3JSJA

Crystal structure of a putative tetr-transcriptional regulator (sav143) from streptomyces avermitilis ma-4680 at 2.10 a resolution
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
184
structure length
184
Chain Sequence
KQSPRERLLEAAAALTYRDGVGIGVEALCKAAGVSKRSMYQLFESKDELLAASLKERSAAFVAKALPPADDGRSPRERILYVFERVESQAGAPDFQGCRYLAVQIELKDQAHPASRVAYQIKADLMAFFRSEAERGGASDPDLLARQLILVFDGASARAGIGADNLTGLIVPTLTTLLDAADMH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Putative transcriptional regulator (NP_821317.1) from Streptomyces avermitilis MA-4680 at 2.10 A resolution
rcsb
source organism Streptomyces avermitilis ma-4680
molecule tags Transcription
molecule keywords Putative TetR-family transcriptional regulator
total genus 68
structure length 184
sequence length 184
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3jsjA00
2UXPA 3ON4A 4MO7A 2QTQA 2PZ9A 5CW8A 3O8HA 2Y30A 5AQCA 2VKVA 4ME9A 5GPAA 5F1JA 2HKUA 2TCTA 5IOZA 3Q0UA 1Z0XA 3G1OA 2UXUA 4MXMA 3B81A 3BCGA 4M3GA 2DG7A 1U9NA 2XRLA 2Y31A 3LHQA 3BR2A 4GCKA 3G1LA 5J1UA 3NNRA 5H9TA 5EYRA 2IBDA 2OERA 3BT9A 2NP3A 5F0HA 4M3FA 4CGRA 3ZQHA 2XPUA 2FQ4A 3FRQA 2ZCNA 3EUPA 3HTAA 3TP0A 1T33A 2ZOYA 5F0CA 4GCLA 4KWAA 5K7HA 2XB5A 2OI8A 3VIBA 4B3AA 3VVYA 5FHPA 3LJLA 4D5CA 3G7RA 4GFLA 5HAWA 3NRGA 2YVHA 3VVZA 2Y2ZA 3BNIA 3T6NA 3BTIA 3ON2A 2DTZA 2Q24A 3HTIA 3G56A 2GENA 4ABZA 5F08A 3VW0A 5D18A 3CRJA 3GEUA 3BR0A 2I10A 2QCOA 3SFIA 3VPRA 3AQSA 3SDGA 3Q3SA 5F04A 2O7OA 3PM1A 1JUPA 2UXHA 3QKXA 4GFKA 3HTHA 2DG8A 2ZOZA 1Z77A 5FKNA 2ZCMA 2G0EA 5FKOA 2JJ7A 3WHBA 3BRUA 3ZQIA 1ZK8A 4JNNA 3P9TA 3CJDA 5GPCA 2FD5A 3HGYA 5J1YA 2HYJA 2HQ5A 3MNLA 2GUHA 2XGCA 4I76A 3DPJA 3ANPA 4V2GA 4JL3A 2TRTA 2WGBA 5FKLA 4DW6A 5C4YA 2NX4A 3LSRA 2NP5A 2REKA 3ZQFA 3LSJA 2FBQA 3NXCA 5K7ZA 3B6CA 4AC6A 2QIBA 1JTYA 4B1RA 4MK6A 5K7FA 4XK4A 3KNWA 3LWJA 5D19A 3CCYA 2QOPA 1JT0A 1ORKA 5J3LA 4JYKA 4JKZA 5IOYA 5FMPA 4NELA 4GCTA 5FGLA 5F0FA 3S5RA 3EGQA 2XPVA 3PPBA 1QVUA 2NS8A 5CXIA 3C07A 2O7TA 1UI6A 3Q0WA 3V78A 3E7QA 3VP5A 3BTCA 3FK6A 3RH2A 1RPWA 2IAIA 2ZCXA 1SGMA 2X9DA 2FJ1A 3MVPA 3QPLA 4M3DA 1JUMA 2PBXA 3CDLA 3JSJA 2IU5A 3VOXA 3CWRA 4NN1A 4D5FA 2ID6A 3HIMA 3BQYA 2FX0A 2XGDA 2GFNA 3FIWA 5EFYA 4YZEA 1A6IA 2WUIA 1QPIA 5EZGA 3BR1A 2ID3A 4M3EA 4I6ZA 3ZQLA 4HKUA 2RASA 4AC0A 5F27A 5HSZA 3ANGA 5GP9A 3VOKA 3WHCA 1ZKGA 3GZIA 3VW2A 3HTJA 3QPSA 5IP6A 3DCFA 5IPAA 3IH3A 5HBUA 5DAJA 5EZHA 3BR6A 3VUQA 2D6YA 2YVEA 5D1RA 2EH3A 3BJBA 4V2FA 1JT6A 3PASA 2QKOA 2OF7A 3NPIA 3ZQGA 1RKWA 2X6OA 5FKKA 3BQZA 4D7MA 3F0CA 2XGEA 1JUSA 3B6AA 2VPRA 5CXGA 4PXIA 3Q0VA 2G3BA 3KKCA 2XDNA 2G7LA 4UDSA 3HE0A 4M3BA 1VI0A 1U9OA 3BTLA 4AUXA 2F07A 3COLA 1JTXA 4AF5A 2RAEA 3KZ9A 1UI5A 3BHQA 5FKMA 3TP3A 3IH2A 2HXIA 3IUVA 2XPWA 1T56A 3V6GA 4D7NA 3BR5A 3DEWA 2G7GA 5K58A 2NS7A 2VKEA 3KKDA 2QWTA 3QQAA 2V57A 3QBMA 3VVXA 3IH4A 2ZB9A 2GBYA 3C2BA 4G12A 2RHAA 4ICHA 2JK3A 3HGGA 3O60A 3O8GA 2HXOA 4W97A 2HYTA 2IEKA 4L62A 2W53A 2WV1A 5J1RA 3LSPA 3NI7A 1QVTA 2OPTA 2UXIA 3F1BA 3RD3A 3FK7A 2G7SA 3AQTA 2UXOA 3BTJA 4X1EA 3BR3A 4ACIA 3VW1A 3G1MA 1BJZA 1RKTA 4W1UA 3LOCA
chains in the Genus database with same CATH superfamily
2UXPA 3ON4A 4MO7A 2QTQA 2PZ9A 5CW8A 3O8HA 2Y30A 5AQCA 2VKVA 4ME9A 5GPAA 5F1JA 2HKUA 2TCTA 4U9LA 5IOZA 3Q0UA 1Z0XA 3G1OA 2UXUA 4MXMA 3B81A 3BCGA 4M3GA 2DG7A 1U9NA 2B1EA 2XRLA 2Y31A 3LHQA 3BR2A 4GCKA 3G1LA 5J1UA 3NNRA 5H9TA 2R7WA 5EYRA 2IBDA 2OERA 3BT9A 2NP3A 5F0HA 4M3FA 5CQGA 4CGRA 3ZQHA 2XPUA 2FQ4A 3FRQA 2ZCNA 3EUPA 3HTAA 3TP0A 1T33A 2ZOYA 5F0CA 4GCLA 4KWAA 5K7HA 2XB5A 2OI8A 3VIBA 4B3AA 3VVYA 5FHPA 3LJLA 4D5CA 3G7RA 4GFLA 5HAWA 3NRGA 2YVHA 3VVZA 2R7XA 2Y2ZA 3BNIA 3T6NA 3BTIA 3ON2A 4IRVA 2DTZA 2Q24A 3HTIA 3G56A 2GENA 4ABZA 5F08A 3VW0A 5D18A 3CRJA 3GEUA 3BR0A 2I10A 2QCOA 3SFIA 2R7SA 3FHNA 3VPRA 3AQSA 3SDGA 2R7QA 3Q3SA 5F04A 2O7OA 3PM1A 1JUPA 2UXHA 3QKXA 4GFKA 3VTIA 3HTHA 2DG8A 2ZOZA 1Z77A 5FKNA 2ZCMA 2G0EA 4OD4A 5FKOA 2JJ7A 3WHBA 3BRUA 3ZQIA 1ZK8A 4JNNA 3P9TA 3CJDA 5GPCA 2FD5A 3HGYA 5J1YA 2HYJA 2HQ5A 3MNLA 2GUHA 2XGCA 4I76A 3DPJA 3ANPA 4V2GA 4JL3A 2TRTA 2WGBA 5FKLA 4DW6A 5C4YA 2NX4A 3LSRA 2NP5A 2REKA 3ZQFA 3LSJA 2FBQA 3NXCA 5K7ZA 3B6CA 4AC6A 2QIBA 2PFVA 1JTYA 4B1RA 4MK6A 5K7FA 4XK4A 3KNWA 3LWJA 5D19A 3CCYA 2QOPA 3K8PC 4C2MA 1JT0A 1ORKA 5J3LA 4JYKA 4JKZA 5IOYA 5FMPA 4NELA 4OD5A 4GCTA 5FGLA 5F0FA 3S5RA 3EGQA 2XPVA 3PPBA 2ZY9A 1QVUA 2NS8A 5CXIA 3C07A 2O7TA 1UI6A 3Q0WA 3V78A 3E7QA 3VP5A 3BTCA 3FK6A 3RH2A 1RPWA 2IAIA 2ZCXA 3DU5A 1SGMA 2X9DA 2FJ1A 3MVPA 3QPLA 4M3DA 1JUMA 2PBXA 3CDLA 3JSJA 2IU5A 3VOXA 3CWRA 4NN1A 4D5FA 2R7VA 2FJI1 2ID6A 3HIMA 3BQYA 3DU6A 2FX0A 2XGDA 2GFNA 3FIWA 5EFYA 4YZEA 1A6IA 4WIBA 2WUIA 1QPIA 4U9NA 5EZGA 3BR1A 2ID3A 2B3WA 4M3EA 4I6ZA 3ZQLA 4HKUA 2RASA 4AC0A 5F27A 5HSZA 3ANGA 5GP9A 3VOKA 3WHCA 1ZKGA 3GZIA 3VW2A 3HTJA 3QPSA 5IP6A 3DCFA 5IPAA 3IH3A 5HBUA 5DAJA 5EZHA 3BR6A 3KYLA 3VUQA 2D6YA 2YVEA 5D1RA 2EH3A 3BJBA 4V2FA 1JT6A 3PASA 2QKOA 2OF7A 3NPIA 3NS4A 3ZQGA 1RKWA 2X6OA 5FKKA 3BQZA 4D7MA 3F0CA 2XGEA 1JUSA 3B6AA 2VPRA 5CXGA 4PXIA 3Q0VA 2G3BA 3KKCA 2A2FX 2XDNA 2G7LA 4UDSA 3HE0A 4M3BA 1VI0A 1U9OA 3BTLA 4AUXA 2F07A 2R7TA 3COLA 1JTXA 4AF5A 2RAEA 3KZ9A 1UI5A 3BHQA 5FKMA 3TP3A 3IH2A 2HXIA 3IUVA 2XPWA 1T56A 3V6GA 4D7NA 3BR5A 3DEWA 2G7GA 5K58A 2NS7A 2VKEA 3KKDA 2QWTA 3QQAA 2V57A 3QBMA 3VVXA 3IH4A 2ZB9A 2GBYA 3C2BA 4G12A 2R7RA 2RHAA 4ICHA 2JK3A 3HGGA 3O60A 3O8GA 2R7UA 2HXOA 4W97A 2HYTA 2IEKA 4DVYP 2YVXA 4L62A 2W53A 2WV1A 5J1RA 3LSPA 3NI7A 1QVTA 2OPTA 2UXIA 3F1BA 3RD3A 3FK7A 2G7SA 3AQTA 2UXOA 3BTJA 3SWHA 4X1EA 2R7OA 3BR3A 4ACIA 3VW1A 3G1MA 1BJZA 1RKTA 4W1UA 3LOCA
chains in the Genus database with same CATH topology
2UXPA 3ON4A 4MO7A 2QTQA 2PZ9A 5CW8A 3O8HA 2Y30A 5AQCA 2VKVA 4ME9A 5GPAA 5F1JA 2HKUA 2TCTA 5IOZA 3Q0UA 1Z0XA 3G1OA 2UXUA 4MXMA 3B81A 3BCGA 4M3GA 2DG7A 1U9NA 2XRLA 2Y31A 3LHQA 3BR2A 4GCKA 3G1LA 5J1UA 3NNRA 5H9TA 5EYRA 2IBDA 2OERA 3BT9A 2NP3A 5F0HA 4M3FA 4CGRA 3ZQHA 2XPUA 2FQ4A 3FRQA 2ZCNA 3EUPA 3HTAA 3TP0A 1T33A 2ZOYA 5F0CA 4GCLA 4KWAA 5K7HA 2XB5A 2OI8A 3VIBA 4B3AA 3VVYA 5FHPA 3LJLA 4D5CA 3G7RA 4GFLA 5HAWA 3NRGA 2YVHA 3VVZA 2Y2ZA 3BNIA 3T6NA 3BTIA 3ON2A 2DTZA 2Q24A 3HTIA 3G56A 2GENA 4ABZA 5F08A 3VW0A 5D18A 3CRJA 3GEUA 3BR0A 2I10A 2QCOA 3SFIA 3VPRA 3AQSA 3SDGA 3Q3SA 5F04A 2O7OA 3PM1A 1JUPA 2UXHA 3QKXA 4GFKA 3HTHA 2DG8A 2ZOZA 1Z77A 5FKNA 2ZCMA 2G0EA 5FKOA 2JJ7A 3WHBA 3BRUA 3ZQIA 1ZK8A 4JNNA 3P9TA 3CJDA 5GPCA 2FD5A 3HGYA 5J1YA 2HYJA 2HQ5A 3MNLA 2GUHA 2XGCA 4I76A 3DPJA 3ANPA 4V2GA 4JL3A 2TRTA 2WGBA 5FKLA 4DW6A 5C4YA 2NX4A 3LSRA 2NP5A 2REKA 3ZQFA 3LSJA 2FBQA 3NXCA 5K7ZA 3B6CA 4AC6A 2QIBA 1JTYA 4B1RA 4MK6A 5K7FA 4XK4A 3KNWA 3LWJA 5D19A 3CCYA 2QOPA 1JT0A 1ORKA 5J3LA 4JYKA 4JKZA 5IOYA 5FMPA 4NELA 4GCTA 5FGLA 5F0FA 3S5RA 3EGQA 2XPVA 3PPBA 1QVUA 2NS8A 5CXIA 3C07A 2O7TA 1UI6A 3Q0WA 3V78A 3E7QA 3VP5A 3BTCA 3FK6A 3RH2A 1RPWA 2IAIA 2ZCXA 1SGMA 2X9DA 2FJ1A 3MVPA 3QPLA 4M3DA 1JUMA 2PBXA 3CDLA 3JSJA 2IU5A 3VOXA 3CWRA 4NN1A 4D5FA 2ID6A 3HIMA 3BQYA 2FX0A 2XGDA 2GFNA 3FIWA 5EFYA 4YZEA 1A6IA 2WUIA 1QPIA 5EZGA 3BR1A 2ID3A 4M3EA 4I6ZA 3ZQLA 4HKUA 2RASA 4AC0A 5F27A 5HSZA 3ANGA 5GP9A 3VOKA 3WHCA 1ZKGA 3GZIA 3VW2A 3HTJA 3QPSA 5IP6A 3DCFA 5IPAA 3IH3A 5HBUA 5DAJA 5EZHA 3BR6A 3VUQA 2D6YA 2YVEA 5D1RA 2EH3A 3BJBA 4V2FA 1JT6A 3PASA 2QKOA 2OF7A 3NPIA 3ZQGA 1RKWA 2X6OA 5FKKA 3BQZA 4D7MA 3F0CA 2XGEA 1JUSA 3B6AA 2VPRA 5CXGA 4PXIA 3Q0VA 2G3BA 3KKCA 2XDNA 2G7LA 4UDSA 3HE0A 4M3BA 1VI0A 1U9OA 3BTLA 4AUXA 2F07A 3COLA 1JTXA 4AF5A 2RAEA 3KZ9A 1UI5A 3BHQA 5FKMA 3TP3A 3IH2A 2HXIA 3IUVA 2XPWA 1T56A 3V6GA 4D7NA 3BR5A 3DEWA 2G7GA 5K58A 2NS7A 2VKEA 3KKDA 2QWTA 3QQAA 2V57A 3QBMA 3VVXA 3IH4A 2ZB9A 2GBYA 3C2BA 4G12A 2RHAA 4ICHA 2JK3A 3HGGA 3O60A 3O8GA 2HXOA 4W97A 2HYTA 2IEKA 4L62A 2W53A 2WV1A 5J1RA 3LSPA 3NI7A 1QVTA 2OPTA 2UXIA 3F1BA 3RD3A 3FK7A 2G7SA 3AQTA 2UXOA 3BTJA 4X1EA 3BR3A 4ACIA 3VW1A 3G1MA 1BJZA 1RKTA 4W1UA 3LOCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UXP A;  3ON4 A;  4MO7 A;  2QTQ A;  2PZ9 A;  5CW8 A;  3O8H A;  2Y30 A;  5AQC A;  2VKV A;  4ME9 A;  5GPA A;  5F1J A;  2HKU A;  2TCT A;  5IOZ A;  3Q0U A;  1Z0X A;  3G1O A;  2UXU A;  4MXM A;  3B81 A;  3BCG A;  4M3G A;  2DG7 A;  1U9N A;  2XRL A;  2Y31 A;  3LHQ A;  3BR2 A;  4GCK A;  3G1L A;  5J1U A;  3NNR A;  5H9T A;  5EYR A;  2IBD A;  2OER A;  3BT9 A;  2NP3 A;  5F0H A;  4M3F A;  4CGR A;  3ZQH A;  2XPU A;  2FQ4 A;  3FRQ A;  2ZCN A;  3EUP A;  3HTA A;  3TP0 A;  1T33 A;  2ZOY A;  5F0C A;  4GCL A;  4KWA A;  5K7H A;  2XB5 A;  2OI8 A;  3VIB A;  4B3A A;  3VVY A;  5FHP A;  3LJL A;  4D5C A;  3G7R A;  4GFL A;  5HAW A;  3NRG A;  2YVH A;  3VVZ A;  2Y2Z A;  3BNI A;  3T6N A;  3BTI A;  3ON2 A;  2DTZ A;  2Q24 A;  3HTI A;  3G56 A;  2GEN A;  4ABZ A;  5F08 A;  3VW0 A;  5D18 A;  3CRJ A;  3GEU A;  3BR0 A;  2I10 A;  2QCO A;  3SFI A;  3VPR A;  3AQS A;  3SDG A;  3Q3S A;  5F04 A;  2O7O A;  3PM1 A;  1JUP A;  2UXH A;  3QKX A;  4GFK A;  3HTH A;  2DG8 A;  2ZOZ A;  1Z77 A;  5FKN A;  2ZCM A;  2G0E A;  5FKO A;  2JJ7 A;  3WHB A;  3BRU A;  3ZQI A;  1ZK8 A;  4JNN A;  3P9T A;  3CJD A;  5GPC A;  2FD5 A;  3HGY A;  5J1Y A;  2HYJ A;  2HQ5 A;  3MNL A;  2GUH A;  2XGC A;  4I76 A;  3DPJ A;  3ANP A;  4V2G A;  4JL3 A;  2TRT A;  2WGB A;  5FKL A;  4DW6 A;  5C4Y A;  2NX4 A;  3LSR A;  2NP5 A;  2REK A;  3ZQF A;  3LSJ A;  2FBQ A;  3NXC A;  5K7Z A;  3B6C A;  4AC6 A;  2QIB A;  1JTY A;  4B1R A;  4MK6 A;  5K7F A;  4XK4 A;  3KNW A;  3LWJ A;  5D19 A;  3CCY A;  2QOP A;  1JT0 A;  1ORK A;  5J3L A;  4JYK A;  4JKZ A;  5IOY A;  5FMP A;  4NEL A;  4GCT A;  5FGL A;  5F0F A;  3S5R A;  3EGQ A;  2XPV A;  3PPB A;  1QVU A;  2NS8 A;  5CXI A;  3C07 A;  2O7T A;  1UI6 A;  3Q0W A;  3V78 A;  3E7Q A;  3VP5 A;  3BTC A;  3FK6 A;  3RH2 A;  1RPW A;  2IAI A;  2ZCX A;  1SGM A;  2X9D A;  2FJ1 A;  3MVP A;  3QPL A;  4M3D A;  1JUM A;  2PBX A;  3CDL A;  3JSJ A;  2IU5 A;  3VOX A;  3CWR A;  4NN1 A;  4D5F A;  2ID6 A;  3HIM A;  3BQY A;  2FX0 A;  2XGD A;  2GFN A;  3FIW A;  5EFY A;  4YZE A;  1A6I A;  2WUI A;  1QPI A;  5EZG A;  3BR1 A;  2ID3 A;  4M3E A;  4I6Z A;  3ZQL A;  4HKU A;  2RAS A;  4AC0 A;  5F27 A;  5HSZ A;  3ANG A;  5GP9 A;  3VOK A;  3WHC A;  1ZKG A;  3GZI A;  3VW2 A;  3HTJ A;  3QPS A;  5IP6 A;  3DCF A;  5IPA A;  3IH3 A;  5HBU A;  5DAJ A;  5EZH A;  3BR6 A;  3VUQ A;  2D6Y A;  2YVE A;  5D1R A;  2EH3 A;  3BJB A;  4V2F A;  1JT6 A;  3PAS A;  2QKO A;  2OF7 A;  3NPI A;  3ZQG A;  1RKW A;  2X6O A;  5FKK A;  3BQZ A;  4D7M A;  3F0C A;  2XGE A;  1JUS A;  3B6A A;  2VPR A;  5CXG A;  4PXI A;  3Q0V A;  2G3B A;  3KKC A;  2XDN A;  2G7L A;  4UDS A;  3HE0 A;  4M3B A;  1VI0 A;  1U9O A;  3BTL A;  4AUX A;  2F07 A;  3COL A;  1JTX A;  4AF5 A;  2RAE A;  3KZ9 A;  1UI5 A;  3BHQ A;  5FKM A;  3TP3 A;  3IH2 A;  2HXI A;  3IUV A;  2XPW A;  1T56 A;  3V6G A;  4D7N A;  3BR5 A;  3DEW A;  2G7G A;  5K58 A;  2NS7 A;  2VKE A;  3KKD A;  2QWT A;  3QQA A;  2V57 A;  3QBM A;  3VVX A;  3IH4 A;  2ZB9 A;  2GBY A;  3C2B A;  4G12 A;  2RHA A;  4ICH A;  2JK3 A;  3HGG A;  3O60 A;  3O8G A;  2HXO A;  4W97 A;  2HYT A;  2IEK A;  4L62 A;  2W53 A;  2WV1 A;  5J1R A;  3LSP A;  3NI7 A;  1QVT A;  2OPT A;  2UXI A;  3F1B A;  3RD3 A;  3FK7 A;  2G7S A;  3AQT A;  2UXO A;  3BTJ A;  4X1E A;  3BR3 A;  4ACI A;  3VW1 A;  3G1M A;  1BJZ A;  1RKT A;  4W1U A;  3LOC A; 
#chains in the Genus database with same CATH topology
 2UXP A;  3ON4 A;  4MO7 A;  2QTQ A;  2PZ9 A;  5CW8 A;  3O8H A;  2Y30 A;  5AQC A;  2VKV A;  4ME9 A;  5GPA A;  5F1J A;  2HKU A;  2TCT A;  4U9L A;  5IOZ A;  3Q0U A;  1Z0X A;  3G1O A;  2UXU A;  4MXM A;  3B81 A;  3BCG A;  4M3G A;  2DG7 A;  1U9N A;  2B1E A;  2XRL A;  2Y31 A;  3LHQ A;  3BR2 A;  4GCK A;  3G1L A;  5J1U A;  3NNR A;  5H9T A;  2R7W A;  5EYR A;  2IBD A;  2OER A;  3BT9 A;  2NP3 A;  5F0H A;  4M3F A;  5CQG A;  4CGR A;  3ZQH A;  2XPU A;  2FQ4 A;  3FRQ A;  2ZCN A;  3EUP A;  3HTA A;  3TP0 A;  1T33 A;  2ZOY A;  5F0C A;  4GCL A;  4KWA A;  5K7H A;  2XB5 A;  2OI8 A;  3VIB A;  4B3A A;  3VVY A;  5FHP A;  3LJL A;  4D5C A;  3G7R A;  4GFL A;  5HAW A;  3NRG A;  2YVH A;  3VVZ A;  2R7X A;  2Y2Z A;  3BNI A;  3T6N A;  3BTI A;  3ON2 A;  4IRV A;  2DTZ A;  2Q24 A;  3HTI A;  3G56 A;  2GEN A;  4ABZ A;  5F08 A;  3VW0 A;  5D18 A;  3CRJ A;  3GEU A;  3BR0 A;  2I10 A;  2QCO A;  3SFI A;  2R7S A;  3FHN A;  3VPR A;  3AQS A;  3SDG A;  2R7Q A;  3Q3S A;  5F04 A;  2O7O A;  3PM1 A;  1JUP A;  2UXH A;  3QKX A;  4GFK A;  3VTI A;  3HTH A;  2DG8 A;  2ZOZ A;  1Z77 A;  5FKN A;  2ZCM A;  2G0E A;  4OD4 A;  5FKO A;  2JJ7 A;  3WHB A;  3BRU A;  3ZQI A;  1ZK8 A;  4JNN A;  3P9T A;  3CJD A;  5GPC A;  2FD5 A;  3HGY A;  5J1Y A;  2HYJ A;  2HQ5 A;  3MNL A;  2GUH A;  2XGC A;  4I76 A;  3DPJ A;  3ANP A;  4V2G A;  4JL3 A;  2TRT A;  2WGB A;  5FKL A;  4DW6 A;  5C4Y A;  2NX4 A;  3LSR A;  2NP5 A;  2REK A;  3ZQF A;  3LSJ A;  2FBQ A;  3NXC A;  5K7Z A;  3B6C A;  4AC6 A;  2QIB A;  2PFV A;  1JTY A;  4B1R A;  4MK6 A;  5K7F A;  4XK4 A;  3KNW A;  3LWJ A;  5D19 A;  3CCY A;  2QOP A;  3K8P C;  4C2M A;  1JT0 A;  1ORK A;  5J3L A;  4JYK A;  4JKZ A;  5IOY A;  5FMP A;  4NEL A;  4OD5 A;  4GCT A;  5FGL A;  5F0F A;  3S5R A;  3EGQ A;  2XPV A;  3PPB A;  2ZY9 A;  1QVU A;  2NS8 A;  5CXI A;  3C07 A;  2O7T A;  1UI6 A;  3Q0W A;  3V78 A;  3E7Q A;  3VP5 A;  3BTC A;  3FK6 A;  3RH2 A;  1RPW A;  2IAI A;  2ZCX A;  3DU5 A;  1SGM A;  2X9D A;  2FJ1 A;  3MVP A;  3QPL A;  4M3D A;  1JUM A;  2PBX A;  3CDL A;  3JSJ A;  2IU5 A;  3VOX A;  3CWR A;  4NN1 A;  4D5F A;  2R7V A;  2FJI 1;  2ID6 A;  3HIM A;  3BQY A;  3DU6 A;  2FX0 A;  2XGD A;  2GFN A;  3FIW A;  5EFY A;  4YZE A;  1A6I A;  4WIB A;  2WUI A;  1QPI A;  4U9N A;  5EZG A;  3BR1 A;  2ID3 A;  2B3W A;  4M3E A;  4I6Z A;  3ZQL A;  4HKU A;  2RAS A;  4AC0 A;  5F27 A;  5HSZ A;  3ANG A;  5GP9 A;  3VOK A;  3WHC A;  1ZKG A;  3GZI A;  3VW2 A;  3HTJ A;  3QPS A;  5IP6 A;  3DCF A;  5IPA A;  3IH3 A;  5HBU A;  5DAJ A;  5EZH A;  3BR6 A;  3KYL A;  3VUQ A;  2D6Y A;  2YVE A;  5D1R A;  2EH3 A;  3BJB A;  4V2F A;  1JT6 A;  3PAS A;  2QKO A;  2OF7 A;  3NPI A;  3NS4 A;  3ZQG A;  1RKW A;  2X6O A;  5FKK A;  3BQZ A;  4D7M A;  3F0C A;  2XGE A;  1JUS A;  3B6A A;  2VPR A;  5CXG A;  4PXI A;  3Q0V A;  2G3B A;  3KKC A;  2A2F X;  2XDN A;  2G7L A;  4UDS A;  3HE0 A;  4M3B A;  1VI0 A;  1U9O A;  3BTL A;  4AUX A;  2F07 A;  2R7T A;  3COL A;  1JTX A;  4AF5 A;  2RAE A;  3KZ9 A;  1UI5 A;  3BHQ A;  5FKM A;  3TP3 A;  3IH2 A;  2HXI A;  3IUV A;  2XPW A;  1T56 A;  3V6G A;  4D7N A;  3BR5 A;  3DEW A;  2G7G A;  5K58 A;  2NS7 A;  2VKE A;  3KKD A;  2QWT A;  3QQA A;  2V57 A;  3QBM A;  3VVX A;  3IH4 A;  2ZB9 A;  2GBY A;  3C2B A;  4G12 A;  2R7R A;  2RHA A;  4ICH A;  2JK3 A;  3HGG A;  3O60 A;  3O8G A;  2R7U A;  2HXO A;  4W97 A;  2HYT A;  2IEK A;  4DVY P;  2YVX A;  4L62 A;  2W53 A;  2WV1 A;  5J1R A;  3LSP A;  3NI7 A;  1QVT A;  2OPT A;  2UXI A;  3F1B A;  3RD3 A;  3FK7 A;  2G7S A;  3AQT A;  2UXO A;  3BTJ A;  3SWH A;  4X1E A;  2R7O A;  3BR3 A;  4ACI A;  3VW1 A;  3G1M A;  1BJZ A;  1RKT A;  4W1U A;  3LOC A; 
#chains in the Genus database with same CATH homology
 2UXP A;  3ON4 A;  4MO7 A;  2QTQ A;  2PZ9 A;  5CW8 A;  3O8H A;  2Y30 A;  5AQC A;  2VKV A;  4ME9 A;  5GPA A;  5F1J A;  2HKU A;  2TCT A;  5IOZ A;  3Q0U A;  1Z0X A;  3G1O A;  2UXU A;  4MXM A;  3B81 A;  3BCG A;  4M3G A;  2DG7 A;  1U9N A;  2XRL A;  2Y31 A;  3LHQ A;  3BR2 A;  4GCK A;  3G1L A;  5J1U A;  3NNR A;  5H9T A;  5EYR A;  2IBD A;  2OER A;  3BT9 A;  2NP3 A;  5F0H A;  4M3F A;  4CGR A;  3ZQH A;  2XPU A;  2FQ4 A;  3FRQ A;  2ZCN A;  3EUP A;  3HTA A;  3TP0 A;  1T33 A;  2ZOY A;  5F0C A;  4GCL A;  4KWA A;  5K7H A;  2XB5 A;  2OI8 A;  3VIB A;  4B3A A;  3VVY A;  5FHP A;  3LJL A;  4D5C A;  3G7R A;  4GFL A;  5HAW A;  3NRG A;  2YVH A;  3VVZ A;  2Y2Z A;  3BNI A;  3T6N A;  3BTI A;  3ON2 A;  2DTZ A;  2Q24 A;  3HTI A;  3G56 A;  2GEN A;  4ABZ A;  5F08 A;  3VW0 A;  5D18 A;  3CRJ A;  3GEU A;  3BR0 A;  2I10 A;  2QCO A;  3SFI A;  3VPR A;  3AQS A;  3SDG A;  3Q3S A;  5F04 A;  2O7O A;  3PM1 A;  1JUP A;  2UXH A;  3QKX A;  4GFK A;  3HTH A;  2DG8 A;  2ZOZ A;  1Z77 A;  5FKN A;  2ZCM A;  2G0E A;  5FKO A;  2JJ7 A;  3WHB A;  3BRU A;  3ZQI A;  1ZK8 A;  4JNN A;  3P9T A;  3CJD A;  5GPC A;  2FD5 A;  3HGY A;  5J1Y A;  2HYJ A;  2HQ5 A;  3MNL A;  2GUH A;  2XGC A;  4I76 A;  3DPJ A;  3ANP A;  4V2G A;  4JL3 A;  2TRT A;  2WGB A;  5FKL A;  4DW6 A;  5C4Y A;  2NX4 A;  3LSR A;  2NP5 A;  2REK A;  3ZQF A;  3LSJ A;  2FBQ A;  3NXC A;  5K7Z A;  3B6C A;  4AC6 A;  2QIB A;  1JTY A;  4B1R A;  4MK6 A;  5K7F A;  4XK4 A;  3KNW A;  3LWJ A;  5D19 A;  3CCY A;  2QOP A;  1JT0 A;  1ORK A;  5J3L A;  4JYK A;  4JKZ A;  5IOY A;  5FMP A;  4NEL A;  4GCT A;  5FGL A;  5F0F A;  3S5R A;  3EGQ A;  2XPV A;  3PPB A;  1QVU A;  2NS8 A;  5CXI A;  3C07 A;  2O7T A;  1UI6 A;  3Q0W A;  3V78 A;  3E7Q A;  3VP5 A;  3BTC A;  3FK6 A;  3RH2 A;  1RPW A;  2IAI A;  2ZCX A;  1SGM A;  2X9D A;  2FJ1 A;  3MVP A;  3QPL A;  4M3D A;  1JUM A;  2PBX A;  3CDL A;  3JSJ A;  2IU5 A;  3VOX A;  3CWR A;  4NN1 A;  4D5F A;  2ID6 A;  3HIM A;  3BQY A;  2FX0 A;  2XGD A;  2GFN A;  3FIW A;  5EFY A;  4YZE A;  1A6I A;  2WUI A;  1QPI A;  5EZG A;  3BR1 A;  2ID3 A;  4M3E A;  4I6Z A;  3ZQL A;  4HKU A;  2RAS A;  4AC0 A;  5F27 A;  5HSZ A;  3ANG A;  5GP9 A;  3VOK A;  3WHC A;  1ZKG A;  3GZI A;  3VW2 A;  3HTJ A;  3QPS A;  5IP6 A;  3DCF A;  5IPA A;  3IH3 A;  5HBU A;  5DAJ A;  5EZH A;  3BR6 A;  3VUQ A;  2D6Y A;  2YVE A;  5D1R A;  2EH3 A;  3BJB A;  4V2F A;  1JT6 A;  3PAS A;  2QKO A;  2OF7 A;  3NPI A;  3ZQG A;  1RKW A;  2X6O A;  5FKK A;  3BQZ A;  4D7M A;  3F0C A;  2XGE A;  1JUS A;  3B6A A;  2VPR A;  5CXG A;  4PXI A;  3Q0V A;  2G3B A;  3KKC A;  2XDN A;  2G7L A;  4UDS A;  3HE0 A;  4M3B A;  1VI0 A;  1U9O A;  3BTL A;  4AUX A;  2F07 A;  3COL A;  1JTX A;  4AF5 A;  2RAE A;  3KZ9 A;  1UI5 A;  3BHQ A;  5FKM A;  3TP3 A;  3IH2 A;  2HXI A;  3IUV A;  2XPW A;  1T56 A;  3V6G A;  4D7N A;  3BR5 A;  3DEW A;  2G7G A;  5K58 A;  2NS7 A;  2VKE A;  3KKD A;  2QWT A;  3QQA A;  2V57 A;  3QBM A;  3VVX A;  3IH4 A;  2ZB9 A;  2GBY A;  3C2B A;  4G12 A;  2RHA A;  4ICH A;  2JK3 A;  3HGG A;  3O60 A;  3O8G A;  2HXO A;  4W97 A;  2HYT A;  2IEK A;  4L62 A;  2W53 A;  2WV1 A;  5J1R A;  3LSP A;  3NI7 A;  1QVT A;  2OPT A;  2UXI A;  3F1B A;  3RD3 A;  3FK7 A;  2G7S A;  3AQT A;  2UXO A;  3BTJ A;  4X1E A;  3BR3 A;  4ACI A;  3VW1 A;  3G1M A;  1BJZ A;  1RKT A;  4W1U A;  3LOC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...