3JSJA

Crystal structure of a putative tetr-transcriptional regulator (sav143) from streptomyces avermitilis ma-4680 at 2.10 a resolution
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
184
structure length
184
Chain Sequence
KQSPRERLLEAAAALTYRDGVGIGVEALCKAAGVSKRSMYQLFESKDELLAASLKERSAAFVAKALPPADDGRSPRERILYVFERVESQAGAPDFQGCRYLAVQIELKDQAHPASRVAYQIKADLMAFFRSEAERGGASDPDLLARQLILVFDGASARAGIGADNLTGLIVPTLTTLLDAADMH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative TetR-family transcriptional regulator
publication title Crystal structure of Putative transcriptional regulator (NP_821317.1) from Streptomyces avermitilis MA-4680 at 2.10 A resolution
rcsb
source organism Streptomyces avermitilis ma-4680
molecule tags Transcription
total genus 68
structure length 184
sequence length 184
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3jsjA00
2FBQA 3QPLA 3BR5A 5AQCA 1A6IA 3HGGA 3HTJA 3VVYA 3WHBA 3ON4A 3WHCA 3B6AA 3CWRA 3GEUA 5FKMA 2DG7A 5EZHA 4X1EA 3DCFA 5J1YA 3BR3A 3BR0A 2YVHA 2QTQA 4W97A 3RD3A 1T56A 1JUSA 3HIMA 1JUMA 3C07A 1JTXA 3IH4A 5FKLA 3PASA 3ZQFA 3NI7A 4KWAA 3O8HA 4MO7A 3O8GA 2G7LA 3DPJA 3BT9A 4DW6A 3FK7A 3DEWA 3QBMA 2ZCXA 2NX4A 3CCYA 2QIBA 2WV1A 3VVZA 2ID6A 5GPCA 4GCLA 3S5RA 3P9TA 5FKOA 3GZIA 2HYTA 5F1JA 2V57A 2I10A 5J1UA 5H9TA 5K7ZA 5FKNA 3LSRA 2FX0A 3FIWA 3LJLA 2RASA 2HKUA 4HKUA 2UXHA 2XGEA 1Z77A 1RKWA 5FHPA 4M3DA 3BCGA 5C4YA 5IPAA 3EUPA 4L62A 3TP0A 1ZKGA 2ZCNA 4V2GA 3ZQIA 4MXMA 2PZ9A 3BTIA 3VUQA 5K7FA 5J1RA 2GUHA 1RKTA 2IBDA 5D19A 3NNRA 2Y2ZA 5F04A 2QKOA 2G0EA 2YVEA 3VVXA 1QPIA 3AQTA 3VW2A 3PM1A 1RPWA 3Q3SA 3BHQA 3TP3A 3BTLA 2QOPA 4ACIA 5D1RA 2HQ5A 3SFIA 3BR2A 2HXIA 2GFNA 3ZQLA 3IH2A 3KKCA 3CDLA 5F0FA 4ABZA 2XPWA 3VOXA 3F1BA 2REKA 3IH3A 5F0HA 3NRGA 3O60A 1QVUA 2X6OA 1BJZA 4XK4A 3ZQHA 3KZ9A 3RH2A 3Q0VA 4AUXA 2WGBA 2FJ1A 3NXCA 2FD5A 2Q24A 3B6CA 1T33A 2TCTA 2WUIA 5HSZA 2HYJA 3HTIA 4B1RA 3BQYA 3COLA 2NS7A 1QVTA 2XGCA 3IUVA 3BR6A 2IAIA 4M3GA 5GP9A 2IEKA 2GBYA 1Z0XA 3G7RA 3HTAA 2ZCMA 5J3LA 5EZGA 3ON2A 3E7QA 1JTYA 5K58A 2ZOYA 2OERA 3HGYA 2NP5A 2Y31A 4NELA 3VW1A 4D7MA 3VIBA 2VKVA 3V6GA 5FGLA 3VPRA 2PBXA 2O7TA 5F0CA 4JL3A 5CXGA 5F27A 3BTJA 5HAWA 4MK6A 4D5FA 4V2FA 3C2BA 2NP3A 3VW0A 1SGMA 4M3BA 2Y30A 4NN1A 1ZK8A 3SDGA 1U9OA 2DG8A 1ORKA 3QPSA 1JUPA 4AF5A 5IOYA 3T6NA 4GCTA 4D7NA 4M3FA 3Q0WA 3FK6A 3MNLA 2W53A 3BRUA 3G1MA 5D18A 2ID3A 2UXIA 4D5CA 2RAEA 1JT6A 3HTHA 2TRTA 5F08A 3V78A 3G56A 2OI8A 5HBUA 3KNWA 2X9DA 3G1LA 3VOKA 3LSJA 3G1OA 2XGDA 2OF7A 4JYKA 2D6YA 1VI0A 3JSJA 2IU5A 4I6ZA 2QWTA 3MVPA 3QQAA 2HXOA 3BTCA 4GFLA 2XRLA 3B81A 3BR1A 2QCOA 3LOCA 3NPIA 4UDSA 2JJ7A 4AC0A 4W1UA 2JK3A 3BNIA 3QKXA 3CRJA 2ZB9A 2DTZA 3BQZA 5DAJA 4G12A 4CGRA 1UI6A 4GFKA 2NS8A 2FQ4A 3BJBA 4AC6A 5IP6A 2VKEA 2VPRA 1JT0A 4YZEA 5EFYA 2G7GA 2F07A 3AQSA 2ZOZA 4ICHA 2OPTA 5CW8A 2UXPA 4JKZA 4B3AA 4JNNA 2XPUA 5CXIA 2G3BA 4M3EA 5FKKA 3CJDA 2G7SA 2RHAA 5IOZA 3ZQGA 3EGQA 2O7OA 3HE0A 3LWJA 5EYRA 2EH3A 4ME9A 2UXOA 2XB5A 2XDNA 5K7HA 3ANPA 4GCKA 3LSPA 4PXIA 3KKDA 4I76A 1UI5A 3FRQA 2GENA 3LHQA 3Q0UA 2XPVA 3VP5A 5FMPA 1U9NA 2UXUA 3PPBA 3ANGA 5GPAA 3F0CA
chains in the Genus database with same CATH superfamily
2FBQA 3QPLA 3BR5A 5AQCA 3K8PC 1A6IA 3HGGA 2R7VA 3HTJA 3VVYA 3WHBA 3ON4A 3WHCA 3B6AA 3CWRA 3NS4A 3GEUA 5FKMA 2DG7A 5EZHA 4X1EA 3DCFA 5J1YA 3BR3A 3BR0A 2YVHA 2QTQA 4W97A 4U9NA 3RD3A 1T56A 1JUSA 3HIMA 1JUMA 3C07A 1JTXA 3IH4A 5FKLA 3PASA 3ZQFA 3NI7A 4KWAA 3O8HA 4MO7A 3O8GA 2G7LA 3DPJA 3BT9A 4DW6A 3FK7A 3DEWA 3QBMA 2ZCXA 2NX4A 3CCYA 2QIBA 2WV1A 3VVZA 2ID6A 5GPCA 4GCLA 3S5RA 3P9TA 5FKOA 3GZIA 2HYTA 5F1JA 2V57A 2I10A 5J1UA 5H9TA 5K7ZA 5FKNA 3LSRA 2FX0A 3FIWA 3LJLA 2R7RA 2RASA 2HKUA 4HKUA 2UXHA 2XGEA 1Z77A 1RKWA 5FHPA 4M3DA 3BCGA 4U9LA 5C4YA 5IPAA 2R7OA 3EUPA 4L62A 3TP0A 1ZKGA 2ZCNA 4V2GA 3ZQIA 4MXMA 2R7XA 2PZ9A 3BTIA 3VUQA 5K7FA 5J1RA 2GUHA 1RKTA 2IBDA 5D19A 3NNRA 2Y2ZA 5F04A 4OD4A 2QKOA 2G0EA 2YVEA 3VVXA 1QPIA 3AQTA 3VW2A 3PM1A 1RPWA 3Q3SA 3BHQA 3TP3A 3BTLA 2QOPA 4ACIA 2PFVA 5D1RA 3SWHA 2HQ5A 3SFIA 3BR2A 2HXIA 2GFNA 3ZQLA 3IH2A 3KKCA 3CDLA 5F0FA 4ABZA 2XPWA 3VOXA 2YVXA 2R7UA 3F1BA 2REKA 3IH3A 5F0HA 3NRGA 3O60A 1QVUA 3FHNA 2X6OA 1BJZA 4XK4A 3ZQHA 3KZ9A 3RH2A 3Q0VA 4AUXA 2WGBA 2FJ1A 3NXCA 4OD5A 2FD5A 2Q24A 3B6CA 1T33A 2TCTA 2WUIA 5HSZA 2HYJA 3HTIA 4B1RA 3BQYA 3COLA 2NS7A 1QVTA 2XGCA 3IUVA 3BR6A 2IAIA 4M3GA 4IRVA 5GP9A 2IEKA 2GBYA 1Z0XA 3G7RA 3HTAA 2ZCMA 5J3LA 5EZGA 3ON2A 3E7QA 1JTYA 5K58A 2ZOYA 2OERA 3HGYA 2NP5A 2Y31A 4DVYP 2FJI1 4NELA 3VW1A 4D7MA 3VIBA 2VKVA 3V6GA 5FGLA 3VPRA 2PBXA 2O7TA 5F0CA 4JL3A 3DU6A 5CXGA 5F27A 3BTJA 5HAWA 4MK6A 4D5FA 4V2FA 3C2BA 2NP3A 3VW0A 1SGMA 4M3BA 2Y30A 2R7TA 4NN1A 1ZK8A 3SDGA 3KYLA 1U9OA 2DG8A 1ORKA 3QPSA 1JUPA 4AF5A 5IOYA 3T6NA 4GCTA 4D7NA 4M3FA 3Q0WA 3FK6A 3MNLA 2W53A 3BRUA 3G1MA 5D18A 2ID3A 2UXIA 4D5CA 2RAEA 1JT6A 3HTHA 2TRTA 5F08A 3V78A 3G56A 2OI8A 2A2FX 5HBUA 3KNWA 2X9DA 3G1LA 3VOKA 3LSJA 3G1OA 2XGDA 2OF7A 4JYKA 2D6YA 1VI0A 3JSJA 2IU5A 4I6ZA 2QWTA 2B3WA 3MVPA 2R7SA 3QQAA 2HXOA 3VTIA 3BTCA 4GFLA 4WIBA 2XRLA 3B81A 3BR1A 2QCOA 3LOCA 3NPIA 4UDSA 2JJ7A 4AC0A 4W1UA 3DU5A 2JK3A 3BNIA 3QKXA 2B1EA 3CRJA 2ZB9A 2DTZA 3BQZA 5CQGA 5DAJA 4G12A 4CGRA 1UI6A 4GFKA 2NS8A 2FQ4A 3BJBA 2ZY9A 4AC6A 5IP6A 2VKEA 2VPRA 1JT0A 4YZEA 5EFYA 2R7QA 2G7GA 2F07A 3AQSA 2ZOZA 4ICHA 2OPTA 5CW8A 2UXPA 4JKZA 4B3AA 4JNNA 2R7WA 2XPUA 5CXIA 2G3BA 4M3EA 5FKKA 3CJDA 2G7SA 2RHAA 5IOZA 3ZQGA 3EGQA 2O7OA 3HE0A 3LWJA 5EYRA 2EH3A 4ME9A 4C2MA 2UXOA 2XB5A 2XDNA 5K7HA 3ANPA 4GCKA 3LSPA 4PXIA 3KKDA 4I76A 1UI5A 3FRQA 2GENA 3LHQA 3Q0UA 2XPVA 3VP5A 5FMPA 1U9NA 2UXUA 3PPBA 3ANGA 5GPAA 3F0CA
chains in the Genus database with same CATH topology
2FBQA 3QPLA 3BR5A 5AQCA 1A6IA 3HGGA 3HTJA 3VVYA 3WHBA 3ON4A 3WHCA 3B6AA 3CWRA 3GEUA 5FKMA 2DG7A 5EZHA 4X1EA 3DCFA 5J1YA 3BR3A 3BR0A 2YVHA 2QTQA 4W97A 3RD3A 1T56A 1JUSA 3HIMA 1JUMA 3C07A 1JTXA 3IH4A 5FKLA 3PASA 3ZQFA 3NI7A 4KWAA 3O8HA 4MO7A 3O8GA 2G7LA 3DPJA 3BT9A 4DW6A 3FK7A 3DEWA 3QBMA 2ZCXA 2NX4A 3CCYA 2QIBA 2WV1A 3VVZA 2ID6A 5GPCA 4GCLA 3S5RA 3P9TA 5FKOA 3GZIA 2HYTA 5F1JA 2V57A 2I10A 5J1UA 5H9TA 5K7ZA 5FKNA 3LSRA 2FX0A 3FIWA 3LJLA 2RASA 2HKUA 4HKUA 2UXHA 2XGEA 1Z77A 1RKWA 5FHPA 4M3DA 3BCGA 5C4YA 5IPAA 3EUPA 4L62A 3TP0A 1ZKGA 2ZCNA 4V2GA 3ZQIA 4MXMA 2PZ9A 3BTIA 3VUQA 5K7FA 5J1RA 2GUHA 1RKTA 2IBDA 5D19A 3NNRA 2Y2ZA 5F04A 2QKOA 2G0EA 2YVEA 3VVXA 1QPIA 3AQTA 3VW2A 3PM1A 1RPWA 3Q3SA 3BHQA 3TP3A 3BTLA 2QOPA 4ACIA 5D1RA 2HQ5A 3SFIA 3BR2A 2HXIA 2GFNA 3ZQLA 3IH2A 3KKCA 3CDLA 5F0FA 4ABZA 2XPWA 3VOXA 3F1BA 2REKA 3IH3A 5F0HA 3NRGA 3O60A 1QVUA 2X6OA 1BJZA 4XK4A 3ZQHA 3KZ9A 3RH2A 3Q0VA 4AUXA 2WGBA 2FJ1A 3NXCA 2FD5A 2Q24A 3B6CA 1T33A 2TCTA 2WUIA 5HSZA 2HYJA 3HTIA 4B1RA 3BQYA 3COLA 2NS7A 1QVTA 2XGCA 3IUVA 3BR6A 2IAIA 4M3GA 5GP9A 2IEKA 2GBYA 1Z0XA 3G7RA 3HTAA 2ZCMA 5J3LA 5EZGA 3ON2A 3E7QA 1JTYA 5K58A 2ZOYA 2OERA 3HGYA 2NP5A 2Y31A 4NELA 3VW1A 4D7MA 3VIBA 2VKVA 3V6GA 5FGLA 3VPRA 2PBXA 2O7TA 5F0CA 4JL3A 5CXGA 5F27A 3BTJA 5HAWA 4MK6A 4D5FA 4V2FA 3C2BA 2NP3A 3VW0A 1SGMA 4M3BA 2Y30A 4NN1A 1ZK8A 3SDGA 1U9OA 2DG8A 1ORKA 3QPSA 1JUPA 4AF5A 5IOYA 3T6NA 4GCTA 4D7NA 4M3FA 3Q0WA 3FK6A 3MNLA 2W53A 3BRUA 3G1MA 5D18A 2ID3A 2UXIA 4D5CA 2RAEA 1JT6A 3HTHA 2TRTA 5F08A 3V78A 3G56A 2OI8A 5HBUA 3KNWA 2X9DA 3G1LA 3VOKA 3LSJA 3G1OA 2XGDA 2OF7A 4JYKA 2D6YA 1VI0A 3JSJA 2IU5A 4I6ZA 2QWTA 3MVPA 3QQAA 2HXOA 3BTCA 4GFLA 2XRLA 3B81A 3BR1A 2QCOA 3LOCA 3NPIA 4UDSA 2JJ7A 4AC0A 4W1UA 2JK3A 3BNIA 3QKXA 3CRJA 2ZB9A 2DTZA 3BQZA 5DAJA 4G12A 4CGRA 1UI6A 4GFKA 2NS8A 2FQ4A 3BJBA 4AC6A 5IP6A 2VKEA 2VPRA 1JT0A 4YZEA 5EFYA 2G7GA 2F07A 3AQSA 2ZOZA 4ICHA 2OPTA 5CW8A 2UXPA 4JKZA 4B3AA 4JNNA 2XPUA 5CXIA 2G3BA 4M3EA 5FKKA 3CJDA 2G7SA 2RHAA 5IOZA 3ZQGA 3EGQA 2O7OA 3HE0A 3LWJA 5EYRA 2EH3A 4ME9A 2UXOA 2XB5A 2XDNA 5K7HA 3ANPA 4GCKA 3LSPA 4PXIA 3KKDA 4I76A 1UI5A 3FRQA 2GENA 3LHQA 3Q0UA 2XPVA 3VP5A 5FMPA 1U9NA 2UXUA 3PPBA 3ANGA 5GPAA 3F0CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FBQ A;  3QPL A;  3BR5 A;  5AQC A;  1A6I A;  3HGG A;  3HTJ A;  3VVY A;  3WHB A;  3ON4 A;  3WHC A;  3B6A A;  3CWR A;  3GEU A;  5FKM A;  2DG7 A;  5EZH A;  4X1E A;  3DCF A;  5J1Y A;  3BR3 A;  3BR0 A;  2YVH A;  2QTQ A;  4W97 A;  3RD3 A;  1T56 A;  1JUS A;  3HIM A;  1JUM A;  3C07 A;  1JTX A;  3IH4 A;  5FKL A;  3PAS A;  3ZQF A;  3NI7 A;  4KWA A;  3O8H A;  4MO7 A;  3O8G A;  2G7L A;  3DPJ A;  3BT9 A;  4DW6 A;  3FK7 A;  3DEW A;  3QBM A;  2ZCX A;  2NX4 A;  3CCY A;  2QIB A;  2WV1 A;  3VVZ A;  2ID6 A;  5GPC A;  4GCL A;  3S5R A;  3P9T A;  5FKO A;  3GZI A;  2HYT A;  5F1J A;  2V57 A;  2I10 A;  5J1U A;  5H9T A;  5K7Z A;  5FKN A;  3LSR A;  2FX0 A;  3FIW A;  3LJL A;  2RAS A;  2HKU A;  4HKU A;  2UXH A;  2XGE A;  1Z77 A;  1RKW A;  5FHP A;  4M3D A;  3BCG A;  5C4Y A;  5IPA A;  3EUP A;  4L62 A;  3TP0 A;  1ZKG A;  2ZCN A;  4V2G A;  3ZQI A;  4MXM A;  2PZ9 A;  3BTI A;  3VUQ A;  5K7F A;  5J1R A;  2GUH A;  1RKT A;  2IBD A;  5D19 A;  3NNR A;  2Y2Z A;  5F04 A;  2QKO A;  2G0E A;  2YVE A;  3VVX A;  1QPI A;  3AQT A;  3VW2 A;  3PM1 A;  1RPW A;  3Q3S A;  3BHQ A;  3TP3 A;  3BTL A;  2QOP A;  4ACI A;  5D1R A;  2HQ5 A;  3SFI A;  3BR2 A;  2HXI A;  2GFN A;  3ZQL A;  3IH2 A;  3KKC A;  3CDL A;  5F0F A;  4ABZ A;  2XPW A;  3VOX A;  3F1B A;  2REK A;  3IH3 A;  5F0H A;  3NRG A;  3O60 A;  1QVU A;  2X6O A;  1BJZ A;  4XK4 A;  3ZQH A;  3KZ9 A;  3RH2 A;  3Q0V A;  4AUX A;  2WGB A;  2FJ1 A;  3NXC A;  2FD5 A;  2Q24 A;  3B6C A;  1T33 A;  2TCT A;  2WUI A;  5HSZ A;  2HYJ A;  3HTI A;  4B1R A;  3BQY A;  3COL A;  2NS7 A;  1QVT A;  2XGC A;  3IUV A;  3BR6 A;  2IAI A;  4M3G A;  5GP9 A;  2IEK A;  2GBY A;  1Z0X A;  3G7R A;  3HTA A;  2ZCM A;  5J3L A;  5EZG A;  3ON2 A;  3E7Q A;  1JTY A;  5K58 A;  2ZOY A;  2OER A;  3HGY A;  2NP5 A;  2Y31 A;  4NEL A;  3VW1 A;  4D7M A;  3VIB A;  2VKV A;  3V6G A;  5FGL A;  3VPR A;  2PBX A;  2O7T A;  5F0C A;  4JL3 A;  5CXG A;  5F27 A;  3BTJ A;  5HAW A;  4MK6 A;  4D5F A;  4V2F A;  3C2B A;  2NP3 A;  3VW0 A;  1SGM A;  4M3B A;  2Y30 A;  4NN1 A;  1ZK8 A;  3SDG A;  1U9O A;  2DG8 A;  1ORK A;  3QPS A;  1JUP A;  4AF5 A;  5IOY A;  3T6N A;  4GCT A;  4D7N A;  4M3F A;  3Q0W A;  3FK6 A;  3MNL A;  2W53 A;  3BRU A;  3G1M A;  5D18 A;  2ID3 A;  2UXI A;  4D5C A;  2RAE A;  1JT6 A;  3HTH A;  2TRT A;  5F08 A;  3V78 A;  3G56 A;  2OI8 A;  5HBU A;  3KNW A;  2X9D A;  3G1L A;  3VOK A;  3LSJ A;  3G1O A;  2XGD A;  2OF7 A;  4JYK A;  2D6Y A;  1VI0 A;  3JSJ A;  2IU5 A;  4I6Z A;  2QWT A;  3MVP A;  3QQA A;  2HXO A;  3BTC A;  4GFL A;  2XRL A;  3B81 A;  3BR1 A;  2QCO A;  3LOC A;  3NPI A;  4UDS A;  2JJ7 A;  4AC0 A;  4W1U A;  2JK3 A;  3BNI A;  3QKX A;  3CRJ A;  2ZB9 A;  2DTZ A;  3BQZ A;  5DAJ A;  4G12 A;  4CGR A;  1UI6 A;  4GFK A;  2NS8 A;  2FQ4 A;  3BJB A;  4AC6 A;  5IP6 A;  2VKE A;  2VPR A;  1JT0 A;  4YZE A;  5EFY A;  2G7G A;  2F07 A;  3AQS A;  2ZOZ A;  4ICH A;  2OPT A;  5CW8 A;  2UXP A;  4JKZ A;  4B3A A;  4JNN A;  2XPU A;  5CXI A;  2G3B A;  4M3E A;  5FKK A;  3CJD A;  2G7S A;  2RHA A;  5IOZ A;  3ZQG A;  3EGQ A;  2O7O A;  3HE0 A;  3LWJ A;  5EYR A;  2EH3 A;  4ME9 A;  2UXO A;  2XB5 A;  2XDN A;  5K7H A;  3ANP A;  4GCK A;  3LSP A;  4PXI A;  3KKD A;  4I76 A;  1UI5 A;  3FRQ A;  2GEN A;  3LHQ A;  3Q0U A;  2XPV A;  3VP5 A;  5FMP A;  1U9N A;  2UXU A;  3PPB A;  3ANG A;  5GPA A;  3F0C A; 
#chains in the Genus database with same CATH topology
 2FBQ A;  3QPL A;  3BR5 A;  5AQC A;  3K8P C;  1A6I A;  3HGG A;  2R7V A;  3HTJ A;  3VVY A;  3WHB A;  3ON4 A;  3WHC A;  3B6A A;  3CWR A;  3NS4 A;  3GEU A;  5FKM A;  2DG7 A;  5EZH A;  4X1E A;  3DCF A;  5J1Y A;  3BR3 A;  3BR0 A;  2YVH A;  2QTQ A;  4W97 A;  4U9N A;  3RD3 A;  1T56 A;  1JUS A;  3HIM A;  1JUM A;  3C07 A;  1JTX A;  3IH4 A;  5FKL A;  3PAS A;  3ZQF A;  3NI7 A;  4KWA A;  3O8H A;  4MO7 A;  3O8G A;  2G7L A;  3DPJ A;  3BT9 A;  4DW6 A;  3FK7 A;  3DEW A;  3QBM A;  2ZCX A;  2NX4 A;  3CCY A;  2QIB A;  2WV1 A;  3VVZ A;  2ID6 A;  5GPC A;  4GCL A;  3S5R A;  3P9T A;  5FKO A;  3GZI A;  2HYT A;  5F1J A;  2V57 A;  2I10 A;  5J1U A;  5H9T A;  5K7Z A;  5FKN A;  3LSR A;  2FX0 A;  3FIW A;  3LJL A;  2R7R A;  2RAS A;  2HKU A;  4HKU A;  2UXH A;  2XGE A;  1Z77 A;  1RKW A;  5FHP A;  4M3D A;  3BCG A;  4U9L A;  5C4Y A;  5IPA A;  2R7O A;  3EUP A;  4L62 A;  3TP0 A;  1ZKG A;  2ZCN A;  4V2G A;  3ZQI A;  4MXM A;  2R7X A;  2PZ9 A;  3BTI A;  3VUQ A;  5K7F A;  5J1R A;  2GUH A;  1RKT A;  2IBD A;  5D19 A;  3NNR A;  2Y2Z A;  5F04 A;  4OD4 A;  2QKO A;  2G0E A;  2YVE A;  3VVX A;  1QPI A;  3AQT A;  3VW2 A;  3PM1 A;  1RPW A;  3Q3S A;  3BHQ A;  3TP3 A;  3BTL A;  2QOP A;  4ACI A;  2PFV A;  5D1R A;  3SWH A;  2HQ5 A;  3SFI A;  3BR2 A;  2HXI A;  2GFN A;  3ZQL A;  3IH2 A;  3KKC A;  3CDL A;  5F0F A;  4ABZ A;  2XPW A;  3VOX A;  2YVX A;  2R7U A;  3F1B A;  2REK A;  3IH3 A;  5F0H A;  3NRG A;  3O60 A;  1QVU A;  3FHN A;  2X6O A;  1BJZ A;  4XK4 A;  3ZQH A;  3KZ9 A;  3RH2 A;  3Q0V A;  4AUX A;  2WGB A;  2FJ1 A;  3NXC A;  4OD5 A;  2FD5 A;  2Q24 A;  3B6C A;  1T33 A;  2TCT A;  2WUI A;  5HSZ A;  2HYJ A;  3HTI A;  4B1R A;  3BQY A;  3COL A;  2NS7 A;  1QVT A;  2XGC A;  3IUV A;  3BR6 A;  2IAI A;  4M3G A;  4IRV A;  5GP9 A;  2IEK A;  2GBY A;  1Z0X A;  3G7R A;  3HTA A;  2ZCM A;  5J3L A;  5EZG A;  3ON2 A;  3E7Q A;  1JTY A;  5K58 A;  2ZOY A;  2OER A;  3HGY A;  2NP5 A;  2Y31 A;  4DVY P;  2FJI 1;  4NEL A;  3VW1 A;  4D7M A;  3VIB A;  2VKV A;  3V6G A;  5FGL A;  3VPR A;  2PBX A;  2O7T A;  5F0C A;  4JL3 A;  3DU6 A;  5CXG A;  5F27 A;  3BTJ A;  5HAW A;  4MK6 A;  4D5F A;  4V2F A;  3C2B A;  2NP3 A;  3VW0 A;  1SGM A;  4M3B A;  2Y30 A;  2R7T A;  4NN1 A;  1ZK8 A;  3SDG A;  3KYL A;  1U9O A;  2DG8 A;  1ORK A;  3QPS A;  1JUP A;  4AF5 A;  5IOY A;  3T6N A;  4GCT A;  4D7N A;  4M3F A;  3Q0W A;  3FK6 A;  3MNL A;  2W53 A;  3BRU A;  3G1M A;  5D18 A;  2ID3 A;  2UXI A;  4D5C A;  2RAE A;  1JT6 A;  3HTH A;  2TRT A;  5F08 A;  3V78 A;  3G56 A;  2OI8 A;  2A2F X;  5HBU A;  3KNW A;  2X9D A;  3G1L A;  3VOK A;  3LSJ A;  3G1O A;  2XGD A;  2OF7 A;  4JYK A;  2D6Y A;  1VI0 A;  3JSJ A;  2IU5 A;  4I6Z A;  2QWT A;  2B3W A;  3MVP A;  2R7S A;  3QQA A;  2HXO A;  3VTI A;  3BTC A;  4GFL A;  4WIB A;  2XRL A;  3B81 A;  3BR1 A;  2QCO A;  3LOC A;  3NPI A;  4UDS A;  2JJ7 A;  4AC0 A;  4W1U A;  3DU5 A;  2JK3 A;  3BNI A;  3QKX A;  2B1E A;  3CRJ A;  2ZB9 A;  2DTZ A;  3BQZ A;  5CQG A;  5DAJ A;  4G12 A;  4CGR A;  1UI6 A;  4GFK A;  2NS8 A;  2FQ4 A;  3BJB A;  2ZY9 A;  4AC6 A;  5IP6 A;  2VKE A;  2VPR A;  1JT0 A;  4YZE A;  5EFY A;  2R7Q A;  2G7G A;  2F07 A;  3AQS A;  2ZOZ A;  4ICH A;  2OPT A;  5CW8 A;  2UXP A;  4JKZ A;  4B3A A;  4JNN A;  2R7W A;  2XPU A;  5CXI A;  2G3B A;  4M3E A;  5FKK A;  3CJD A;  2G7S A;  2RHA A;  5IOZ A;  3ZQG A;  3EGQ A;  2O7O A;  3HE0 A;  3LWJ A;  5EYR A;  2EH3 A;  4ME9 A;  4C2M A;  2UXO A;  2XB5 A;  2XDN A;  5K7H A;  3ANP A;  4GCK A;  3LSP A;  4PXI A;  3KKD A;  4I76 A;  1UI5 A;  3FRQ A;  2GEN A;  3LHQ A;  3Q0U A;  2XPV A;  3VP5 A;  5FMP A;  1U9N A;  2UXU A;  3PPB A;  3ANG A;  5GPA A;  3F0C A; 
#chains in the Genus database with same CATH homology
 2FBQ A;  3QPL A;  3BR5 A;  5AQC A;  1A6I A;  3HGG A;  3HTJ A;  3VVY A;  3WHB A;  3ON4 A;  3WHC A;  3B6A A;  3CWR A;  3GEU A;  5FKM A;  2DG7 A;  5EZH A;  4X1E A;  3DCF A;  5J1Y A;  3BR3 A;  3BR0 A;  2YVH A;  2QTQ A;  4W97 A;  3RD3 A;  1T56 A;  1JUS A;  3HIM A;  1JUM A;  3C07 A;  1JTX A;  3IH4 A;  5FKL A;  3PAS A;  3ZQF A;  3NI7 A;  4KWA A;  3O8H A;  4MO7 A;  3O8G A;  2G7L A;  3DPJ A;  3BT9 A;  4DW6 A;  3FK7 A;  3DEW A;  3QBM A;  2ZCX A;  2NX4 A;  3CCY A;  2QIB A;  2WV1 A;  3VVZ A;  2ID6 A;  5GPC A;  4GCL A;  3S5R A;  3P9T A;  5FKO A;  3GZI A;  2HYT A;  5F1J A;  2V57 A;  2I10 A;  5J1U A;  5H9T A;  5K7Z A;  5FKN A;  3LSR A;  2FX0 A;  3FIW A;  3LJL A;  2RAS A;  2HKU A;  4HKU A;  2UXH A;  2XGE A;  1Z77 A;  1RKW A;  5FHP A;  4M3D A;  3BCG A;  5C4Y A;  5IPA A;  3EUP A;  4L62 A;  3TP0 A;  1ZKG A;  2ZCN A;  4V2G A;  3ZQI A;  4MXM A;  2PZ9 A;  3BTI A;  3VUQ A;  5K7F A;  5J1R A;  2GUH A;  1RKT A;  2IBD A;  5D19 A;  3NNR A;  2Y2Z A;  5F04 A;  2QKO A;  2G0E A;  2YVE A;  3VVX A;  1QPI A;  3AQT A;  3VW2 A;  3PM1 A;  1RPW A;  3Q3S A;  3BHQ A;  3TP3 A;  3BTL A;  2QOP A;  4ACI A;  5D1R A;  2HQ5 A;  3SFI A;  3BR2 A;  2HXI A;  2GFN A;  3ZQL A;  3IH2 A;  3KKC A;  3CDL A;  5F0F A;  4ABZ A;  2XPW A;  3VOX A;  3F1B A;  2REK A;  3IH3 A;  5F0H A;  3NRG A;  3O60 A;  1QVU A;  2X6O A;  1BJZ A;  4XK4 A;  3ZQH A;  3KZ9 A;  3RH2 A;  3Q0V A;  4AUX A;  2WGB A;  2FJ1 A;  3NXC A;  2FD5 A;  2Q24 A;  3B6C A;  1T33 A;  2TCT A;  2WUI A;  5HSZ A;  2HYJ A;  3HTI A;  4B1R A;  3BQY A;  3COL A;  2NS7 A;  1QVT A;  2XGC A;  3IUV A;  3BR6 A;  2IAI A;  4M3G A;  5GP9 A;  2IEK A;  2GBY A;  1Z0X A;  3G7R A;  3HTA A;  2ZCM A;  5J3L A;  5EZG A;  3ON2 A;  3E7Q A;  1JTY A;  5K58 A;  2ZOY A;  2OER A;  3HGY A;  2NP5 A;  2Y31 A;  4NEL A;  3VW1 A;  4D7M A;  3VIB A;  2VKV A;  3V6G A;  5FGL A;  3VPR A;  2PBX A;  2O7T A;  5F0C A;  4JL3 A;  5CXG A;  5F27 A;  3BTJ A;  5HAW A;  4MK6 A;  4D5F A;  4V2F A;  3C2B A;  2NP3 A;  3VW0 A;  1SGM A;  4M3B A;  2Y30 A;  4NN1 A;  1ZK8 A;  3SDG A;  1U9O A;  2DG8 A;  1ORK A;  3QPS A;  1JUP A;  4AF5 A;  5IOY A;  3T6N A;  4GCT A;  4D7N A;  4M3F A;  3Q0W A;  3FK6 A;  3MNL A;  2W53 A;  3BRU A;  3G1M A;  5D18 A;  2ID3 A;  2UXI A;  4D5C A;  2RAE A;  1JT6 A;  3HTH A;  2TRT A;  5F08 A;  3V78 A;  3G56 A;  2OI8 A;  5HBU A;  3KNW A;  2X9D A;  3G1L A;  3VOK A;  3LSJ A;  3G1O A;  2XGD A;  2OF7 A;  4JYK A;  2D6Y A;  1VI0 A;  3JSJ A;  2IU5 A;  4I6Z A;  2QWT A;  3MVP A;  3QQA A;  2HXO A;  3BTC A;  4GFL A;  2XRL A;  3B81 A;  3BR1 A;  2QCO A;  3LOC A;  3NPI A;  4UDS A;  2JJ7 A;  4AC0 A;  4W1U A;  2JK3 A;  3BNI A;  3QKX A;  3CRJ A;  2ZB9 A;  2DTZ A;  3BQZ A;  5DAJ A;  4G12 A;  4CGR A;  1UI6 A;  4GFK A;  2NS8 A;  2FQ4 A;  3BJB A;  4AC6 A;  5IP6 A;  2VKE A;  2VPR A;  1JT0 A;  4YZE A;  5EFY A;  2G7G A;  2F07 A;  3AQS A;  2ZOZ A;  4ICH A;  2OPT A;  5CW8 A;  2UXP A;  4JKZ A;  4B3A A;  4JNN A;  2XPU A;  5CXI A;  2G3B A;  4M3E A;  5FKK A;  3CJD A;  2G7S A;  2RHA A;  5IOZ A;  3ZQG A;  3EGQ A;  2O7O A;  3HE0 A;  3LWJ A;  5EYR A;  2EH3 A;  4ME9 A;  2UXO A;  2XB5 A;  2XDN A;  5K7H A;  3ANP A;  4GCK A;  3LSP A;  4PXI A;  3KKD A;  4I76 A;  1UI5 A;  3FRQ A;  2GEN A;  3LHQ A;  3Q0U A;  2XPV A;  3VP5 A;  5FMP A;  1U9N A;  2UXU A;  3PPB A;  3ANG A;  5GPA A;  3F0C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...