DTZA 3BRUA 3B81A 2XPVA 2QWTA 3BQYA 2XGEA 1T56A 2NP5A 4XK4A 2ZCMA 5EZHA 5FKLA 3VW1A 3VOXA 5IP6A 2IU5A 3HTAA 4YZEA 1ZKGA 1RKTA 5F08A 3V78A 3BNIA 3BTCA 2JK3A 3ZQGA 5AQCA 4D7NA 3G1MA 3BR1A 5FKMA 3BCGA 3LWJA 2HKUA 3VPRA 3V6GA 3WHCA 2Q24A 4ABZA 5DAJA 3LJLA 5HAWA 2HXOA 4UDSA 5D19A 4AC6A 1JUSA 3QPSA 5FGLA 2REKA 1QVUA 3P9TA 4KWAA 4JNNA 2OF7A 3HTIA 2FX0A 2I10A 3FK7A 2FJ1A 5EFYA 3QPLA 2UXOA 3VP5A 5IOZA 3LSJA 1ORKA 1UI6A 2DG7A 3DEWA 3NNRA 4MO7A 2X6OA 4D5FA 3COLA 2G0EA 2XGCA 2FBQA 3QKXA 2UXHA 2UXIA 4W1UA 2XPUA 4GCTA 2XGDA 4AUXA 3ANPA 3BR6A 5FMPA 3DCFA 1JUMA 3B6CA 3KZ9A 4GCLA 5D1RA 2G3BA 3ON4A 2Y30A 1U9OA 2EH3A 3CJDA 4I6ZA 3Q3SA 1QPIA 1RPWA 5D18A 3G56A 4X1EA 5FHPA 2D6YA 4DW6A 2Y31A 3IH4A 3ZQIA 3IH3A 3T6NA 3FK6A 4NELA 3F0CA 2GFNA 3KKCA 2TCTA 3VVXA 2ID6A 4M3GA 4M3DA 2OERA 1JUPA 1ZK8A 5IOYA 5C4YA 3IH2A 3LSPA 5GP9A 4NN1A 5CXGA 5J1UA 4V2FA 2ZB9A 3Q0UA 2F07A 3BR0A 2NP3A 3G1OA 2HXIA 2XDNA 1QVTA 1Z77A 3IUVA 2WGBA 2YVHA 4G12A 4V2GA 3ON2A 3VVZA 3CCYA 5K7ZA 2DG8A 4M3EA 5HSZA 3VUQA 3NRGA 1JT0A 2IEKA 4MK6A 3FRQA 3GZIA 3RD3A 3Q0WA 3NPIA 2TRTA 2QCOA 3WHBA 2WUIA 4GFKA 3DPJA 2QTQA 2XB5A 1JTXA 3SFIA 5F0FA 2NX4A 3ZQFA 3KNWA 3Q0VA 3FIWA 3MNLA 4D5CA 5CW8A 3NI7A 4W97A 2PBXA 3VVYA 3EGQA 3HGYA 2JJ7A 2VPRA 2ZOZA 2IBDA 3LOCA 1RKWA 2G7SA
chains in the Genus database with same CATH superfamily
4M3BA 5EYRA 3PM1A 4JKZA 2UXPA 3HIMA 2OI8A 3VW0A 5K7HA 2NS7A 4U9LA 5F27A 2PZ9A 3SDGA 5FKOA 3NXCA 2W53A 3BHQA 5GPCA 3DU6A 3GEUA 4ACIA 2R7OA 3BQZA 4CGRA 4IRVA 2WV1A 3E7QA 1Z0XA 5J1RA 2YVEA 4L62A 3S5RA 3QQAA 2VKEA 2FQ4A 3ANGA 3VOKA 3LHQA 4HKUA 1U9NA 4PXIA 2GBYA 2HYJA 3BR2A 2GUHA 2O7TA 3NS4A 3BTJA 2GENA 5J1YA 3HGGA 5J3LA 3CWRA 3O60A 4I76A 4C2MA 2ID3A 5IPAA 2RAEA 2ZCNA 4GFLA 1UI5A 3PASA 2G7LA 3BT9A 2Y2ZA 3BTLA 3VIBA 2QKOA 3TP0A 2UXUA 2FD5A 4B1RA 2XRLA 3CRJA 2NS8A 4AF5A 3BTIA 2QOPA 5F1JA 3EUPA 5FKNA 3VW2A 3G1LA 2RHAA 3C07A 3B6AA 4JYKA 5K7FA 4M3FA 1A6IA 3QBMA 2QIBA 3BJBA 2R7QA 2R7VA 2G7GA 2XPWA 2ZOYA 3JSJA 5F0CA 5HBUA 4JL3A 5CXIA 2V57A 1VI0A 3PPBA 5FKKA 3ZQHA 4MXMA 3AQSA 3LSRA 2OPTA 1JTYA 2HYTA 3O8HA 2ZCXA 3HE0A 3O8GA 4ICHA 4D7MA 3RH2A 5K58A 1SGMA 3F1BA 2VKVA 3CDLA 5GPAA 3C2BA 1JT6A 4B3AA 2IAIA 3KKDA 5H9TA 2HQ5A 3G7RA 1T33A 3HTJA 4GCKA 5F0HA 2RASA 2R7RA 3MVPA 5EZGA 5F04A 4OD5A 4ME9A 3HTHA 3TP3A 3ZQLA 1BJZA 4AC0A 2O7OA 2X9DA 3BR3A 3AQTA 3BR5A 2DTZA 3BRUA 3B81A 2XPVA 2QWTA 3BQYA 2XGEA 1T56A 2NP5A 4XK4A 2ZCMA 5EZHA 5FKLA 2R7SA 3VOXA 3VW1A 5IP6A 2IU5A 3HTAA 4YZEA 1ZKGA 1RKTA 5F08A 3V78A 3BNIA 3BTCA 2JK3A 3ZQGA 5AQCA 4D7NA 3DU5A 2A2FX 3G1MA 3BR1A 5FKMA 3K8PC 3BCGA 3LWJA 2HKUA 3VPRA 2R7UA 3V6GA 3WHCA 2Q24A 4ABZA 5DAJA 3LJLA 5HAWA 2HXOA 4UDSA 3SWHA 5D19A 4AC6A 1JUSA 3QPSA 5FGLA 2REKA 1QVUA 3P9TA 4KWAA 4JNNA 2OF7A 2FJI1 3HTIA 2FX0A 2I10A 3FK7A 2FJ1A 2PFVA 5EFYA 3QPLA 2UXOA 3VP5A 5IOZA 3LSJA 1ORKA 1UI6A 2DG7A 3DEWA 3NNRA 4MO7A 2X6OA 4D5FA 3COLA 2G0EA 2XGCA 2FBQA 3QKXA 2UXHA 4OD4A 2UXIA 4W1UA 2XPUA 4GCTA 2XGDA 4AUXA 3ANPA 2B3WA 3KYLA 3BR6A 5FMPA 3DCFA 1JUMA 3B6CA 3KZ9A 4GCLA 5D1RA 2G3BA 3ON4A 3FHNA 4DVYP 2Y30A 1U9OA 2EH3A 3CJDA 4I6ZA 2YVXA 3Q3SA 1QPIA 1RPWA 5D18A 3G56A 4X1EA 5FHPA 2D6YA 4DW6A 2Y31A 3IH4A 3ZQIA 3IH3A 3T6NA 3FK6A 4NELA 3F0CA 2GFNA 2ZY9A 3KKCA 2R7TA 2TCTA 3VVXA 2ID6A 4M3GA 4M3DA 2OERA 1JUPA 1ZK8A 5IOYA 5C4YA 3IH2A 3LSPA 5GP9A 3VTIA 4NN1A 5CXGA 5J1UA 4V2FA 2ZB9A 3Q0UA 2F07A 2R7XA 3BR0A 2NP3A 3G1OA 2HXIA 2XDNA 1QVTA 1Z77A 3IUVA 2B1EA 2WGBA 2YVHA 4G12A 4V2GA 3ON2A 3VVZA 3CCYA 5K7ZA 2DG8A 4M3EA 5HSZA 3VUQA 3NRGA 1JT0A 2IEKA 4MK6A 3FRQA 3GZIA 3RD3A 3Q0WA 3NPIA 2TRTA 4U9NA 4WIBA 2QCOA 3WHBA 2WUIA 4GFKA 3DPJA 2QTQA 2R7WA 2XB5A 1JTXA 3SFIA 5F0FA 2NX4A 3ZQFA 3KNWA 5CQGA 3Q0VA 3FIWA 3MNLA 4D5CA 5CW8A 3NI7A 4W97A 2PBXA 3VVYA 3EGQA 3HGYA 2JJ7A 2VPRA 2ZOZA 2IBDA 3LOCA 1RKWA 2G7SA
chains in the Genus database with same CATH topology
4M3BA 5EYRA 3PM1A 4JKZA 2UXPA 3HIMA 2OI8A 3VW0A 5K7HA 2NS7A 5F27A 2PZ9A 3SDGA 5FKOA 3NXCA 2W53A 3BHQA 5GPCA 3GEUA 4ACIA 3BQZA 4CGRA 2WV1A 3E7QA 1Z0XA 5J1RA 2YVEA 4L62A 3S5RA 3QQAA 2VKEA 2FQ4A 3ANGA 3VOKA 3LHQA 4HKUA 1U9NA 4PXIA 2GBYA 2HYJA 3BR2A 2GUHA 2O7TA 3BTJA 2GENA 5J1YA 3HGGA 5J3LA 3CWRA 3O60A 4I76A 2ID3A 5IPAA 2RAEA 2ZCNA 4GFLA 1UI5A 3PASA 2G7LA 3BT9A 2Y2ZA 3BTLA 3VIBA 2QKOA 3TP0A 2UXUA 2FD5A 4B1RA 2XRLA 3CRJA 2NS8A 4AF5A 3BTIA 2QOPA 5F1JA 3EUPA 5FKNA 3VW2A 3G1LA 2RHAA 3C07A 3B6AA 4JYKA 5K7FA 4M3FA 1A6IA 3QBMA 2QIBA 3BJBA 2G7GA 2XPWA 2ZOYA 3JSJA 5F0CA 5HBUA 4JL3A 5CXIA 2V57A 1VI0A 3PPBA 5FKKA 3ZQHA 4MXMA 3AQSA 3LSRA 2OPTA 1JTYA 2HYTA 3O8HA 2ZCXA 3HE0A 3O8GA 4ICHA 4D7MA 3RH2A 5K58A 1SGMA 3F1BA 2VKVA 3CDLA 5GPAA 3C2BA 1JT6A 4B3AA 2IAIA 3KKDA 5H9TA 2HQ5A 3G7RA 1T33A 3HTJA 4GCKA 5F0HA 2RASA 3MVPA 5EZGA 5F04A 4ME9A 3HTHA 3TP3A 3ZQLA 1BJZA 4AC0A 2O7OA 2X9DA 3BR3A 3AQTA 3BR5A 2DTZA 3BRUA 3B81A 2XPVA 2QWTA 3BQYA 2XGEA 1T56A 2NP5A 4XK4A 2ZCMA 5EZHA 5FKLA 3VW1A 3VOXA 5IP6A 2IU5A 3HTAA 4YZEA 1ZKGA 1RKTA 5F08A 3V78A 3BNIA 3BTCA 2JK3A 3ZQGA 5AQCA 4D7NA 3G1MA 3BR1A 5FKMA 3BCGA 3LWJA 2HKUA 3VPRA 3V6GA 3WHCA 2Q24A 4ABZA 5DAJA 3LJLA 5HAWA 2HXOA 4UDSA 5D19A 4AC6A 1JUSA 3QPSA 5FGLA 2REKA 1QVUA 3P9TA 4KWAA 4JNNA 2OF7A 3HTIA 2FX0A 2I10A 3FK7A 2FJ1A 5EFYA 3QPLA 2UXOA 3VP5A 5IOZA 3LSJA 1ORKA 1UI6A 2DG7A 3DEWA 3NNRA 4MO7A 2X6OA 4D5FA 3COLA 2G0EA 2XGCA 2FBQA 3QKXA 2UXHA 2UXIA 4W1UA 2XPUA 4GCTA 2XGDA 4AUXA 3ANPA 3BR6A 5FMPA 3DCFA 1JUMA 3B6CA 3KZ9A 4GCLA 5D1RA 2G3BA 3ON4A 2Y30A 1U9OA 2EH3A 3CJDA 4I6ZA 3Q3SA 1QPIA 1RPWA 5D18A 3G56A 4X1EA 5FHPA 2D6YA 4DW6A 2Y31A 3IH4A 3ZQIA 3IH3A 3T6NA 3FK6A 4NELA 3F0CA 2GFNA 3KKCA 2TCTA 3VVXA 2ID6A 4M3GA 4M3DA 2OERA 1JUPA 1ZK8A 5IOYA 5C4YA 3IH2A 3LSPA 5GP9A 4NN1A 5CXGA 5J1UA 4V2FA 2ZB9A 3Q0UA 2F07A 3BR0A 2NP3A 3G1OA 2HXIA 2XDNA 1QVTA 1Z77A 3IUVA 2WGBA 2YVHA 4G12A 4V2GA 3ON2A 3VVZA 3CCYA 5K7ZA 2DG8A 4M3EA 5HSZA 3VUQA 3NRGA 1JT0A 2IEKA 4MK6A 3FRQA 3GZIA 3RD3A 3Q0WA 3NPIA 2TRTA 2QCOA 3WHBA 2WUIA 4GFKA 3DPJA 2QTQA 2XB5A 1JTXA 3SFIA 5F0FA 2NX4A 3ZQFA 3KNWA 3Q0VA 3FIWA 3MNLA 4D5CA 5CW8A 3NI7A 4W97A 2PBXA 3VVYA 3EGQA 3HGYA 2JJ7A 2VPRA 2ZOZA 2IBDA 3LOCA 1RKWA 2G7SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M3B A;  5EYR A;  3PM1 A;  4JKZ A;  2UXP A;  3HIM A;  2OI8 A;  3VW0 A;  5K7H A;  2NS7 A;  5F27 A;  2PZ9 A;  3SDG A;  5FKO A;  3NXC A;  2W53 A;  3BHQ A;  5GPC A;  3GEU A;  4ACI A;  3BQZ A;  4CGR A;  2WV1 A;  3E7Q A;  1Z0X A;  5J1R A;  2YVE A;  4L62 A;  3S5R A;  3QQA A;  2VKE A;  2FQ4 A;  3ANG A;  3VOK A;  3LHQ A;  4HKU A;  1U9N A;  4PXI A;  2GBY A;  2HYJ A;  3BR2 A;  2GUH A;  2O7T A;  3BTJ A;  2GEN A;  5J1Y A;  3HGG A;  5J3L A;  3CWR A;  3O60 A;  4I76 A;  2ID3 A;  5IPA A;  2RAE A;  2ZCN A;  4GFL A;  1UI5 A;  3PAS A;  2G7L A;  3BT9 A;  2Y2Z A;  3BTL A;  3VIB A;  2QKO A;  3TP0 A;  2UXU A;  2FD5 A;  4B1R A;  2XRL A;  3CRJ A;  2NS8 A;  4AF5 A;  3BTI A;  2QOP A;  5F1J A;  3EUP A;  5FKN A;  3VW2 A;  3G1L A;  2RHA A;  3C07 A;  3B6A A;  4JYK A;  5K7F A;  4M3F A;  1A6I A;  3QBM A;  2QIB A;  3BJB A;  2G7G A;  2XPW A;  2ZOY A;  3JSJ A;  5F0C A;  5HBU A;  4JL3 A;  5CXI A;  2V57 A;  1VI0 A;  3PPB A;  5FKK A;  3ZQH A;  4MXM A;  3AQS A;  3LSR A;  2OPT A;  1JTY A;  2HYT A;  3O8H A;  2ZCX A;  3HE0 A;  3O8G A;  4ICH A;  4D7M A;  3RH2 A;  5K58 A;  1SGM A;  3F1B A;  2VKV A;  3CDL A;  5GPA A;  3C2B A;  1JT6 A;  4B3A A;  2IAI A;  3KKD A;  5H9T A;  2HQ5 A;  3G7R A;  1T33 A;  3HTJ A;  4GCK A;  5F0H A;  2RAS A;  3MVP A;  5EZG A;  5F04 A;  4ME9 A;  3HTH A;  3TP3 A;  3ZQL A;  1BJZ A;  4AC0 A;  2O7O A;  2X9D A;  3BR3 A;  3AQT A;  3BR5 A;  2DTZ A;  3BRU A;  3B81 A;  2XPV A;  2QWT A;  3BQY A;  2XGE A;  1T56 A;  2NP5 A;  4XK4 A;  2ZCM A;  5EZH A;  5FKL A;  3VW1 A;  3VOX A;  5IP6 A;  2IU5 A;  3HTA A;  4YZE A;  1ZKG A;  1RKT A;  5F08 A;  3V78 A;  3BNI A;  3BTC A;  2JK3 A;  3ZQG A;  5AQC A;  4D7N A;  3G1M A;  3BR1 A;  5FKM A;  3BCG A;  3LWJ A;  2HKU A;  3VPR A;  3V6G A;  3WHC A;  2Q24 A;  4ABZ A;  5DAJ A;  3LJL A;  5HAW A;  2HXO A;  4UDS A;  5D19 A;  4AC6 A;  1JUS A;  3QPS A;  5FGL A;  2REK A;  1QVU A;  3P9T A;  4KWA A;  4JNN A;  2OF7 A;  3HTI A;  2FX0 A;  2I10 A;  3FK7 A;  2FJ1 A;  5EFY A;  3QPL A;  2UXO A;  3VP5 A;  5IOZ A;  3LSJ A;  1ORK A;  1UI6 A;  2DG7 A;  3DEW A;  3NNR A;  4MO7 A;  2X6O A;  4D5F A;  3COL A;  2G0E A;  2XGC A;  2FBQ A;  3QKX A;  2UXH A;  2UXI A;  4W1U A;  2XPU A;  4GCT A;  2XGD A;  4AUX A;  3ANP A;  3BR6 A;  5FMP A;  3DCF A;  1JUM A;  3B6C A;  3KZ9 A;  4GCL A;  5D1R A;  2G3B A;  3ON4 A;  2Y30 A;  1U9O A;  2EH3 A;  3CJD A;  4I6Z A;  3Q3S A;  1QPI A;  1RPW A;  5D18 A;  3G56 A;  4X1E A;  5FHP A;  2D6Y A;  4DW6 A;  2Y31 A;  3IH4 A;  3ZQI A;  3IH3 A;  3T6N A;  3FK6 A;  4NEL A;  3F0C A;  2GFN A;  3KKC A;  2TCT A;  3VVX A;  2ID6 A;  4M3G A;  4M3D A;  2OER A;  1JUP A;  1ZK8 A;  5IOY A;  5C4Y A;  3IH2 A;  3LSP A;  5GP9 A;  4NN1 A;  5CXG A;  5J1U A;  4V2F A;  2ZB9 A;  3Q0U A;  2F07 A;  3BR0 A;  2NP3 A;  3G1O A;  2HXI A;  2XDN A;  1QVT A;  1Z77 A;  3IUV A;  2WGB A;  2YVH A;  4G12 A;  4V2G A;  3ON2 A;  3VVZ A;  3CCY A;  5K7Z A;  2DG8 A;  4M3E A;  5HSZ A;  3VUQ A;  3NRG A;  1JT0 A;  2IEK A;  4MK6 A;  3FRQ A;  3GZI A;  3RD3 A;  3Q0W A;  3NPI A;  2TRT A;  2QCO A;  3WHB A;  2WUI A;  4GFK A;  3DPJ A;  2QTQ A;  2XB5 A;  1JTX A;  3SFI A;  5F0F A;  2NX4 A;  3ZQF A;  3KNW A;  3Q0V A;  3FIW A;  3MNL A;  4D5C A;  5CW8 A;  3NI7 A;  4W97 A;  2PBX A;  3VVY A;  3EGQ A;  3HGY A;  2JJ7 A;  2VPR A;  2ZOZ A;  2IBD A;  3LOC A;  1RKW A;  2G7S A; 
#chains in the Genus database with same CATH topology
 4M3B A;  5EYR A;  3PM1 A;  4JKZ A;  2UXP A;  3HIM A;  2OI8 A;  3VW0 A;  5K7H A;  2NS7 A;  4U9L A;  5F27 A;  2PZ9 A;  3SDG A;  5FKO A;  3NXC A;  2W53 A;  3BHQ A;  5GPC A;  3DU6 A;  3GEU A;  4ACI A;  2R7O A;  3BQZ A;  4CGR A;  4IRV A;  2WV1 A;  3E7Q A;  1Z0X A;  5J1R A;  2YVE A;  4L62 A;  3S5R A;  3QQA A;  2VKE A;  2FQ4 A;  3ANG A;  3VOK A;  3LHQ A;  4HKU A;  1U9N A;  4PXI A;  2GBY A;  2HYJ A;  3BR2 A;  2GUH A;  2O7T A;  3NS4 A;  3BTJ A;  2GEN A;  5J1Y A;  3HGG A;  5J3L A;  3CWR A;  3O60 A;  4I76 A;  4C2M A;  2ID3 A;  5IPA A;  2RAE A;  2ZCN A;  4GFL A;  1UI5 A;  3PAS A;  2G7L A;  3BT9 A;  2Y2Z A;  3BTL A;  3VIB A;  2QKO A;  3TP0 A;  2UXU A;  2FD5 A;  4B1R A;  2XRL A;  3CRJ A;  2NS8 A;  4AF5 A;  3BTI A;  2QOP A;  5F1J A;  3EUP A;  5FKN A;  3VW2 A;  3G1L A;  2RHA A;  3C07 A;  3B6A A;  4JYK A;  5K7F A;  4M3F A;  1A6I A;  3QBM A;  2QIB A;  3BJB A;  2R7Q A;  2R7V A;  2G7G A;  2XPW A;  2ZOY A;  3JSJ A;  5F0C A;  5HBU A;  4JL3 A;  5CXI A;  2V57 A;  1VI0 A;  3PPB A;  5FKK A;  3ZQH A;  4MXM A;  3AQS A;  3LSR A;  2OPT A;  1JTY A;  2HYT A;  3O8H A;  2ZCX A;  3HE0 A;  3O8G A;  4ICH A;  4D7M A;  3RH2 A;  5K58 A;  1SGM A;  3F1B A;  2VKV A;  3CDL A;  5GPA A;  3C2B A;  1JT6 A;  4B3A A;  2IAI A;  3KKD A;  5H9T A;  2HQ5 A;  3G7R A;  1T33 A;  3HTJ A;  4GCK A;  5F0H A;  2RAS A;  2R7R A;  3MVP A;  5EZG A;  5F04 A;  4OD5 A;  4ME9 A;  3HTH A;  3TP3 A;  3ZQL A;  1BJZ A;  4AC0 A;  2O7O A;  2X9D A;  3BR3 A;  3AQT A;  3BR5 A;  2DTZ A;  3BRU A;  3B81 A;  2XPV A;  2QWT A;  3BQY A;  2XGE A;  1T56 A;  2NP5 A;  4XK4 A;  2ZCM A;  5EZH A;  5FKL A;  2R7S A;  3VOX A;  3VW1 A;  5IP6 A;  2IU5 A;  3HTA A;  4YZE A;  1ZKG A;  1RKT A;  5F08 A;  3V78 A;  3BNI A;  3BTC A;  2JK3 A;  3ZQG A;  5AQC A;  4D7N A;  3DU5 A;  2A2F X;  3G1M A;  3BR1 A;  5FKM A;  3K8P C;  3BCG A;  3LWJ A;  2HKU A;  3VPR A;  2R7U A;  3V6G A;  3WHC A;  2Q24 A;  4ABZ A;  5DAJ A;  3LJL A;  5HAW A;  2HXO A;  4UDS A;  3SWH A;  5D19 A;  4AC6 A;  1JUS A;  3QPS A;  5FGL A;  2REK A;  1QVU A;  3P9T A;  4KWA A;  4JNN A;  2OF7 A;  2FJI 1;  3HTI A;  2FX0 A;  2I10 A;  3FK7 A;  2FJ1 A;  2PFV A;  5EFY A;  3QPL A;  2UXO A;  3VP5 A;  5IOZ A;  3LSJ A;  1ORK A;  1UI6 A;  2DG7 A;  3DEW A;  3NNR A;  4MO7 A;  2X6O A;  4D5F A;  3COL A;  2G0E A;  2XGC A;  2FBQ A;  3QKX A;  2UXH A;  4OD4 A;  2UXI A;  4W1U A;  2XPU A;  4GCT A;  2XGD A;  4AUX A;  3ANP A;  2B3W A;  3KYL A;  3BR6 A;  5FMP A;  3DCF A;  1JUM A;  3B6C A;  3KZ9 A;  4GCL A;  5D1R A;  2G3B A;  3ON4 A;  3FHN A;  4DVY P;  2Y30 A;  1U9O A;  2EH3 A;  3CJD A;  4I6Z A;  2YVX A;  3Q3S A;  1QPI A;  1RPW A;  5D18 A;  3G56 A;  4X1E A;  5FHP A;  2D6Y A;  4DW6 A;  2Y31 A;  3IH4 A;  3ZQI A;  3IH3 A;  3T6N A;  3FK6 A;  4NEL A;  3F0C A;  2GFN A;  2ZY9 A;  3KKC A;  2R7T A;  2TCT A;  3VVX A;  2ID6 A;  4M3G A;  4M3D A;  2OER A;  1JUP A;  1ZK8 A;  5IOY A;  5C4Y A;  3IH2 A;  3LSP A;  5GP9 A;  3VTI A;  4NN1 A;  5CXG A;  5J1U A;  4V2F A;  2ZB9 A;  3Q0U A;  2F07 A;  2R7X A;  3BR0 A;  2NP3 A;  3G1O A;  2HXI A;  2XDN A;  1QVT A;  1Z77 A;  3IUV A;  2B1E A;  2WGB A;  2YVH A;  4G12 A;  4V2G A;  3ON2 A;  3VVZ A;  3CCY A;  5K7Z A;  2DG8 A;  4M3E A;  5HSZ A;  3VUQ A;  3NRG A;  1JT0 A;  2IEK A;  4MK6 A;  3FRQ A;  3GZI A;  3RD3 A;  3Q0W A;  3NPI A;  2TRT A;  4U9N A;  4WIB A;  2QCO A;  3WHB A;  2WUI A;  4GFK A;  3DPJ A;  2QTQ A;  2R7W A;  2XB5 A;  1JTX A;  3SFI A;  5F0F A;  2NX4 A;  3ZQF A;  3KNW A;  5CQG A;  3Q0V A;  3FIW A;  3MNL A;  4D5C A;  5CW8 A;  3NI7 A;  4W97 A;  2PBX A;  3VVY A;  3EGQ A;  3HGY A;  2JJ7 A;  2VPR A;  2ZOZ A;  2IBD A;  3LOC A;  1RKW A;  2G7S A; 
#chains in the Genus database with same CATH homology
 4M3B A;  5EYR A;  3PM1 A;  4JKZ A;  2UXP A;  3HIM A;  2OI8 A;  3VW0 A;  5K7H A;  2NS7 A;  5F27 A;  2PZ9 A;  3SDG A;  5FKO A;  3NXC A;  2W53 A;  3BHQ A;  5GPC A;  3GEU A;  4ACI A;  3BQZ A;  4CGR A;  2WV1 A;  3E7Q A;  1Z0X A;  5J1R A;  2YVE A;  4L62 A;  3S5R A;  3QQA A;  2VKE A;  2FQ4 A;  3ANG A;  3VOK A;  3LHQ A;  4HKU A;  1U9N A;  4PXI A;  2GBY A;  2HYJ A;  3BR2 A;  2GUH A;  2O7T A;  3BTJ A;  2GEN A;  5J1Y A;  3HGG A;  5J3L A;  3CWR A;  3O60 A;  4I76 A;  2ID3 A;  5IPA A;  2RAE A;  2ZCN A;  4GFL A;  1UI5 A;  3PAS A;  2G7L A;  3BT9 A;  2Y2Z A;  3BTL A;  3VIB A;  2QKO A;  3TP0 A;  2UXU A;  2FD5 A;  4B1R A;  2XRL A;  3CRJ A;  2NS8 A;  4AF5 A;  3BTI A;  2QOP A;  5F1J A;  3EUP A;  5FKN A;  3VW2 A;  3G1L A;  2RHA A;  3C07 A;  3B6A A;  4JYK A;  5K7F A;  4M3F A;  1A6I A;  3QBM A;  2QIB A;  3BJB A;  2G7G A;  2XPW A;  2ZOY A;  3JSJ A;  5F0C A;  5HBU A;  4JL3 A;  5CXI A;  2V57 A;  1VI0 A;  3PPB A;  5FKK A;  3ZQH A;  4MXM A;  3AQS A;  3LSR A;  2OPT A;  1JTY A;  2HYT A;  3O8H A;  2ZCX A;  3HE0 A;  3O8G A;  4ICH A;  4D7M A;  3RH2 A;  5K58 A;  1SGM A;  3F1B A;  2VKV A;  3CDL A;  5GPA A;  3C2B A;  1JT6 A;  4B3A A;  2IAI A;  3KKD A;  5H9T A;  2HQ5 A;  3G7R A;  1T33 A;  3HTJ A;  4GCK A;  5F0H A;  2RAS A;  3MVP A;  5EZG A;  5F04 A;  4ME9 A;  3HTH A;  3TP3 A;  3ZQL A;  1BJZ A;  4AC0 A;  2O7O A;  2X9D A;  3BR3 A;  3AQT A;  3BR5 A;  2DTZ A;  3BRU A;  3B81 A;  2XPV A;  2QWT A;  3BQY A;  2XGE A;  1T56 A;  2NP5 A;  4XK4 A;  2ZCM A;  5EZH A;  5FKL A;  3VW1 A;  3VOX A;  5IP6 A;  2IU5 A;  3HTA A;  4YZE A;  1ZKG A;  1RKT A;  5F08 A;  3V78 A;  3BNI A;  3BTC A;  2JK3 A;  3ZQG A;  5AQC A;  4D7N A;  3G1M A;  3BR1 A;  5FKM A;  3BCG A;  3LWJ A;  2HKU A;  3VPR A;  3V6G A;  3WHC A;  2Q24 A;  4ABZ A;  5DAJ A;  3LJL A;  5HAW A;  2HXO A;  4UDS A;  5D19 A;  4AC6 A;  1JUS A;  3QPS A;  5FGL A;  2REK A;  1QVU A;  3P9T A;  4KWA A;  4JNN A;  2OF7 A;  3HTI A;  2FX0 A;  2I10 A;  3FK7 A;  2FJ1 A;  5EFY A;  3QPL A;  2UXO A;  3VP5 A;  5IOZ A;  3LSJ A;  1ORK A;  1UI6 A;  2DG7 A;  3DEW A;  3NNR A;  4MO7 A;  2X6O A;  4D5F A;  3COL A;  2G0E A;  2XGC A;  2FBQ A;  3QKX A;  2UXH A;  2UXI A;  4W1U A;  2XPU A;  4GCT A;  2XGD A;  4AUX A;  3ANP A;  3BR6 A;  5FMP A;  3DCF A;  1JUM A;  3B6C A;  3KZ9 A;  4GCL A;  5D1R A;  2G3B A;  3ON4 A;  2Y30 A;  1U9O A;  2EH3 A;  3CJD A;  4I6Z A;  3Q3S A;  1QPI A;  1RPW A;  5D18 A;  3G56 A;  4X1E A;  5FHP A;  2D6Y A;  4DW6 A;  2Y31 A;  3IH4 A;  3ZQI A;  3IH3 A;  3T6N A;  3FK6 A;  4NEL A;  3F0C A;  2GFN A;  3KKC A;  2TCT A;  3VVX A;  2ID6 A;  4M3G A;  4M3D A;  2OER A;  1JUP A;  1ZK8 A;  5IOY A;  5C4Y A;  3IH2 A;  3LSP A;  5GP9 A;  4NN1 A;  5CXG A;  5J1U A;  4V2F A;  2ZB9 A;  3Q0U A;  2F07 A;  3BR0 A;  2NP3 A;  3G1O A;  2HXI A;  2XDN A;  1QVT A;  1Z77 A;  3IUV A;  2WGB A;  2YVH A;  4G12 A;  4V2G A;  3ON2 A;  3VVZ A;  3CCY A;  5K7Z A;  2DG8 A;  4M3E A;  5HSZ A;  3VUQ A;  3NRG A;  1JT0 A;  2IEK A;  4MK6 A;  3FRQ A;  3GZI A;  3RD3 A;  3Q0W A;  3NPI A;  2TRT A;  2QCO A;  3WHB A;  2WUI A;  4GFK A;  3DPJ A;  2QTQ A;  2XB5 A;  1JTX A;  3SFI A;  5F0F A;  2NX4 A;  3ZQF A;  3KNW A;  3Q0V A;  3FIW A;  3MNL A;  4D5C A;  5CW8 A;  3NI7 A;  4W97 A;  2PBX A;  3VVY A;  3EGQ A;  3HGY A;  2JJ7 A;  2VPR A;  2ZOZ A;  2IBD A;  3LOC A;  1RKW A;  2G7S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...