3JSJA

Crystal structure of a putative tetr-transcriptional regulator (sav143) from streptomyces avermitilis ma-4680 at 2.10 a resolution
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
184
structure length
184
Chain Sequence
KQSPRERLLEAAAALTYRDGVGIGVEALCKAAGVSKRSMYQLFESKDELLAASLKERSAAFVAKALPPADDGRSPRERILYVFERVESQAGAPDFQGCRYLAVQIELKDQAHPASRVAYQIKADLMAFFRSEAERGGASDPDLLARQLILVFDGASARAGIGADNLTGLIVPTLTTLLDAADMH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative TetR-family transcriptional regulator
publication title Crystal structure of Putative transcriptional regulator (NP_821317.1) from Streptomyces avermitilis MA-4680 at 2.10 A resolution
rcsb
source organism Streptomyces avermitilis ma-4680
molecule tags Transcription
total genus 68
structure length 184
sequence length 184
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3jsjA00
3QQAA 3F1BA 3AQSA 3EGQA 3DPJA 3FK6A 3C07A 3BTIA 3HE0A 4D7MA 1QVUA 2JJ7A 3B81A 3BT9A 2IEKA 4MXMA 2XGEA 1Z0XA 2Y2ZA 3LSJA 3ANGA 5EYRA 4AC0A 2ID6A 3NI7A 3VUQA 5CW8A 1UI6A 2OF7A 4JYKA 2VPRA 3FIWA 3KNWA 3DEWA 3O60A 2PBXA 2OPTA 3G1OA 3VP5A 2EH3A 3COLA 3IH2A 3QPLA 5K7ZA 4YZEA 3BTCA 3IH3A 2YVHA 3BJBA 1JUPA 3HTHA 2UXHA 2XB5A 5FKNA 3HIMA 5F08A 3PM1A 3CWRA 3B6AA 3GZIA 2QTQA 3NPIA 3PASA 3BQZA 2VKVA 5K7HA 2F07A 2NS7A 3FK7A 3VOKA 2WGBA 5C4YA 5IOZA 4M3GA 5HAWA 4B3AA 5EZHA 2FBQA 4G12A 1ORKA 1JUMA 2ZCMA 5FHPA 4HKUA 3VPRA 2WV1A 5GPAA 3CRJA 4NN1A 5FKOA 4KWAA 5D18A 3MNLA 2W53A 3BTLA 3S5RA 2UXUA 5AQCA 2HYJA 4GFLA 2WUIA 2JK3A 4PXIA 1ZKGA 3BQYA 5CXIA 1RKTA 1JTXA 2X9DA 3VW1A 3TP0A 4AUXA 3BR6A 3ON4A 2YVEA 2XGDA 2OERA 3HTJA 3V78A 3BNIA 2NS8A 2XGCA 3IUVA 5F0HA 4I6ZA 4D7NA 3KKCA 3VOXA 4ABZA 1JT0A 3CJDA 3VVXA 2QKOA 3DCFA 3BR2A 4CGRA 3Q3SA 3T6NA 1U9NA 3GEUA 2X6OA 5HBUA 3BR1A 4X1EA 2FD5A 4GCTA 4ICHA 2UXIA 3ZQGA 4M3FA 2TRTA 1T33A 1ZK8A 3O8GA 3QBMA 2Y30A 2OI8A 2DG7A 4ACIA 5F0FA 2ZCXA 2TCTA 4GCKA 3TP3A 4I76A 3G56A 4GFKA 4V2FA 5DAJA 1JUSA 4ME9A 2IBDA 2REKA 3ZQIA 4NELA 2G0EA 5J1RA 1RKWA 3F0CA 3WHBA 3C2BA 2RASA 2XPWA 1QPIA 5FMPA 3CDLA 5EFYA 4DW6A 4GCLA 5IPAA 3G1LA 3JSJA 2O7OA 2FX0A 1BJZA 4AF5A 2ZOYA 4MK6A 3ON2A 5HSZA 3VVYA 3KZ9A 3KKDA 2HXIA 3LJLA 3LSPA 2QOPA 2QIBA 2RAEA 5F27A 4M3BA 4M3EA 2NP3A 2XDNA 2Y31A 5K7FA 3WHCA 1VI0A 3QPSA 3NRGA 5FKLA 4L62A 1T56A 5F04A 2G7SA 3ZQLA 1UI5A 2ID3A 3CCYA 2NP5A 1JT6A 2ZCNA 3G7RA 4JNNA 2V57A 4AC6A 1RPWA 2I10A 3BCGA 2HQ5A 3IH4A 2DG8A 4M3DA 2GFNA 5CXGA 2QWTA 3NXCA 5GP9A 3HTIA 4XK4A 2ZOZA 4JKZA 4D5CA 4V2GA 3BR5A 5EZGA 1Z77A 2FQ4A 5GPCA 5D19A 2XPVA 2GBYA 3HGGA 2G7LA 2HYTA 2G3BA 3RD3A 4W97A 5FKMA 3BR0A 1U9OA 3VIBA 2IU5A 3FRQA 5J3LA 2NX4A 3QKXA 1A6IA 2XRLA 3Q0UA 3MVPA 3ANPA 3LWJA 3O8HA 2RHAA 3BR3A 3SFIA 3ZQFA 3ZQHA 4UDSA 2DTZA 2XPUA 1SGMA 1QVTA 3Q0VA 2PZ9A 3LSRA 3BHQA 2QCOA 3SDGA 4D5FA 2D6YA 3BRUA 4JL3A 5IOYA 4W1UA 2HKUA 3LOCA 3Q0WA 4B1RA 5FGLA 5IP6A 3BTJA 2VKEA 2GENA 3LHQA 2G7GA 3P9TA 3VW2A 2HXOA 5F0CA 3B6CA 3EUPA 5J1YA 3HTAA 3G1MA 5F1JA 3AQTA 3E7QA 3VVZA 3RH2A 5D1RA 2O7TA 5J1UA 2Q24A 5K58A 4MO7A 2GUHA 3HGYA 2ZB9A 2IAIA 5H9TA 2UXOA 3PPBA 1JTYA 2UXPA 5FKKA 3NNRA 3VW0A 2FJ1A 3V6GA
chains in the Genus database with same CATH superfamily
3QQAA 3F1BA 3AQSA 3EGQA 3DPJA 3FK6A 3C07A 3BTIA 3HE0A 4D7MA 1QVUA 2JJ7A 3B81A 3BT9A 2IEKA 4OD4A 4MXMA 4DVYP 2XGEA 1Z0XA 2Y2ZA 3LSJA 3ANGA 5EYRA 4AC0A 2ID6A 3NI7A 3VUQA 5CW8A 1UI6A 2OF7A 3K8PC 4JYKA 2VPRA 3FIWA 3KNWA 3DEWA 3O60A 2PBXA 2OPTA 3G1OA 3VP5A 3NS4A 2EH3A 3COLA 3IH2A 3QPLA 5K7ZA 4YZEA 3BTCA 3IH3A 2YVHA 3BJBA 1JUPA 3HTHA 2UXHA 2XB5A 5FKNA 3HIMA 5F08A 3PM1A 3CWRA 3B6AA 3GZIA 2QTQA 3NPIA 3PASA 3BQZA 2VKVA 5K7HA 2F07A 2NS7A 3FK7A 4IRVA 3VOKA 2WGBA 5C4YA 5IOZA 4M3GA 5HAWA 4B3AA 5EZHA 2R7RA 2FBQA 4U9LA 4G12A 1ORKA 1JUMA 2ZCMA 5FHPA 4HKUA 3DU5A 3VPRA 2WV1A 5GPAA 3CRJA 4OD5A 3KYLA 4NN1A 5FKOA 4KWAA 5D18A 3MNLA 2W53A 3BTLA 3S5RA 2UXUA 5AQCA 2HYJA 2B1EA 4GFLA 2WUIA 2JK3A 4PXIA 1ZKGA 3BQYA 5CXIA 1RKTA 1JTXA 2X9DA 3VW1A 3TP0A 4AUXA 3BR6A 3ON4A 2YVEA 2XGDA 2OERA 3VTIA 3HTJA 3V78A 3BNIA 3SWHA 2NS8A 2XGCA 3IUVA 5F0HA 4I6ZA 4D7NA 3KKCA 3VOXA 4ABZA 1JT0A 3CJDA 3VVXA 2QKOA 3DCFA 3BR2A 4CGRA 3Q3SA 3T6NA 1U9NA 3GEUA 2X6OA 5HBUA 3BR1A 4X1EA 2FD5A 4GCTA 4ICHA 2UXIA 4M3FA 3ZQGA 2TRTA 1T33A 1ZK8A 3O8GA 3QBMA 2Y30A 2OI8A 2DG7A 4ACIA 5F0FA 2ZCXA 2TCTA 4GCKA 3TP3A 4I76A 3G56A 4GFKA 4V2FA 5DAJA 1JUSA 4ME9A 2IBDA 2REKA 3ZQIA 4NELA 2G0EA 5J1RA 1RKWA 3F0CA 2R7TA 3WHBA 3C2BA 2RASA 2XPWA 1QPIA 5FMPA 2YVXA 3CDLA 5EFYA 4DW6A 4GCLA 5IPAA 3JSJA 3G1LA 2O7OA 2FX0A 1BJZA 4AF5A 2ZOYA 4MK6A 3ON2A 5HSZA 3VVYA 3KZ9A 2R7OA 3KKDA 2HXIA 3LJLA 3LSPA 2QOPA 2QIBA 2RAEA 5F27A 4M3BA 4M3EA 2NP3A 2XDNA 2Y31A 5K7FA 3WHCA 1VI0A 3QPSA 3NRGA 2R7XA 5FKLA 4L62A 1T56A 5F04A 2G7SA 3ZQLA 1UI5A 2ID3A 3CCYA 2NP5A 1JT6A 2ZCNA 3G7RA 4JNNA 2V57A 4AC6A 1RPWA 2I10A 3BCGA 2HQ5A 3IH4A 2DG8A 4M3DA 2GFNA 4U9NA 5CXGA 2QWTA 3NXCA 5GP9A 3HTIA 4XK4A 2ZOZA 4JKZA 4D5CA 4V2GA 3BR5A 5EZGA 1Z77A 2FQ4A 5GPCA 5D19A 2XPVA 2GBYA 3HGGA 2G7LA 4WIBA 2HYTA 2G3BA 3RD3A 4W97A 5FKMA 3BR0A 1U9OA 3VIBA 2IU5A 3FRQA 5J3LA 2NX4A 3QKXA 2ZY9A 1A6IA 2XRLA 3Q0UA 3MVPA 3ANPA 2PFVA 3LWJA 3O8HA 2RHAA 3BR3A 3SFIA 3ZQFA 3ZQHA 4UDSA 2DTZA 2XPUA 1SGMA 1QVTA 2R7QA 3Q0VA 2PZ9A 3LSRA 3BHQA 2QCOA 3SDGA 4D5FA 2D6YA 3BRUA 4JL3A 5IOYA 4W1UA 2HKUA 3LOCA 3Q0WA 4B1RA 5FGLA 5IP6A 3BTJA 5CQGA 2A2FX 2VKEA 2GENA 3LHQA 2G7GA 3P9TA 3VW2A 2HXOA 5F0CA 2R7VA 3B6CA 3EUPA 5J1YA 3HTAA 2FJI1 3G1MA 5F1JA 3AQTA 3E7QA 2R7SA 3VVZA 3RH2A 5D1RA 2B3WA 2O7TA 5J1UA 2Q24A 5K58A 4MO7A 2GUHA 3HGYA 2ZB9A 2IAIA 5H9TA 2UXOA 2R7UA 3PPBA 1JTYA 2UXPA 5FKKA 3DU6A 3NNRA 4C2MA 2R7WA 3VW0A 3FHNA 2FJ1A 3V6GA
chains in the Genus database with same CATH topology
3QQAA 3F1BA 3AQSA 3EGQA 3DPJA 3FK6A 3C07A 3BTIA 3HE0A 4D7MA 1QVUA 2JJ7A 3B81A 3BT9A 2IEKA 4MXMA 2XGEA 1Z0XA 2Y2ZA 3LSJA 3ANGA 5EYRA 4AC0A 2ID6A 3NI7A 3VUQA 5CW8A 1UI6A 2OF7A 4JYKA 2VPRA 3FIWA 3KNWA 3DEWA 3O60A 2PBXA 2OPTA 3G1OA 3VP5A 2EH3A 3COLA 3IH2A 3QPLA 5K7ZA 4YZEA 3BTCA 3IH3A 2YVHA 3BJBA 1JUPA 3HTHA 2UXHA 2XB5A 5FKNA 3HIMA 5F08A 3PM1A 3CWRA 3B6AA 3GZIA 2QTQA 3NPIA 3PASA 3BQZA 2VKVA 5K7HA 2F07A 2NS7A 3FK7A 3VOKA 2WGBA 5C4YA 5IOZA 4M3GA 5HAWA 4B3AA 5EZHA 2FBQA 4G12A 1ORKA 1JUMA 2ZCMA 5FHPA 4HKUA 3VPRA 2WV1A 5GPAA 3CRJA 4NN1A 5FKOA 4KWAA 5D18A 3MNLA 2W53A 3BTLA 3S5RA 2UXUA 5AQCA 2HYJA 4GFLA 2WUIA 2JK3A 4PXIA 1ZKGA 3BQYA 5CXIA 1RKTA 1JTXA 2X9DA 3VW1A 3TP0A 4AUXA 3BR6A 3ON4A 2YVEA 2XGDA 2OERA 3HTJA 3V78A 3BNIA 2NS8A 2XGCA 3IUVA 5F0HA 4I6ZA 4D7NA 3KKCA 3VOXA 4ABZA 1JT0A 3CJDA 3VVXA 2QKOA 3DCFA 3BR2A 4CGRA 3Q3SA 3T6NA 1U9NA 3GEUA 2X6OA 5HBUA 3BR1A 4X1EA 2FD5A 4GCTA 4ICHA 2UXIA 3ZQGA 4M3FA 2TRTA 1T33A 1ZK8A 3O8GA 3QBMA 2Y30A 2OI8A 2DG7A 4ACIA 5F0FA 2ZCXA 2TCTA 4GCKA 3TP3A 4I76A 3G56A 4GFKA 4V2FA 5DAJA 1JUSA 4ME9A 2IBDA 2REKA 3ZQIA 4NELA 2G0EA 5J1RA 1RKWA 3F0CA 3WHBA 3C2BA 2RASA 2XPWA 1QPIA 5FMPA 3CDLA 5EFYA 4DW6A 4GCLA 5IPAA 3G1LA 3JSJA 2O7OA 2FX0A 1BJZA 4AF5A 2ZOYA 4MK6A 3ON2A 5HSZA 3VVYA 3KZ9A 3KKDA 2HXIA 3LJLA 3LSPA 2QOPA 2QIBA 2RAEA 5F27A 4M3BA 4M3EA 2NP3A 2XDNA 2Y31A 5K7FA 3WHCA 1VI0A 3QPSA 3NRGA 5FKLA 4L62A 1T56A 5F04A 2G7SA 3ZQLA 1UI5A 2ID3A 3CCYA 2NP5A 1JT6A 2ZCNA 3G7RA 4JNNA 2V57A 4AC6A 1RPWA 2I10A 3BCGA 2HQ5A 3IH4A 2DG8A 4M3DA 2GFNA 5CXGA 2QWTA 3NXCA 5GP9A 3HTIA 4XK4A 2ZOZA 4JKZA 4D5CA 4V2GA 3BR5A 5EZGA 1Z77A 2FQ4A 5GPCA 5D19A 2XPVA 2GBYA 3HGGA 2G7LA 2HYTA 2G3BA 3RD3A 4W97A 5FKMA 3BR0A 1U9OA 3VIBA 2IU5A 3FRQA 5J3LA 2NX4A 3QKXA 1A6IA 2XRLA 3Q0UA 3MVPA 3ANPA 3LWJA 3O8HA 2RHAA 3BR3A 3SFIA 3ZQFA 3ZQHA 4UDSA 2DTZA 2XPUA 1SGMA 1QVTA 3Q0VA 2PZ9A 3LSRA 3BHQA 2QCOA 3SDGA 4D5FA 2D6YA 3BRUA 4JL3A 5IOYA 4W1UA 2HKUA 3LOCA 3Q0WA 4B1RA 5FGLA 5IP6A 3BTJA 2VKEA 2GENA 3LHQA 2G7GA 3P9TA 3VW2A 2HXOA 5F0CA 3B6CA 3EUPA 5J1YA 3HTAA 3G1MA 5F1JA 3AQTA 3E7QA 3VVZA 3RH2A 5D1RA 2O7TA 5J1UA 2Q24A 5K58A 4MO7A 2GUHA 3HGYA 2ZB9A 2IAIA 5H9TA 2UXOA 3PPBA 1JTYA 2UXPA 5FKKA 3NNRA 3VW0A 2FJ1A 3V6GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QQA A;  3F1B A;  3AQS A;  3EGQ A;  3DPJ A;  3FK6 A;  3C07 A;  3BTI A;  3HE0 A;  4D7M A;  1QVU A;  2JJ7 A;  3B81 A;  3BT9 A;  2IEK A;  4MXM A;  2XGE A;  1Z0X A;  2Y2Z A;  3LSJ A;  3ANG A;  5EYR A;  4AC0 A;  2ID6 A;  3NI7 A;  3VUQ A;  5CW8 A;  1UI6 A;  2OF7 A;  4JYK A;  2VPR A;  3FIW A;  3KNW A;  3DEW A;  3O60 A;  2PBX A;  2OPT A;  3G1O A;  3VP5 A;  2EH3 A;  3COL A;  3IH2 A;  3QPL A;  5K7Z A;  4YZE A;  3BTC A;  3IH3 A;  2YVH A;  3BJB A;  1JUP A;  3HTH A;  2UXH A;  2XB5 A;  5FKN A;  3HIM A;  5F08 A;  3PM1 A;  3CWR A;  3B6A A;  3GZI A;  2QTQ A;  3NPI A;  3PAS A;  3BQZ A;  2VKV A;  5K7H A;  2F07 A;  2NS7 A;  3FK7 A;  3VOK A;  2WGB A;  5C4Y A;  5IOZ A;  4M3G A;  5HAW A;  4B3A A;  5EZH A;  2FBQ A;  4G12 A;  1ORK A;  1JUM A;  2ZCM A;  5FHP A;  4HKU A;  3VPR A;  2WV1 A;  5GPA A;  3CRJ A;  4NN1 A;  5FKO A;  4KWA A;  5D18 A;  3MNL A;  2W53 A;  3BTL A;  3S5R A;  2UXU A;  5AQC A;  2HYJ A;  4GFL A;  2WUI A;  2JK3 A;  4PXI A;  1ZKG A;  3BQY A;  5CXI A;  1RKT A;  1JTX A;  2X9D A;  3VW1 A;  3TP0 A;  4AUX A;  3BR6 A;  3ON4 A;  2YVE A;  2XGD A;  2OER A;  3HTJ A;  3V78 A;  3BNI A;  2NS8 A;  2XGC A;  3IUV A;  5F0H A;  4I6Z A;  4D7N A;  3KKC A;  3VOX A;  4ABZ A;  1JT0 A;  3CJD A;  3VVX A;  2QKO A;  3DCF A;  3BR2 A;  4CGR A;  3Q3S A;  3T6N A;  1U9N A;  3GEU A;  2X6O A;  5HBU A;  3BR1 A;  4X1E A;  2FD5 A;  4GCT A;  4ICH A;  2UXI A;  3ZQG A;  4M3F A;  2TRT A;  1T33 A;  1ZK8 A;  3O8G A;  3QBM A;  2Y30 A;  2OI8 A;  2DG7 A;  4ACI A;  5F0F A;  2ZCX A;  2TCT A;  4GCK A;  3TP3 A;  4I76 A;  3G56 A;  4GFK A;  4V2F A;  5DAJ A;  1JUS A;  4ME9 A;  2IBD A;  2REK A;  3ZQI A;  4NEL A;  2G0E A;  5J1R A;  1RKW A;  3F0C A;  3WHB A;  3C2B A;  2RAS A;  2XPW A;  1QPI A;  5FMP A;  3CDL A;  5EFY A;  4DW6 A;  4GCL A;  5IPA A;  3G1L A;  3JSJ A;  2O7O A;  2FX0 A;  1BJZ A;  4AF5 A;  2ZOY A;  4MK6 A;  3ON2 A;  5HSZ A;  3VVY A;  3KZ9 A;  3KKD A;  2HXI A;  3LJL A;  3LSP A;  2QOP A;  2QIB A;  2RAE A;  5F27 A;  4M3B A;  4M3E A;  2NP3 A;  2XDN A;  2Y31 A;  5K7F A;  3WHC A;  1VI0 A;  3QPS A;  3NRG A;  5FKL A;  4L62 A;  1T56 A;  5F04 A;  2G7S A;  3ZQL A;  1UI5 A;  2ID3 A;  3CCY A;  2NP5 A;  1JT6 A;  2ZCN A;  3G7R A;  4JNN A;  2V57 A;  4AC6 A;  1RPW A;  2I10 A;  3BCG A;  2HQ5 A;  3IH4 A;  2DG8 A;  4M3D A;  2GFN A;  5CXG A;  2QWT A;  3NXC A;  5GP9 A;  3HTI A;  4XK4 A;  2ZOZ A;  4JKZ A;  4D5C A;  4V2G A;  3BR5 A;  5EZG A;  1Z77 A;  2FQ4 A;  5GPC A;  5D19 A;  2XPV A;  2GBY A;  3HGG A;  2G7L A;  2HYT A;  2G3B A;  3RD3 A;  4W97 A;  5FKM A;  3BR0 A;  1U9O A;  3VIB A;  2IU5 A;  3FRQ A;  5J3L A;  2NX4 A;  3QKX A;  1A6I A;  2XRL A;  3Q0U A;  3MVP A;  3ANP A;  3LWJ A;  3O8H A;  2RHA A;  3BR3 A;  3SFI A;  3ZQF A;  3ZQH A;  4UDS A;  2DTZ A;  2XPU A;  1SGM A;  1QVT A;  3Q0V A;  2PZ9 A;  3LSR A;  3BHQ A;  2QCO A;  3SDG A;  4D5F A;  2D6Y A;  3BRU A;  4JL3 A;  5IOY A;  4W1U A;  2HKU A;  3LOC A;  3Q0W A;  4B1R A;  5FGL A;  5IP6 A;  3BTJ A;  2VKE A;  2GEN A;  3LHQ A;  2G7G A;  3P9T A;  3VW2 A;  2HXO A;  5F0C A;  3B6C A;  3EUP A;  5J1Y A;  3HTA A;  3G1M A;  5F1J A;  3AQT A;  3E7Q A;  3VVZ A;  3RH2 A;  5D1R A;  2O7T A;  5J1U A;  2Q24 A;  5K58 A;  4MO7 A;  2GUH A;  3HGY A;  2ZB9 A;  2IAI A;  5H9T A;  2UXO A;  3PPB A;  1JTY A;  2UXP A;  5FKK A;  3NNR A;  3VW0 A;  2FJ1 A;  3V6G A; 
#chains in the Genus database with same CATH topology
 3QQA A;  3F1B A;  3AQS A;  3EGQ A;  3DPJ A;  3FK6 A;  3C07 A;  3BTI A;  3HE0 A;  4D7M A;  1QVU A;  2JJ7 A;  3B81 A;  3BT9 A;  2IEK A;  4OD4 A;  4MXM A;  4DVY P;  2XGE A;  1Z0X A;  2Y2Z A;  3LSJ A;  3ANG A;  5EYR A;  4AC0 A;  2ID6 A;  3NI7 A;  3VUQ A;  5CW8 A;  1UI6 A;  2OF7 A;  3K8P C;  4JYK A;  2VPR A;  3FIW A;  3KNW A;  3DEW A;  3O60 A;  2PBX A;  2OPT A;  3G1O A;  3VP5 A;  3NS4 A;  2EH3 A;  3COL A;  3IH2 A;  3QPL A;  5K7Z A;  4YZE A;  3BTC A;  3IH3 A;  2YVH A;  3BJB A;  1JUP A;  3HTH A;  2UXH A;  2XB5 A;  5FKN A;  3HIM A;  5F08 A;  3PM1 A;  3CWR A;  3B6A A;  3GZI A;  2QTQ A;  3NPI A;  3PAS A;  3BQZ A;  2VKV A;  5K7H A;  2F07 A;  2NS7 A;  3FK7 A;  4IRV A;  3VOK A;  2WGB A;  5C4Y A;  5IOZ A;  4M3G A;  5HAW A;  4B3A A;  5EZH A;  2R7R A;  2FBQ A;  4U9L A;  4G12 A;  1ORK A;  1JUM A;  2ZCM A;  5FHP A;  4HKU A;  3DU5 A;  3VPR A;  2WV1 A;  5GPA A;  3CRJ A;  4OD5 A;  3KYL A;  4NN1 A;  5FKO A;  4KWA A;  5D18 A;  3MNL A;  2W53 A;  3BTL A;  3S5R A;  2UXU A;  5AQC A;  2HYJ A;  2B1E A;  4GFL A;  2WUI A;  2JK3 A;  4PXI A;  1ZKG A;  3BQY A;  5CXI A;  1RKT A;  1JTX A;  2X9D A;  3VW1 A;  3TP0 A;  4AUX A;  3BR6 A;  3ON4 A;  2YVE A;  2XGD A;  2OER A;  3VTI A;  3HTJ A;  3V78 A;  3BNI A;  3SWH A;  2NS8 A;  2XGC A;  3IUV A;  5F0H A;  4I6Z A;  4D7N A;  3KKC A;  3VOX A;  4ABZ A;  1JT0 A;  3CJD A;  3VVX A;  2QKO A;  3DCF A;  3BR2 A;  4CGR A;  3Q3S A;  3T6N A;  1U9N A;  3GEU A;  2X6O A;  5HBU A;  3BR1 A;  4X1E A;  2FD5 A;  4GCT A;  4ICH A;  2UXI A;  4M3F A;  3ZQG A;  2TRT A;  1T33 A;  1ZK8 A;  3O8G A;  3QBM A;  2Y30 A;  2OI8 A;  2DG7 A;  4ACI A;  5F0F A;  2ZCX A;  2TCT A;  4GCK A;  3TP3 A;  4I76 A;  3G56 A;  4GFK A;  4V2F A;  5DAJ A;  1JUS A;  4ME9 A;  2IBD A;  2REK A;  3ZQI A;  4NEL A;  2G0E A;  5J1R A;  1RKW A;  3F0C A;  2R7T A;  3WHB A;  3C2B A;  2RAS A;  2XPW A;  1QPI A;  5FMP A;  2YVX A;  3CDL A;  5EFY A;  4DW6 A;  4GCL A;  5IPA A;  3JSJ A;  3G1L A;  2O7O A;  2FX0 A;  1BJZ A;  4AF5 A;  2ZOY A;  4MK6 A;  3ON2 A;  5HSZ A;  3VVY A;  3KZ9 A;  2R7O A;  3KKD A;  2HXI A;  3LJL A;  3LSP A;  2QOP A;  2QIB A;  2RAE A;  5F27 A;  4M3B A;  4M3E A;  2NP3 A;  2XDN A;  2Y31 A;  5K7F A;  3WHC A;  1VI0 A;  3QPS A;  3NRG A;  2R7X A;  5FKL A;  4L62 A;  1T56 A;  5F04 A;  2G7S A;  3ZQL A;  1UI5 A;  2ID3 A;  3CCY A;  2NP5 A;  1JT6 A;  2ZCN A;  3G7R A;  4JNN A;  2V57 A;  4AC6 A;  1RPW A;  2I10 A;  3BCG A;  2HQ5 A;  3IH4 A;  2DG8 A;  4M3D A;  2GFN A;  4U9N A;  5CXG A;  2QWT A;  3NXC A;  5GP9 A;  3HTI A;  4XK4 A;  2ZOZ A;  4JKZ A;  4D5C A;  4V2G A;  3BR5 A;  5EZG A;  1Z77 A;  2FQ4 A;  5GPC A;  5D19 A;  2XPV A;  2GBY A;  3HGG A;  2G7L A;  4WIB A;  2HYT A;  2G3B A;  3RD3 A;  4W97 A;  5FKM A;  3BR0 A;  1U9O A;  3VIB A;  2IU5 A;  3FRQ A;  5J3L A;  2NX4 A;  3QKX A;  2ZY9 A;  1A6I A;  2XRL A;  3Q0U A;  3MVP A;  3ANP A;  2PFV A;  3LWJ A;  3O8H A;  2RHA A;  3BR3 A;  3SFI A;  3ZQF A;  3ZQH A;  4UDS A;  2DTZ A;  2XPU A;  1SGM A;  1QVT A;  2R7Q A;  3Q0V A;  2PZ9 A;  3LSR A;  3BHQ A;  2QCO A;  3SDG A;  4D5F A;  2D6Y A;  3BRU A;  4JL3 A;  5IOY A;  4W1U A;  2HKU A;  3LOC A;  3Q0W A;  4B1R A;  5FGL A;  5IP6 A;  3BTJ A;  5CQG A;  2A2F X;  2VKE A;  2GEN A;  3LHQ A;  2G7G A;  3P9T A;  3VW2 A;  2HXO A;  5F0C A;  2R7V A;  3B6C A;  3EUP A;  5J1Y A;  3HTA A;  2FJI 1;  3G1M A;  5F1J A;  3AQT A;  3E7Q A;  2R7S A;  3VVZ A;  3RH2 A;  5D1R A;  2B3W A;  2O7T A;  5J1U A;  2Q24 A;  5K58 A;  4MO7 A;  2GUH A;  3HGY A;  2ZB9 A;  2IAI A;  5H9T A;  2UXO A;  2R7U A;  3PPB A;  1JTY A;  2UXP A;  5FKK A;  3DU6 A;  3NNR A;  4C2M A;  2R7W A;  3VW0 A;  3FHN A;  2FJ1 A;  3V6G A; 
#chains in the Genus database with same CATH homology
 3QQA A;  3F1B A;  3AQS A;  3EGQ A;  3DPJ A;  3FK6 A;  3C07 A;  3BTI A;  3HE0 A;  4D7M A;  1QVU A;  2JJ7 A;  3B81 A;  3BT9 A;  2IEK A;  4MXM A;  2XGE A;  1Z0X A;  2Y2Z A;  3LSJ A;  3ANG A;  5EYR A;  4AC0 A;  2ID6 A;  3NI7 A;  3VUQ A;  5CW8 A;  1UI6 A;  2OF7 A;  4JYK A;  2VPR A;  3FIW A;  3KNW A;  3DEW A;  3O60 A;  2PBX A;  2OPT A;  3G1O A;  3VP5 A;  2EH3 A;  3COL A;  3IH2 A;  3QPL A;  5K7Z A;  4YZE A;  3BTC A;  3IH3 A;  2YVH A;  3BJB A;  1JUP A;  3HTH A;  2UXH A;  2XB5 A;  5FKN A;  3HIM A;  5F08 A;  3PM1 A;  3CWR A;  3B6A A;  3GZI A;  2QTQ A;  3NPI A;  3PAS A;  3BQZ A;  2VKV A;  5K7H A;  2F07 A;  2NS7 A;  3FK7 A;  3VOK A;  2WGB A;  5C4Y A;  5IOZ A;  4M3G A;  5HAW A;  4B3A A;  5EZH A;  2FBQ A;  4G12 A;  1ORK A;  1JUM A;  2ZCM A;  5FHP A;  4HKU A;  3VPR A;  2WV1 A;  5GPA A;  3CRJ A;  4NN1 A;  5FKO A;  4KWA A;  5D18 A;  3MNL A;  2W53 A;  3BTL A;  3S5R A;  2UXU A;  5AQC A;  2HYJ A;  4GFL A;  2WUI A;  2JK3 A;  4PXI A;  1ZKG A;  3BQY A;  5CXI A;  1RKT A;  1JTX A;  2X9D A;  3VW1 A;  3TP0 A;  4AUX A;  3BR6 A;  3ON4 A;  2YVE A;  2XGD A;  2OER A;  3HTJ A;  3V78 A;  3BNI A;  2NS8 A;  2XGC A;  3IUV A;  5F0H A;  4I6Z A;  4D7N A;  3KKC A;  3VOX A;  4ABZ A;  1JT0 A;  3CJD A;  3VVX A;  2QKO A;  3DCF A;  3BR2 A;  4CGR A;  3Q3S A;  3T6N A;  1U9N A;  3GEU A;  2X6O A;  5HBU A;  3BR1 A;  4X1E A;  2FD5 A;  4GCT A;  4ICH A;  2UXI A;  3ZQG A;  4M3F A;  2TRT A;  1T33 A;  1ZK8 A;  3O8G A;  3QBM A;  2Y30 A;  2OI8 A;  2DG7 A;  4ACI A;  5F0F A;  2ZCX A;  2TCT A;  4GCK A;  3TP3 A;  4I76 A;  3G56 A;  4GFK A;  4V2F A;  5DAJ A;  1JUS A;  4ME9 A;  2IBD A;  2REK A;  3ZQI A;  4NEL A;  2G0E A;  5J1R A;  1RKW A;  3F0C A;  3WHB A;  3C2B A;  2RAS A;  2XPW A;  1QPI A;  5FMP A;  3CDL A;  5EFY A;  4DW6 A;  4GCL A;  5IPA A;  3G1L A;  3JSJ A;  2O7O A;  2FX0 A;  1BJZ A;  4AF5 A;  2ZOY A;  4MK6 A;  3ON2 A;  5HSZ A;  3VVY A;  3KZ9 A;  3KKD A;  2HXI A;  3LJL A;  3LSP A;  2QOP A;  2QIB A;  2RAE A;  5F27 A;  4M3B A;  4M3E A;  2NP3 A;  2XDN A;  2Y31 A;  5K7F A;  3WHC A;  1VI0 A;  3QPS A;  3NRG A;  5FKL A;  4L62 A;  1T56 A;  5F04 A;  2G7S A;  3ZQL A;  1UI5 A;  2ID3 A;  3CCY A;  2NP5 A;  1JT6 A;  2ZCN A;  3G7R A;  4JNN A;  2V57 A;  4AC6 A;  1RPW A;  2I10 A;  3BCG A;  2HQ5 A;  3IH4 A;  2DG8 A;  4M3D A;  2GFN A;  5CXG A;  2QWT A;  3NXC A;  5GP9 A;  3HTI A;  4XK4 A;  2ZOZ A;  4JKZ A;  4D5C A;  4V2G A;  3BR5 A;  5EZG A;  1Z77 A;  2FQ4 A;  5GPC A;  5D19 A;  2XPV A;  2GBY A;  3HGG A;  2G7L A;  2HYT A;  2G3B A;  3RD3 A;  4W97 A;  5FKM A;  3BR0 A;  1U9O A;  3VIB A;  2IU5 A;  3FRQ A;  5J3L A;  2NX4 A;  3QKX A;  1A6I A;  2XRL A;  3Q0U A;  3MVP A;  3ANP A;  3LWJ A;  3O8H A;  2RHA A;  3BR3 A;  3SFI A;  3ZQF A;  3ZQH A;  4UDS A;  2DTZ A;  2XPU A;  1SGM A;  1QVT A;  3Q0V A;  2PZ9 A;  3LSR A;  3BHQ A;  2QCO A;  3SDG A;  4D5F A;  2D6Y A;  3BRU A;  4JL3 A;  5IOY A;  4W1U A;  2HKU A;  3LOC A;  3Q0W A;  4B1R A;  5FGL A;  5IP6 A;  3BTJ A;  2VKE A;  2GEN A;  3LHQ A;  2G7G A;  3P9T A;  3VW2 A;  2HXO A;  5F0C A;  3B6C A;  3EUP A;  5J1Y A;  3HTA A;  3G1M A;  5F1J A;  3AQT A;  3E7Q A;  3VVZ A;  3RH2 A;  5D1R A;  2O7T A;  5J1U A;  2Q24 A;  5K58 A;  4MO7 A;  2GUH A;  3HGY A;  2ZB9 A;  2IAI A;  5H9T A;  2UXO A;  3PPB A;  1JTY A;  2UXP A;  5FKK A;  3NNR A;  3VW0 A;  2FJ1 A;  3V6G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...