3JSJA

Crystal structure of a putative tetr-transcriptional regulator (sav143) from streptomyces avermitilis ma-4680 at 2.10 a resolution
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
184
structure length
184
Chain Sequence
KQSPRERLLEAAAALTYRDGVGIGVEALCKAAGVSKRSMYQLFESKDELLAASLKERSAAFVAKALPPADDGRSPRERILYVFERVESQAGAPDFQGCRYLAVQIELKDQAHPASRVAYQIKADLMAFFRSEAERGGASDPDLLARQLILVFDGASARAGIGADNLTGLIVPTLTTLLDAADMH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Putative transcriptional regulator (NP_821317.1) from Streptomyces avermitilis MA-4680 at 2.10 A resolution
rcsb
source organism Streptomyces avermitilis ma-4680
molecule tags Transcription
molecule keywords Putative TetR-family transcriptional regulator
total genus 68
structure length 184
sequence length 184
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3jsjA00
1JUSA 3ZQIA 5F0FA 5EZGA 3ANPA 2G7LA 3RD3A 2G7SA 3QKXA 2ZCXA 1ZKGA 2DG7A 2F07A 4W1UA 3GZIA 2ID6A 4NELA 2HYTA 3NI7A 5K7ZA 3IH4A 5FKNA 3IH2A 4AUXA 3O8GA 3VW1A 1JT6A 2GENA 3HTHA 3BCGA 3IH3A 1BJZA 4GCLA 3DPJA 1U9NA 3AQTA 1QVUA 3MNLA 3KKCA 4YZEA 3HIMA 2QTQA 4JL3A 3V6GA 3BHQA 5FKMA 2HXOA 3HE0A 3BR5A 3BR0A 2NS8A 2RHAA 2FBQA 3NXCA 3BTJA 5IP6A 5F04A 2QWTA 4ACIA 2FQ4A 1UI5A 5J1YA 3VUQA 1ORKA 4GCKA 5AQCA 4KWAA 3Q0VA 3C2BA 2GFNA 3NPIA 1JUPA 4I76A 4UDSA 4I6ZA 3VW2A 3BTIA 1A6IA 2HYJA 3BQYA 3ZQFA 3BR3A 5IOZA 5EYRA 3CWRA 2XDNA 3O8HA 2IBDA 2UXUA 5F0CA 3CJDA 5F27A 3ANGA 2ZCMA 2UXOA 3PM1A 2XPVA 2O7TA 2FJ1A 4MXMA 3VPRA 2NS7A 3Q0WA 3KKDA 4X1EA 5D1RA 3MVPA 2G3BA 1JTXA 2HKUA 2Y31A 4M3BA 4D5FA 5J3LA 2YVHA 4W97A 2PBXA 3DEWA 2ZOZA 5FMPA 3RH2A 4M3EA 5IOYA 3VP5A 3IUVA 4AF5A 4GFKA 3BNIA 3T6NA 2X6OA 2Q24A 3G1LA 5FGLA 2ZB9A 3LSRA 3BRUA 5GPCA 3BQZA 3VOKA 5HAWA 2O7OA 2XRLA 3Q0UA 2HQ5A 2FD5A 4JYKA 3ON2A 3QPSA 4G12A 3VIBA 4CGRA 4GCTA 3DCFA 5K7FA 2X9DA 3B81A 5CXIA 3EGQA 3AQSA 3ZQGA 3B6CA 4XK4A 1T33A 2XPUA 3FRQA 3Q3SA 4GFLA 2XGDA 3LOCA 1QVTA 2QCOA 2DG8A 2OF7A 2VPRA 2RASA 3BJBA 3HGGA 2V57A 5CXGA 4L62A 2TCTA 3G1MA 1RKTA 2W53A 4AC0A 5F08A 2WUIA 5J1RA 2ID3A 2DTZA 4M3FA 2I10A 2QIBA 3HTJA 4DW6A 1JT0A 3FK6A 1JTYA 5HBUA 3BR2A 1U9OA 5GPAA 4V2GA 2Y2ZA 2UXHA 4D5CA 2YVEA 5H9TA 5K7HA 3C07A 3FIWA 4M3GA 5FHPA 2NX4A 4D7MA 3JSJA 1ZK8A 3G56A 2TRTA 3F0CA 4D7NA 2PZ9A 3QPLA 4B1RA 5F0HA 3F1BA 2XGEA 4JNNA 4MK6A 4ABZA 3LSPA 3ZQHA 1QPIA 1JUMA 3LSJA 3COLA 5FKKA 3LHQA 3ZQLA 3KNWA 2IEKA 3GEUA 3BTLA 2OPTA 3P9TA 1Z0XA 2IU5A 2RAEA 5FKOA 3LJLA 3PPBA 5D18A 3HGYA 4MO7A 1RKWA 3HTAA 3G1OA 3G7RA 3NNRA 3WHBA 2IAIA 5J1UA 2ZOYA 3VVYA 2WV1A 3B6AA 5EFYA 2QOPA 2NP3A 4ME9A 5EZHA 2JK3A 3TP3A 4NN1A 3FK7A 4JKZA 3EUPA 2NP5A 4HKUA 3VOXA 1SGMA 3O60A 3VVZA 2XB5A 3E7QA 2D6YA 3VW0A 3BR1A 3CRJA 5IPAA 3S5RA 2FX0A 2REKA 5D19A 3TP0A 5CW8A 5K58A 3PASA 2G7GA 2HXIA 3SDGA 5C4YA 2OERA 2WGBA 3BR6A 3CCYA 3ON4A 2UXIA 4V2FA 3SFIA 4AC6A 2JJ7A 3KZ9A 3WHCA 5GP9A 2XGCA 1UI6A 3LWJA 3NRGA 5F1JA 2Y30A 4PXIA 1RPWA 2XPWA 5HSZA 2G0EA 3BTCA 3CDLA 2VKVA 2OI8A 2GUHA 2GBYA 4M3DA 2QKOA 1VI0A 3HTIA 3BT9A 4B3AA 2VKEA 3V78A 5FKLA 3QQAA 2ZCNA 1T56A 3QBMA 1Z77A 5DAJA 2EH3A 3VVXA 2UXPA 4ICHA
chains in the Genus database with same CATH superfamily
3K8PC 1JUSA 3ZQIA 5F0FA 5EZGA 3ANPA 2G7LA 3RD3A 2G7SA 3QKXA 2ZCXA 1ZKGA 2DG7A 2F07A 4W1UA 3GZIA 2ID6A 2R7SA 4NELA 2HYTA 3NI7A 5K7ZA 3IH4A 5FKNA 3IH2A 4AUXA 3O8GA 3VW1A 1JT6A 2GENA 3HTHA 3BCGA 3IH3A 1BJZA 4GCLA 3DPJA 1U9NA 3AQTA 1QVUA 3MNLA 2ZY9A 3KKCA 4YZEA 3HIMA 2QTQA 4JL3A 3V6GA 3BHQA 5FKMA 2HXOA 3HE0A 3BR5A 3BR0A 2NS8A 5CQGA 2RHAA 2FBQA 3NXCA 3BTJA 5IP6A 5F04A 2QWTA 4ACIA 2FQ4A 1UI5A 5J1YA 3VUQA 1ORKA 4GCKA 5AQCA 4KWAA 3Q0VA 3C2BA 2GFNA 3NPIA 1JUPA 4I76A 4UDSA 2R7TA 4I6ZA 3VW2A 3BTIA 1A6IA 2HYJA 3BQYA 3ZQFA 2YVXA 3BR3A 5IOZA 5EYRA 3CWRA 2XDNA 3O8HA 2IBDA 2UXUA 5F0CA 3CJDA 5F27A 4DVYP 4WIBA 3ANGA 2ZCMA 4C2MA 2UXOA 3PM1A 2XPVA 2O7TA 3VTIA 2FJ1A 4MXMA 3VPRA 2NS7A 3Q0WA 3KKDA 4X1EA 5D1RA 3MVPA 2G3BA 1JTXA 2HKUA 2Y31A 4M3BA 4D5FA 5J3LA 2YVHA 4W97A 2R7UA 2PBXA 3DEWA 2ZOZA 5FMPA 3RH2A 4OD5A 4M3EA 5IOYA 3VP5A 2R7WA 3IUVA 4AF5A 2B1EA 4GFKA 3BNIA 3T6NA 2X6OA 2Q24A 3G1LA 5FGLA 2ZB9A 3LSRA 4IRVA 3BRUA 5GPCA 3BQZA 3VOKA 5HAWA 2O7OA 2XRLA 3Q0UA 2HQ5A 2FD5A 4JYKA 3ON2A 3QPSA 4G12A 3VIBA 4CGRA 4GCTA 3DCFA 5K7FA 2X9DA 3B81A 5CXIA 3EGQA 3AQSA 3ZQGA 3B6CA 4XK4A 1T33A 2XPUA 3FRQA 2R7OA 3Q3SA 4GFLA 2XGDA 2FJI1 3LOCA 1QVTA 2QCOA 2DG8A 2OF7A 2VPRA 2RASA 3BJBA 3HGGA 2V57A 5CXGA 4L62A 2TCTA 3G1MA 1RKTA 2W53A 4AC0A 5F08A 2WUIA 5J1RA 2ID3A 2DTZA 2R7QA 4M3FA 2I10A 2QIBA 3HTJA 4DW6A 1JT0A 3FK6A 1JTYA 5HBUA 3BR2A 1U9OA 5GPAA 4V2GA 2Y2ZA 2UXHA 4D5CA 2YVEA 5H9TA 2PFVA 5K7HA 3C07A 3FIWA 4M3GA 5FHPA 2NX4A 4D7MA 3JSJA 1ZK8A 3G56A 2TRTA 3F0CA 4D7NA 2PZ9A 3QPLA 4B1RA 5F0HA 3F1BA 2XGEA 4JNNA 4MK6A 4ABZA 3LSPA 3ZQHA 1QPIA 1JUMA 3LSJA 3COLA 3SWHA 5FKKA 3LHQA 3ZQLA 4U9LA 3NS4A 3KNWA 2IEKA 3GEUA 3BTLA 2OPTA 3P9TA 1Z0XA 2IU5A 2RAEA 5FKOA 3LJLA 3PPBA 5D18A 3HGYA 4MO7A 1RKWA 3HTAA 3G1OA 3G7RA 3NNRA 3WHBA 2IAIA 5J1UA 4U9NA 2ZOYA 3VVYA 2WV1A 3DU5A 3B6AA 5EFYA 2QOPA 2NP3A 4ME9A 5EZHA 2B3WA 2JK3A 3FHNA 3TP3A 4NN1A 3FK7A 4JKZA 3EUPA 2NP5A 4HKUA 3VOXA 1SGMA 3O60A 3VVZA 2XB5A 3E7QA 2R7RA 2D6YA 3VW0A 3BR1A 3CRJA 5IPAA 3S5RA 2FX0A 2REKA 5D19A 3TP0A 5CW8A 5K58A 3PASA 2G7GA 2HXIA 3SDGA 5C4YA 2OERA 2WGBA 3BR6A 3CCYA 3ON4A 2UXIA 4V2FA 3SFIA 4AC6A 2JJ7A 3KZ9A 3WHCA 5GP9A 3DU6A 2XGCA 1UI6A 3LWJA 2A2FX 3NRGA 4OD4A 5F1JA 2Y30A 4PXIA 1RPWA 2XPWA 5HSZA 2G0EA 3BTCA 3CDLA 2VKVA 3KYLA 2OI8A 2GUHA 2GBYA 4M3DA 2R7VA 2QKOA 1VI0A 3HTIA 3BT9A 4B3AA 2VKEA 3V78A 5FKLA 3QQAA 2ZCNA 1T56A 3QBMA 1Z77A 5DAJA 2R7XA 2EH3A 3VVXA 2UXPA 4ICHA
chains in the Genus database with same CATH topology
1JUSA 3ZQIA 5F0FA 5EZGA 3ANPA 2G7LA 3RD3A 2G7SA 3QKXA 2ZCXA 1ZKGA 2DG7A 2F07A 4W1UA 3GZIA 2ID6A 4NELA 2HYTA 3NI7A 5K7ZA 3IH4A 5FKNA 3IH2A 4AUXA 3O8GA 3VW1A 1JT6A 2GENA 3HTHA 3BCGA 3IH3A 1BJZA 4GCLA 3DPJA 1U9NA 3AQTA 1QVUA 3MNLA 3KKCA 4YZEA 3HIMA 2QTQA 4JL3A 3V6GA 3BHQA 5FKMA 2HXOA 3HE0A 3BR5A 3BR0A 2NS8A 2RHAA 2FBQA 3NXCA 3BTJA 5IP6A 5F04A 2QWTA 4ACIA 2FQ4A 1UI5A 5J1YA 3VUQA 1ORKA 4GCKA 5AQCA 4KWAA 3Q0VA 3C2BA 2GFNA 3NPIA 1JUPA 4I76A 4UDSA 4I6ZA 3VW2A 3BTIA 1A6IA 2HYJA 3BQYA 3ZQFA 3BR3A 5IOZA 5EYRA 3CWRA 2XDNA 3O8HA 2IBDA 2UXUA 5F0CA 3CJDA 5F27A 3ANGA 2ZCMA 2UXOA 3PM1A 2XPVA 2O7TA 2FJ1A 4MXMA 3VPRA 2NS7A 3Q0WA 3KKDA 4X1EA 5D1RA 3MVPA 2G3BA 1JTXA 2HKUA 2Y31A 4M3BA 4D5FA 5J3LA 2YVHA 4W97A 2PBXA 3DEWA 2ZOZA 5FMPA 3RH2A 4M3EA 5IOYA 3VP5A 3IUVA 4AF5A 4GFKA 3BNIA 3T6NA 2X6OA 2Q24A 3G1LA 5FGLA 2ZB9A 3LSRA 3BRUA 5GPCA 3BQZA 3VOKA 5HAWA 2O7OA 2XRLA 3Q0UA 2HQ5A 2FD5A 4JYKA 3ON2A 3QPSA 4G12A 3VIBA 4CGRA 4GCTA 3DCFA 5K7FA 2X9DA 3B81A 5CXIA 3EGQA 3AQSA 3ZQGA 3B6CA 4XK4A 1T33A 2XPUA 3FRQA 3Q3SA 4GFLA 2XGDA 3LOCA 1QVTA 2QCOA 2DG8A 2OF7A 2VPRA 2RASA 3BJBA 3HGGA 2V57A 5CXGA 4L62A 2TCTA 3G1MA 1RKTA 2W53A 4AC0A 5F08A 2WUIA 5J1RA 2ID3A 2DTZA 4M3FA 2I10A 2QIBA 3HTJA 4DW6A 1JT0A 3FK6A 1JTYA 5HBUA 3BR2A 1U9OA 5GPAA 4V2GA 2Y2ZA 2UXHA 4D5CA 2YVEA 5H9TA 5K7HA 3C07A 3FIWA 4M3GA 5FHPA 2NX4A 4D7MA 3JSJA 1ZK8A 3G56A 2TRTA 3F0CA 4D7NA 2PZ9A 3QPLA 4B1RA 5F0HA 3F1BA 2XGEA 4JNNA 4MK6A 4ABZA 3LSPA 3ZQHA 1QPIA 1JUMA 3LSJA 3COLA 5FKKA 3LHQA 3ZQLA 3KNWA 2IEKA 3GEUA 3BTLA 2OPTA 3P9TA 1Z0XA 2IU5A 2RAEA 5FKOA 3LJLA 3PPBA 5D18A 3HGYA 4MO7A 1RKWA 3HTAA 3G1OA 3G7RA 3NNRA 3WHBA 2IAIA 5J1UA 2ZOYA 3VVYA 2WV1A 3B6AA 5EFYA 2QOPA 2NP3A 4ME9A 5EZHA 2JK3A 3TP3A 4NN1A 3FK7A 4JKZA 3EUPA 2NP5A 4HKUA 3VOXA 1SGMA 3O60A 3VVZA 2XB5A 3E7QA 2D6YA 3VW0A 3BR1A 3CRJA 5IPAA 3S5RA 2FX0A 2REKA 5D19A 3TP0A 5CW8A 5K58A 3PASA 2G7GA 2HXIA 3SDGA 5C4YA 2OERA 2WGBA 3BR6A 3CCYA 3ON4A 2UXIA 4V2FA 3SFIA 4AC6A 2JJ7A 3KZ9A 3WHCA 5GP9A 2XGCA 1UI6A 3LWJA 3NRGA 5F1JA 2Y30A 4PXIA 1RPWA 2XPWA 5HSZA 2G0EA 3BTCA 3CDLA 2VKVA 2OI8A 2GUHA 2GBYA 4M3DA 2QKOA 1VI0A 3HTIA 3BT9A 4B3AA 2VKEA 3V78A 5FKLA 3QQAA 2ZCNA 1T56A 3QBMA 1Z77A 5DAJA 2EH3A 3VVXA 2UXPA 4ICHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JUS A;  3ZQI A;  5F0F A;  5EZG A;  3ANP A;  2G7L A;  3RD3 A;  2G7S A;  3QKX A;  2ZCX A;  1ZKG A;  2DG7 A;  2F07 A;  4W1U A;  3GZI A;  2ID6 A;  4NEL A;  2HYT A;  3NI7 A;  5K7Z A;  3IH4 A;  5FKN A;  3IH2 A;  4AUX A;  3O8G A;  3VW1 A;  1JT6 A;  2GEN A;  3HTH A;  3BCG A;  3IH3 A;  1BJZ A;  4GCL A;  3DPJ A;  1U9N A;  3AQT A;  1QVU A;  3MNL A;  3KKC A;  4YZE A;  3HIM A;  2QTQ A;  4JL3 A;  3V6G A;  3BHQ A;  5FKM A;  2HXO A;  3HE0 A;  3BR5 A;  3BR0 A;  2NS8 A;  2RHA A;  2FBQ A;  3NXC A;  3BTJ A;  5IP6 A;  5F04 A;  2QWT A;  4ACI A;  2FQ4 A;  1UI5 A;  5J1Y A;  3VUQ A;  1ORK A;  4GCK A;  5AQC A;  4KWA A;  3Q0V A;  3C2B A;  2GFN A;  3NPI A;  1JUP A;  4I76 A;  4UDS A;  4I6Z A;  3VW2 A;  3BTI A;  1A6I A;  2HYJ A;  3BQY A;  3ZQF A;  3BR3 A;  5IOZ A;  5EYR A;  3CWR A;  2XDN A;  3O8H A;  2IBD A;  2UXU A;  5F0C A;  3CJD A;  5F27 A;  3ANG A;  2ZCM A;  2UXO A;  3PM1 A;  2XPV A;  2O7T A;  2FJ1 A;  4MXM A;  3VPR A;  2NS7 A;  3Q0W A;  3KKD A;  4X1E A;  5D1R A;  3MVP A;  2G3B A;  1JTX A;  2HKU A;  2Y31 A;  4M3B A;  4D5F A;  5J3L A;  2YVH A;  4W97 A;  2PBX A;  3DEW A;  2ZOZ A;  5FMP A;  3RH2 A;  4M3E A;  5IOY A;  3VP5 A;  3IUV A;  4AF5 A;  4GFK A;  3BNI A;  3T6N A;  2X6O A;  2Q24 A;  3G1L A;  5FGL A;  2ZB9 A;  3LSR A;  3BRU A;  5GPC A;  3BQZ A;  3VOK A;  5HAW A;  2O7O A;  2XRL A;  3Q0U A;  2HQ5 A;  2FD5 A;  4JYK A;  3ON2 A;  3QPS A;  4G12 A;  3VIB A;  4CGR A;  4GCT A;  3DCF A;  5K7F A;  2X9D A;  3B81 A;  5CXI A;  3EGQ A;  3AQS A;  3ZQG A;  3B6C A;  4XK4 A;  1T33 A;  2XPU A;  3FRQ A;  3Q3S A;  4GFL A;  2XGD A;  3LOC A;  1QVT A;  2QCO A;  2DG8 A;  2OF7 A;  2VPR A;  2RAS A;  3BJB A;  3HGG A;  2V57 A;  5CXG A;  4L62 A;  2TCT A;  3G1M A;  1RKT A;  2W53 A;  4AC0 A;  5F08 A;  2WUI A;  5J1R A;  2ID3 A;  2DTZ A;  4M3F A;  2I10 A;  2QIB A;  3HTJ A;  4DW6 A;  1JT0 A;  3FK6 A;  1JTY A;  5HBU A;  3BR2 A;  1U9O A;  5GPA A;  4V2G A;  2Y2Z A;  2UXH A;  4D5C A;  2YVE A;  5H9T A;  5K7H A;  3C07 A;  3FIW A;  4M3G A;  5FHP A;  2NX4 A;  4D7M A;  3JSJ A;  1ZK8 A;  3G56 A;  2TRT A;  3F0C A;  4D7N A;  2PZ9 A;  3QPL A;  4B1R A;  5F0H A;  3F1B A;  2XGE A;  4JNN A;  4MK6 A;  4ABZ A;  3LSP A;  3ZQH A;  1QPI A;  1JUM A;  3LSJ A;  3COL A;  5FKK A;  3LHQ A;  3ZQL A;  3KNW A;  2IEK A;  3GEU A;  3BTL A;  2OPT A;  3P9T A;  1Z0X A;  2IU5 A;  2RAE A;  5FKO A;  3LJL A;  3PPB A;  5D18 A;  3HGY A;  4MO7 A;  1RKW A;  3HTA A;  3G1O A;  3G7R A;  3NNR A;  3WHB A;  2IAI A;  5J1U A;  2ZOY A;  3VVY A;  2WV1 A;  3B6A A;  5EFY A;  2QOP A;  2NP3 A;  4ME9 A;  5EZH A;  2JK3 A;  3TP3 A;  4NN1 A;  3FK7 A;  4JKZ A;  3EUP A;  2NP5 A;  4HKU A;  3VOX A;  1SGM A;  3O60 A;  3VVZ A;  2XB5 A;  3E7Q A;  2D6Y A;  3VW0 A;  3BR1 A;  3CRJ A;  5IPA A;  3S5R A;  2FX0 A;  2REK A;  5D19 A;  3TP0 A;  5CW8 A;  5K58 A;  3PAS A;  2G7G A;  2HXI A;  3SDG A;  5C4Y A;  2OER A;  2WGB A;  3BR6 A;  3CCY A;  3ON4 A;  2UXI A;  4V2F A;  3SFI A;  4AC6 A;  2JJ7 A;  3KZ9 A;  3WHC A;  5GP9 A;  2XGC A;  1UI6 A;  3LWJ A;  3NRG A;  5F1J A;  2Y30 A;  4PXI A;  1RPW A;  2XPW A;  5HSZ A;  2G0E A;  3BTC A;  3CDL A;  2VKV A;  2OI8 A;  2GUH A;  2GBY A;  4M3D A;  2QKO A;  1VI0 A;  3HTI A;  3BT9 A;  4B3A A;  2VKE A;  3V78 A;  5FKL A;  3QQA A;  2ZCN A;  1T56 A;  3QBM A;  1Z77 A;  5DAJ A;  2EH3 A;  3VVX A;  2UXP A;  4ICH A; 
#chains in the Genus database with same CATH topology
 3K8P C;  1JUS A;  3ZQI A;  5F0F A;  5EZG A;  3ANP A;  2G7L A;  3RD3 A;  2G7S A;  3QKX A;  2ZCX A;  1ZKG A;  2DG7 A;  2F07 A;  4W1U A;  3GZI A;  2ID6 A;  2R7S A;  4NEL A;  2HYT A;  3NI7 A;  5K7Z A;  3IH4 A;  5FKN A;  3IH2 A;  4AUX A;  3O8G A;  3VW1 A;  1JT6 A;  2GEN A;  3HTH A;  3BCG A;  3IH3 A;  1BJZ A;  4GCL A;  3DPJ A;  1U9N A;  3AQT A;  1QVU A;  3MNL A;  2ZY9 A;  3KKC A;  4YZE A;  3HIM A;  2QTQ A;  4JL3 A;  3V6G A;  3BHQ A;  5FKM A;  2HXO A;  3HE0 A;  3BR5 A;  3BR0 A;  2NS8 A;  5CQG A;  2RHA A;  2FBQ A;  3NXC A;  3BTJ A;  5IP6 A;  5F04 A;  2QWT A;  4ACI A;  2FQ4 A;  1UI5 A;  5J1Y A;  3VUQ A;  1ORK A;  4GCK A;  5AQC A;  4KWA A;  3Q0V A;  3C2B A;  2GFN A;  3NPI A;  1JUP A;  4I76 A;  4UDS A;  2R7T A;  4I6Z A;  3VW2 A;  3BTI A;  1A6I A;  2HYJ A;  3BQY A;  3ZQF A;  2YVX A;  3BR3 A;  5IOZ A;  5EYR A;  3CWR A;  2XDN A;  3O8H A;  2IBD A;  2UXU A;  5F0C A;  3CJD A;  5F27 A;  4DVY P;  4WIB A;  3ANG A;  2ZCM A;  4C2M A;  2UXO A;  3PM1 A;  2XPV A;  2O7T A;  3VTI A;  2FJ1 A;  4MXM A;  3VPR A;  2NS7 A;  3Q0W A;  3KKD A;  4X1E A;  5D1R A;  3MVP A;  2G3B A;  1JTX A;  2HKU A;  2Y31 A;  4M3B A;  4D5F A;  5J3L A;  2YVH A;  4W97 A;  2R7U A;  2PBX A;  3DEW A;  2ZOZ A;  5FMP A;  3RH2 A;  4OD5 A;  4M3E A;  5IOY A;  3VP5 A;  2R7W A;  3IUV A;  4AF5 A;  2B1E A;  4GFK A;  3BNI A;  3T6N A;  2X6O A;  2Q24 A;  3G1L A;  5FGL A;  2ZB9 A;  3LSR A;  4IRV A;  3BRU A;  5GPC A;  3BQZ A;  3VOK A;  5HAW A;  2O7O A;  2XRL A;  3Q0U A;  2HQ5 A;  2FD5 A;  4JYK A;  3ON2 A;  3QPS A;  4G12 A;  3VIB A;  4CGR A;  4GCT A;  3DCF A;  5K7F A;  2X9D A;  3B81 A;  5CXI A;  3EGQ A;  3AQS A;  3ZQG A;  3B6C A;  4XK4 A;  1T33 A;  2XPU A;  3FRQ A;  2R7O A;  3Q3S A;  4GFL A;  2XGD A;  2FJI 1;  3LOC A;  1QVT A;  2QCO A;  2DG8 A;  2OF7 A;  2VPR A;  2RAS A;  3BJB A;  3HGG A;  2V57 A;  5CXG A;  4L62 A;  2TCT A;  3G1M A;  1RKT A;  2W53 A;  4AC0 A;  5F08 A;  2WUI A;  5J1R A;  2ID3 A;  2DTZ A;  2R7Q A;  4M3F A;  2I10 A;  2QIB A;  3HTJ A;  4DW6 A;  1JT0 A;  3FK6 A;  1JTY A;  5HBU A;  3BR2 A;  1U9O A;  5GPA A;  4V2G A;  2Y2Z A;  2UXH A;  4D5C A;  2YVE A;  5H9T A;  2PFV A;  5K7H A;  3C07 A;  3FIW A;  4M3G A;  5FHP A;  2NX4 A;  4D7M A;  3JSJ A;  1ZK8 A;  3G56 A;  2TRT A;  3F0C A;  4D7N A;  2PZ9 A;  3QPL A;  4B1R A;  5F0H A;  3F1B A;  2XGE A;  4JNN A;  4MK6 A;  4ABZ A;  3LSP A;  3ZQH A;  1QPI A;  1JUM A;  3LSJ A;  3COL A;  3SWH A;  5FKK A;  3LHQ A;  3ZQL A;  4U9L A;  3NS4 A;  3KNW A;  2IEK A;  3GEU A;  3BTL A;  2OPT A;  3P9T A;  1Z0X A;  2IU5 A;  2RAE A;  5FKO A;  3LJL A;  3PPB A;  5D18 A;  3HGY A;  4MO7 A;  1RKW A;  3HTA A;  3G1O A;  3G7R A;  3NNR A;  3WHB A;  2IAI A;  5J1U A;  4U9N A;  2ZOY A;  3VVY A;  2WV1 A;  3DU5 A;  3B6A A;  5EFY A;  2QOP A;  2NP3 A;  4ME9 A;  5EZH A;  2B3W A;  2JK3 A;  3FHN A;  3TP3 A;  4NN1 A;  3FK7 A;  4JKZ A;  3EUP A;  2NP5 A;  4HKU A;  3VOX A;  1SGM A;  3O60 A;  3VVZ A;  2XB5 A;  3E7Q A;  2R7R A;  2D6Y A;  3VW0 A;  3BR1 A;  3CRJ A;  5IPA A;  3S5R A;  2FX0 A;  2REK A;  5D19 A;  3TP0 A;  5CW8 A;  5K58 A;  3PAS A;  2G7G A;  2HXI A;  3SDG A;  5C4Y A;  2OER A;  2WGB A;  3BR6 A;  3CCY A;  3ON4 A;  2UXI A;  4V2F A;  3SFI A;  4AC6 A;  2JJ7 A;  3KZ9 A;  3WHC A;  5GP9 A;  3DU6 A;  2XGC A;  1UI6 A;  3LWJ A;  2A2F X;  3NRG A;  4OD4 A;  5F1J A;  2Y30 A;  4PXI A;  1RPW A;  2XPW A;  5HSZ A;  2G0E A;  3BTC A;  3CDL A;  2VKV A;  3KYL A;  2OI8 A;  2GUH A;  2GBY A;  4M3D A;  2R7V A;  2QKO A;  1VI0 A;  3HTI A;  3BT9 A;  4B3A A;  2VKE A;  3V78 A;  5FKL A;  3QQA A;  2ZCN A;  1T56 A;  3QBM A;  1Z77 A;  5DAJ A;  2R7X A;  2EH3 A;  3VVX A;  2UXP A;  4ICH A; 
#chains in the Genus database with same CATH homology
 1JUS A;  3ZQI A;  5F0F A;  5EZG A;  3ANP A;  2G7L A;  3RD3 A;  2G7S A;  3QKX A;  2ZCX A;  1ZKG A;  2DG7 A;  2F07 A;  4W1U A;  3GZI A;  2ID6 A;  4NEL A;  2HYT A;  3NI7 A;  5K7Z A;  3IH4 A;  5FKN A;  3IH2 A;  4AUX A;  3O8G A;  3VW1 A;  1JT6 A;  2GEN A;  3HTH A;  3BCG A;  3IH3 A;  1BJZ A;  4GCL A;  3DPJ A;  1U9N A;  3AQT A;  1QVU A;  3MNL A;  3KKC A;  4YZE A;  3HIM A;  2QTQ A;  4JL3 A;  3V6G A;  3BHQ A;  5FKM A;  2HXO A;  3HE0 A;  3BR5 A;  3BR0 A;  2NS8 A;  2RHA A;  2FBQ A;  3NXC A;  3BTJ A;  5IP6 A;  5F04 A;  2QWT A;  4ACI A;  2FQ4 A;  1UI5 A;  5J1Y A;  3VUQ A;  1ORK A;  4GCK A;  5AQC A;  4KWA A;  3Q0V A;  3C2B A;  2GFN A;  3NPI A;  1JUP A;  4I76 A;  4UDS A;  4I6Z A;  3VW2 A;  3BTI A;  1A6I A;  2HYJ A;  3BQY A;  3ZQF A;  3BR3 A;  5IOZ A;  5EYR A;  3CWR A;  2XDN A;  3O8H A;  2IBD A;  2UXU A;  5F0C A;  3CJD A;  5F27 A;  3ANG A;  2ZCM A;  2UXO A;  3PM1 A;  2XPV A;  2O7T A;  2FJ1 A;  4MXM A;  3VPR A;  2NS7 A;  3Q0W A;  3KKD A;  4X1E A;  5D1R A;  3MVP A;  2G3B A;  1JTX A;  2HKU A;  2Y31 A;  4M3B A;  4D5F A;  5J3L A;  2YVH A;  4W97 A;  2PBX A;  3DEW A;  2ZOZ A;  5FMP A;  3RH2 A;  4M3E A;  5IOY A;  3VP5 A;  3IUV A;  4AF5 A;  4GFK A;  3BNI A;  3T6N A;  2X6O A;  2Q24 A;  3G1L A;  5FGL A;  2ZB9 A;  3LSR A;  3BRU A;  5GPC A;  3BQZ A;  3VOK A;  5HAW A;  2O7O A;  2XRL A;  3Q0U A;  2HQ5 A;  2FD5 A;  4JYK A;  3ON2 A;  3QPS A;  4G12 A;  3VIB A;  4CGR A;  4GCT A;  3DCF A;  5K7F A;  2X9D A;  3B81 A;  5CXI A;  3EGQ A;  3AQS A;  3ZQG A;  3B6C A;  4XK4 A;  1T33 A;  2XPU A;  3FRQ A;  3Q3S A;  4GFL A;  2XGD A;  3LOC A;  1QVT A;  2QCO A;  2DG8 A;  2OF7 A;  2VPR A;  2RAS A;  3BJB A;  3HGG A;  2V57 A;  5CXG A;  4L62 A;  2TCT A;  3G1M A;  1RKT A;  2W53 A;  4AC0 A;  5F08 A;  2WUI A;  5J1R A;  2ID3 A;  2DTZ A;  4M3F A;  2I10 A;  2QIB A;  3HTJ A;  4DW6 A;  1JT0 A;  3FK6 A;  1JTY A;  5HBU A;  3BR2 A;  1U9O A;  5GPA A;  4V2G A;  2Y2Z A;  2UXH A;  4D5C A;  2YVE A;  5H9T A;  5K7H A;  3C07 A;  3FIW A;  4M3G A;  5FHP A;  2NX4 A;  4D7M A;  3JSJ A;  1ZK8 A;  3G56 A;  2TRT A;  3F0C A;  4D7N A;  2PZ9 A;  3QPL A;  4B1R A;  5F0H A;  3F1B A;  2XGE A;  4JNN A;  4MK6 A;  4ABZ A;  3LSP A;  3ZQH A;  1QPI A;  1JUM A;  3LSJ A;  3COL A;  5FKK A;  3LHQ A;  3ZQL A;  3KNW A;  2IEK A;  3GEU A;  3BTL A;  2OPT A;  3P9T A;  1Z0X A;  2IU5 A;  2RAE A;  5FKO A;  3LJL A;  3PPB A;  5D18 A;  3HGY A;  4MO7 A;  1RKW A;  3HTA A;  3G1O A;  3G7R A;  3NNR A;  3WHB A;  2IAI A;  5J1U A;  2ZOY A;  3VVY A;  2WV1 A;  3B6A A;  5EFY A;  2QOP A;  2NP3 A;  4ME9 A;  5EZH A;  2JK3 A;  3TP3 A;  4NN1 A;  3FK7 A;  4JKZ A;  3EUP A;  2NP5 A;  4HKU A;  3VOX A;  1SGM A;  3O60 A;  3VVZ A;  2XB5 A;  3E7Q A;  2D6Y A;  3VW0 A;  3BR1 A;  3CRJ A;  5IPA A;  3S5R A;  2FX0 A;  2REK A;  5D19 A;  3TP0 A;  5CW8 A;  5K58 A;  3PAS A;  2G7G A;  2HXI A;  3SDG A;  5C4Y A;  2OER A;  2WGB A;  3BR6 A;  3CCY A;  3ON4 A;  2UXI A;  4V2F A;  3SFI A;  4AC6 A;  2JJ7 A;  3KZ9 A;  3WHC A;  5GP9 A;  2XGC A;  1UI6 A;  3LWJ A;  3NRG A;  5F1J A;  2Y30 A;  4PXI A;  1RPW A;  2XPW A;  5HSZ A;  2G0E A;  3BTC A;  3CDL A;  2VKV A;  2OI8 A;  2GUH A;  2GBY A;  4M3D A;  2QKO A;  1VI0 A;  3HTI A;  3BT9 A;  4B3A A;  2VKE A;  3V78 A;  5FKL A;  3QQA A;  2ZCN A;  1T56 A;  3QBM A;  1Z77 A;  5DAJ A;  2EH3 A;  3VVX A;  2UXP A;  4ICH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...