3JSPA

Classic protein with a new twist: crystal structure of a lexa repressor dna complex
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
198
structure length
194
Chain Sequence
KALTARQQEVFDLIRDHISQTGMPPTRAEIAQRLGFRSPNAAEEHLKALARKGVIEIVSGASRGIRLLQGLPLVGRVAAGEPLLAQQHIEGHYQVDPSLFKPNADFLLRVSGMSMKDIGIMDGDLLAVHKTQDVRNGQVVVARIDDEVTVARLKKQGNKVELLPENSEFKPIVVDLRQQSFTIEGLAVGVIRNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LexA repressor
publication title Structure of the LexA-DNA complex and implications for SOS box measurement.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Hydrolase/dna
total genus 38
structure length 194
sequence length 198
chains with identical sequence B
ec nomenclature ec 3.4.21.88: Repressor LexA.
pdb deposition date 2009-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00717 Peptidase_S24 Peptidase S24-like
A PF01726 LexA_DNA_bind LexA DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3jspA01
2.10.109.10 Mainly Beta Ribbon Umud Fragment, subunit A Umud Fragment, subunit A 3jspA02
2VBXA 1GVJA 3CUQC 4KN7X 1A04A 3HTSB 4P9FA 3CO6C 1TBXA 5DV5A 1U2WA 2IA2A 3TOBA 2XUBA 2J5OA 1OR7A 2ZNZA 3BY6A 1RUOA 2V6CA 2V1DA 2A6EF 1FC3A 1S7OA 2CWEA 3M9AA 4AD9A 2ZNYA 4EV0A 3DV8A 5ICEA 2RGVA 2E1NA 1K78A 5LHIA 4M6YA 2VT3A 3RPQA 5HDNA 1VTNC 2YU3A 1DDNA 4IRIA 3GUDA 2A07F 2Z5UA 3IWFA 1WWXA 1KYZA 3F8MA 1JE8A 1FOKA 5D4SA 4P55A 2O8XA 1UHWA 1ULYA 2FQ3A 3CUQA 2NAZA 2DK5A 1U5TC 2HOEA 2FMYA 3FM3A 3LA3A 1XD7A 4ESFA 3WTUC 4M9XA 1DP7P 2H27A 4U0YA 1LDKB 1V3FA 2FU4A 2NS0A 5FLXK 3OOPA 2KJBA 2A6HF 3P9KA 1KU3A 3E5UA 2EA2A 1EH6A 3WE3A 4M71A 5LBQA 3M7GA 3E97A 1FSHA 2Z9OA 1EV7A 2JSCA 2XAFA 4ENKA 5A2QZ 2L4AA 1PP8F 4K8WA 1E2XA 5D6EA 4EQQA 5HLGA 1ZRFA 3REOA 5LRSA 4UVAA 4E70A 5FD5A 2LDUA 3K0LA 4ENMA 3RKXA 4PGGA 4IRGA 1T39A 1OYIA 2ZO4A 1ZG1A 5CVVA 5J8CA 1LEAA 4M74A 3JW4A 1YG2A 5FB2A 4LLNA 3MAJA 2OA4A 1WRJA 3HSFA 1R00A 2MA3A 4KIBA 4MQVA 1G3WA 2Q8KA 2DLLA 1SD7A 4KMUX 4RAZA 2FKDA 5FD6A 1XDSA 2FJRA 4GCVA 2VE9A 5K1YA 2R7DA 2WWYA 2XAQA 3V7SA 1I1SA 1ZHFA 3FXUA 2PBIA 1K6OA 5TRDA 1YQAA 3F6OA 4CHUA 4U88A 4AIJA 5LGNA 3J80Z 4WXCA 1JGSA 5J6XA 2GQQA 4HV5A 4U0WA 3N4MA 4WK8F 2HO0A 3FX3A 2PFBA 2HYGD 2E7WA 2G9WA 2JT1A 4HYEA 4MHGA 4IJAA 1FLIA 3V7CA 3F8BA 1WKMA 4G7OF 4HLYA 1SMTA 3J7AO 2P6SA 2RDPA 2L3DA 3B73A 1P4AA 3CDHA 2F5EA 4I7HA 3MWMA 4XSZF 3HRMA 4TV7A 2CYYA 3WGHA 4ZH4F 1YW9A 4XSXF 1J5YA 2RVCA 2XHKA 3ZMZA 3MZYA 1F39A 4RGSA 1H0MA 3HRSA 2P5VA 3J81K 3C18A 2Q2EA 3DQVC 3RJPA 3GWZA 4L9NA 2DQRA 2CQKA 4HLXA 4LMYA 3FXRA 3GFJA 2STTA 2DT5A 1P6RA 1JHHA 3JAMK 1LB2A 3ECOA 4PZJA 1BM9A 1D3YA 3L00A 2RN7A 1FNNA 1U8RA 1KQ0A 3QU6A 3WODF 2HZTA 4CYDA 3EQLF 3BZ6A 5EEGA 2IP2A 1BIBA 4N9HA 2CW0F 1ZGAA 4LLGF 4UNOA 4L5IA 3VOEA 4G6QA 3F6VA 3HYIA 4WXHA 3WU0A 1QQIA 4WCGA 1G3YA 3RDIA 2M8EA 4O6JA 1FT9A 1B4AA 4EJWA 2FBHA 3F8CA 5KK1A 3V7RA 3P9CA 1QZYA 1TQIA 3ML6A 3ZN0A 4HAMA 2EWNA 1UFMA 3G3ZA 2EV6A 2H6BA 2QQAA 1XMKA 5AONA 4OINF 3T0YA 3KZZA 5ICCA 3WGIA 4LJZF 3BPXA 5H6QA 2BGCA 1S8NA 5FFZA 2FNPA 3KP6A 3TGNA 4LB5A 2JZYA 3G73A 1YIOA 2VC1A 3OV8A 1LJ9A 2NNYA 4RB2C 3ZMSA 3E3VA 2LF8A 4U7DA 3GX4X 4A0YA 4L9JA 2M45A 4HBLA 2NYXA 1K78B 4HOBA 2LNBA 1KU9A 1L3LA 4UVCA 3JSPA 1HQCA 1YS7A 2W85A 4CGZA 3P7NA 3IRRA 1W5TA 1W4MA 1V4RA 2P5KA 1ZH5A 5K5OA 1T38A 1SFEA 5CVJA 3BP8A 3CUQB 3F23A 3GLXA 4HX8A 4G9YA 1WQ2A 3LQRA 4Z2YA 2L4MA 2JPBA 5HS8A 5K5RA 1R7JA 4LK1F 3NQOA 2DFIA 2XAJA 3SXYA 2NRAC 2HKXA 1J75A 2RNJA 2Y0MA 5DUIA 3HUGA 4CO8A 1SAXA 5IT9K 1O3QA 5TJJA 3V8LA 4M9SA 4EJUA 2VBWA 4JK1X 4L5JA 3LQQA 2LKPA 3GVAA 1IXRC 4LD5A 1R5HA 3ECHA 2D1VA 4ETSA 3MFKA 2M5WA 4OOIA 2OU2A 1HSJA 2Z3YA 3GO5A 4O3MA 5E8IA 2VT2A 1I6XA 1HW1A 1OKRA 4CZZA 5D8KB 3CJNA 1GXPA 1GHCA 4YFNF 4L0YB 1YFHA 1KQ9A 1O7FA 1YS6A 1QZZA 5J8FA 1H9GA 5LRRA 5E1XA 2VONA 1U5TB 1RNLA 5HS9A 1R1TA 2V79A 2BYVE 4FX4A 4I09A 4B09A 2P7CB 3R61A 3BOQA 3FHZA 4Q5SF 4G6DA 3TQNA 1Z6RA 5FLXZ 1FSEA 3QPHA 1RZ4A 2CFXA 3K2ZA 3WTVC 3ZPLA 5F6FA 2ESHA 2GAUA 3WTXC 1PP7U 1S7AA 1YO5C 2FXAA 3SFZA 1HBXG 4G8XA 1T98A 5E8GA 5ICGA 1PUEE 3ULQB 2E7XA 5CJ9A 2XIGA 1I4VA 3O2PE 2X0LA 3QOPA 4WF2A 2P7VB 3KP4A 3U1DA 2PLYA 3DKWA 2FBIA 5AIPA 2DTRA 1T6SA 3MCZA 3TOAA 1EH8A 1R22A 2UWMA 4A2UA 1J59A 3DF8A 2HR3A 2M1BA 5BQTA 4RGRA 2DBBA 3I4PA 5DEQA 5EEHA 4M9ZA 3HOSA 1G3TA 4HA8A 3ZQ7A 2DPUA 1R36A 5HDKA 3KETA 3DXJF 5E17F 1QGPA 2K02A 4GO1A 1Z6TA 2BEOA 1UCRA 4OIQF 2FE3A 2HTJA 4XLNF 1UB9A 1IN6A 4LGWA 4RAYA 3EETA 3SQNA 2IA1A 4ZZDA 4KN4X 3WTYC 3F8NA 3I54A 4U7BA 3KEQA 2HWVA 3KZYA 1Z1DA 3WGGA 2ZCWA 3HOTA 2XV4S 1BOAA 1E17A 2HNFA 3KE2A 3JTGA 1IRGA 1KN9A 4M73A 5E18F 1B9MA 2A3SA 2VE8A 1FP1D 1MDMA 2K27A 2P5LC 1XN7A 1U5TA 2FRHA 4ESJA 2VOPA 1F4KA 2BV6A 1DPUA 3ROUA 4EJOA 5HLHA 3CLOA 4LG0B 1G4DA 2QUFA 4YFXF 2IJLA 5D4RA 4BNCA 2EFNA 1HKQA 4IF4A 4LK0F 3LAJA 2JPCA 3GFMA 2ACJA 4LB6B 4O5VA 2XASA 1TQMA 2PJPA 4U0VA 3J81Z 4HF1A 4CXFA 2ISZA 2J5PA 3CUOA 2GXBA 5F1RA 4A6DA 5DUKA 5JFRA 1J7KA 2DK8A 2P6TA 5L3DA 1ZG5A 1U3EM 1IN7A 3FXQA 5LHGA 2MD5A 1IAWA 3JAMZ 5ILVA 1YLFA 4KMFA 3W6JB 1XDUA 2QWWA 3QP6A 3DPTA 1FYMA 2PG4A 1O3SA 3BROA 2CSOA 5F64A 4ENNA 1TW2A 5CVIA 2IA0A 1ZGJA 3U2RA 4KIGA 1KCAA 5FGMA 2QQ9A 3ISPA 4EMSA 2KKOA 3E5XA 1LEBA 4MEYF 2TDXA 2IW5A 2VOOA 5JVTA 1HW5A 1DPRA 1P2FA 4YIIA 4HDUA 4A5MA 3IRQA 2HFHA 2KIFA 4A6EA 4A0XA 1ZAOA 2OZUA 4EJTA 4KA4A 2A69F 5H6RA 4BYYA 2XKOA 3BJAA 2HKOA 4RS8A 3BJOA 3V8KA 2DI3A 5DDGA 3IC7A 2ESNA 2PMUA 3LAPA 2WC2A 4NV4A 3H3ZA 3ZMTA 1O57A 4ASNA 1D8JA 3EYYA 4ZYGA 4HQEA 1J0RA 2PEXA 4EM2A 2PQ8A 4MQ9F 4BH9A 4OU0A 1USSA 5CYVA 3JTHA 3K1MA 3K9TA 1LNWA 1FP2A 5CVRA 3L2CA 1J9IA 4IRHA 3IHUA 5D8LB 1H9TA 1T2KA 4KFCA 3ERED 1IRFA 1ON2A 4EM0B 3M1EA 4N31A 2GWRA 1BIAA 3FZVA 2GA2A 5HS7A 4LG0A 1FWZA 4ON0A 4UHTA 1XGNA 3K1PA 5JI6A 1BC8C 4IXAA 3Q5FA 2QZ8A 4LFUA 1D5VA 3SHFA 3LWFA 4QWQA 3TO6A 1F5TA 2ISYA 3RIRA 3TDZC 1K79A 4A5NA 2A68F 1QO0D 3Q9SA 3BDDA 2XAGA 2OZ6A 4DNCA 2G7HA 3H92A 3ELKA 3I0TA 4ZYHA 4N9IA 4I2OA 5IT9Z 1HXDA 4MEXF 2XROA 4Y13A 2P4WA 1I27A 1TQPA 1MJ9A 3E6BA 3F21A 1TTYA 4IPAA 1B1BA 1SD5A 1RIOH 3E5QA 3T1BA 1MJBA 3RYPA 1BN5A 4KDPA 4RGUA 2WTEA 2Z33A 1KU2A 1MJAA 2OQRA 3GZ5A 1AOYA 2EFQA 4HDVA 2QVOA 2X4HA 3TO7A 5DCMB 3LA2A 1USTA 1BI2A 4BHPA 5L3CA 1WI9A 3HTUA 4GGGA 5ILUA 3I59A 4EJVA 3IKTA 2RC4A 3I5UA 3EDPA 2NNNA 4P96A 1SFUA 3I53A 2VBYA 2HYFA 2ZFWA 2KRFA 3P9IA 3HRUA 1YW8A 3ZMDA 3MQ0A 2UZKA 1KA8A 4I0BA 4FX0A 2IRFG 5ERIA 1O3RA 3M8EA 1FZPB 2RV8A 2JRTA 2QBYA 1YYVA 1CGPA 3KP3A 4ESBA 5D5WB 1LVAA 2QENA 5CVUA 1Q1HA 2MLKA 2W24A 4HX4A 3F72A 1BC7C 4RB3C 1QBJA 2EV5A 2WV0A 2C6YA 3FF5A 1IN4A 4F7ZA 4FHTA 2IPQX 5D5XB 4UUVA 5JR3A 2KIMA 1TNTA 1MGTA 5K5QA 2ZKZA 1MKMA 3L9FA 1Z9CA 2BBYA 4HZFA 1S6LA 1I5ZA 5BS6A 4KIFA 5E20A 3C3WA 4CICA 2EA4A 3KLNA 4HX7A 1YW7A 2AXLA 5AIQA 4KT5C 3LA7A 2FSWA 1AY9A 1FBSA 2ZBKA 3DPLC 5DD8A 4ME8A 1MDMB 1CF7B 1C0WA 4G7HF 5D6FA 1ZRCA 2R3SA 3QPTA 1BBYA 1ODDA 2W25A 4EM1A 1XSXA 3U9GA 3RKYA 1HW2A 2DW4A 1ZYRF 5BOXA 1FX7A 1FPQA 1FYLA 1SD4A 4GXOA 2OAZA 4XBFA 4S05A 4PGHA 5DCMA 1IZ1A 4BHCA 3FMRA 2FA5A 3CO7C 3GXOA 4G7ZF 1BI1A 4AWXB 4G94A 1IN5A 3WTTC 5BPDA 4OIRF 3R0AA 1O3TA 4AVPA 1IN8A 2FNAA 2XKPA 3N97A 1ZREA 2DPDA 3COAC 4YFKF 3RTRA 1Z7UA 2RKHA 1B9NA 1ZLJA 4UV8A 5LGUA 4A12A 1P4XA 1FY7A 1J2XA 4BAYA 4JBAA 3DFGA 4MNUA 4Q4ZF 2HGCA 2G7UA 4AIKA 2OD5A 2K86A 3I58A 1XCBA 1LDJA 3MEXA 2VODA 4KICA 3ABTA 3IKVA 1S3JA 2QYOA 4NQWA 5LGTA 3Q9VA 1JHCA 2JTVA 3ZN1A 1F1ZA 1R1UA 2LF7A 4IHSA 3DEUA 2M87A 5L3EA 1OMIA 4OMZA 1U6GA 5HDGA 2YX7A 3FM5A 3DP7A 4P9UA 4HQMA 2P8TA 4QLCU 3R0JA 4RB0A 2XVCA 4HF0A 5ICFA 5LEJA 2ETHA 1UHMA 3E6CC 2ZXJA 2H09A 4A0ZA 3TDUC 1JHFA 3FMSA 2MH9A 2H6CA 2ZMEB 3D0SA 5CLSA 3SZPA 1XSDA 4L9TA 4FT8A 1ZG3A 3QU3A 2A61A 2MC3A 1FBQA 1SFXA 1LQ1A 3T5XA 1CF7A 3BDNA 1STZA 4I01A 4EGZA 1W7PB 1FYKA 3VEPA 5IT3A 2ADUA 2KIUA 1ZLKA 2O3FA 2VBZA 1IUYA 5BMZA 3PFIA 3R60A 4N0BA 2HQRA 4P5OA 5D5UB 5BPIA 5FFXA 3FWEA 1SMYF 2GXGA 3BJ6A 3I71A 3PQKA 2OQGA 3WTSC 1XSVA 2GIVA 1GXQA 3T8TA 4NB5A 2COMA 4Y15A 4EVIA 2YPRA 4UXNA 4MTDA 5HOOA 4EGYA 2M30A 1R1VA 1REPC 2K4BA 2EFWA 5DCFA 3KP7A 1JHEA 2EFOA 5L3BA 1D8KA 5DYMA 1KQ8A 3V4GA 4XLPF 3SZTA 3M8FA 5E1ZB 1B6AA 1FBUA 3VB2A 3F3XA 1T7DA 5A2QK 2EK5A 2HDCA 3WE2A 1KGSA 1HKSA 3WU1B 3GYHX 3VODA 2EJRA 2IVMA 4BXUA 3I59B 4KUMA 1SD6A 3GFLA 3O3KA 3ABUA 3L09A 5KVRA 1O7LA 3TKYA 2D2WA 3QAHA 2PN6A 3T8RA 2QLZA 3HHHA 1Z05A 1X3UA 2VN2A 5L3GA 2EFPA 4L0ZB 4I0AA 2FOKA 2D1HA 4JQFA 3WTWC 2MBFA 4PCQA 2A5YB 2K7LA 2EV0A 2HTSA 3I64A 1DUXC 3QP5A 1XB4A 5LLQA 2AS5F 2CO5A 1BJAA 4UV9A 2QBYB 1W7PD 2Q0OA 1RUNA 2O03A 4Y17A 1I1GA 1BI3A 2H94A 2XGXA 1WSUA 4YG2F 4BHBA 3D5LA 2LSOA 4OMYA 3KCCA 5LHHA 2E1CA 2EB7A 4ZYEA 2GA1A 3WTZA 1OYYA 5HLIA 2ZMEA 1RI7A 1OPCA 1ON1A 3E6MA 2FEZA 2PI0A 3GW2A 3WG9A 3J80K 2XRNA 3C7JA 2PMHA 3KP2A 5FO5A 2Y75A 4K2EA 3K69A 4AIHA 1F9NA 2W84A 3KLOA 4WWCA 2HEOA 1W7PA 2CG4A 2V1UA 4XRFA 3GEZA 3AAFA 1P92A 3EUHA 3HRTA 1JXSA 1YTYA 3MZHA 4HF2A 3CTAA 2F2EA 2R7FA 3JSOA 3QRFF 2XAHA 1QNTA 4HV6A 3VFZA 2MH2A 1ZRDA 4D0PA 5E1WA 4WX9A 2W57A 2Z99A 4I02A 3S04A 4L18B 1IXSB 1LDDA 3IWZA 3EYIA 2STWA 4M6XA 5DD4A 3LFKA 1L0OC 1B59A 3NEUA 2VC0A 1R58A 2F5FA 3NRVA 1ZARA 1XGOA 2FMLA 1R5GA 3KFWX 3GZ6A 1XGMA 4OIOF 2MLGA 3ZMUA 3R4KA 1BI0A 1Y0UA 4KYWA 2L54A 1TW3A 1G6NA 1W5SA 3KP5A 3B02A 4ENJA 1U78A 3O6BB 1TNSA 1PDNC 4IVNA 2YSRA 3ZP5A 4PDKA 1UMUA 5L3FA 4ZZLA 4MGRA 1MD0A 4WXDA 2O61A 1KU7A 1NHAA 2O0YA 1K7AA 2K4JA 2DU9A 2QQBA 4H0EA 5JHUA 2D45A 2DAOA 3FMQA 5ED4A 2OBPA 1XGSA 1XMAA 3PQJA 1OYWA 4BQAA 2UXXA 4HW0A 1MZBA 1EH7A 4I98B 2KJCA 3GF2A 2ELHA 3HSRA 4R79A 2HQNA 4B8XA 3HSEA 3KEOA 2ZJ2A 2L01A 1ONVA 3GFIA 1IF1A 2IT0A 2HS5A 1XCVA 4IHTA 3V8JA 3W6KB 4OIPF 3H3UA 3F8FA 2O6GE 2QM3A 4R1HA 3LSTA 4RB1A 4GYIA 2B0LA 3IL2A 3BWGA 3TO9A 1Z91A 2GZWA 2UXNA 3R6SA 2FF4A 1KYWA 1HKTA 2BE5F 6PAXA 1TLHB 2YR2A 4Q47A 2YX4A 4R8HA 3C1DA 2V9VA 3RPUA 3L7WA 2VXZA 1S29A 5ILSA 5HVQC 3S2WA 2DQLA 2L02A 1B12A 3K1NA 1AWCA 1T0FA 1R23A 4M72A 3E6DA 1P4WA 4NHJA 4S04A 4LLLA 4UVBA 3HIFA 1HSTA 3RKWA 3IIQA 1IW7F 4L9VA 3RYRA 2RQPA 3RI4A 2Y48A 1G3SA 2F5DA 4KNYA 4MTEA 4YIFA 3HHGA 4Q48A 1QPMA 2V1XA 3F22A 2DO7A 2F5CA 3BPVA 4ZYDA 5LEKA 1ZN2A 5H20A 4RGXA 4GYGA 4DQ2A 2CGPA 3ZMVA 1IXCA 4CDGA 5D5VB 2FBKA
chains in the Genus database with same CATH superfamily
2VBXA 1GVJA 3CUQC 1CQTA 1HLVA 2NVYJ 4KN7X 2NVTJ 4D7MA 4E7KA 3CF2A 4QTRA 1A04A 3HTSB 4P9FA 1ZR2A 3CO6C 2VL8A 4IHXA 1TBXA 5EDNA 2R93J 3K4JA 2LKXA 5DV5A 1APLC 3OSGA 1FMWA 1U2WA 1X2NA 4NBQA 2IA2A 3TOBA 2XUBA 1JJ6C 3CCUI 2J5OA 4BJ6C 1MNEA 1OR7A 5JHFA 2BXYA 2XB5A 2H8WA 2ZNZA 3BY6A 1RUOA 2Y2ZA 2V6CA 1JT0A 2V1DA 2A6EF 5F0FA 1FC3A 1S7OA 2CWEA 4BE0A 3M9AA 4FISA 4AD9A 1S72I 2ZNYA 3UNGC 5HLTA 4EV0A 1MBHA 5M5YJ 3DV8A 5ICEA 2RGVA 2E1NA 1K78A 5LHIA 2AQEA 4M6YA 4HNVA 1Z77A 2JRMA 2VT3A 2HDDA 5IOYA 4PSXA 2CUFA 3RPQA 5EG0B 5HDNA 1VTNC 3CCYA 3HJEA 3RZDJ 2YU3A 1DDNA 3HEFA 5B1BH 2VJ4A 3LSPA 4RMNA 2COBA 4BS9A 4IRIA 3GUDA 3SYTA 5EGOB 4XKWA 1X1BA 2A07F 3S14J 2O5RA 2Z5UA 3IWFA 1NG7A 2X6OA 1WWXA 1KYZA 3F8MA 4CCLA 1JE8A 1FOKA 3CLQA 5D4SA 4P55A 3HKZN 2O8XA 2CRGA 1UHWA 2BY3A 1ULYA 5KAIC 3S3MA 4D5CA 2FQ3A 3CUQA 1HOMA 2NAZA 2DK5A 1U5TC 2L7FP 3BG5A 5K7ZA 2HOEA 2FMYA 3FM3A 3LA3A 1X58A 2A6TA 4X0GA 3RKQA 4J00A 2CV2A 1XD7A 2CW8A 4ESFA 1JKPC 3CC2I 2DYSH 2KDOA 3ASNH 5J47A 3WTUC 2H1LA 4M9XA 3MVPA 3PUBA 1DP7P 1EJ9A 2H27A 3FXOA 1X19A 5C4JJ 2OV7A 4U0YA 1QRYA 3CD6I 5CKTA 1LDKB 2LBFB 4DZPA 1R4MB 1V3FA 1VQNI 2FU4A 3H5RA 3JRBA 2NS0A 5FLXK 3JRCA 2W4SA 3OOPA 2KJBA 2A6HF 3P9KA 4UB8C 4JX6A 3MKWB 5B66C 4MO7A 2JA6J 4B3AA 2KL4A 1KU3A 3E5UA 2EA2A 1EH6A 3WE3A 1A36A 4M71A 3W2VA 5LBQA 1V55H 1OJLA 2LTPA 3M7GA 3E97A 2CUJA 1FSHA 3PNTA 2Z9OA 1EV7A 2JSCA 2XAFA 4ENKA 1JUMA 5A2QZ 2X1CA 2L4AA 1PP8F 4K8WA 2VIXA 4BBRJ 3CMAI 2E1MC 1E2XA 3BR6A 3OL4A 3PNYA 2LLKA 5D6EA 3TEDA 1Z21A 4EQQA 5HLGA 1Y1WJ 1ZRFA 1WHUA 1YX5A 3REOA 1PYVA 5LRSA 1GUUA 2EZHA 4UVAA 3S32A 2CMPA 2BOLA 4E70A 1VI0A 5FD5A 2LDUA 3K0LA 1AKHB 4ENMA 3RKXA 4PGGA 4IRGA 1T39A 3ASOH 2I10A 1OYIA 2ZO4A 1ZG1A 5CVVA 4F3QA 1G59A 2NS7A 3MKYB 1Y1VJ 5J8CA 1LEAA 1I39A 4M74A 3JW4A 1YG2A 5FB2A 3S1RJ 4LLNA 3HOVJ 1YI2I 3MAJA 3HM5A 2OA4A 2QKLB 1WRJA 3HSFA 1R00A 2OPTA 1ITYA 2MA3A 4KIBA 2VUMJ 4MQVA 1IC8A 3CESA 1TL8A 3G1OA 1G3WA 3BTJA 1R71A 3K4BA 3PFYA 2Q8KA 2DLLA 1SD7A 4KMUX 4RAZA 2FKDA 2WB1N 2CJJA 5FD6A 2Y31A 1HC8A 1VFCA 2JVGA 2QGUA 1XDSA 1LKXA 2FJRA 4GCVA 2F48A 3DLLF 4Y4RA 2VE9A 5K1YA 2KISA 4Y3OA 2R7DA 2WWYA 2IGOA 5F0HA 2XAQA 3L1PA 3V7SA 1I1SA 3ZQQA 3LL7A 4M3DA 2KPMA 3FKJA 1ZHFA 3FXUA 2ZB9A 3J7AY 2PBIA 1K6OA 4LOCA 2R4GA 5TRDA 1YQAA 3F6OA 4BJ5C 4CHUA 2X6WA 2VPRA 2EZKA 4U88A 2OUMA 4AIJA 1JJ8C 3DPUA 5LGNA 5IPAA 2KT0A 3J80Z 4P1WA 2XRLA 2E1OA 5KNLA 4WXCA 1JGSA 2BY0A 1FEXA 1EF4A 1FTZA 5J6XA 2GQQA 4HV5A 4U0WA 2VXDA 3N4MA 5TGTA 2E36A 1FTTA 3RQIA 4WK8F 2HO0A 5DM6F 2R5YB 3OYEA 5EG0A 3FX3A 2PFBA 2HYGD 3OYLA 2E7WA 2XDVA 2G9WA 2JT1A 4HYEA 2CQXA 4MHGA 4IJAA 4V2GA 4N4OB 2XF6A 4C3HJ 4XORA 1FLIA 3V7CA 5J1YA 3S16J 3GLLA 1IO2A 2LP0A 3F8BA 3U21A 1WKMA 4G7OF 5DS9A 1ENHA 4M3BA 4HLYA 4W1UA 3A0HC 1K61A 1SMTA 3J7AO 3VYSB 4QPQA 3OR1C 2DMTA 2P6SA 2RDPA 2L3DA 1PUFB 1WCMJ 3U1KA 3IH4A 3B73A 1P4AA 3GTOJ 3VWBA 2DMQA 3CDHA 3PNVA 3MD2A 2F5EA 2KLOA 4IQ4A 3SEZA 4IOCF 4CCOA 4I7HA 5FKNA 3MWMA 3AL0B 1V5FA 2MG4A 2IEKA 3HRMA 4TV7A 4U87A 4XSZF 2CYYA 3WGHA 4ZH4F 4A69C 1PVEA 2HXIA 1YW9A 2CQQA 2LBFA 1BOBA 1ACIA 5J1RA 2XPVA 2DN0A 4NC6A 4XSXF 1YJNI 3KIOA 1J5YA 1HCRA 2DFHA 2RVCA 4V2FA 2BVMA 2XHKA 3ZMZA 3MZYA 1IGNA 3IV5A 2K85A 2K9MA 2NVUB 1F39A 4RGSA 1A6QA 1VQLI 1H0MA 5CQGA 2LK2A 3HRSA 2P5VA 1J09A 2K40A 3J81K 3C18A 2Q2EA 3DQVC 2VKEA 3RJPA 5LFAA 3GWZA 4L9NA 2DQRA 2OCEA 2CQKA 4HLXA 4LMYA 3G1MA 3HUGB 3FXRA 2IS6A 2L2OA 1OCOH 3GFJA 1UZCA 2STTA 2V4JC 2DT5A 1P6RA 1VQKI 4HNUA 1JHHA 2BXZA 3JAMK 4HSRA 1LB2A 3ECOA 4PZJA 1MMGA 2IAIA 4XOPA 2HPIA 3S1MJ 1HDPA 1AKHA 1BM9A 2WB1A 3H0GJ 5GAHJ 1X1CA 1SFKA 3K4LA 1D3YA 3L00A 1WZ2A 2RN7A 1FNNA 1U8RA 3HOWJ 1U9OA 2L9SA 1KQ0A 1SEUA 1BR4A 3QU6A 3WODF 2X6XA 2DYRH 5GPCA 2HZTA 2IS1A 1F36A 2RNGA 4XONA 4CYDA 4D9JA 1VQ7I 3EQLF 3BZ6A 1SAUA 2OCCH 5EEGA 4BGDA 4BUPA 4CCKA 1Y8RB 4DGWB 3H3VK 2IP2A 1BIBA 4N9HA 2CW0F 1ZGAA 4LLGF 4UNOA 5J4VA 4L5IA 1JKQC 3VOEA 4G6QA 1OQYA 3F6VA 3HYIA 1FIPA 4BACA 4F55A 2FOWA 2I5UA 3AKZA 4WXHA 3B6AA 3WU0A 1QQIA 4WCGA 1G3YA 2F4OB 3RDIA 3O8HA 2M8EA 3ABMH 3AL0C 3D5SC 4O6JA 1FT9A 1B4AA 3VDXA 4EJWA 5GTIC 2FBHA 1B8IB 3F8CA 3H36A 5KK1A 2JQ7A 3V7RA 1LE8B 2V1NA 3P9CA 1QZYA 1TQIA 3QPLA 3JREA 3ML6A 3ZN0A 3HOXJ 4HAMA 4L5EA 1VQOI 4B4CA 2EWNA 3S8PA 1UFMA 3G3ZA 1AA7A 1MBFA 2EV6A 2ME6A 5F1JA 4RBOA 2H6BA 2QQAA 4JYKA 4DYRA 3HGYA 1XMKA 5AONA 4J19A 4OINF 3HOUJ 1TWFJ 3T0YA 3KZZA 4MLOA 5ICCA 3BC8A 2QKMB 4ZDOA 3WGIA 4C3JJ 3SDBA 4C9YA 4LJZF 3BPXA 1GDTA 4XICA 5H6QA 1ZGWA 5GPAA 3CMEI 4DYCA 1X4PA 2BGCA 4IX7A 1S8NA 5FFZA 2FNPA 3KP6A 4DW6A 2MYSA 2B7EA 2VQLA 1B72A 3TGNA 4LB5A 2E19A 2JZYA 3G73A 1YIOA 2VC1A 2F6CA 3OV8A 3Q3SA 1LJ9A 2E35A 2NNYA 1ETVA 2BVLA 4RB2C 3ZMSA 3MKLA 3QOEA 2E71A 3AG1H 3E3VA 2KP6A 2FQ4A 1GV5A 2LF8A 4W97A 4U7DA 3P5JA 4LG3A 3GX4X 2MD0A 4A0YA 4B3XA 4L9JA 2M45A 5IYDJ 4J01A 1A6IA 1PJRA 4HBLA 2ZJQF 2NYXA 4KT6A 3M1CA 3BG6A 1VQMI 1SC7A 4JX4A 1IUFA 1K78B 1MH3A 4HOBA 2LNBA 1KU9A 1ETKA 1L3LA 4UVCA 3JSPA 3G4SI 1HQCA 1YS7A 2W85A 4CGZA 5EYRA 3P7NA 1G2HA 3CP2A 4ABZA 2JA5J 3IRRA 1W5TA 1W4MA 2OTJI 1RC9A 1SANA 3MKZA 1I6HJ 1V4RA 4DJAA 2P5KA 1ZH5A 2BHYA 3LSRA 2W48A 2W00A 3PIOF 5K5OA 1T38A 4HPQA 1SFEA 3JRFA 1Z3XA 1UAAA 5CVJA 3BP8A 3C2GA 3CUQB 3F23A 3GLXA 5CQEA 4HX8A 4G9YA 1UHSA 1WQ2A 3LQRA 5J1UA 4Z2YA 2L4MA 2JPBA 5HS8A 2JSPA 5K5RA 1JUPA 1R7JA 4LK1F 3NQOA 2DFIA 2XAJA 3SXYA 3NWSA 2NRAC 2LOOA 2HKXA 1J75A 2RNJA 2Y0MA 5DUIA 3HUGA 5GAEJ 4CO8A 2EZLA 1SAXA 5IT9K 2DMPA 3OWTA 1O3QA 5TJJA 2MABA 3V8LA 4BU2A 5M3MJ 4M9SA 4EJUA 2VBWA 3K6GA 4JK1X 3W2WA 4L5JA 3LQQA 2WAQN 2LKPA 3GVAA 1X1PA 1IXRC 1A35A 4LD5A 4DYQA 1R5HA 3ECHA 2L7MP 2LG4A 2D1VA 3CQZJ 5E3NA 4ETSA 1MMDA 1YJWI 3DU6A 1RESA 3BLYA 3OSFA 3K70C 3MFKA 4PSWA 2M5WA 2WBMA 2ZFUA 4OOIA 3W3CA 1BW6A 2OU2A 1HSJA 2BY1A 4XL9A 3A03A 1OFCX 2CW7A 2Z3YA 1WJFA 3GO5A 2VKVA 5E8IA 2WA0A 4O3MA 2VT2A 1VNDA 1I6XA 1HW1A 1OKRA 4KJZA 4CZZA 5D8KB 3HDDA 5FLMJ 2JUGA 3CJNA 3BG7A 1GXPA 4YFNF 1VQ5I 1GHCA 3SJMA 4L0YB 1T95A 2KIQA 3K4MA 1R9TJ 1YFHA 1KQ9A 1O7FA 1YS6A 3W2AA 1QZZA 1X4OA 2VQCA 5J8FA 1H9GA 4UUSB 3ZQHA 5LRRA 3FBIB 1W0UA 3LMMA 5E1XA 2HDWA 2FUG2 2VONA 3K70D 1U5TB 1RNLA 5HS9A 1R1TA 1FOWA 2ELKA 2V79A 2BYVE 3IUOA 3KPHA 4FX4A 4I09A 1Q1VA 1OCCH 1MBGA 3OY9A 3KEYA 4E7HA 4YEJA 4B09A 3S3OA 2KZGA 2P7CB 3R61A 2R7TA 3BOQA 1TWCJ 3FHZA 4Q5SF 2RQQA 3A1YA 4G6DA 3F0CA 3TQNA 4A3IJ 1Z6RA 5FLXZ 1FSEA 4RM2A 4YIRX 3QPHA 1RZ4A 1JGGA 2GXAA 4C2UA 2CFXA 3CP8A 3K2ZA 3WTVC 3ZPLA 3DBLB 5F6FA 2ESHA 2GAUA 3WTXC 4NUBA 4LIUA 5K7FA 2R5ZB 1PP7U 1LPQA 1S7AA 4A3KJ 2XPUA 1YO5C 2FXAA 2V7FA 2AQFA 3SFZA 4AM3A 4XKCA 4AIDA 2K3PA 1HBXG 4G8XA 2VJ5A 1TP4A 4S0HB 3UKGA 4X6AJ 1T98A 2E1MB 2LY9A 1ETOA 2L0KA 4IHWA 2DT6A 5E8GA 5ICGA 2JA2A 2VASA 1PUEE 2PX9A 3ULQB 2E7XA 5CJ9A 1YE9A 2V9KA 2XIGA 1I4VA 3O2PE 2X0LA 4XRSA 4BJTA 3QOPA 4CUGA 4WF2A 2P7VB 1WI3A 2LR8A 3KP4A 4XRMA 3VSLA 3U1DA 2PLYA 2XGEA 3A02A 3DKWA 2FBIA 1TWHJ 5AIPA 2GOXB 2R7OA 5IYBJ 3FXKA 3GZNB 2DTZA 2CUEA 2DTRA 2CFOA 1V5EA 1T6SA 2HU9A 3MCZA 1EH8A 3TOAA 5GADJ 1R22A 2UWMA 3MN2A 2A05A 2L9VA 1BR1A 2IBDA 3S2HJ 3G6EI 4D5FA 3CCSI 3OYIA 3LSJA 1W36C 3OYGA 2WAQA 1T08B 2QF7A 4A2UA 1J59A 3K7AJ 3DF8A 3ZQIA 1N75A 2HI3A 2HR3A 2M1BA 5BQTA 4RGRA 3BZKA 2DBBA 3I4PA 5DEQA 5EEHA 4M9ZA 3HOSA 1G3TA 3NARA 3DTEA 3TP0A 4QSHA 4IL6C 4HA8A 3ZQ7A 3F9KA 4RLQA 4AYBA 3QWLA 2DPUA 1R36A 5HDKA 3KETA 3DXJF 2WADA 5E17F 5JVGF 1QGPA 2K02A 1X3ZB 4JX5A 3VSKA 4GO1A 4HEA2 1Z6TA 2BEOA 1UCRA 3OS2A 4OIQF 2FE3A 2HTJA 4A3EJ 1T33A 4XLNF 1K4SA 2ZXWH 1UB9A 1MMSA 1IN6A 2IXSA 4LGWA 3EETA 4RAYA 3SQNA 3DWLE 2IA1A 4ZZDA 3K4CA 4KN4X 3WTYC 3F8NA 4ZDLA 2Q2EB 3I54A 4U7BA 2EINH 3KEQA 2HWVA 3KZYA 1Z1DA 3WGGA 1P7JA 2IGMA 2XGDA 2ZCWA 3JRGA 1WH7A 2E2HJ 3HOTA 3HG9A 2R7QA 2XV4S 2VB6A 3H9GA 3CCEI 1BOAA 1E17A 2HNFA 4KITB 2UV1A 3KE2A 3HL2A 4I6ZA 1DGRM 3JTGA 2E34A 3HOYJ 1IRGA 3DBRB 1KN9A 2O9LA 1UG0A 4M73A 5E18F 1XS9A 1B9MA 1AU7A 3HGGA 2A3SA 2VE8A 1YRNA 3GTLJ 4UUSA 3X2QH 1FP1D 1MDMA 2K27A 2P5LC 2DJNA 1H89C 1XN7A 3BR5A 2R7ZJ 1UG2A 1U5TA 2FRHA 4ESJA 4XMYA 2VOPA 3KZIC 1ETWA 1F4KA 2CS3A 2BV6A 1DPUA 3ROUA 4EJOA 2DA6A 5C3EJ 5HLHA 3CLOA 4LG0B 3CCLI 4E7LA 4BXXJ 1G4DA 3Q0WA 2HOAA 3LNQA 2QUFA 4YFXF 2IJLA 2E5NA 5D4RA 4BNCA 2EFNA 1HKQA 3K4NA 4IF4A 5IOZA 4LK0F 4UY8I 2LY2A 3LAJA 3WG7H 2JPCA 3GFMA 2ACJA 4LB6B 2EZIA 2MFZA 4O5VA 3OMYA 3VYUB 2XASA 1TQMA 2DOEA 2XPWA 2R5ZA 2PJPA 4PUSA 2I8DA 4U0VA 3SFIA 3J81Z 4HF1A 4C30A 3WU2C 2P0WA 3HZJA 4CXFA 2HVRA 2ISZA 3L2RA 2J5PA 3CUOA 2GXBA 2EPFA 2LH9A 5F1RA 4A6DA 5DUKA 2VQHA 5JFRA 1J7KA 2DK8A 2P6TA 2M8GX 5L3DA 1ZG5A 1ZQ3P 1U3EM 1IN7A 5J3LA 5EJCA 3FXQA 3HC7A 5LHGA 4XIDA 2MD5A 1RPWA 2LVSA 2Z2SB 3HKZA 1IAWA 1U0JA 3JAMZ 5ILVA 1YLFA 3M07A 3AG4H 3W6JB 4KMFA 2LRDA 4EATA 4QPOA 3FXMA 1XDUA 2QWWA 4BE2A 3QP6A 1LFPA 3DPTA 3GTPJ 1FYMA 2PG4A 1O3SA 4BEHB 3VYTB 3BROA 1U9NA 1B72B 4JP0A 2CSOA 3KYLA 5F64A 2PMZN 1TW2A 4ENNA 1ORKA 5CVIA 2IA0A 4H4KC 3CC4I 5IY5H 3LSIA 1BJZA 2VKHA 1ZGJA 3U2RA 3D1NI 3TW6A 3BR2A 1TT0A 4KIGA 1V54H 1X1DA 2GM4A 1KCAA 5FGMA 2AHQA 2QQ9A 3OYDA 3ISPA 4EMSA 2KKOA 3E5XA 4FETA 2MSYA 4CCMA 1LEBA 3QQAA 4MEYF 1MSEC 3QYFA 2TDXA 3ERMA 2IW5A 3G1LA 2VOOA 5JVTA 2DOAA 1HW5A 1DPRA 1P2FA 1WJ5A 4YIIA 4HDUA 4A5MA 3IRQA 2HFHA 1ETQA 2LD5A 2KIFA 1OCTC 4A6EA 2E5ZA 4A0XA 1ZAOA 4B47A 4E7SA 2F4IA 2Y9ZA 2CQ7A 4E7ZA 4NNJA 1DP3A 2ID3A 1TWGJ 2OZUA 5CPRB 1W5CC 4EJTA 4KA4A 2A69F 4PJLA 1NK2P 3DLAA 5H6RA 4BYYA 2XKOA 3BJAA 2VPLA 2HKOA 4RS8A 2L9RA 3BJOA 3V8KA 2OC6A 2B63J 4AC0A 2DI3A 4M3FA 5DDGA 3IC7A 3BCAA 1KONA 2ESNA 5IP6A 2PMUA 1IV6A 3I56I 2ZJRF 3LAPA 2DA7A 2WC2A 1VQPI 3LSMA 4NV4A 3H3ZA 2ID6A 3ZMTA 1O57A 1XX5A 3H35A 3EYYA 4ASNA 4ZYGA 1J0RA 4HQEA 1D8JA 2PEXA 4EM2A 2PQ8A 3H5NA 4MQ9F 3ZQGA 4BH9A 4BKXA 3S1QJ 2OTLI 4OU0A 1USSA 5CYVA 2JA7J 3JTHA 3K1MA 2ZC2A 1TT5B 5FKOA 2BW3B 5IP9J 3K9TA 1DGWY 3BT9A 1LNWA 4NC7A 1FP2A 5CVRA 3L2CA 3OS0A 1J9IA 2IGKA 2VQGA 4IRHA 2M7AA 3IHUA 2QCOA 4CSWA 5D8LB 2K9LA 2RREA 1H9TA 1YITI 1T2KA 3BCBA 1D5YA 2M4GA 4KFCA 3ERED 1IRFA 1WJDA 3JCUC 1ON2A 3LSGA 4RAGA 4EM0B 3M1EA 4N31A 3FXJA 2XB0X 2GWRA 1BIAA 3FZVA 2GA2A 3IP4B 3OIPA 1ZKGA 4PK4A 5J40A 5HS7A 1X1AA 4CA0A 4LG0A 1TC3C 1FWZA 4ON0A 2HVSA 4UHTA 1XGNA 2XSJC 3K1PA 5JI6A 3JRDA 1BC8C 4IXAA 1QZEA 2BY2A 3Q5FA 2X6YA 5B3SH 2QZ8A 2Y0SN 3SDGA 4LFUA 1D5VA 3SHFA 3LWFA 4QWQA 3TO6A 2F5VA 1F5TA 2ISYA 3RIRA 3TDZC 1K79A 4A5NA 2A68F 4A3MJ 4PJ0C 1QO0D 2K5CA 3Q9SA 3BDDA 2XAGA 4HRIA 2OZ6A 4DNCA 3UR3C 1WJBA 3QODA 1M1EB 3QYBA 1MNDA 3OYFA 2G7HA 3H92A 3ELKA 3I0TA 3LOCA 4N9IA 4ITVA 4ZYHA 2CV0A 4I2OA 5IT9Z 1HXDA 4MEXF 2L9NA 2N8GA 3HB9A 3SEQA 2XROA 3H1CA 4Y13A 2P4WA 1I27A 1TQPA 1MJ9A 3ESWB 3CCRI 3E6BA 2L7KA 3I9V2 3F21A 1TTYA 4IPAA 1B1BA 1SD5A 1R4NB 1RIOH 3E5QA 3T1BA 3O8GA 1MJBA 4BEHA 3QPSA 3RYPA 1BN5A 4KDPA 4RGUA 1SVOA 4FCYA 4LITA 1RETA 2QSFX 2HNHA 2WTEA 2Z33A 3JR9A 1KU2A 4Y7NJ 1MJAA 2CQNA 2OQRA 3GZ5A 1OISA 1AOYA 2EFQA 4HDVA 5GP9A 2XSDC 2QVOA 1IJWC 1ETYA 2X4HA 5DCMB 3TO7A 3LA2A 3FK6A 1USTA 1RR7A 1BI2A 4BHPA 5L3CA 3I55I 2XF7A 1WI9A 3MMYB 1HA8A 1D1CA 2R7WA 1GV2A 3HTUA 2QA4I 4GGGA 5ILUA 3I59A 4EJVA 4XLFA 3IKTA 4AVZA 5M5XJ 3ZR8X 2RC4A 1ETXA 5EZHA 2DA1A 3I5UA 3EDPA 2DXIA 3CCMI 1BL0A 2NNNA 4P96A 1SFUA 3I53A 3PIPF 3CJRB 2VBYA 2WY8Q 3CCQI 2HYFA 2ZFWA 3DKYA 5EF6A 2KRFA 3P9IA 1D0ZA 3HRUA 1YW8A 3ZMDA 3MQ0A 2GOMA 2K9QA 2UZKA 1KA8A 2R7UA 4I0BA 4HG2A 4FX0A 2IRFG 4DBRA 1Y8QB 5ERIA 1O3RA 4RDUA 1W1WE 3M8EA 2G0EA 1FZPB 5B5EC 2RV8A 4OWRB 2JRTA 4FASD 2R7XA 2QBYA 1YYVA 5FJ8J 2DA3A 3KP3A 4XOTA 1CGPA 9ANTA 4ESBA 5D5WB 2R0QC 1LVAA 2QENA 5CVUA 1Q1HA 2MLKA 2W24A 4HX4A 1SVMA 3F72A 4CH7A 1E0EA 2UUZA 1BC7C 2LFBA 2NOJB 2L7ZA 4A3FJ 4RB3C 4E6KG 1QBJA 2HOSA 4JOMA 2EV5A 3PL8A 2WV0A 2C6YA 4BBSJ 4DBQA 3FF5A 1IN4A 1TZLA 3TBIA 4NQWB 1MMAA 2BW3A 4F7ZA 4FHTA 2IPQX 5D5XB 4UUVA 2V6EA 5JR3A 2Y0SA 3OYKA 2KIMA 1WJEA 1TNTA 1WGXA 4Y52J 1MGTA 3K4KA 1WJCA 1XG1A 3RZOJ 3PSFA 5K5QA 4AU7A 1H8AC 1Z7LA 3OYBA 4BDZA 2ZKZA 2TCTA 1MKMA 3L9FA 1Z9CA 2BBYA 2LC2A 1TWAJ 4HZFA 1I3AA 1S6LA 1I5ZA 4CZCA 1E3PA 5BS6A 4KIFA 1V5GA 3D5RC 5E20A 2NXNB 3C3WA 3DKXA 5E3LA 4I99C 3ZXSA 5KCMA 2EA4A 4CICA 4D1QA 4EEFG 2X85A 4MFDA 3KLNA 4HX7A 4PJMA 1YW7A 2AXLA 5AIQA 4KT5C 3LA7A 2FSWA 3BR3A 1AY9A 3RQ4A 1U8BA 1FBSA 2M2EA 3DCFA 3L2WA 2ZBKA 2RAEA 4BY1J 4G12A 3DPLC 5DD8A 1YRNB 2HPMA 4ME8A 2VJIA 1YHQI 2VI6A 1MDMB 3CCVI 3PJRA 1CF7B 3BR0A 1C0WA 2LMDA 3H9QA 4G7HF 3CCJI 1P7IA 3NWTA 4ZTJA 5D6FA 1ERDA 3CMMA 1ZRCA 2R3SA 3QPTA 1GVDA 3JRHA 3L2VA 3S3NA 1BBYA 3OIOA 1ODDA 2W25A 2V9PA 3CJTB 3CF5F 2M34A 4BQQA 4EM1A 1XSXA 2GBYA 3U9GA 3RKYA 1HW2A 2DW4A 1ZYRF 2ZJPF 1ZELA 2E2IJ 5BOXA 1IG7A 2LY1A 1FPQA 1FX7A 2AXTC 3CMYA 1FYLA 4E7JA 2R7VA 1SD4A 2M7BA 3JRAA 4GXOA 3HPHA 3ZOBA 3DEEA 2OAZA 4XBFA 4S05A 4PGHA 1EA3A 5DCMA 1IDZA 2Q1ZB 1IZ1A 3G2BA 4BHCA 3GTGJ 3FMRA 2FA5A 3CO7C 4BE1A 3GXOA 4OAYA 3HBLA 4RM3A 1DU6A 4G7ZF 2ELJA 4ZYAA 3ZCOA 1BI1A 1T56A 4AWXB 4G94A 1IN5A 2ZXIA 4XLHA 4OAZA 3WTTC 5BPDA 3S17J 4B43A 4OIRF 3R0AA 1O3TA 5EZGA 3S15J 1MIJA 4ZDPA 2LKSA 1BA5A 4AVPA 1IN8A 2FNAA 2XKPA 3N97A 1QHGA 1ZREA 2LYCA 1BR2A 2DPDA 3K2AA 3OOUA 3COAC 1DU0A 2JWTA 1Z0XA 1I3QJ 2DA5A 4YFKF 3RTRA 2O7OA 3ZRGA 2VJJA 4PJJA 1Z7UA 2RKHA 3ONQA 1B9NA 1D1AA 1ZLJA 4UV8A 4M3EA 5LGUA 5C4XJ 2JVHA 4YRVA 3OYJA 4MFEA 2NVQJ 4A12A 1K83J 1P4XA 2DDAA 1WJAA 4G6TB 1FY7A 1J2XA 3DTIA 4BAYA 1SFOJ 1JKRC 5GTHC 4JBAA 3DFGA 4MNUA 4XRSG 4Q4ZF 2HGCA 2DFFA 2G7UA 2QEXI 1MMNA 4A3LJ 4AIKA 1FOYA 1VQ8I 1Y39A 4B44A 2OD5A 2K86A 3I58A 1XCBA 1GLNA 1LDJA 3MEXA 2KRCA 2VODA 3PSIA 4KICA 3CDLA 3ABTA 1OCRH 3IKVA 1WPKA 1S3JA 1X3WB 2QYOA 1E3HA 1W36D 3AFHA 4NQWA 2W7NA 5LGTA 2XF5A 3Q9VA 1JHCA 2JTVA 2ZSIB 4XK4A 3ZN1A 3JRIA 1F1ZA 1R1UA 2LF7A 4IOAF 4IHSA 3DEUA 2M87A 5L3EA 1OMIA 4OMZA 1U6GA 2DMUA 4F93B 1KZHA 5HDGA 2YX7A 3FM5A 1O4XA 1IRXA 3DP7A 4P9UA 2A5WA 4HQMA 2P8TA 1LVKA 4QLCU 3CDIA 3DTKA 3R0JA 4RB0A 3PM1A 4N4NB 1FOXA 2KQRA 2XVCA 5FRMA 2PJRB 4HF0A 5ICFA 5LEJA 2ETHA 2R7RA 1UHMA 3E6CC 4XLAA 1S7EA 3A2KA 3CC7I 5HNFA 2ZXJA 2H09A 5TISC 4A0ZA 3AG3H 4F52A 3TDUC 3J7ZI 1JHFA 3C2HA 3FMSA 2H1KA 2MH9A 4A93J 2CV1A 4MIMA 3K10A 1JTXA 2H6CA 2ZMEB 3PO3J 3D0SA 5CLSA 3SZPA 1XSDA 4L9TA 3OIQA 4FT8A 1W0TA 5H2FC 2BZTA 5JLXA 1ZG3A 3QU3A 2A61A 1OCZH 2MC3A 1FBQA 1SFXA 4UUTA 1RKWA 3CJQB 5C44J 2X48A 2QSHX 1JTYA 2NS8A 1LQ1A 3T5XA 1CF7A 1G8XA 2KMUA 3BDNA 1FMVA 3HPGA 1STZA 2K3FA 1H88C 4RAFA 3OYNA 2JN6A 1UELB 4I01A 3FHNA 4DOZA 3OYMA 2F4MB 4EGZA 1W7PB 1GT0C 2FJ1A 3LSKA 5JLWA 3GMEA 1NH3A 3VEPA 1FYKA 5IT3A 2ADUA 2KIUA 1ZLKA 2O3FA 2VBZA 1IUYA 5BMZA 2ZXHA 4XKBA 3EUAA 3W6VA 1QPIA 3PFIA 3R60A 3IAS2 1JUSA 4N0BA 1S9HA 4FTHA 2HQRA 1K4TA 2W82A 1D1BA 2DCEA 4CYCB 3WHBA 1WVRA 4P5OA 4XNFA 3TL4X 1IDYA 5F27A 2YU9J 4E7IA 5D5UB 5BPIA 2DJIA 3BTIA 4BDYA 5FFXA 2X1EA 4AUXA 3OL3A 4XN0A 1QVTA 3FWEA 1SMYF 4FE7A 1MBEA 4CCNA 5J4YA 2HZDA 2KRHA 4ANJA 2WV1A 5GAGJ 1K6YA 2GXGA 3NAUA 1N77A 3BJ6A 1NG6A 3I71A 3PQKA 4HNTA 5KHDA 3EUKL 3CZ6A 3DU5A 2OQGA 3WTSC 1XSVA 4PFOA 2GIVA 1GXQA 2W1OA 2ZSHB 3T8TA 4NB5A 2COMA 2OF7A 4Y15A 4EVIA 2YPRA 4UXNA 4MTDA 5HOOA 2M9HA 4EGYA 4V19K 2M30A 1R1VA 2HOTA 1ZR4A 4IKFA 1REPC 2K4BA 4Y33A 2EFWA 1YJ9I 1Z3YA 3KYCB 2TRTA 2V26A 2X1DA 3KP7A 5DCFA 2XAUA 2H8RA 1JHEA 2EFOA 5L3BA 1D8KA 2ICWG 3KX2A 3N05A 5DYMA 3V4GA 1KQ8A 2X9DA 4XLPF 3S93A 3SZTA 1Z67A 3M8FA 5E1ZB 1B6AA 1FBUA 2Z16A 3VB2A 3F3XA 4RLFA 5KAFC 1T7DA 3VPRA 5A2QK 2EK5A 2ZMEC 2HDCA 3WE2A 1D0XA 1WH5A 2BHZA 1KGSA 3TP3A 1HKSA 1RKTA 2CUZA 3WU1B 3GYHX 4A3CJ 4ZJZA 3VODA 3ABKH 3G71I 1UMQA 2EJRA 5IYCJ 4X1EA 4XLCA 2IVMA 4BXUA 3I59B 4LIVA 4Z6YA 5M3FJ 4KUMA 1VQ9I 1SD6A 3GFLA 3O3KA 1IRZA 3PO2J 1NTCA 2EBIA 3ABUA 3L09A 3A01B 5KVRA 5EGOA 3RCOA 2B9SA 1O7LA 2DDBA 1YX3A 3TKYA 2D2WA 3EUHC 3QAHA 2PN6A 4DZJA 3H0DA 3T8RA 2QLZA 3HHHA 4FE4A 1Z05A 1X3UA 2VN2A 5L3GA 2CH0A 4IEJA 2EFPA 3M4OJ 1RRJA 4L0ZB 4I0AA 4IQJA 2FOKA 3OYAA 3DBHB 4ZC3A 2D1HA 3GCMA 4JQFA 1POGA 3WTWC 2MBFA 4PCQA 2A5YB 2K7LA 3Q0UA 5DTDA 3BQYA 2EV0A 1ZK8A 3IH3A 5F08A 1FIAA 3HOZJ 2HTSA 3I64A 5HNHA 1XC5A 1DUXC 3QP5A 1XB4A 5LLQA 2AS5F 2CO5A 1BJAA 4UV9A 2NVXJ 2QBYB 2IS4A 2R92J 1W7PD 2Q0OA 1RUNA 2O03A 4Y17A 3OYHA 1I1GA 1BI3A 3I4MJ 2H94A 4NC8A 2XGXA 4IZZA 2PJRA 2P81A 2AO9A 1WSUA 4ZTFA 4XM3A 4YG2F 1RR8C 1ZTRA 3QYEA 4BHBA 5M5WJ 1QU3A 2Y69H 4F91B 3D5LA 2LSOA 3PUFA 1LFBA 1FJLA 4OMYA 3KCCA 2WAFA 3V42A 5LHHA 5DM7F 1R6RA 2E1CA 2NOGA 2EB7A 3L2QA 4ZYEA 1P9QC 2GA1A 3WTZA 1OYYA 3E0JB 5HLIA 2ZMEA 2KDZA 2KZVA 1QVUA 1OPCA 1RI7A 3FXLA 4A3JJ 1ON1A 3E6MA 3OS1A 2FEZA 2PI0A 2JMWA 3GW2A 3WG9A 2XRNA 3C7JA 3J80K 2HQ5A 2PMHA 3KP2A 2Y75A 4K2EA 5FO5A 4M6VA 1VZ0A 1VQ4I 3K69A 4AIHA 2R7SA 1F9NA 2W84A 1SVLA 3KLOA 4WWCA 2HEOA 1W7PA 2ECBA 2CG4A 3FBNB 3C2BA 4XRFA 3GEZA 3AAFA 2V1UA 4A3GJ 1P92A 3EUHA 3HRTA 5LD2C 1JXSA 5IP7J 1YTYA 3MZHA 1QA6A 2IGNA 4HF2A 1JKOC 3CTAA 2K9NA 2F2EA 2R7FA 3OYCA 3JSOA 3QRFF 2XAHA 1QNTA 4QIWN 4A3DJ 4CYCA 5BNGA 4HV6A 3VFZA 5K7HA 2MH2A 4BY7J 3RSNA 4BXFA 1ZRDA 5F0CA 3FISA 1HF0A 4D0PA 5FLVA 5E1WA 4C3IJ 4B48A 2M3AA 1N25A 4A3BJ 4WX9A 3GTKJ 2W57A 2JK3A 2Z99A 4I02A 2DA4A 1R49A 3WHCA 1Y56A 3S04A 5FROA 5E3OA 2PMZA 4L18B 1IXSB 1LDDA 2JA8J 3IWZA 1VQ6I 1S5LC 3EYIA 2STWA 3S1NJ 1IV8A 4M6XA 1MSFC 3FIWA 4DIQA 5DD4A 1VF9A 3LFKA 1L0OC 3SZGA 2E2JJ 1B59A 2IS2A 3NEUA 1YIJI 2VC0A 1R58A 2F5FA 1WFXA 1MW7A 2M4KA 1F43A 3NRVA 1ZARA 1XGOA 3BTCA 2FMLA 2L5QA 4IO9F 1R5GA 2E60A 3KFWX 4XR6A 3GZ6A 2KFDA 3LFUA 1XGMA 4HSTA 4OIOF 2MLGA 2FX0A 3ZMUA 2QQ8A 2EIMH 3R4KA 1BI0A 4RA2A 2QSGX 2K9SA 1Y0UA 4KYWA 1BW5A 2MW8A 2KHMA 2L54A 2VLAA 3TW7A 3BZCA 1TW3A 3GTJJ 3ZQLA 1G6NA 1W5SA 3MZ8A 4I76A 3KP5A 1JT6A 3B02A 4ENJA 2Y9YA 1U78A 3O6BB 1TNSA 4UB6C 1PDNC 4IVNA 2R5YA 3H5AA 2YSRA 4C2TA 2ME0A 2HVQA 3ZP5A 2EH3A 2HXOA 4PDKA 5E79C 3BG9A 3VYRB 1UMUA 5L3FA 3BR1A 3E7LA 5F04A 4MGRA 4ZZLA 1MD0A 1A31A 4WXDA 3ZQFA 2EQRA 1AHDP 3A01A 3J7YJ 3GBGA 3HXLA 1JI8A 2O61A 1KU7A 1UJ8A 1NHAA 2O0YA 1K7AA 1HDDC 2O8KA 1T0FC 3E1SA 2K4JA 3ZQCA 2WY7Q 3FDYA 1MNMC 3BG3A 2DU9A 2QQBA 1D0YA 4H0EA 5JHUA 2D45A 1Y0NA 2DAOA 3FMQA 5ED4A 2DT7B 1PUFA 2OBPA 1XGSA 1XMAA 2JUCA 3DEWA 4XQFA 1A5JA 2XGCA 2WAEA 3PQJA 3GTMJ 2M0MA 1OYWA 4BQAA 4C2MJ 1QHHD 5FKLA 2FD5A 2UXXA 4HW0A 3TMOA 1MZBA 3A0BC 1EH7A 4I98B 2KJCA 3GF2A 2ELHA 3RPUD 3HSRA 1XPXA 4R79A 2HQNA 4B8XA 3HSEA 3KEOA 2ZJ2A 2L01A 2ECCA 4D7NA 1ONVA 3B6CA 3GFIA 3S2DJ 1DQUA 1IF1A 2D5VA 4CCJA 2IT0A 2HS5A 4II2A 2DMNA 1XCVA 3ABLH 4IHTA 2YS9A 4XLEA 3V8JA 3W6KB 4OIPF 2Z1DA 2XC7A 2MGQA 1LUJB 3H3UA 1E3OC 3F8FA 2O6GE 2JJ7A 3ZGKA 1LFUP 4FQGA 2QM3A 2VKDA 4R1HA 3LSTA 4RB1A 2DODA 4GYIA 2B0LA 2DFEA 3IL2A 3BWGA 1Z91A 2GZWA 2UXNA 4GRIA 3TO9A 4NDLA 3LSHA 4YELA 3R6SA 4KISA 2FF4A 1I50J 5FKMA 3BQZA 1MBJA 1KYWA 5E3MA 1HKTA 2BE5F 6PAXA 2CU7A 1TLHB 2YR2A 5HODA 2EIJH 4Q47A 2YX4A 1OLTA 5FKKA 4R8HA 4BL0B 4GDFA 4GFBA 3C1DA 2MC4A 2V9VA 3Q0VA 4M3GA 3RPUA 3L7WA 3IH2A 2EIKH 1S29A 2VXZA 1XMXA 2YUSA 5ILSA 5HVQC 3S2WA 2DOFA 2DQLA 2L02A 1NK3P 4PFPA 1B12A 3K1NA 1AWCA 1MBKA 2LREA 1T0FA 1R23A 1X2MA 4M72A 3E6DA 5FRNA 1YOVB 1N78A 1P4WA 1Y6IA 1EKEA 3AG2H 2GLOA 2HYJA 1OR7C 3L2UA 4NHJA 3KYDB 3A4CA 4S04A 2Y30A 4AYBN 4BQNA 4IHYA 4LLLA 3FKIJ 4B1RA 2EILH 2M0CA 4II3A 3IAM2 4UVBA 3HIFA 1HSTA 3I4NJ 3RKWA 4F92B 3IIQA 3M3YJ 1IW7F 2GIZA 4L9VA 3RYRA 4PJNA 3EPZA 3H9JA 2RQPA 1OCPA 3RI4A 1XTAA 2Y48A 1G3SA 2F5DA 3BTLA 3M8JA 4KNYA 4E4HA 4MTEA 4YIFA 2DA2A 3HHGA 4Q48A 4XKVA 2HQAA 1B8IA 5EEAA 4IHVA 1QPMA 2V1XA 3F22A 1MH4A 1LE8A 2DO7A 2OJED 2F5CA 3BPVA 4ZYDA 5LEKA 3I3LA 1ZN2A 2X51A 4BQOA 1T8IA 5H20A 4XN3A 3FK7A 4GYGA 4RGXA 4DQ2A 2CGPA 3OR2C 1IXCA 3ZMVA 3GTQJ 5B1AH 4CDGA 5D5VB 1R5ID 2FBKA
chains in the Genus database with same CATH topology
2VBXA 1GVJA 3CUQC 4KN7X 1A04A 3HTSB 4P9FA 3CO6C 1TBXA 5DV5A 1U2WA 2IA2A 3TOBA 2XUBA 2J5OA 1OR7A 2ZNZA 3BY6A 1RUOA 2V6CA 2V1DA 2A6EF 1FC3A 1S7OA 2CWEA 3M9AA 4AD9A 2ZNYA 4EV0A 3DV8A 5ICEA 2RGVA 2E1NA 1K78A 5LHIA 4M6YA 2VT3A 3RPQA 5HDNA 1VTNC 2YU3A 1DDNA 4IRIA 3GUDA 2A07F 2Z5UA 3IWFA 1WWXA 1KYZA 3F8MA 1JE8A 1FOKA 5D4SA 4P55A 2O8XA 1UHWA 1ULYA 2FQ3A 3CUQA 2NAZA 2DK5A 1U5TC 2HOEA 2FMYA 3FM3A 3LA3A 1XD7A 4ESFA 3WTUC 4M9XA 1DP7P 2H27A 4U0YA 1LDKB 1V3FA 2FU4A 2NS0A 5FLXK 3OOPA 2KJBA 2A6HF 3P9KA 1KU3A 3E5UA 2EA2A 1EH6A 3WE3A 4M71A 5LBQA 3M7GA 3E97A 1FSHA 2Z9OA 1EV7A 2JSCA 2XAFA 4ENKA 5A2QZ 2L4AA 1PP8F 4K8WA 1E2XA 5D6EA 4EQQA 5HLGA 1ZRFA 3REOA 5LRSA 4UVAA 4E70A 5FD5A 2LDUA 3K0LA 4ENMA 3RKXA 4PGGA 4IRGA 1T39A 1OYIA 2ZO4A 1ZG1A 5CVVA 5J8CA 1LEAA 4M74A 3JW4A 1YG2A 5FB2A 4LLNA 3MAJA 2OA4A 1WRJA 3HSFA 1R00A 2MA3A 4KIBA 4MQVA 1G3WA 2Q8KA 2DLLA 1SD7A 4KMUX 4RAZA 2FKDA 5FD6A 1XDSA 2FJRA 4GCVA 2VE9A 5K1YA 2R7DA 2WWYA 2XAQA 3V7SA 1I1SA 1ZHFA 3FXUA 2PBIA 1K6OA 5TRDA 1YQAA 3F6OA 4CHUA 4U88A 4AIJA 5LGNA 3J80Z 4WXCA 1JGSA 5J6XA 2GQQA 4HV5A 4U0WA 3N4MA 4WK8F 2HO0A 3FX3A 2PFBA 2HYGD 2E7WA 2G9WA 2JT1A 4HYEA 4MHGA 4IJAA 1FLIA 3V7CA 3F8BA 1WKMA 4G7OF 4HLYA 1SMTA 3J7AO 2P6SA 2RDPA 2L3DA 3B73A 1P4AA 3CDHA 2F5EA 4I7HA 3MWMA 4XSZF 3HRMA 4TV7A 2CYYA 3WGHA 4ZH4F 1YW9A 4XSXF 1J5YA 2RVCA 2XHKA 3ZMZA 3MZYA 1F39A 4RGSA 1H0MA 3HRSA 2P5VA 3J81K 3C18A 2Q2EA 3DQVC 3RJPA 3GWZA 4L9NA 2DQRA 2CQKA 4HLXA 4LMYA 3FXRA 3GFJA 2STTA 2DT5A 1P6RA 1JHHA 3JAMK 1LB2A 3ECOA 4PZJA 1BM9A 1D3YA 3L00A 2RN7A 1FNNA 1U8RA 1KQ0A 3QU6A 3WODF 2HZTA 4CYDA 3EQLF 3BZ6A 5EEGA 2IP2A 1BIBA 4N9HA 2CW0F 1ZGAA 4LLGF 4UNOA 4L5IA 3VOEA 4G6QA 3F6VA 3HYIA 4WXHA 3WU0A 1QQIA 4WCGA 1G3YA 3RDIA 2M8EA 4O6JA 1FT9A 1B4AA 4EJWA 2FBHA 3F8CA 5KK1A 3V7RA 3P9CA 1QZYA 1TQIA 3ML6A 3ZN0A 4HAMA 2EWNA 1UFMA 3G3ZA 2EV6A 2H6BA 2QQAA 1XMKA 5AONA 4OINF 3T0YA 3KZZA 5ICCA 3WGIA 4LJZF 3BPXA 5H6QA 2BGCA 1S8NA 5FFZA 2FNPA 3KP6A 3TGNA 4LB5A 2JZYA 3G73A 1YIOA 2VC1A 3OV8A 1LJ9A 2NNYA 4RB2C 3ZMSA 3E3VA 2LF8A 4U7DA 3GX4X 4A0YA 4L9JA 2M45A 4HBLA 2NYXA 1K78B 4HOBA 2LNBA 1KU9A 1L3LA 4UVCA 3JSPA 1HQCA 1YS7A 2W85A 4CGZA 3P7NA 3IRRA 1W5TA 1W4MA 1V4RA 2P5KA 1ZH5A 5K5OA 1T38A 1SFEA 5CVJA 3BP8A 3CUQB 3F23A 3GLXA 4HX8A 4G9YA 1WQ2A 3LQRA 4Z2YA 2L4MA 2JPBA 5HS8A 5K5RA 1R7JA 4LK1F 3NQOA 2DFIA 2XAJA 3SXYA 2NRAC 2HKXA 1J75A 2RNJA 2Y0MA 5DUIA 3HUGA 4CO8A 1SAXA 5IT9K 1O3QA 5TJJA 3V8LA 4M9SA 4EJUA 2VBWA 4JK1X 4L5JA 3LQQA 2LKPA 3GVAA 1IXRC 4LD5A 1R5HA 3ECHA 2D1VA 4ETSA 3MFKA 2M5WA 4OOIA 2OU2A 1HSJA 2Z3YA 3GO5A 4O3MA 5E8IA 2VT2A 1I6XA 1HW1A 1OKRA 4CZZA 5D8KB 3CJNA 1GXPA 1GHCA 4YFNF 4L0YB 1YFHA 1KQ9A 1O7FA 1YS6A 1QZZA 5J8FA 1H9GA 5LRRA 5E1XA 2VONA 1U5TB 1RNLA 5HS9A 1R1TA 2V79A 2BYVE 4FX4A 4I09A 4B09A 2P7CB 3R61A 3BOQA 3FHZA 4Q5SF 4G6DA 3TQNA 1Z6RA 5FLXZ 1FSEA 3QPHA 1RZ4A 2CFXA 3K2ZA 3WTVC 3ZPLA 5F6FA 2ESHA 2GAUA 3WTXC 1PP7U 1S7AA 1YO5C 2FXAA 3SFZA 1HBXG 4G8XA 1T98A 5E8GA 5ICGA 1PUEE 3ULQB 2E7XA 5CJ9A 2XIGA 1I4VA 3O2PE 2X0LA 3QOPA 4WF2A 2P7VB 3KP4A 3U1DA 2PLYA 3DKWA 2FBIA 5AIPA 2DTRA 1T6SA 3MCZA 3TOAA 1EH8A 1R22A 2UWMA 4A2UA 1J59A 3DF8A 2HR3A 2M1BA 5BQTA 4RGRA 2DBBA 3I4PA 5DEQA 5EEHA 4M9ZA 3HOSA 1G3TA 4HA8A 3ZQ7A 2DPUA 1R36A 5HDKA 3KETA 3DXJF 5E17F 1QGPA 2K02A 4GO1A 1Z6TA 2BEOA 1UCRA 4OIQF 2FE3A 2HTJA 4XLNF 1UB9A 1IN6A 4LGWA 4RAYA 3EETA 3SQNA 2IA1A 4ZZDA 4KN4X 3WTYC 3F8NA 3I54A 4U7BA 3KEQA 2HWVA 3KZYA 1Z1DA 3WGGA 2ZCWA 3HOTA 2XV4S 1BOAA 1E17A 2HNFA 3KE2A 3JTGA 1IRGA 1KN9A 4M73A 5E18F 1B9MA 2A3SA 2VE8A 1FP1D 1MDMA 2K27A 2P5LC 1XN7A 1U5TA 2FRHA 4ESJA 2VOPA 1F4KA 2BV6A 1DPUA 3ROUA 4EJOA 5HLHA 3CLOA 4LG0B 1G4DA 2QUFA 4YFXF 2IJLA 5D4RA 4BNCA 2EFNA 1HKQA 4IF4A 4LK0F 3LAJA 2JPCA 3GFMA 2ACJA 4LB6B 4O5VA 2XASA 1TQMA 2PJPA 4U0VA 3J81Z 4HF1A 4CXFA 2ISZA 2J5PA 3CUOA 2GXBA 5F1RA 4A6DA 5DUKA 5JFRA 1J7KA 2DK8A 2P6TA 5L3DA 1ZG5A 1U3EM 1IN7A 3FXQA 5LHGA 2MD5A 1IAWA 3JAMZ 5ILVA 1YLFA 4KMFA 3W6JB 1XDUA 2QWWA 3QP6A 3DPTA 1FYMA 2PG4A 1O3SA 3BROA 2CSOA 5F64A 4ENNA 1TW2A 5CVIA 2IA0A 1ZGJA 3U2RA 4KIGA 1KCAA 5FGMA 2QQ9A 3ISPA 4EMSA 2KKOA 3E5XA 1LEBA 4MEYF 2TDXA 2IW5A 2VOOA 5JVTA 1HW5A 1DPRA 1P2FA 4YIIA 4HDUA 4A5MA 3IRQA 2HFHA 2KIFA 4A6EA 4A0XA 1ZAOA 2OZUA 4EJTA 4KA4A 2A69F 5H6RA 4BYYA 2XKOA 3BJAA 2HKOA 4RS8A 3BJOA 3V8KA 2DI3A 5DDGA 3IC7A 2ESNA 2PMUA 3LAPA 2WC2A 4NV4A 3H3ZA 3ZMTA 1O57A 4ASNA 1D8JA 3EYYA 4ZYGA 4HQEA 1J0RA 2PEXA 4EM2A 2PQ8A 4MQ9F 4BH9A 4OU0A 1USSA 5CYVA 3JTHA 3K1MA 3K9TA 1LNWA 1FP2A 5CVRA 3L2CA 1J9IA 4IRHA 3IHUA 5D8LB 1H9TA 1T2KA 4KFCA 3ERED 1IRFA 1ON2A 4EM0B 3M1EA 4N31A 2GWRA 1BIAA 3FZVA 2GA2A 5HS7A 4LG0A 1FWZA 4ON0A 4UHTA 1XGNA 3K1PA 5JI6A 1BC8C 4IXAA 3Q5FA 2QZ8A 4LFUA 1D5VA 3SHFA 3LWFA 4QWQA 3TO6A 1F5TA 2ISYA 3RIRA 3TDZC 1K79A 4A5NA 2A68F 1QO0D 3Q9SA 3BDDA 2XAGA 2OZ6A 4DNCA 2G7HA 3H92A 3ELKA 3I0TA 4ZYHA 4N9IA 4I2OA 5IT9Z 1HXDA 4MEXF 2XROA 4Y13A 2P4WA 1I27A 1TQPA 1MJ9A 3E6BA 3F21A 1TTYA 4IPAA 1B1BA 1SD5A 1RIOH 3E5QA 3T1BA 1MJBA 3RYPA 1BN5A 4KDPA 4RGUA 2WTEA 2Z33A 1KU2A 1MJAA 2OQRA 3GZ5A 1AOYA 2EFQA 4HDVA 2QVOA 2X4HA 3TO7A 5DCMB 3LA2A 1USTA 1BI2A 4BHPA 5L3CA 1WI9A 3HTUA 4GGGA 5ILUA 3I59A 4EJVA 3IKTA 2RC4A 3I5UA 3EDPA 2NNNA 4P96A 1SFUA 3I53A 2VBYA 2HYFA 2ZFWA 2KRFA 3P9IA 3HRUA 1YW8A 3ZMDA 3MQ0A 2UZKA 1KA8A 4I0BA 4FX0A 2IRFG 5ERIA 1O3RA 3M8EA 1FZPB 2RV8A 2JRTA 2QBYA 1YYVA 1CGPA 3KP3A 4ESBA 5D5WB 1LVAA 2QENA 5CVUA 1Q1HA 2MLKA 2W24A 4HX4A 3F72A 1BC7C 4RB3C 1QBJA 2EV5A 2WV0A 2C6YA 3FF5A 1IN4A 4F7ZA 4FHTA 2IPQX 5D5XB 4UUVA 5JR3A 2KIMA 1TNTA 1MGTA 5K5QA 2ZKZA 1MKMA 3L9FA 1Z9CA 2BBYA 4HZFA 1S6LA 1I5ZA 5BS6A 4KIFA 5E20A 3C3WA 4CICA 2EA4A 3KLNA 4HX7A 1YW7A 2AXLA 5AIQA 4KT5C 3LA7A 2FSWA 1AY9A 1FBSA 2ZBKA 3DPLC 5DD8A 4ME8A 1MDMB 1CF7B 1C0WA 4G7HF 5D6FA 1ZRCA 2R3SA 3QPTA 1BBYA 1ODDA 2W25A 4EM1A 1XSXA 3U9GA 3RKYA 1HW2A 2DW4A 1ZYRF 5BOXA 1FX7A 1FPQA 1FYLA 1SD4A 4GXOA 2OAZA 4XBFA 4S05A 4PGHA 5DCMA 1IZ1A 4BHCA 3FMRA 2FA5A 3CO7C 3GXOA 4G7ZF 1BI1A 4AWXB 4G94A 1IN5A 3WTTC 5BPDA 4OIRF 3R0AA 1O3TA 4AVPA 1IN8A 2FNAA 2XKPA 3N97A 1ZREA 2DPDA 3COAC 4YFKF 3RTRA 1Z7UA 2RKHA 1B9NA 1ZLJA 4UV8A 5LGUA 4A12A 1P4XA 1FY7A 1J2XA 4BAYA 4JBAA 3DFGA 4MNUA 4Q4ZF 2HGCA 2G7UA 4AIKA 2OD5A 2K86A 3I58A 1XCBA 1LDJA 3MEXA 2VODA 4KICA 3ABTA 3IKVA 1S3JA 2QYOA 4NQWA 5LGTA 3Q9VA 1JHCA 2JTVA 3ZN1A 1F1ZA 1R1UA 2LF7A 4IHSA 3DEUA 2M87A 5L3EA 1OMIA 4OMZA 1U6GA 5HDGA 2YX7A 3FM5A 3DP7A 4P9UA 4HQMA 2P8TA 4QLCU 3R0JA 4RB0A 2XVCA 4HF0A 5ICFA 5LEJA 2ETHA 1UHMA 3E6CC 2ZXJA 2H09A 4A0ZA 3TDUC 1JHFA 3FMSA 2MH9A 2H6CA 2ZMEB 3D0SA 5CLSA 3SZPA 1XSDA 4L9TA 4FT8A 1ZG3A 3QU3A 2A61A 2MC3A 1FBQA 1SFXA 1LQ1A 3T5XA 1CF7A 3BDNA 1STZA 4I01A 4EGZA 1W7PB 1FYKA 3VEPA 5IT3A 2ADUA 2KIUA 1ZLKA 2O3FA 2VBZA 1IUYA 5BMZA 3PFIA 3R60A 4N0BA 2HQRA 4P5OA 5D5UB 5BPIA 5FFXA 3FWEA 1SMYF 2GXGA 3BJ6A 3I71A 3PQKA 2OQGA 3WTSC 1XSVA 2GIVA 1GXQA 3T8TA 4NB5A 2COMA 4Y15A 4EVIA 2YPRA 4UXNA 4MTDA 5HOOA 4EGYA 2M30A 1R1VA 1REPC 2K4BA 2EFWA 5DCFA 3KP7A 1JHEA 2EFOA 5L3BA 1D8KA 5DYMA 1KQ8A 3V4GA 4XLPF 3SZTA 3M8FA 5E1ZB 1B6AA 1FBUA 3VB2A 3F3XA 1T7DA 5A2QK 2EK5A 2HDCA 3WE2A 1KGSA 1HKSA 3WU1B 3GYHX 3VODA 2EJRA 2IVMA 4BXUA 3I59B 4KUMA 1SD6A 3GFLA 3O3KA 3ABUA 3L09A 5KVRA 1O7LA 3TKYA 2D2WA 3QAHA 2PN6A 3T8RA 2QLZA 3HHHA 1Z05A 1X3UA 2VN2A 5L3GA 2EFPA 4L0ZB 4I0AA 2FOKA 2D1HA 4JQFA 3WTWC 2MBFA 4PCQA 2A5YB 2K7LA 2EV0A 2HTSA 3I64A 1DUXC 3QP5A 1XB4A 5LLQA 2AS5F 2CO5A 1BJAA 4UV9A 2QBYB 1W7PD 2Q0OA 1RUNA 2O03A 4Y17A 1I1GA 1BI3A 2H94A 2XGXA 1WSUA 4YG2F 4BHBA 3D5LA 2LSOA 4OMYA 3KCCA 5LHHA 2E1CA 2EB7A 4ZYEA 2GA1A 3WTZA 1OYYA 5HLIA 2ZMEA 1RI7A 1OPCA 1ON1A 3E6MA 2FEZA 2PI0A 3GW2A 3WG9A 3J80K 2XRNA 3C7JA 2PMHA 3KP2A 5FO5A 2Y75A 4K2EA 3K69A 4AIHA 1F9NA 2W84A 3KLOA 4WWCA 2HEOA 1W7PA 2CG4A 2V1UA 4XRFA 3GEZA 3AAFA 1P92A 3EUHA 3HRTA 1JXSA 1YTYA 3MZHA 4HF2A 3CTAA 2F2EA 2R7FA 3JSOA 3QRFF 2XAHA 1QNTA 4HV6A 3VFZA 2MH2A 1ZRDA 4D0PA 5E1WA 4WX9A 2W57A 2Z99A 4I02A 3S04A 4L18B 1IXSB 1LDDA 3IWZA 3EYIA 2STWA 4M6XA 5DD4A 3LFKA 1L0OC 1B59A 3NEUA 2VC0A 1R58A 2F5FA 3NRVA 1ZARA 1XGOA 2FMLA 1R5GA 3KFWX 3GZ6A 1XGMA 4OIOF 2MLGA 3ZMUA 3R4KA 1BI0A 1Y0UA 4KYWA 2L54A 1TW3A 1G6NA 1W5SA 3KP5A 3B02A 4ENJA 1U78A 3O6BB 1TNSA 1PDNC 4IVNA 2YSRA 3ZP5A 4PDKA 1UMUA 5L3FA 4ZZLA 4MGRA 1MD0A 4WXDA 2O61A 1KU7A 1NHAA 2O0YA 1K7AA 2K4JA 2DU9A 2QQBA 4H0EA 5JHUA 2D45A 2DAOA 3FMQA 5ED4A 2OBPA 1XGSA 1XMAA 3PQJA 1OYWA 4BQAA 2UXXA 4HW0A 1MZBA 1EH7A 4I98B 2KJCA 3GF2A 2ELHA 3HSRA 4R79A 2HQNA 4B8XA 3HSEA 3KEOA 2ZJ2A 2L01A 1ONVA 3GFIA 1IF1A 2IT0A 2HS5A 1XCVA 4IHTA 3V8JA 3W6KB 4OIPF 3H3UA 3F8FA 2O6GE 2QM3A 4R1HA 3LSTA 4RB1A 4GYIA 2B0LA 3IL2A 3BWGA 3TO9A 1Z91A 2GZWA 2UXNA 3R6SA 2FF4A 1KYWA 1HKTA 2BE5F 6PAXA 1TLHB 2YR2A 4Q47A 2YX4A 4R8HA 3C1DA 2V9VA 3RPUA 3L7WA 2VXZA 1S29A 5ILSA 5HVQC 3S2WA 2DQLA 2L02A 1B12A 3K1NA 1AWCA 1T0FA 1R23A 4M72A 3E6DA 1P4WA 4NHJA 4S04A 4LLLA 4UVBA 3HIFA 1HSTA 3RKWA 3IIQA 1IW7F 4L9VA 3RYRA 2RQPA 3RI4A 2Y48A 1G3SA 2F5DA 4KNYA 4MTEA 4YIFA 3HHGA 4Q48A 1QPMA 2V1XA 3F22A 2DO7A 2F5CA 3BPVA 4ZYDA 5LEKA 1ZN2A 5H20A 4RGXA 4GYGA 4DQ2A 2CGPA 3ZMVA 1IXCA 4CDGA 5D5VB 2FBKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VBX A;  1GVJ A;  3CUQ C;  4KN7 X;  1A04 A;  3HTS B;  4P9F A;  3CO6 C;  1TBX A;  5DV5 A;  1U2W A;  2IA2 A;  3TOB A;  2XUB A;  2J5O A;  1OR7 A;  2ZNZ A;  3BY6 A;  1RUO A;  2V6C A;  2V1D A;  2A6E F;  1FC3 A;  1S7O A;  2CWE A;  3M9A A;  4AD9 A;  2ZNY A;  4EV0 A;  3DV8 A;  5ICE A;  2RGV A;  2E1N A;  1K78 A;  5LHI A;  4M6Y A;  2VT3 A;  3RPQ A;  5HDN A;  1VTN C;  2YU3 A;  1DDN A;  4IRI A;  3GUD A;  2A07 F;  2Z5U A;  3IWF A;  1WWX A;  1KYZ A;  3F8M A;  1JE8 A;  1FOK A;  5D4S A;  4P55 A;  2O8X A;  1UHW A;  1ULY A;  2FQ3 A;  3CUQ A;  2NAZ A;  2DK5 A;  1U5T C;  2HOE A;  2FMY A;  3FM3 A;  3LA3 A;  1XD7 A;  4ESF A;  3WTU C;  4M9X A;  1DP7 P;  2H27 A;  4U0Y A;  1LDK B;  1V3F A;  2FU4 A;  2NS0 A;  5FLX K;  3OOP A;  2KJB A;  2A6H F;  3P9K A;  1KU3 A;  3E5U A;  2EA2 A;  1EH6 A;  3WE3 A;  4M71 A;  5LBQ A;  3M7G A;  3E97 A;  1FSH A;  2Z9O A;  1EV7 A;  2JSC A;  2XAF A;  4ENK A;  5A2Q Z;  2L4A A;  1PP8 F;  4K8W A;  1E2X A;  5D6E A;  4EQQ A;  5HLG A;  1ZRF A;  3REO A;  5LRS A;  4UVA A;  4E70 A;  5FD5 A;  2LDU A;  3K0L A;  4ENM A;  3RKX A;  4PGG A;  4IRG A;  1T39 A;  1OYI A;  2ZO4 A;  1ZG1 A;  5CVV A;  5J8C A;  1LEA A;  4M74 A;  3JW4 A;  1YG2 A;  5FB2 A;  4LLN A;  3MAJ A;  2OA4 A;  1WRJ A;  3HSF A;  1R00 A;  2MA3 A;  4KIB A;  4MQV A;  1G3W A;  2Q8K A;  2DLL A;  1SD7 A;  4KMU X;  4RAZ A;  2FKD A;  5FD6 A;  1XDS A;  2FJR A;  4GCV A;  2VE9 A;  5K1Y A;  2R7D A;  2WWY A;  2XAQ A;  3V7S A;  1I1S A;  1ZHF A;  3FXU A;  2PBI A;  1K6O A;  5TRD A;  1YQA A;  3F6O A;  4CHU A;  4U88 A;  4AIJ A;  5LGN A;  3J80 Z;  4WXC A;  1JGS A;  5J6X A;  2GQQ A;  4HV5 A;  4U0W A;  3N4M A;  4WK8 F;  2HO0 A;  3FX3 A;  2PFB A;  2HYG D;  2E7W A;  2G9W A;  2JT1 A;  4HYE A;  4MHG A;  4IJA A;  1FLI A;  3V7C A;  3F8B A;  1WKM A;  4G7O F;  4HLY A;  1SMT A;  3J7A O;  2P6S A;  2RDP A;  2L3D A;  3B73 A;  1P4A A;  3CDH A;  2F5E A;  4I7H A;  3MWM A;  4XSZ F;  3HRM A;  4TV7 A;  2CYY A;  3WGH A;  4ZH4 F;  1YW9 A;  4XSX F;  1J5Y A;  2RVC A;  2XHK A;  3ZMZ A;  3MZY A;  1F39 A;  4RGS A;  1H0M A;  3HRS A;  2P5V A;  3J81 K;  3C18 A;  2Q2E A;  3DQV C;  3RJP A;  3GWZ A;  4L9N A;  2DQR A;  2CQK A;  4HLX A;  4LMY A;  3FXR A;  3GFJ A;  2STT A;  2DT5 A;  1P6R A;  1JHH A;  3JAM K;  1LB2 A;  3ECO A;  4PZJ A;  1BM9 A;  1D3Y A;  3L00 A;  2RN7 A;  1FNN A;  1U8R A;  1KQ0 A;  3QU6 A;  3WOD F;  2HZT A;  4CYD A;  3EQL F;  3BZ6 A;  5EEG A;  2IP2 A;  1BIB A;  4N9H A;  2CW0 F;  1ZGA A;  4LLG F;  4UNO A;  4L5I A;  3VOE A;  4G6Q A;  3F6V A;  3HYI A;  4WXH A;  3WU0 A;  1QQI A;  4WCG A;  1G3Y A;  3RDI A;  2M8E A;  4O6J A;  1FT9 A;  1B4A A;  4EJW A;  2FBH A;  3F8C A;  5KK1 A;  3V7R A;  3P9C A;  1QZY A;  1TQI A;  3ML6 A;  3ZN0 A;  4HAM A;  2EWN A;  1UFM A;  3G3Z A;  2EV6 A;  2H6B A;  2QQA A;  1XMK A;  5AON A;  4OIN F;  3T0Y A;  3KZZ A;  5ICC A;  3WGI A;  4LJZ F;  3BPX A;  5H6Q A;  2BGC A;  1S8N A;  5FFZ A;  2FNP A;  3KP6 A;  3TGN A;  4LB5 A;  2JZY A;  3G73 A;  1YIO A;  2VC1 A;  3OV8 A;  1LJ9 A;  2NNY A;  4RB2 C;  3ZMS A;  3E3V A;  2LF8 A;  4U7D A;  3GX4 X;  4A0Y A;  4L9J A;  2M45 A;  4HBL A;  2NYX A;  1K78 B;  4HOB A;  2LNB A;  1KU9 A;  1L3L A;  4UVC A;  3JSP A;  1HQC A;  1YS7 A;  2W85 A;  4CGZ A;  3P7N A;  3IRR A;  1W5T A;  1W4M A;  1V4R A;  2P5K A;  1ZH5 A;  5K5O A;  1T38 A;  1SFE A;  5CVJ A;  3BP8 A;  3CUQ B;  3F23 A;  3GLX A;  4HX8 A;  4G9Y A;  1WQ2 A;  3LQR A;  4Z2Y A;  2L4M A;  2JPB A;  5HS8 A;  5K5R A;  1R7J A;  4LK1 F;  3NQO A;  2DFI A;  2XAJ A;  3SXY A;  2NRA C;  2HKX A;  1J75 A;  2RNJ A;  2Y0M A;  5DUI A;  3HUG A;  4CO8 A;  1SAX A;  5IT9 K;  1O3Q A;  5TJJ A;  3V8L A;  4M9S A;  4EJU A;  2VBW A;  4JK1 X;  4L5J A;  3LQQ A;  2LKP A;  3GVA A;  1IXR C;  4LD5 A;  1R5H A;  3ECH A;  2D1V A;  4ETS A;  3MFK A;  2M5W A;  4OOI A;  2OU2 A;  1HSJ A;  2Z3Y A;  3GO5 A;  4O3M A;  5E8I A;  2VT2 A;  1I6X A;  1HW1 A;  1OKR A;  4CZZ A;  5D8K B;  3CJN A;  1GXP A;  1GHC A;  4YFN F;  4L0Y B;  1YFH A;  1KQ9 A;  1O7F A;  1YS6 A;  1QZZ A;  5J8F A;  1H9G A;  5LRR A;  5E1X A;  2VON A;  1U5T B;  1RNL A;  5HS9 A;  1R1T A;  2V79 A;  2BYV E;  4FX4 A;  4I09 A;  4B09 A;  2P7C B;  3R61 A;  3BOQ A;  3FHZ A;  4Q5S F;  4G6D A;  3TQN A;  1Z6R A;  5FLX Z;  1FSE A;  3QPH A;  1RZ4 A;  2CFX A;  3K2Z A;  3WTV C;  3ZPL A;  5F6F A;  2ESH A;  2GAU A;  3WTX C;  1PP7 U;  1S7A A;  1YO5 C;  2FXA A;  3SFZ A;  1HBX G;  4G8X A;  1T98 A;  5E8G A;  5ICG A;  1PUE E;  3ULQ B;  2E7X A;  5CJ9 A;  2XIG A;  1I4V A;  3O2P E;  2X0L A;  3QOP A;  4WF2 A;  2P7V B;  3KP4 A;  3U1D A;  2PLY A;  3DKW A;  2FBI A;  5AIP A;  2DTR A;  1T6S A;  3MCZ A;  3TOA A;  1EH8 A;  1R22 A;  2UWM A;  4A2U A;  1J59 A;  3DF8 A;  2HR3 A;  2M1B A;  5BQT A;  4RGR A;  2DBB A;  3I4P A;  5DEQ A;  5EEH A;  4M9Z A;  3HOS A;  1G3T A;  4HA8 A;  3ZQ7 A;  2DPU A;  1R36 A;  5HDK A;  3KET A;  3DXJ F;  5E17 F;  1QGP A;  2K02 A;  4GO1 A;  1Z6T A;  2BEO A;  1UCR A;  4OIQ F;  2FE3 A;  2HTJ A;  4XLN F;  1UB9 A;  1IN6 A;  4LGW A;  4RAY A;  3EET A;  3SQN A;  2IA1 A;  4ZZD A;  4KN4 X;  3WTY C;  3F8N A;  3I54 A;  4U7B A;  3KEQ A;  2HWV A;  3KZY A;  1Z1D A;  3WGG A;  2ZCW A;  3HOT A;  2XV4 S;  1BOA A;  1E17 A;  2HNF A;  3KE2 A;  3JTG A;  1IRG A;  1KN9 A;  4M73 A;  5E18 F;  1B9M A;  2A3S A;  2VE8 A;  1FP1 D;  1MDM A;  2K27 A;  2P5L C;  1XN7 A;  1U5T A;  2FRH A;  4ESJ A;  2VOP A;  1F4K A;  2BV6 A;  1DPU A;  3ROU A;  4EJO A;  5HLH A;  3CLO A;  4LG0 B;  1G4D A;  2QUF A;  4YFX F;  2IJL A;  5D4R A;  4BNC A;  2EFN A;  1HKQ A;  4IF4 A;  4LK0 F;  3LAJ A;  2JPC A;  3GFM A;  2ACJ A;  4LB6 B;  4O5V A;  2XAS A;  1TQM A;  2PJP A;  4U0V A;  3J81 Z;  4HF1 A;  4CXF A;  2ISZ A;  2J5P A;  3CUO A;  2GXB A;  5F1R A;  4A6D A;  5DUK A;  5JFR A;  1J7K A;  2DK8 A;  2P6T A;  5L3D A;  1ZG5 A;  1U3E M;  1IN7 A;  3FXQ A;  5LHG A;  2MD5 A;  1IAW A;  3JAM Z;  5ILV A;  1YLF A;  4KMF A;  3W6J B;  1XDU A;  2QWW A;  3QP6 A;  3DPT A;  1FYM A;  2PG4 A;  1O3S A;  3BRO A;  2CSO A;  5F64 A;  4ENN A;  1TW2 A;  5CVI A;  2IA0 A;  1ZGJ A;  3U2R A;  4KIG A;  1KCA A;  5FGM A;  2QQ9 A;  3ISP A;  4EMS A;  2KKO A;  3E5X A;  1LEB A;  4MEY F;  2TDX A;  2IW5 A;  2VOO A;  5JVT A;  1HW5 A;  1DPR A;  1P2F A;  4YII A;  4HDU A;  4A5M A;  3IRQ A;  2HFH A;  2KIF A;  4A6E A;  4A0X A;  1ZAO A;  2OZU A;  4EJT A;  4KA4 A;  2A69 F;  5H6R A;  4BYY A;  2XKO A;  3BJA A;  2HKO A;  4RS8 A;  3BJO A;  3V8K A;  2DI3 A;  5DDG A;  3IC7 A;  2ESN A;  2PMU A;  3LAP A;  2WC2 A;  4NV4 A;  3H3Z A;  3ZMT A;  1O57 A;  4ASN A;  1D8J A;  3EYY A;  4ZYG A;  4HQE A;  1J0R A;  2PEX A;  4EM2 A;  2PQ8 A;  4MQ9 F;  4BH9 A;  4OU0 A;  1USS A;  5CYV A;  3JTH A;  3K1M A;  3K9T A;  1LNW A;  1FP2 A;  5CVR A;  3L2C A;  1J9I A;  4IRH A;  3IHU A;  5D8L B;  1H9T A;  1T2K A;  4KFC A;  3ERE D;  1IRF A;  1ON2 A;  4EM0 B;  3M1E A;  4N31 A;  2GWR A;  1BIA A;  3FZV A;  2GA2 A;  5HS7 A;  4LG0 A;  1FWZ A;  4ON0 A;  4UHT A;  1XGN A;  3K1P A;  5JI6 A;  1BC8 C;  4IXA A;  3Q5F A;  2QZ8 A;  4LFU A;  1D5V A;  3SHF A;  3LWF A;  4QWQ A;  3TO6 A;  1F5T A;  2ISY A;  3RIR A;  3TDZ C;  1K79 A;  4A5N A;  2A68 F;  1QO0 D;  3Q9S A;  3BDD A;  2XAG A;  2OZ6 A;  4DNC A;  2G7H A;  3H92 A;  3ELK A;  3I0T A;  4ZYH A;  4N9I A;  4I2O A;  5IT9 Z;  1HXD A;  4MEX F;  2XRO A;  4Y13 A;  2P4W A;  1I27 A;  1TQP A;  1MJ9 A;  3E6B A;  3F21 A;  1TTY A;  4IPA A;  1B1B A;  1SD5 A;  1RIO H;  3E5Q A;  3T1B A;  1MJB A;  3RYP A;  1BN5 A;  4KDP A;  4RGU A;  2WTE A;  2Z33 A;  1KU2 A;  1MJA A;  2OQR A;  3GZ5 A;  1AOY A;  2EFQ A;  4HDV A;  2QVO A;  2X4H A;  3TO7 A;  5DCM B;  3LA2 A;  1UST A;  1BI2 A;  4BHP A;  5L3C A;  1WI9 A;  3HTU A;  4GGG A;  5ILU A;  3I59 A;  4EJV A;  3IKT A;  2RC4 A;  3I5U A;  3EDP A;  2NNN A;  4P96 A;  1SFU A;  3I53 A;  2VBY A;  2HYF A;  2ZFW A;  2KRF A;  3P9I A;  3HRU A;  1YW8 A;  3ZMD A;  3MQ0 A;  2UZK A;  1KA8 A;  4I0B A;  4FX0 A;  2IRF G;  5ERI A;  1O3R A;  3M8E A;  1FZP B;  2RV8 A;  2JRT A;  2QBY A;  1YYV A;  1CGP A;  3KP3 A;  4ESB A;  5D5W B;  1LVA A;  2QEN A;  5CVU A;  1Q1H A;  2MLK A;  2W24 A;  4HX4 A;  3F72 A;  1BC7 C;  4RB3 C;  1QBJ A;  2EV5 A;  2WV0 A;  2C6Y A;  3FF5 A;  1IN4 A;  4F7Z A;  4FHT A;  2IPQ X;  5D5X B;  4UUV A;  5JR3 A;  2KIM A;  1TNT A;  1MGT A;  5K5Q A;  2ZKZ A;  1MKM A;  3L9F A;  1Z9C A;  2BBY A;  4HZF A;  1S6L A;  1I5Z A;  5BS6 A;  4KIF A;  5E20 A;  3C3W A;  4CIC A;  2EA4 A;  3KLN A;  4HX7 A;  1YW7 A;  2AXL A;  5AIQ A;  4KT5 C;  3LA7 A;  2FSW A;  1AY9 A;  1FBS A;  2ZBK A;  3DPL C;  5DD8 A;  4ME8 A;  1MDM B;  1CF7 B;  1C0W A;  4G7H F;  5D6F A;  1ZRC A;  2R3S A;  3QPT A;  1BBY A;  1ODD A;  2W25 A;  4EM1 A;  1XSX A;  3U9G A;  3RKY A;  1HW2 A;  2DW4 A;  1ZYR F;  5BOX A;  1FX7 A;  1FPQ A;  1FYL A;  1SD4 A;  4GXO A;  2OAZ A;  4XBF A;  4S05 A;  4PGH A;  5DCM A;  1IZ1 A;  4BHC A;  3FMR A;  2FA5 A;  3CO7 C;  3GXO A;  4G7Z F;  1BI1 A;  4AWX B;  4G94 A;  1IN5 A;  3WTT C;  5BPD A;  4OIR F;  3R0A A;  1O3T A;  4AVP A;  1IN8 A;  2FNA A;  2XKP A;  3N97 A;  1ZRE A;  2DPD A;  3COA C;  4YFK F;  3RTR A;  1Z7U A;  2RKH A;  1B9N A;  1ZLJ A;  4UV8 A;  5LGU A;  4A12 A;  1P4X A;  1FY7 A;  1J2X A;  4BAY A;  4JBA A;  3DFG A;  4MNU A;  4Q4Z F;  2HGC A;  2G7U A;  4AIK A;  2OD5 A;  2K86 A;  3I58 A;  1XCB A;  1LDJ A;  3MEX A;  2VOD A;  4KIC A;  3ABT A;  3IKV A;  1S3J A;  2QYO A;  4NQW A;  5LGT A;  3Q9V A;  1JHC A;  2JTV A;  3ZN1 A;  1F1Z A;  1R1U A;  2LF7 A;  4IHS A;  3DEU A;  2M87 A;  5L3E A;  1OMI A;  4OMZ A;  1U6G A;  5HDG A;  2YX7 A;  3FM5 A;  3DP7 A;  4P9U A;  4HQM A;  2P8T A;  4QLC U;  3R0J A;  4RB0 A;  2XVC A;  4HF0 A;  5ICF A;  5LEJ A;  2ETH A;  1UHM A;  3E6C C;  2ZXJ A;  2H09 A;  4A0Z A;  3TDU C;  1JHF A;  3FMS A;  2MH9 A;  2H6C A;  2ZME B;  3D0S A;  5CLS A;  3SZP A;  1XSD A;  4L9T A;  4FT8 A;  1ZG3 A;  3QU3 A;  2A61 A;  2MC3 A;  1FBQ A;  1SFX A;  1LQ1 A;  3T5X A;  1CF7 A;  3BDN A;  1STZ A;  4I01 A;  4EGZ A;  1W7P B;  1FYK A;  3VEP A;  5IT3 A;  2ADU A;  2KIU A;  1ZLK A;  2O3F A;  2VBZ A;  1IUY A;  5BMZ A;  3PFI A;  3R60 A;  4N0B A;  2HQR A;  4P5O A;  5D5U B;  5BPI A;  5FFX A;  3FWE A;  1SMY F;  2GXG A;  3BJ6 A;  3I71 A;  3PQK A;  2OQG A;  3WTS C;  1XSV A;  2GIV A;  1GXQ A;  3T8T A;  4NB5 A;  2COM A;  4Y15 A;  4EVI A;  2YPR A;  4UXN A;  4MTD A;  5HOO A;  4EGY A;  2M30 A;  1R1V A;  1REP C;  2K4B A;  2EFW A;  5DCF A;  3KP7 A;  1JHE A;  2EFO A;  5L3B A;  1D8K A;  5DYM A;  1KQ8 A;  3V4G A;  4XLP F;  3SZT A;  3M8F A;  5E1Z B;  1B6A A;  1FBU A;  3VB2 A;  3F3X A;  1T7D A;  5A2Q K;  2EK5 A;  2HDC A;  3WE2 A;  1KGS A;  1HKS A;  3WU1 B;  3GYH X;  3VOD A;  2EJR A;  2IVM A;  4BXU A;  3I59 B;  4KUM A;  1SD6 A;  3GFL A;  3O3K A;  3ABU A;  3L09 A;  5KVR A;  1O7L A;  3TKY A;  2D2W A;  3QAH A;  2PN6 A;  3T8R A;  2QLZ A;  3HHH A;  1Z05 A;  1X3U A;  2VN2 A;  5L3G A;  2EFP A;  4L0Z B;  4I0A A;  2FOK A;  2D1H A;  4JQF A;  3WTW C;  2MBF A;  4PCQ A;  2A5Y B;  2K7L A;  2EV0 A;  2HTS A;  3I64 A;  1DUX C;  3QP5 A;  1XB4 A;  5LLQ A;  2AS5 F;  2CO5 A;  1BJA A;  4UV9 A;  2QBY B;  1W7P D;  2Q0O A;  1RUN A;  2O03 A;  4Y17 A;  1I1G A;  1BI3 A;  2H94 A;  2XGX A;  1WSU A;  4YG2 F;  4BHB A;  3D5L A;  2LSO A;  4OMY A;  3KCC A;  5LHH A;  2E1C A;  2EB7 A;  4ZYE A;  2GA1 A;  3WTZ A;  1OYY A;  5HLI A;  2ZME A;  1RI7 A;  1OPC A;  1ON1 A;  3E6M A;  2FEZ A;  2PI0 A;  3GW2 A;  3WG9 A;  3J80 K;  2XRN A;  3C7J A;  2PMH A;  3KP2 A;  5FO5 A;  2Y75 A;  4K2E A;  3K69 A;  4AIH A;  1F9N A;  2W84 A;  3KLO A;  4WWC A;  2HEO A;  1W7P A;  2CG4 A;  2V1U A;  4XRF A;  3GEZ A;  3AAF A;  1P92 A;  3EUH A;  3HRT A;  1JXS A;  1YTY A;  3MZH A;  4HF2 A;  3CTA A;  2F2E A;  2R7F A;  3JSO A;  3QRF F;  2XAH A;  1QNT A;  4HV6 A;  3VFZ A;  2MH2 A;  1ZRD A;  4D0P A;  5E1W A;  4WX9 A;  2W57 A;  2Z99 A;  4I02 A;  3S04 A;  4L18 B;  1IXS B;  1LDD A;  3IWZ A;  3EYI A;  2STW A;  4M6X A;  5DD4 A;  3LFK A;  1L0O C;  1B59 A;  3NEU A;  2VC0 A;  1R58 A;  2F5F A;  3NRV A;  1ZAR A;  1XGO A;  2FML A;  1R5G A;  3KFW X;  3GZ6 A;  1XGM A;  4OIO F;  2MLG A;  3ZMU A;  3R4K A;  1BI0 A;  1Y0U A;  4KYW A;  2L54 A;  1TW3 A;  1G6N A;  1W5S A;  3KP5 A;  3B02 A;  4ENJ A;  1U78 A;  3O6B B;  1TNS A;  1PDN C;  4IVN A;  2YSR A;  3ZP5 A;  4PDK A;  1UMU A;  5L3F A;  4ZZL A;  4MGR A;  1MD0 A;  4WXD A;  2O61 A;  1KU7 A;  1NHA A;  2O0Y A;  1K7A A;  2K4J A;  2DU9 A;  2QQB A;  4H0E A;  5JHU A;  2D45 A;  2DAO A;  3FMQ A;  5ED4 A;  2OBP A;  1XGS A;  1XMA A;  3PQJ A;  1OYW A;  4BQA A;  2UXX A;  4HW0 A;  1MZB A;  1EH7 A;  4I98 B;  2KJC A;  3GF2 A;  2ELH A;  3HSR A;  4R79 A;  2HQN A;  4B8X A;  3HSE A;  3KEO A;  2ZJ2 A;  2L01 A;  1ONV A;  3GFI A;  1IF1 A;  2IT0 A;  2HS5 A;  1XCV A;  4IHT A;  3V8J A;  3W6K B;  4OIP F;  3H3U A;  3F8F A;  2O6G E;  2QM3 A;  4R1H A;  3LST A;  4RB1 A;  4GYI A;  2B0L A;  3IL2 A;  3BWG A;  3TO9 A;  1Z91 A;  2GZW A;  2UXN A;  3R6S A;  2FF4 A;  1KYW A;  1HKT A;  2BE5 F;  6PAX A;  1TLH B;  2YR2 A;  4Q47 A;  2YX4 A;  4R8H A;  3C1D A;  2V9V A;  3RPU A;  3L7W A;  2VXZ A;  1S29 A;  5ILS A;  5HVQ C;  3S2W A;  2DQL A;  2L02 A;  1B12 A;  3K1N A;  1AWC A;  1T0F A;  1R23 A;  4M72 A;  3E6D A;  1P4W A;  4NHJ A;  4S04 A;  4LLL A;  4UVB A;  3HIF A;  1HST A;  3RKW A;  3IIQ A;  1IW7 F;  4L9V A;  3RYR A;  2RQP A;  3RI4 A;  2Y48 A;  1G3S A;  2F5D A;  4KNY A;  4MTE A;  4YIF A;  3HHG A;  4Q48 A;  1QPM A;  2V1X A;  3F22 A;  2DO7 A;  2F5C A;  3BPV A;  4ZYD A;  5LEK A;  1ZN2 A;  5H20 A;  4RGX A;  4GYG A;  4DQ2 A;  2CGP A;  3ZMV A;  1IXC A;  4CDG A;  5D5V B;  2FBK A; 
#chains in the Genus database with same CATH topology
 2VBX A;  1GVJ A;  3CUQ C;  1CQT A;  1HLV A;  2NVY J;  4KN7 X;  2NVT J;  4D7M A;  4E7K A;  3CF2 A;  4QTR A;  1A04 A;  3HTS B;  4P9F A;  1ZR2 A;  3CO6 C;  2VL8 A;  4IHX A;  1TBX A;  5EDN A;  2R93 J;  3K4J A;  2LKX A;  5DV5 A;  1APL C;  3OSG A;  1FMW A;  1U2W A;  1X2N A;  4NBQ A;  2IA2 A;  3TOB A;  2XUB A;  1JJ6 C;  3CCU I;  2J5O A;  4BJ6 C;  1MNE A;  1OR7 A;  5JHF A;  2BXY A;  2XB5 A;  2H8W A;  2ZNZ A;  3BY6 A;  1RUO A;  2Y2Z A;  2V6C A;  1JT0 A;  2V1D A;  2A6E F;  5F0F A;  1FC3 A;  1S7O A;  2CWE A;  4BE0 A;  3M9A A;  4FIS A;  4AD9 A;  1S72 I;  2ZNY A;  3UNG C;  5HLT A;  4EV0 A;  1MBH A;  5M5Y J;  3DV8 A;  5ICE A;  2RGV A;  2E1N A;  1K78 A;  5LHI A;  2AQE A;  4M6Y A;  4HNV A;  1Z77 A;  2JRM A;  2VT3 A;  2HDD A;  5IOY A;  4PSX A;  2CUF A;  3RPQ A;  5EG0 B;  5HDN A;  1VTN C;  3CCY A;  3HJE A;  3RZD J;  2YU3 A;  1DDN A;  3HEF A;  5B1B H;  2VJ4 A;  3LSP A;  4RMN A;  2COB A;  4BS9 A;  4IRI A;  3GUD A;  3SYT A;  5EGO B;  4XKW A;  1X1B A;  2A07 F;  3S14 J;  2O5R A;  2Z5U A;  3IWF A;  1NG7 A;  2X6O A;  1WWX A;  1KYZ A;  3F8M A;  4CCL A;  1JE8 A;  1FOK A;  3CLQ A;  5D4S A;  4P55 A;  3HKZ N;  2O8X A;  2CRG A;  1UHW A;  2BY3 A;  1ULY A;  5KAI C;  3S3M A;  4D5C A;  2FQ3 A;  3CUQ A;  1HOM A;  2NAZ A;  2DK5 A;  1U5T C;  2L7F P;  3BG5 A;  5K7Z A;  2HOE A;  2FMY A;  3FM3 A;  3LA3 A;  1X58 A;  2A6T A;  4X0G A;  3RKQ A;  4J00 A;  2CV2 A;  1XD7 A;  2CW8 A;  4ESF A;  1JKP C;  3CC2 I;  2DYS H;  2KDO A;  3ASN H;  5J47 A;  3WTU C;  2H1L A;  4M9X A;  3MVP A;  3PUB A;  1DP7 P;  1EJ9 A;  2H27 A;  3FXO A;  1X19 A;  5C4J J;  2OV7 A;  4U0Y A;  1QRY A;  3CD6 I;  5CKT A;  1LDK B;  2LBF B;  4DZP A;  1R4M B;  1V3F A;  1VQN I;  2FU4 A;  3H5R A;  3JRB A;  2NS0 A;  5FLX K;  3JRC A;  2W4S A;  3OOP A;  2KJB A;  2A6H F;  3P9K A;  4UB8 C;  4JX6 A;  3MKW B;  5B66 C;  4MO7 A;  2JA6 J;  4B3A A;  2KL4 A;  1KU3 A;  3E5U A;  2EA2 A;  1EH6 A;  3WE3 A;  1A36 A;  4M71 A;  3W2V A;  5LBQ A;  1V55 H;  1OJL A;  2LTP A;  3M7G A;  3E97 A;  2CUJ A;  1FSH A;  3PNT A;  2Z9O A;  1EV7 A;  2JSC A;  2XAF A;  4ENK A;  1JUM A;  5A2Q Z;  2X1C A;  2L4A A;  1PP8 F;  4K8W A;  2VIX A;  4BBR J;  3CMA I;  2E1M C;  1E2X A;  3BR6 A;  3OL4 A;  3PNY A;  2LLK A;  5D6E A;  3TED A;  1Z21 A;  4EQQ A;  5HLG A;  1Y1W J;  1ZRF A;  1WHU A;  1YX5 A;  3REO A;  1PYV A;  5LRS A;  1GUU A;  2EZH A;  4UVA A;  3S32 A;  2CMP A;  2BOL A;  4E70 A;  1VI0 A;  5FD5 A;  2LDU A;  3K0L A;  1AKH B;  4ENM A;  3RKX A;  4PGG A;  4IRG A;  1T39 A;  3ASO H;  2I10 A;  1OYI A;  2ZO4 A;  1ZG1 A;  5CVV A;  4F3Q A;  1G59 A;  2NS7 A;  3MKY B;  1Y1V J;  5J8C A;  1LEA A;  1I39 A;  4M74 A;  3JW4 A;  1YG2 A;  5FB2 A;  3S1R J;  4LLN A;  3HOV J;  1YI2 I;  3MAJ A;  3HM5 A;  2OA4 A;  2QKL B;  1WRJ A;  3HSF A;  1R00 A;  2OPT A;  1ITY A;  2MA3 A;  4KIB A;  2VUM J;  4MQV A;  1IC8 A;  3CES A;  1TL8 A;  3G1O A;  1G3W A;  3BTJ A;  1R71 A;  3K4B A;  3PFY A;  2Q8K A;  2DLL A;  1SD7 A;  4KMU X;  4RAZ A;  2FKD A;  2WB1 N;  2CJJ A;  5FD6 A;  2Y31 A;  1HC8 A;  1VFC A;  2JVG A;  2QGU A;  1XDS A;  1LKX A;  2FJR A;  4GCV A;  2F48 A;  3DLL F;  4Y4R A;  2VE9 A;  5K1Y A;  2KIS A;  4Y3O A;  2R7D A;  2WWY A;  2IGO A;  5F0H A;  2XAQ A;  3L1P A;  3V7S A;  1I1S A;  3ZQQ A;  3LL7 A;  4M3D A;  2KPM A;  3FKJ A;  1ZHF A;  3FXU A;  2ZB9 A;  3J7A Y;  2PBI A;  1K6O A;  4LOC A;  2R4G A;  5TRD A;  1YQA A;  3F6O A;  4BJ5 C;  4CHU A;  2X6W A;  2VPR A;  2EZK A;  4U88 A;  2OUM A;  4AIJ A;  1JJ8 C;  3DPU A;  5LGN A;  5IPA A;  2KT0 A;  3J80 Z;  4P1W A;  2XRL A;  2E1O A;  5KNL A;  4WXC A;  1JGS A;  2BY0 A;  1FEX A;  1EF4 A;  1FTZ A;  5J6X A;  2GQQ A;  4HV5 A;  4U0W A;  2VXD A;  3N4M A;  5TGT A;  2E36 A;  1FTT A;  3RQI A;  4WK8 F;  2HO0 A;  5DM6 F;  2R5Y B;  3OYE A;  5EG0 A;  3FX3 A;  2PFB A;  2HYG D;  3OYL A;  2E7W A;  2XDV A;  2G9W A;  2JT1 A;  4HYE A;  2CQX A;  4MHG A;  4IJA A;  4V2G A;  4N4O B;  2XF6 A;  4C3H J;  4XOR A;  1FLI A;  3V7C A;  5J1Y A;  3S16 J;  3GLL A;  1IO2 A;  2LP0 A;  3F8B A;  3U21 A;  1WKM A;  4G7O F;  5DS9 A;  1ENH A;  4M3B A;  4HLY A;  4W1U A;  3A0H C;  1K61 A;  1SMT A;  3J7A O;  3VYS B;  4QPQ A;  3OR1 C;  2DMT A;  2P6S A;  2RDP A;  2L3D A;  1PUF B;  1WCM J;  3U1K A;  3IH4 A;  3B73 A;  1P4A A;  3GTO J;  3VWB A;  2DMQ A;  3CDH A;  3PNV A;  3MD2 A;  2F5E A;  2KLO A;  4IQ4 A;  3SEZ A;  4IOC F;  4CCO A;  4I7H A;  5FKN A;  3MWM A;  3AL0 B;  1V5F A;  2MG4 A;  2IEK A;  3HRM A;  4TV7 A;  4U87 A;  4XSZ F;  2CYY A;  3WGH A;  4ZH4 F;  4A69 C;  1PVE A;  2HXI A;  1YW9 A;  2CQQ A;  2LBF A;  1BOB A;  1ACI A;  5J1R A;  2XPV A;  2DN0 A;  4NC6 A;  4XSX F;  1YJN I;  3KIO A;  1J5Y A;  1HCR A;  2DFH A;  2RVC A;  4V2F A;  2BVM A;  2XHK A;  3ZMZ A;  3MZY A;  1IGN A;  3IV5 A;  2K85 A;  2K9M A;  2NVU B;  1F39 A;  4RGS A;  1A6Q A;  1VQL I;  1H0M A;  5CQG A;  2LK2 A;  3HRS A;  2P5V A;  1J09 A;  2K40 A;  3J81 K;  3C18 A;  2Q2E A;  3DQV C;  2VKE A;  3RJP A;  5LFA A;  3GWZ A;  4L9N A;  2DQR A;  2OCE A;  2CQK A;  4HLX A;  4LMY A;  3G1M A;  3HUG B;  3FXR A;  2IS6 A;  2L2O A;  1OCO H;  3GFJ A;  1UZC A;  2STT A;  2V4J C;  2DT5 A;  1P6R A;  1VQK I;  4HNU A;  1JHH A;  2BXZ A;  3JAM K;  4HSR A;  1LB2 A;  3ECO A;  4PZJ A;  1MMG A;  2IAI A;  4XOP A;  2HPI A;  3S1M J;  1HDP A;  1AKH A;  1BM9 A;  2WB1 A;  3H0G J;  5GAH J;  1X1C A;  1SFK A;  3K4L A;  1D3Y A;  3L00 A;  1WZ2 A;  2RN7 A;  1FNN A;  1U8R A;  3HOW J;  1U9O A;  2L9S A;  1KQ0 A;  1SEU A;  1BR4 A;  3QU6 A;  3WOD F;  2X6X A;  2DYR H;  5GPC A;  2HZT A;  2IS1 A;  1F36 A;  2RNG A;  4XON A;  4CYD A;  4D9J A;  1VQ7 I;  3EQL F;  3BZ6 A;  1SAU A;  2OCC H;  5EEG A;  4BGD A;  4BUP A;  4CCK A;  1Y8R B;  4DGW B;  3H3V K;  2IP2 A;  1BIB A;  4N9H A;  2CW0 F;  1ZGA A;  4LLG F;  4UNO A;  5J4V A;  4L5I A;  1JKQ C;  3VOE A;  4G6Q A;  1OQY A;  3F6V A;  3HYI A;  1FIP A;  4BAC A;  4F55 A;  2FOW A;  2I5U A;  3AKZ A;  4WXH A;  3B6A A;  3WU0 A;  1QQI A;  4WCG A;  1G3Y A;  2F4O B;  3RDI A;  3O8H A;  2M8E A;  3ABM H;  3AL0 C;  3D5S C;  4O6J A;  1FT9 A;  1B4A A;  3VDX A;  4EJW A;  5GTI C;  2FBH A;  1B8I B;  3F8C A;  3H36 A;  5KK1 A;  2JQ7 A;  3V7R A;  1LE8 B;  2V1N A;  3P9C A;  1QZY A;  1TQI A;  3QPL A;  3JRE A;  3ML6 A;  3ZN0 A;  3HOX J;  4HAM A;  4L5E A;  1VQO I;  4B4C A;  2EWN A;  3S8P A;  1UFM A;  3G3Z A;  1AA7 A;  1MBF A;  2EV6 A;  2ME6 A;  5F1J A;  4RBO A;  2H6B A;  2QQA A;  4JYK A;  4DYR A;  3HGY A;  1XMK A;  5AON A;  4J19 A;  4OIN F;  3HOU J;  1TWF J;  3T0Y A;  3KZZ A;  4MLO A;  5ICC A;  3BC8 A;  2QKM B;  4ZDO A;  3WGI A;  4C3J J;  3SDB A;  4C9Y A;  4LJZ F;  3BPX A;  1GDT A;  4XIC A;  5H6Q A;  1ZGW A;  5GPA A;  3CME I;  4DYC A;  1X4P A;  2BGC A;  4IX7 A;  1S8N A;  5FFZ A;  2FNP A;  3KP6 A;  4DW6 A;  2MYS A;  2B7E A;  2VQL A;  1B72 A;  3TGN A;  4LB5 A;  2E19 A;  2JZY A;  3G73 A;  1YIO A;  2VC1 A;  2F6C A;  3OV8 A;  3Q3S A;  1LJ9 A;  2E35 A;  2NNY A;  1ETV A;  2BVL A;  4RB2 C;  3ZMS A;  3MKL A;  3QOE A;  2E71 A;  3AG1 H;  3E3V A;  2KP6 A;  2FQ4 A;  1GV5 A;  2LF8 A;  4W97 A;  4U7D A;  3P5J A;  4LG3 A;  3GX4 X;  2MD0 A;  4A0Y A;  4B3X A;  4L9J A;  2M45 A;  5IYD J;  4J01 A;  1A6I A;  1PJR A;  4HBL A;  2ZJQ F;  2NYX A;  4KT6 A;  3M1C A;  3BG6 A;  1VQM I;  1SC7 A;  4JX4 A;  1IUF A;  1K78 B;  1MH3 A;  4HOB A;  2LNB A;  1KU9 A;  1ETK A;  1L3L A;  4UVC A;  3JSP A;  3G4S I;  1HQC A;  1YS7 A;  2W85 A;  4CGZ A;  5EYR A;  3P7N A;  1G2H A;  3CP2 A;  4ABZ A;  2JA5 J;  3IRR A;  1W5T A;  1W4M A;  2OTJ I;  1RC9 A;  1SAN A;  3MKZ A;  1I6H J;  1V4R A;  4DJA A;  2P5K A;  1ZH5 A;  2BHY A;  3LSR A;  2W48 A;  2W00 A;  3PIO F;  5K5O A;  1T38 A;  4HPQ A;  1SFE A;  3JRF A;  1Z3X A;  1UAA A;  5CVJ A;  3BP8 A;  3C2G A;  3CUQ B;  3F23 A;  3GLX A;  5CQE A;  4HX8 A;  4G9Y A;  1UHS A;  1WQ2 A;  3LQR A;  5J1U A;  4Z2Y A;  2L4M A;  2JPB A;  5HS8 A;  2JSP A;  5K5R A;  1JUP A;  1R7J A;  4LK1 F;  3NQO A;  2DFI A;  2XAJ A;  3SXY A;  3NWS A;  2NRA C;  2LOO A;  2HKX A;  1J75 A;  2RNJ A;  2Y0M A;  5DUI A;  3HUG A;  5GAE J;  4CO8 A;  2EZL A;  1SAX A;  5IT9 K;  2DMP A;  3OWT A;  1O3Q A;  5TJJ A;  2MAB A;  3V8L A;  4BU2 A;  5M3M J;  4M9S A;  4EJU A;  2VBW A;  3K6G A;  4JK1 X;  3W2W A;  4L5J A;  3LQQ A;  2WAQ N;  2LKP A;  3GVA A;  1X1P A;  1IXR C;  1A35 A;  4LD5 A;  4DYQ A;  1R5H A;  3ECH A;  2L7M P;  2LG4 A;  2D1V A;  3CQZ J;  5E3N A;  4ETS A;  1MMD A;  1YJW I;  3DU6 A;  1RES A;  3BLY A;  3OSF A;  3K70 C;  3MFK A;  4PSW A;  2M5W A;  2WBM A;  2ZFU A;  4OOI A;  3W3C A;  1BW6 A;  2OU2 A;  1HSJ A;  2BY1 A;  4XL9 A;  3A03 A;  1OFC X;  2CW7 A;  2Z3Y A;  1WJF A;  3GO5 A;  2VKV A;  5E8I A;  2WA0 A;  4O3M A;  2VT2 A;  1VND A;  1I6X A;  1HW1 A;  1OKR A;  4KJZ A;  4CZZ A;  5D8K B;  3HDD A;  5FLM J;  2JUG A;  3CJN A;  3BG7 A;  1GXP A;  4YFN F;  1VQ5 I;  1GHC A;  3SJM A;  4L0Y B;  1T95 A;  2KIQ A;  3K4M A;  1R9T J;  1YFH A;  1KQ9 A;  1O7F A;  1YS6 A;  3W2A A;  1QZZ A;  1X4O A;  2VQC A;  5J8F A;  1H9G A;  4UUS B;  3ZQH A;  5LRR A;  3FBI B;  1W0U A;  3LMM A;  5E1X A;  2HDW A;  2FUG 2;  2VON A;  3K70 D;  1U5T B;  1RNL A;  5HS9 A;  1R1T A;  1FOW A;  2ELK A;  2V79 A;  2BYV E;  3IUO A;  3KPH A;  4FX4 A;  4I09 A;  1Q1V A;  1OCC H;  1MBG A;  3OY9 A;  3KEY A;  4E7H A;  4YEJ A;  4B09 A;  3S3O A;  2KZG A;  2P7C B;  3R61 A;  2R7T A;  3BOQ A;  1TWC J;  3FHZ A;  4Q5S F;  2RQQ A;  3A1Y A;  4G6D A;  3F0C A;  3TQN A;  4A3I J;  1Z6R A;  5FLX Z;  1FSE A;  4RM2 A;  4YIR X;  3QPH A;  1RZ4 A;  1JGG A;  2GXA A;  4C2U A;  2CFX A;  3CP8 A;  3K2Z A;  3WTV C;  3ZPL A;  3DBL B;  5F6F A;  2ESH A;  2GAU A;  3WTX C;  4NUB A;  4LIU A;  5K7F A;  2R5Z B;  1PP7 U;  1LPQ A;  1S7A A;  4A3K J;  2XPU A;  1YO5 C;  2FXA A;  2V7F A;  2AQF A;  3SFZ A;  4AM3 A;  4XKC A;  4AID A;  2K3P A;  1HBX G;  4G8X A;  2VJ5 A;  1TP4 A;  4S0H B;  3UKG A;  4X6A J;  1T98 A;  2E1M B;  2LY9 A;  1ETO A;  2L0K A;  4IHW A;  2DT6 A;  5E8G A;  5ICG A;  2JA2 A;  2VAS A;  1PUE E;  2PX9 A;  3ULQ B;  2E7X A;  5CJ9 A;  1YE9 A;  2V9K A;  2XIG A;  1I4V A;  3O2P E;  2X0L A;  4XRS A;  4BJT A;  3QOP A;  4CUG A;  4WF2 A;  2P7V B;  1WI3 A;  2LR8 A;  3KP4 A;  4XRM A;  3VSL A;  3U1D A;  2PLY A;  2XGE A;  3A02 A;  3DKW A;  2FBI A;  1TWH J;  5AIP A;  2GOX B;  2R7O A;  5IYB J;  3FXK A;  3GZN B;  2DTZ A;  2CUE A;  2DTR A;  2CFO A;  1V5E A;  1T6S A;  2HU9 A;  3MCZ A;  1EH8 A;  3TOA A;  5GAD J;  1R22 A;  2UWM A;  3MN2 A;  2A05 A;  2L9V A;  1BR1 A;  2IBD A;  3S2H J;  3G6E I;  4D5F A;  3CCS I;  3OYI A;  3LSJ A;  1W36 C;  3OYG A;  2WAQ A;  1T08 B;  2QF7 A;  4A2U A;  1J59 A;  3K7A J;  3DF8 A;  3ZQI A;  1N75 A;  2HI3 A;  2HR3 A;  2M1B A;  5BQT A;  4RGR A;  3BZK A;  2DBB A;  3I4P A;  5DEQ A;  5EEH A;  4M9Z A;  3HOS A;  1G3T A;  3NAR A;  3DTE A;  3TP0 A;  4QSH A;  4IL6 C;  4HA8 A;  3ZQ7 A;  3F9K A;  4RLQ A;  4AYB A;  3QWL A;  2DPU A;  1R36 A;  5HDK A;  3KET A;  3DXJ F;  2WAD A;  5E17 F;  5JVG F;  1QGP A;  2K02 A;  1X3Z B;  4JX5 A;  3VSK A;  4GO1 A;  4HEA 2;  1Z6T A;  2BEO A;  1UCR A;  3OS2 A;  4OIQ F;  2FE3 A;  2HTJ A;  4A3E J;  1T33 A;  4XLN F;  1K4S A;  2ZXW H;  1UB9 A;  1MMS A;  1IN6 A;  2IXS A;  4LGW A;  3EET A;  4RAY A;  3SQN A;  3DWL E;  2IA1 A;  4ZZD A;  3K4C A;  4KN4 X;  3WTY C;  3F8N A;  4ZDL A;  2Q2E B;  3I54 A;  4U7B A;  2EIN H;  3KEQ A;  2HWV A;  3KZY A;  1Z1D A;  3WGG A;  1P7J A;  2IGM A;  2XGD A;  2ZCW A;  3JRG A;  1WH7 A;  2E2H J;  3HOT A;  3HG9 A;  2R7Q A;  2XV4 S;  2VB6 A;  3H9G A;  3CCE I;  1BOA A;  1E17 A;  2HNF A;  4KIT B;  2UV1 A;  3KE2 A;  3HL2 A;  4I6Z A;  1DGR M;  3JTG A;  2E34 A;  3HOY J;  1IRG A;  3DBR B;  1KN9 A;  2O9L A;  1UG0 A;  4M73 A;  5E18 F;  1XS9 A;  1B9M A;  1AU7 A;  3HGG A;  2A3S A;  2VE8 A;  1YRN A;  3GTL J;  4UUS A;  3X2Q H;  1FP1 D;  1MDM A;  2K27 A;  2P5L C;  2DJN A;  1H89 C;  1XN7 A;  3BR5 A;  2R7Z J;  1UG2 A;  1U5T A;  2FRH A;  4ESJ A;  4XMY A;  2VOP A;  3KZI C;  1ETW A;  1F4K A;  2CS3 A;  2BV6 A;  1DPU A;  3ROU A;  4EJO A;  2DA6 A;  5C3E J;  5HLH A;  3CLO A;  4LG0 B;  3CCL I;  4E7L A;  4BXX J;  1G4D A;  3Q0W A;  2HOA A;  3LNQ A;  2QUF A;  4YFX F;  2IJL A;  2E5N A;  5D4R A;  4BNC A;  2EFN A;  1HKQ A;  3K4N A;  4IF4 A;  5IOZ A;  4LK0 F;  4UY8 I;  2LY2 A;  3LAJ A;  3WG7 H;  2JPC A;  3GFM A;  2ACJ A;  4LB6 B;  2EZI A;  2MFZ A;  4O5V A;  3OMY A;  3VYU B;  2XAS A;  1TQM A;  2DOE A;  2XPW A;  2R5Z A;  2PJP A;  4PUS A;  2I8D A;  4U0V A;  3SFI A;  3J81 Z;  4HF1 A;  4C30 A;  3WU2 C;  2P0W A;  3HZJ A;  4CXF A;  2HVR A;  2ISZ A;  3L2R A;  2J5P A;  3CUO A;  2GXB A;  2EPF A;  2LH9 A;  5F1R A;  4A6D A;  5DUK A;  2VQH A;  5JFR A;  1J7K A;  2DK8 A;  2P6T A;  2M8G X;  5L3D A;  1ZG5 A;  1ZQ3 P;  1U3E M;  1IN7 A;  5J3L A;  5EJC A;  3FXQ A;  3HC7 A;  5LHG A;  4XID A;  2MD5 A;  1RPW A;  2LVS A;  2Z2S B;  3HKZ A;  1IAW A;  1U0J A;  3JAM Z;  5ILV A;  1YLF A;  3M07 A;  3AG4 H;  3W6J B;  4KMF A;  2LRD A;  4EAT A;  4QPO A;  3FXM A;  1XDU A;  2QWW A;  4BE2 A;  3QP6 A;  1LFP A;  3DPT A;  3GTP J;  1FYM A;  2PG4 A;  1O3S A;  4BEH B;  3VYT B;  3BRO A;  1U9N A;  1B72 B;  4JP0 A;  2CSO A;  3KYL A;  5F64 A;  2PMZ N;  1TW2 A;  4ENN A;  1ORK A;  5CVI A;  2IA0 A;  4H4K C;  3CC4 I;  5IY5 H;  3LSI A;  1BJZ A;  2VKH A;  1ZGJ A;  3U2R A;  3D1N I;  3TW6 A;  3BR2 A;  1TT0 A;  4KIG A;  1V54 H;  1X1D A;  2GM4 A;  1KCA A;  5FGM A;  2AHQ A;  2QQ9 A;  3OYD A;  3ISP A;  4EMS A;  2KKO A;  3E5X A;  4FET A;  2MSY A;  4CCM A;  1LEB A;  3QQA A;  4MEY F;  1MSE C;  3QYF A;  2TDX A;  3ERM A;  2IW5 A;  3G1L A;  2VOO A;  5JVT A;  2DOA A;  1HW5 A;  1DPR A;  1P2F A;  1WJ5 A;  4YII A;  4HDU A;  4A5M A;  3IRQ A;  2HFH A;  1ETQ A;  2LD5 A;  2KIF A;  1OCT C;  4A6E A;  2E5Z A;  4A0X A;  1ZAO A;  4B47 A;  4E7S A;  2F4I A;  2Y9Z A;  2CQ7 A;  4E7Z A;  4NNJ A;  1DP3 A;  2ID3 A;  1TWG J;  2OZU A;  5CPR B;  1W5C C;  4EJT A;  4KA4 A;  2A69 F;  4PJL A;  1NK2 P;  3DLA A;  5H6R A;  4BYY A;  2XKO A;  3BJA A;  2VPL A;  2HKO A;  4RS8 A;  2L9R A;  3BJO A;  3V8K A;  2OC6 A;  2B63 J;  4AC0 A;  2DI3 A;  4M3F A;  5DDG A;  3IC7 A;  3BCA A;  1KON A;  2ESN A;  5IP6 A;  2PMU A;  1IV6 A;  3I56 I;  2ZJR F;  3LAP A;  2DA7 A;  2WC2 A;  1VQP I;  3LSM A;  4NV4 A;  3H3Z A;  2ID6 A;  3ZMT A;  1O57 A;  1XX5 A;  3H35 A;  3EYY A;  4ASN A;  4ZYG A;  1J0R A;  4HQE A;  1D8J A;  2PEX A;  4EM2 A;  2PQ8 A;  3H5N A;  4MQ9 F;  3ZQG A;  4BH9 A;  4BKX A;  3S1Q J;  2OTL I;  4OU0 A;  1USS A;  5CYV A;  2JA7 J;  3JTH A;  3K1M A;  2ZC2 A;  1TT5 B;  5FKO A;  2BW3 B;  5IP9 J;  3K9T A;  1DGW Y;  3BT9 A;  1LNW A;  4NC7 A;  1FP2 A;  5CVR A;  3L2C A;  3OS0 A;  1J9I A;  2IGK A;  2VQG A;  4IRH A;  2M7A A;  3IHU A;  2QCO A;  4CSW A;  5D8L B;  2K9L A;  2RRE A;  1H9T A;  1YIT I;  1T2K A;  3BCB A;  1D5Y A;  2M4G A;  4KFC A;  3ERE D;  1IRF A;  1WJD A;  3JCU C;  1ON2 A;  3LSG A;  4RAG A;  4EM0 B;  3M1E A;  4N31 A;  3FXJ A;  2XB0 X;  2GWR A;  1BIA A;  3FZV A;  2GA2 A;  3IP4 B;  3OIP A;  1ZKG A;  4PK4 A;  5J40 A;  5HS7 A;  1X1A A;  4CA0 A;  4LG0 A;  1TC3 C;  1FWZ A;  4ON0 A;  2HVS A;  4UHT A;  1XGN A;  2XSJ C;  3K1P A;  5JI6 A;  3JRD A;  1BC8 C;  4IXA A;  1QZE A;  2BY2 A;  3Q5F A;  2X6Y A;  5B3S H;  2QZ8 A;  2Y0S N;  3SDG A;  4LFU A;  1D5V A;  3SHF A;  3LWF A;  4QWQ A;  3TO6 A;  2F5V A;  1F5T A;  2ISY A;  3RIR A;  3TDZ C;  1K79 A;  4A5N A;  2A68 F;  4A3M J;  4PJ0 C;  1QO0 D;  2K5C A;  3Q9S A;  3BDD A;  2XAG A;  4HRI A;  2OZ6 A;  4DNC A;  3UR3 C;  1WJB A;  3QOD A;  1M1E B;  3QYB A;  1MND A;  3OYF A;  2G7H A;  3H92 A;  3ELK A;  3I0T A;  3LOC A;  4N9I A;  4ITV A;  4ZYH A;  2CV0 A;  4I2O A;  5IT9 Z;  1HXD A;  4MEX F;  2L9N A;  2N8G A;  3HB9 A;  3SEQ A;  2XRO A;  3H1C A;  4Y13 A;  2P4W A;  1I27 A;  1TQP A;  1MJ9 A;  3ESW B;  3CCR I;  3E6B A;  2L7K A;  3I9V 2;  3F21 A;  1TTY A;  4IPA A;  1B1B A;  1SD5 A;  1R4N B;  1RIO H;  3E5Q A;  3T1B A;  3O8G A;  1MJB A;  4BEH A;  3QPS A;  3RYP A;  1BN5 A;  4KDP A;  4RGU A;  1SVO A;  4FCY A;  4LIT A;  1RET A;  2QSF X;  2HNH A;  2WTE A;  2Z33 A;  3JR9 A;  1KU2 A;  4Y7N J;  1MJA A;  2CQN A;  2OQR A;  3GZ5 A;  1OIS A;  1AOY A;  2EFQ A;  4HDV A;  5GP9 A;  2XSD C;  2QVO A;  1IJW C;  1ETY A;  2X4H A;  5DCM B;  3TO7 A;  3LA2 A;  3FK6 A;  1UST A;  1RR7 A;  1BI2 A;  4BHP A;  5L3C A;  3I55 I;  2XF7 A;  1WI9 A;  3MMY B;  1HA8 A;  1D1C A;  2R7W A;  1GV2 A;  3HTU A;  2QA4 I;  4GGG A;  5ILU A;  3I59 A;  4EJV A;  4XLF A;  3IKT A;  4AVZ A;  5M5X J;  3ZR8 X;  2RC4 A;  1ETX A;  5EZH A;  2DA1 A;  3I5U A;  3EDP A;  2DXI A;  3CCM I;  1BL0 A;  2NNN A;  4P96 A;  1SFU A;  3I53 A;  3PIP F;  3CJR B;  2VBY A;  2WY8 Q;  3CCQ I;  2HYF A;  2ZFW A;  3DKY A;  5EF6 A;  2KRF A;  3P9I A;  1D0Z A;  3HRU A;  1YW8 A;  3ZMD A;  3MQ0 A;  2GOM A;  2K9Q A;  2UZK A;  1KA8 A;  2R7U A;  4I0B A;  4HG2 A;  4FX0 A;  2IRF G;  4DBR A;  1Y8Q B;  5ERI A;  1O3R A;  4RDU A;  1W1W E;  3M8E A;  2G0E A;  1FZP B;  5B5E C;  2RV8 A;  4OWR B;  2JRT A;  4FAS D;  2R7X A;  2QBY A;  1YYV A;  5FJ8 J;  2DA3 A;  3KP3 A;  4XOT A;  1CGP A;  9ANT A;  4ESB A;  5D5W B;  2R0Q C;  1LVA A;  2QEN A;  5CVU A;  1Q1H A;  2MLK A;  2W24 A;  4HX4 A;  1SVM A;  3F72 A;  4CH7 A;  1E0E A;  2UUZ A;  1BC7 C;  2LFB A;  2NOJ B;  2L7Z A;  4A3F J;  4RB3 C;  4E6K G;  1QBJ A;  2HOS A;  4JOM A;  2EV5 A;  3PL8 A;  2WV0 A;  2C6Y A;  4BBS J;  4DBQ A;  3FF5 A;  1IN4 A;  1TZL A;  3TBI A;  4NQW B;  1MMA A;  2BW3 A;  4F7Z A;  4FHT A;  2IPQ X;  5D5X B;  4UUV A;  2V6E A;  5JR3 A;  2Y0S A;  3OYK A;  2KIM A;  1WJE A;  1TNT A;  1WGX A;  4Y52 J;  1MGT A;  3K4K A;  1WJC A;  1XG1 A;  3RZO J;  3PSF A;  5K5Q A;  4AU7 A;  1H8A C;  1Z7L A;  3OYB A;  4BDZ A;  2ZKZ A;  2TCT A;  1MKM A;  3L9F A;  1Z9C A;  2BBY A;  2LC2 A;  1TWA J;  4HZF A;  1I3A A;  1S6L A;  1I5Z A;  4CZC A;  1E3P A;  5BS6 A;  4KIF A;  1V5G A;  3D5R C;  5E20 A;  2NXN B;  3C3W A;  3DKX A;  5E3L A;  4I99 C;  3ZXS A;  5KCM A;  2EA4 A;  4CIC A;  4D1Q A;  4EEF G;  2X85 A;  4MFD A;  3KLN A;  4HX7 A;  4PJM A;  1YW7 A;  2AXL A;  5AIQ A;  4KT5 C;  3LA7 A;  2FSW A;  3BR3 A;  1AY9 A;  3RQ4 A;  1U8B A;  1FBS A;  2M2E A;  3DCF A;  3L2W A;  2ZBK A;  2RAE A;  4BY1 J;  4G12 A;  3DPL C;  5DD8 A;  1YRN B;  2HPM A;  4ME8 A;  2VJI A;  1YHQ I;  2VI6 A;  1MDM B;  3CCV I;  3PJR A;  1CF7 B;  3BR0 A;  1C0W A;  2LMD A;  3H9Q A;  4G7H F;  3CCJ I;  1P7I A;  3NWT A;  4ZTJ A;  5D6F A;  1ERD A;  3CMM A;  1ZRC A;  2R3S A;  3QPT A;  1GVD A;  3JRH A;  3L2V A;  3S3N A;  1BBY A;  3OIO A;  1ODD A;  2W25 A;  2V9P A;  3CJT B;  3CF5 F;  2M34 A;  4BQQ A;  4EM1 A;  1XSX A;  2GBY A;  3U9G A;  3RKY A;  1HW2 A;  2DW4 A;  1ZYR F;  2ZJP F;  1ZEL A;  2E2I J;  5BOX A;  1IG7 A;  2LY1 A;  1FPQ A;  1FX7 A;  2AXT C;  3CMY A;  1FYL A;  4E7J A;  2R7V A;  1SD4 A;  2M7B A;  3JRA A;  4GXO A;  3HPH A;  3ZOB A;  3DEE A;  2OAZ A;  4XBF A;  4S05 A;  4PGH A;  1EA3 A;  5DCM A;  1IDZ A;  2Q1Z B;  1IZ1 A;  3G2B A;  4BHC A;  3GTG J;  3FMR A;  2FA5 A;  3CO7 C;  4BE1 A;  3GXO A;  4OAY A;  3HBL A;  4RM3 A;  1DU6 A;  4G7Z F;  2ELJ A;  4ZYA A;  3ZCO A;  1BI1 A;  1T56 A;  4AWX B;  4G94 A;  1IN5 A;  2ZXI A;  4XLH A;  4OAZ A;  3WTT C;  5BPD A;  3S17 J;  4B43 A;  4OIR F;  3R0A A;  1O3T A;  5EZG A;  3S15 J;  1MIJ A;  4ZDP A;  2LKS A;  1BA5 A;  4AVP A;  1IN8 A;  2FNA A;  2XKP A;  3N97 A;  1QHG A;  1ZRE A;  2LYC A;  1BR2 A;  2DPD A;  3K2A A;  3OOU A;  3COA C;  1DU0 A;  2JWT A;  1Z0X A;  1I3Q J;  2DA5 A;  4YFK F;  3RTR A;  2O7O A;  3ZRG A;  2VJJ A;  4PJJ A;  1Z7U A;  2RKH A;  3ONQ A;  1B9N A;  1D1A A;  1ZLJ A;  4UV8 A;  4M3E A;  5LGU A;  5C4X J;  2JVH A;  4YRV A;  3OYJ A;  4MFE A;  2NVQ J;  4A12 A;  1K83 J;  1P4X A;  2DDA A;  1WJA A;  4G6T B;  1FY7 A;  1J2X A;  3DTI A;  4BAY A;  1SFO J;  1JKR C;  5GTH C;  4JBA A;  3DFG A;  4MNU A;  4XRS G;  4Q4Z F;  2HGC A;  2DFF A;  2G7U A;  2QEX I;  1MMN A;  4A3L J;  4AIK A;  1FOY A;  1VQ8 I;  1Y39 A;  4B44 A;  2OD5 A;  2K86 A;  3I58 A;  1XCB A;  1GLN A;  1LDJ A;  3MEX A;  2KRC A;  2VOD A;  3PSI A;  4KIC A;  3CDL A;  3ABT A;  1OCR H;  3IKV A;  1WPK A;  1S3J A;  1X3W B;  2QYO A;  1E3H A;  1W36 D;  3AFH A;  4NQW A;  2W7N A;  5LGT A;  2XF5 A;  3Q9V A;  1JHC A;  2JTV A;  2ZSI B;  4XK4 A;  3ZN1 A;  3JRI A;  1F1Z A;  1R1U A;  2LF7 A;  4IOA F;  4IHS A;  3DEU A;  2M87 A;  5L3E A;  1OMI A;  4OMZ A;  1U6G A;  2DMU A;  4F93 B;  1KZH A;  5HDG A;  2YX7 A;  3FM5 A;  1O4X A;  1IRX A;  3DP7 A;  4P9U A;  2A5W A;  4HQM A;  2P8T A;  1LVK A;  4QLC U;  3CDI A;  3DTK A;  3R0J A;  4RB0 A;  3PM1 A;  4N4N B;  1FOX A;  2KQR A;  2XVC A;  5FRM A;  2PJR B;  4HF0 A;  5ICF A;  5LEJ A;  2ETH A;  2R7R A;  1UHM A;  3E6C C;  4XLA A;  1S7E A;  3A2K A;  3CC7 I;  5HNF A;  2ZXJ A;  2H09 A;  5TIS C;  4A0Z A;  3AG3 H;  4F52 A;  3TDU C;  3J7Z I;  1JHF A;  3C2H A;  3FMS A;  2H1K A;  2MH9 A;  4A93 J;  2CV1 A;  4MIM A;  3K10 A;  1JTX A;  2H6C A;  2ZME B;  3PO3 J;  3D0S A;  5CLS A;  3SZP A;  1XSD A;  4L9T A;  3OIQ A;  4FT8 A;  1W0T A;  5H2F C;  2BZT A;  5JLX A;  1ZG3 A;  3QU3 A;  2A61 A;  1OCZ H;  2MC3 A;  1FBQ A;  1SFX A;  4UUT A;  1RKW A;  3CJQ B;  5C44 J;  2X48 A;  2QSH X;  1JTY A;  2NS8 A;  1LQ1 A;  3T5X A;  1CF7 A;  1G8X A;  2KMU A;  3BDN A;  1FMV A;  3HPG A;  1STZ A;  2K3F A;  1H88 C;  4RAF A;  3OYN A;  2JN6 A;  1UEL B;  4I01 A;  3FHN A;  4DOZ A;  3OYM A;  2F4M B;  4EGZ A;  1W7P B;  1GT0 C;  2FJ1 A;  3LSK A;  5JLW A;  3GME A;  1NH3 A;  3VEP A;  1FYK A;  5IT3 A;  2ADU A;  2KIU A;  1ZLK A;  2O3F A;  2VBZ A;  1IUY A;  5BMZ A;  2ZXH A;  4XKB A;  3EUA A;  3W6V A;  1QPI A;  3PFI A;  3R60 A;  3IAS 2;  1JUS A;  4N0B A;  1S9H A;  4FTH A;  2HQR A;  1K4T A;  2W82 A;  1D1B A;  2DCE A;  4CYC B;  3WHB A;  1WVR A;  4P5O A;  4XNF A;  3TL4 X;  1IDY A;  5F27 A;  2YU9 J;  4E7I A;  5D5U B;  5BPI A;  2DJI A;  3BTI A;  4BDY A;  5FFX A;  2X1E A;  4AUX A;  3OL3 A;  4XN0 A;  1QVT A;  3FWE A;  1SMY F;  4FE7 A;  1MBE A;  4CCN A;  5J4Y A;  2HZD A;  2KRH A;  4ANJ A;  2WV1 A;  5GAG J;  1K6Y A;  2GXG A;  3NAU A;  1N77 A;  3BJ6 A;  1NG6 A;  3I71 A;  3PQK A;  4HNT A;  5KHD A;  3EUK L;  3CZ6 A;  3DU5 A;  2OQG A;  3WTS C;  1XSV A;  4PFO A;  2GIV A;  1GXQ A;  2W1O A;  2ZSH B;  3T8T A;  4NB5 A;  2COM A;  2OF7 A;  4Y15 A;  4EVI A;  2YPR A;  4UXN A;  4MTD A;  5HOO A;  2M9H A;  4EGY A;  4V19 K;  2M30 A;  1R1V A;  2HOT A;  1ZR4 A;  4IKF A;  1REP C;  2K4B A;  4Y33 A;  2EFW A;  1YJ9 I;  1Z3Y A;  3KYC B;  2TRT A;  2V26 A;  2X1D A;  3KP7 A;  5DCF A;  2XAU A;  2H8R A;  1JHE A;  2EFO A;  5L3B A;  1D8K A;  2ICW G;  3KX2 A;  3N05 A;  5DYM A;  3V4G A;  1KQ8 A;  2X9D A;  4XLP F;  3S93 A;  3SZT A;  1Z67 A;  3M8F A;  5E1Z B;  1B6A A;  1FBU A;  2Z16 A;  3VB2 A;  3F3X A;  4RLF A;  5KAF C;  1T7D A;  3VPR A;  5A2Q K;  2EK5 A;  2ZME C;  2HDC A;  3WE2 A;  1D0X A;  1WH5 A;  2BHZ A;  1KGS A;  3TP3 A;  1HKS A;  1RKT A;  2CUZ A;  3WU1 B;  3GYH X;  4A3C J;  4ZJZ A;  3VOD A;  3ABK H;  3G71 I;  1UMQ A;  2EJR A;  5IYC J;  4X1E A;  4XLC A;  2IVM A;  4BXU A;  3I59 B;  4LIV A;  4Z6Y A;  5M3F J;  4KUM A;  1VQ9 I;  1SD6 A;  3GFL A;  3O3K A;  1IRZ A;  3PO2 J;  1NTC A;  2EBI A;  3ABU A;  3L09 A;  3A01 B;  5KVR A;  5EGO A;  3RCO A;  2B9S A;  1O7L A;  2DDB A;  1YX3 A;  3TKY A;  2D2W A;  3EUH C;  3QAH A;  2PN6 A;  4DZJ A;  3H0D A;  3T8R A;  2QLZ A;  3HHH A;  4FE4 A;  1Z05 A;  1X3U A;  2VN2 A;  5L3G A;  2CH0 A;  4IEJ A;  2EFP A;  3M4O J;  1RRJ A;  4L0Z B;  4I0A A;  4IQJ A;  2FOK A;  3OYA A;  3DBH B;  4ZC3 A;  2D1H A;  3GCM A;  4JQF A;  1POG A;  3WTW C;  2MBF A;  4PCQ A;  2A5Y B;  2K7L A;  3Q0U A;  5DTD A;  3BQY A;  2EV0 A;  1ZK8 A;  3IH3 A;  5F08 A;  1FIA A;  3HOZ J;  2HTS A;  3I64 A;  5HNH A;  1XC5 A;  1DUX C;  3QP5 A;  1XB4 A;  5LLQ A;  2AS5 F;  2CO5 A;  1BJA A;  4UV9 A;  2NVX J;  2QBY B;  2IS4 A;  2R92 J;  1W7P D;  2Q0O A;  1RUN A;  2O03 A;  4Y17 A;  3OYH A;  1I1G A;  1BI3 A;  3I4M J;  2H94 A;  4NC8 A;  2XGX A;  4IZZ A;  2PJR A;  2P81 A;  2AO9 A;  1WSU A;  4ZTF A;  4XM3 A;  4YG2 F;  1RR8 C;  1ZTR A;  3QYE A;  4BHB A;  5M5W J;  1QU3 A;  2Y69 H;  4F91 B;  3D5L A;  2LSO A;  3PUF A;  1LFB A;  1FJL A;  4OMY A;  3KCC A;  2WAF A;  3V42 A;  5LHH A;  5DM7 F;  1R6R A;  2E1C A;  2NOG A;  2EB7 A;  3L2Q A;  4ZYE A;  1P9Q C;  2GA1 A;  3WTZ A;  1OYY A;  3E0J B;  5HLI A;  2ZME A;  2KDZ A;  2KZV A;  1QVU A;  1OPC A;  1RI7 A;  3FXL A;  4A3J J;  1ON1 A;  3E6M A;  3OS1 A;  2FEZ A;  2PI0 A;  2JMW A;  3GW2 A;  3WG9 A;  2XRN A;  3C7J A;  3J80 K;  2HQ5 A;  2PMH A;  3KP2 A;  2Y75 A;  4K2E A;  5FO5 A;  4M6V A;  1VZ0 A;  1VQ4 I;  3K69 A;  4AIH A;  2R7S A;  1F9N A;  2W84 A;  1SVL A;  3KLO A;  4WWC A;  2HEO A;  1W7P A;  2ECB A;  2CG4 A;  3FBN B;  3C2B A;  4XRF A;  3GEZ A;  3AAF A;  2V1U A;  4A3G J;  1P92 A;  3EUH A;  3HRT A;  5LD2 C;  1JXS A;  5IP7 J;  1YTY A;  3MZH A;  1QA6 A;  2IGN A;  4HF2 A;  1JKO C;  3CTA A;  2K9N A;  2F2E A;  2R7F A;  3OYC A;  3JSO A;  3QRF F;  2XAH A;  1QNT A;  4QIW N;  4A3D J;  4CYC A;  5BNG A;  4HV6 A;  3VFZ A;  5K7H A;  2MH2 A;  4BY7 J;  3RSN A;  4BXF A;  1ZRD A;  5F0C A;  3FIS A;  1HF0 A;  4D0P A;  5FLV A;  5E1W A;  4C3I J;  4B48 A;  2M3A A;  1N25 A;  4A3B J;  4WX9 A;  3GTK J;  2W57 A;  2JK3 A;  2Z99 A;  4I02 A;  2DA4 A;  1R49 A;  3WHC A;  1Y56 A;  3S04 A;  5FRO A;  5E3O A;  2PMZ A;  4L18 B;  1IXS B;  1LDD A;  2JA8 J;  3IWZ A;  1VQ6 I;  1S5L C;  3EYI A;  2STW A;  3S1N J;  1IV8 A;  4M6X A;  1MSF C;  3FIW A;  4DIQ A;  5DD4 A;  1VF9 A;  3LFK A;  1L0O C;  3SZG A;  2E2J J;  1B59 A;  2IS2 A;  3NEU A;  1YIJ I;  2VC0 A;  1R58 A;  2F5F A;  1WFX A;  1MW7 A;  2M4K A;  1F43 A;  3NRV A;  1ZAR A;  1XGO A;  3BTC A;  2FML A;  2L5Q A;  4IO9 F;  1R5G A;  2E60 A;  3KFW X;  4XR6 A;  3GZ6 A;  2KFD A;  3LFU A;  1XGM A;  4HST A;  4OIO F;  2MLG A;  2FX0 A;  3ZMU A;  2QQ8 A;  2EIM H;  3R4K A;  1BI0 A;  4RA2 A;  2QSG X;  2K9S A;  1Y0U A;  4KYW A;  1BW5 A;  2MW8 A;  2KHM A;  2L54 A;  2VLA A;  3TW7 A;  3BZC A;  1TW3 A;  3GTJ J;  3ZQL A;  1G6N A;  1W5S A;  3MZ8 A;  4I76 A;  3KP5 A;  1JT6 A;  3B02 A;  4ENJ A;  2Y9Y A;  1U78 A;  3O6B B;  1TNS A;  4UB6 C;  1PDN C;  4IVN A;  2R5Y A;  3H5A A;  2YSR A;  4C2T A;  2ME0 A;  2HVQ A;  3ZP5 A;  2EH3 A;  2HXO A;  4PDK A;  5E79 C;  3BG9 A;  3VYR B;  1UMU A;  5L3F A;  3BR1 A;  3E7L A;  5F04 A;  4MGR A;  4ZZL A;  1MD0 A;  1A31 A;  4WXD A;  3ZQF A;  2EQR A;  1AHD P;  3A01 A;  3J7Y J;  3GBG A;  3HXL A;  1JI8 A;  2O61 A;  1KU7 A;  1UJ8 A;  1NHA A;  2O0Y A;  1K7A A;  1HDD C;  2O8K A;  1T0F C;  3E1S A;  2K4J A;  3ZQC A;  2WY7 Q;  3FDY A;  1MNM C;  3BG3 A;  2DU9 A;  2QQB A;  1D0Y A;  4H0E A;  5JHU A;  2D45 A;  1Y0N A;  2DAO A;  3FMQ A;  5ED4 A;  2DT7 B;  1PUF A;  2OBP A;  1XGS A;  1XMA A;  2JUC A;  3DEW A;  4XQF A;  1A5J A;  2XGC A;  2WAE A;  3PQJ A;  3GTM J;  2M0M A;  1OYW A;  4BQA A;  4C2M J;  1QHH D;  5FKL A;  2FD5 A;  2UXX A;  4HW0 A;  3TMO A;  1MZB A;  3A0B C;  1EH7 A;  4I98 B;  2KJC A;  3GF2 A;  2ELH A;  3RPU D;  3HSR A;  1XPX A;  4R79 A;  2HQN A;  4B8X A;  3HSE A;  3KEO A;  2ZJ2 A;  2L01 A;  2ECC A;  4D7N A;  1ONV A;  3B6C A;  3GFI A;  3S2D J;  1DQU A;  1IF1 A;  2D5V A;  4CCJ A;  2IT0 A;  2HS5 A;  4II2 A;  2DMN A;  1XCV A;  3ABL H;  4IHT A;  2YS9 A;  4XLE A;  3V8J A;  3W6K B;  4OIP F;  2Z1D A;  2XC7 A;  2MGQ A;  1LUJ B;  3H3U A;  1E3O C;  3F8F A;  2O6G E;  2JJ7 A;  3ZGK A;  1LFU P;  4FQG A;  2QM3 A;  2VKD A;  4R1H A;  3LST A;  4RB1 A;  2DOD A;  4GYI A;  2B0L A;  2DFE A;  3IL2 A;  3BWG A;  1Z91 A;  2GZW A;  2UXN A;  4GRI A;  3TO9 A;  4NDL A;  3LSH A;  4YEL A;  3R6S A;  4KIS A;  2FF4 A;  1I50 J;  5FKM A;  3BQZ A;  1MBJ A;  1KYW A;  5E3M A;  1HKT A;  2BE5 F;  6PAX A;  2CU7 A;  1TLH B;  2YR2 A;  5HOD A;  2EIJ H;  4Q47 A;  2YX4 A;  1OLT A;  5FKK A;  4R8H A;  4BL0 B;  4GDF A;  4GFB A;  3C1D A;  2MC4 A;  2V9V A;  3Q0V A;  4M3G A;  3RPU A;  3L7W A;  3IH2 A;  2EIK H;  1S29 A;  2VXZ A;  1XMX A;  2YUS A;  5ILS A;  5HVQ C;  3S2W A;  2DOF A;  2DQL A;  2L02 A;  1NK3 P;  4PFP A;  1B12 A;  3K1N A;  1AWC A;  1MBK A;  2LRE A;  1T0F A;  1R23 A;  1X2M A;  4M72 A;  3E6D A;  5FRN A;  1YOV B;  1N78 A;  1P4W A;  1Y6I A;  1EKE A;  3AG2 H;  2GLO A;  2HYJ A;  1OR7 C;  3L2U A;  4NHJ A;  3KYD B;  3A4C A;  4S04 A;  2Y30 A;  4AYB N;  4BQN A;  4IHY A;  4LLL A;  3FKI J;  4B1R A;  2EIL H;  2M0C A;  4II3 A;  3IAM 2;  4UVB A;  3HIF A;  1HST A;  3I4N J;  3RKW A;  4F92 B;  3IIQ A;  3M3Y J;  1IW7 F;  2GIZ A;  4L9V A;  3RYR A;  4PJN A;  3EPZ A;  3H9J A;  2RQP A;  1OCP A;  3RI4 A;  1XTA A;  2Y48 A;  1G3S A;  2F5D A;  3BTL A;  3M8J A;  4KNY A;  4E4H A;  4MTE A;  4YIF A;  2DA2 A;  3HHG A;  4Q48 A;  4XKV A;  2HQA A;  1B8I A;  5EEA A;  4IHV A;  1QPM A;  2V1X A;  3F22 A;  1MH4 A;  1LE8 A;  2DO7 A;  2OJE D;  2F5C A;  3BPV A;  4ZYD A;  5LEK A;  3I3L A;  1ZN2 A;  2X51 A;  4BQO A;  1T8I A;  5H20 A;  4XN3 A;  3FK7 A;  4GYG A;  4RGX A;  4DQ2 A;  2CGP A;  3OR2 C;  1IXC A;  3ZMV A;  3GTQ J;  5B1A H;  4CDG A;  5D5V B;  1R5I D;  2FBK A; 
#chains in the Genus database with same CATH homology
 2VBX A;  1GVJ A;  3CUQ C;  4KN7 X;  1A04 A;  3HTS B;  4P9F A;  3CO6 C;  1TBX A;  5DV5 A;  1U2W A;  2IA2 A;  3TOB A;  2XUB A;  2J5O A;  1OR7 A;  2ZNZ A;  3BY6 A;  1RUO A;  2V6C A;  2V1D A;  2A6E F;  1FC3 A;  1S7O A;  2CWE A;  3M9A A;  4AD9 A;  2ZNY A;  4EV0 A;  3DV8 A;  5ICE A;  2RGV A;  2E1N A;  1K78 A;  5LHI A;  4M6Y A;  2VT3 A;  3RPQ A;  5HDN A;  1VTN C;  2YU3 A;  1DDN A;  4IRI A;  3GUD A;  2A07 F;  2Z5U A;  3IWF A;  1WWX A;  1KYZ A;  3F8M A;  1JE8 A;  1FOK A;  5D4S A;  4P55 A;  2O8X A;  1UHW A;  1ULY A;  2FQ3 A;  3CUQ A;  2NAZ A;  2DK5 A;  1U5T C;  2HOE A;  2FMY A;  3FM3 A;  3LA3 A;  1XD7 A;  4ESF A;  3WTU C;  4M9X A;  1DP7 P;  2H27 A;  4U0Y A;  1LDK B;  1V3F A;  2FU4 A;  2NS0 A;  5FLX K;  3OOP A;  2KJB A;  2A6H F;  3P9K A;  1KU3 A;  3E5U A;  2EA2 A;  1EH6 A;  3WE3 A;  4M71 A;  5LBQ A;  3M7G A;  3E97 A;  1FSH A;  2Z9O A;  1EV7 A;  2JSC A;  2XAF A;  4ENK A;  5A2Q Z;  2L4A A;  1PP8 F;  4K8W A;  1E2X A;  5D6E A;  4EQQ A;  5HLG A;  1ZRF A;  3REO A;  5LRS A;  4UVA A;  4E70 A;  5FD5 A;  2LDU A;  3K0L A;  4ENM A;  3RKX A;  4PGG A;  4IRG A;  1T39 A;  1OYI A;  2ZO4 A;  1ZG1 A;  5CVV A;  5J8C A;  1LEA A;  4M74 A;  3JW4 A;  1YG2 A;  5FB2 A;  4LLN A;  3MAJ A;  2OA4 A;  1WRJ A;  3HSF A;  1R00 A;  2MA3 A;  4KIB A;  4MQV A;  1G3W A;  2Q8K A;  2DLL A;  1SD7 A;  4KMU X;  4RAZ A;  2FKD A;  5FD6 A;  1XDS A;  2FJR A;  4GCV A;  2VE9 A;  5K1Y A;  2R7D A;  2WWY A;  2XAQ A;  3V7S A;  1I1S A;  1ZHF A;  3FXU A;  2PBI A;  1K6O A;  5TRD A;  1YQA A;  3F6O A;  4CHU A;  4U88 A;  4AIJ A;  5LGN A;  3J80 Z;  4WXC A;  1JGS A;  5J6X A;  2GQQ A;  4HV5 A;  4U0W A;  3N4M A;  4WK8 F;  2HO0 A;  3FX3 A;  2PFB A;  2HYG D;  2E7W A;  2G9W A;  2JT1 A;  4HYE A;  4MHG A;  4IJA A;  1FLI A;  3V7C A;  3F8B A;  1WKM A;  4G7O F;  4HLY A;  1SMT A;  3J7A O;  2P6S A;  2RDP A;  2L3D A;  3B73 A;  1P4A A;  3CDH A;  2F5E A;  4I7H A;  3MWM A;  4XSZ F;  3HRM A;  4TV7 A;  2CYY A;  3WGH A;  4ZH4 F;  1YW9 A;  4XSX F;  1J5Y A;  2RVC A;  2XHK A;  3ZMZ A;  3MZY A;  1F39 A;  4RGS A;  1H0M A;  3HRS A;  2P5V A;  3J81 K;  3C18 A;  2Q2E A;  3DQV C;  3RJP A;  3GWZ A;  4L9N A;  2DQR A;  2CQK A;  4HLX A;  4LMY A;  3FXR A;  3GFJ A;  2STT A;  2DT5 A;  1P6R A;  1JHH A;  3JAM K;  1LB2 A;  3ECO A;  4PZJ A;  1BM9 A;  1D3Y A;  3L00 A;  2RN7 A;  1FNN A;  1U8R A;  1KQ0 A;  3QU6 A;  3WOD F;  2HZT A;  4CYD A;  3EQL F;  3BZ6 A;  5EEG A;  2IP2 A;  1BIB A;  4N9H A;  2CW0 F;  1ZGA A;  4LLG F;  4UNO A;  4L5I A;  3VOE A;  4G6Q A;  3F6V A;  3HYI A;  4WXH A;  3WU0 A;  1QQI A;  4WCG A;  1G3Y A;  3RDI A;  2M8E A;  4O6J A;  1FT9 A;  1B4A A;  4EJW A;  2FBH A;  3F8C A;  5KK1 A;  3V7R A;  3P9C A;  1QZY A;  1TQI A;  3ML6 A;  3ZN0 A;  4HAM A;  2EWN A;  1UFM A;  3G3Z A;  2EV6 A;  2H6B A;  2QQA A;  1XMK A;  5AON A;  4OIN F;  3T0Y A;  3KZZ A;  5ICC A;  3WGI A;  4LJZ F;  3BPX A;  5H6Q A;  2BGC A;  1S8N A;  5FFZ A;  2FNP A;  3KP6 A;  3TGN A;  4LB5 A;  2JZY A;  3G73 A;  1YIO A;  2VC1 A;  3OV8 A;  1LJ9 A;  2NNY A;  4RB2 C;  3ZMS A;  3E3V A;  2LF8 A;  4U7D A;  3GX4 X;  4A0Y A;  4L9J A;  2M45 A;  4HBL A;  2NYX A;  1K78 B;  4HOB A;  2LNB A;  1KU9 A;  1L3L A;  4UVC A;  3JSP A;  1HQC A;  1YS7 A;  2W85 A;  4CGZ A;  3P7N A;  3IRR A;  1W5T A;  1W4M A;  1V4R A;  2P5K A;  1ZH5 A;  5K5O A;  1T38 A;  1SFE A;  5CVJ A;  3BP8 A;  3CUQ B;  3F23 A;  3GLX A;  4HX8 A;  4G9Y A;  1WQ2 A;  3LQR A;  4Z2Y A;  2L4M A;  2JPB A;  5HS8 A;  5K5R A;  1R7J A;  4LK1 F;  3NQO A;  2DFI A;  2XAJ A;  3SXY A;  2NRA C;  2HKX A;  1J75 A;  2RNJ A;  2Y0M A;  5DUI A;  3HUG A;  4CO8 A;  1SAX A;  5IT9 K;  1O3Q A;  5TJJ A;  3V8L A;  4M9S A;  4EJU A;  2VBW A;  4JK1 X;  4L5J A;  3LQQ A;  2LKP A;  3GVA A;  1IXR C;  4LD5 A;  1R5H A;  3ECH A;  2D1V A;  4ETS A;  3MFK A;  2M5W A;  4OOI A;  2OU2 A;  1HSJ A;  2Z3Y A;  3GO5 A;  4O3M A;  5E8I A;  2VT2 A;  1I6X A;  1HW1 A;  1OKR A;  4CZZ A;  5D8K B;  3CJN A;  1GXP A;  1GHC A;  4YFN F;  4L0Y B;  1YFH A;  1KQ9 A;  1O7F A;  1YS6 A;  1QZZ A;  5J8F A;  1H9G A;  5LRR A;  5E1X A;  2VON A;  1U5T B;  1RNL A;  5HS9 A;  1R1T A;  2V79 A;  2BYV E;  4FX4 A;  4I09 A;  4B09 A;  2P7C B;  3R61 A;  3BOQ A;  3FHZ A;  4Q5S F;  4G6D A;  3TQN A;  1Z6R A;  5FLX Z;  1FSE A;  3QPH A;  1RZ4 A;  2CFX A;  3K2Z A;  3WTV C;  3ZPL A;  5F6F A;  2ESH A;  2GAU A;  3WTX C;  1PP7 U;  1S7A A;  1YO5 C;  2FXA A;  3SFZ A;  1HBX G;  4G8X A;  1T98 A;  5E8G A;  5ICG A;  1PUE E;  3ULQ B;  2E7X A;  5CJ9 A;  2XIG A;  1I4V A;  3O2P E;  2X0L A;  3QOP A;  4WF2 A;  2P7V B;  3KP4 A;  3U1D A;  2PLY A;  3DKW A;  2FBI A;  5AIP A;  2DTR A;  1T6S A;  3MCZ A;  3TOA A;  1EH8 A;  1R22 A;  2UWM A;  4A2U A;  1J59 A;  3DF8 A;  2HR3 A;  2M1B A;  5BQT A;  4RGR A;  2DBB A;  3I4P A;  5DEQ A;  5EEH A;  4M9Z A;  3HOS A;  1G3T A;  4HA8 A;  3ZQ7 A;  2DPU A;  1R36 A;  5HDK A;  3KET A;  3DXJ F;  5E17 F;  1QGP A;  2K02 A;  4GO1 A;  1Z6T A;  2BEO A;  1UCR A;  4OIQ F;  2FE3 A;  2HTJ A;  4XLN F;  1UB9 A;  1IN6 A;  4LGW A;  4RAY A;  3EET A;  3SQN A;  2IA1 A;  4ZZD A;  4KN4 X;  3WTY C;  3F8N A;  3I54 A;  4U7B A;  3KEQ A;  2HWV A;  3KZY A;  1Z1D A;  3WGG A;  2ZCW A;  3HOT A;  2XV4 S;  1BOA A;  1E17 A;  2HNF A;  3KE2 A;  3JTG A;  1IRG A;  1KN9 A;  4M73 A;  5E18 F;  1B9M A;  2A3S A;  2VE8 A;  1FP1 D;  1MDM A;  2K27 A;  2P5L C;  1XN7 A;  1U5T A;  2FRH A;  4ESJ A;  2VOP A;  1F4K A;  2BV6 A;  1DPU A;  3ROU A;  4EJO A;  5HLH A;  3CLO A;  4LG0 B;  1G4D A;  2QUF A;  4YFX F;  2IJL A;  5D4R A;  4BNC A;  2EFN A;  1HKQ A;  4IF4 A;  4LK0 F;  3LAJ A;  2JPC A;  3GFM A;  2ACJ A;  4LB6 B;  4O5V A;  2XAS A;  1TQM A;  2PJP A;  4U0V A;  3J81 Z;  4HF1 A;  4CXF A;  2ISZ A;  2J5P A;  3CUO A;  2GXB A;  5F1R A;  4A6D A;  5DUK A;  5JFR A;  1J7K A;  2DK8 A;  2P6T A;  5L3D A;  1ZG5 A;  1U3E M;  1IN7 A;  3FXQ A;  5LHG A;  2MD5 A;  1IAW A;  3JAM Z;  5ILV A;  1YLF A;  4KMF A;  3W6J B;  1XDU A;  2QWW A;  3QP6 A;  3DPT A;  1FYM A;  2PG4 A;  1O3S A;  3BRO A;  2CSO A;  5F64 A;  4ENN A;  1TW2 A;  5CVI A;  2IA0 A;  1ZGJ A;  3U2R A;  4KIG A;  1KCA A;  5FGM A;  2QQ9 A;  3ISP A;  4EMS A;  2KKO A;  3E5X A;  1LEB A;  4MEY F;  2TDX A;  2IW5 A;  2VOO A;  5JVT A;  1HW5 A;  1DPR A;  1P2F A;  4YII A;  4HDU A;  4A5M A;  3IRQ A;  2HFH A;  2KIF A;  4A6E A;  4A0X A;  1ZAO A;  2OZU A;  4EJT A;  4KA4 A;  2A69 F;  5H6R A;  4BYY A;  2XKO A;  3BJA A;  2HKO A;  4RS8 A;  3BJO A;  3V8K A;  2DI3 A;  5DDG A;  3IC7 A;  2ESN A;  2PMU A;  3LAP A;  2WC2 A;  4NV4 A;  3H3Z A;  3ZMT A;  1O57 A;  4ASN A;  1D8J A;  3EYY A;  4ZYG A;  4HQE A;  1J0R A;  2PEX A;  4EM2 A;  2PQ8 A;  4MQ9 F;  4BH9 A;  4OU0 A;  1USS A;  5CYV A;  3JTH A;  3K1M A;  3K9T A;  1LNW A;  1FP2 A;  5CVR A;  3L2C A;  1J9I A;  4IRH A;  3IHU A;  5D8L B;  1H9T A;  1T2K A;  4KFC A;  3ERE D;  1IRF A;  1ON2 A;  4EM0 B;  3M1E A;  4N31 A;  2GWR A;  1BIA A;  3FZV A;  2GA2 A;  5HS7 A;  4LG0 A;  1FWZ A;  4ON0 A;  4UHT A;  1XGN A;  3K1P A;  5JI6 A;  1BC8 C;  4IXA A;  3Q5F A;  2QZ8 A;  4LFU A;  1D5V A;  3SHF A;  3LWF A;  4QWQ A;  3TO6 A;  1F5T A;  2ISY A;  3RIR A;  3TDZ C;  1K79 A;  4A5N A;  2A68 F;  1QO0 D;  3Q9S A;  3BDD A;  2XAG A;  2OZ6 A;  4DNC A;  2G7H A;  3H92 A;  3ELK A;  3I0T A;  4ZYH A;  4N9I A;  4I2O A;  5IT9 Z;  1HXD A;  4MEX F;  2XRO A;  4Y13 A;  2P4W A;  1I27 A;  1TQP A;  1MJ9 A;  3E6B A;  3F21 A;  1TTY A;  4IPA A;  1B1B A;  1SD5 A;  1RIO H;  3E5Q A;  3T1B A;  1MJB A;  3RYP A;  1BN5 A;  4KDP A;  4RGU A;  2WTE A;  2Z33 A;  1KU2 A;  1MJA A;  2OQR A;  3GZ5 A;  1AOY A;  2EFQ A;  4HDV A;  2QVO A;  2X4H A;  3TO7 A;  5DCM B;  3LA2 A;  1UST A;  1BI2 A;  4BHP A;  5L3C A;  1WI9 A;  3HTU A;  4GGG A;  5ILU A;  3I59 A;  4EJV A;  3IKT A;  2RC4 A;  3I5U A;  3EDP A;  2NNN A;  4P96 A;  1SFU A;  3I53 A;  2VBY A;  2HYF A;  2ZFW A;  2KRF A;  3P9I A;  3HRU A;  1YW8 A;  3ZMD A;  3MQ0 A;  2UZK A;  1KA8 A;  4I0B A;  4FX0 A;  2IRF G;  5ERI A;  1O3R A;  3M8E A;  1FZP B;  2RV8 A;  2JRT A;  2QBY A;  1YYV A;  1CGP A;  3KP3 A;  4ESB A;  5D5W B;  1LVA A;  2QEN A;  5CVU A;  1Q1H A;  2MLK A;  2W24 A;  4HX4 A;  3F72 A;  1BC7 C;  4RB3 C;  1QBJ A;  2EV5 A;  2WV0 A;  2C6Y A;  3FF5 A;  1IN4 A;  4F7Z A;  4FHT A;  2IPQ X;  5D5X B;  4UUV A;  5JR3 A;  2KIM A;  1TNT A;  1MGT A;  5K5Q A;  2ZKZ A;  1MKM A;  3L9F A;  1Z9C A;  2BBY A;  4HZF A;  1S6L A;  1I5Z A;  5BS6 A;  4KIF A;  5E20 A;  3C3W A;  4CIC A;  2EA4 A;  3KLN A;  4HX7 A;  1YW7 A;  2AXL A;  5AIQ A;  4KT5 C;  3LA7 A;  2FSW A;  1AY9 A;  1FBS A;  2ZBK A;  3DPL C;  5DD8 A;  4ME8 A;  1MDM B;  1CF7 B;  1C0W A;  4G7H F;  5D6F A;  1ZRC A;  2R3S A;  3QPT A;  1BBY A;  1ODD A;  2W25 A;  4EM1 A;  1XSX A;  3U9G A;  3RKY A;  1HW2 A;  2DW4 A;  1ZYR F;  5BOX A;  1FX7 A;  1FPQ A;  1FYL A;  1SD4 A;  4GXO A;  2OAZ A;  4XBF A;  4S05 A;  4PGH A;  5DCM A;  1IZ1 A;  4BHC A;  3FMR A;  2FA5 A;  3CO7 C;  3GXO A;  4G7Z F;  1BI1 A;  4AWX B;  4G94 A;  1IN5 A;  3WTT C;  5BPD A;  4OIR F;  3R0A A;  1O3T A;  4AVP A;  1IN8 A;  2FNA A;  2XKP A;  3N97 A;  1ZRE A;  2DPD A;  3COA C;  4YFK F;  3RTR A;  1Z7U A;  2RKH A;  1B9N A;  1ZLJ A;  4UV8 A;  5LGU A;  4A12 A;  1P4X A;  1FY7 A;  1J2X A;  4BAY A;  4JBA A;  3DFG A;  4MNU A;  4Q4Z F;  2HGC A;  2G7U A;  4AIK A;  2OD5 A;  2K86 A;  3I58 A;  1XCB A;  1LDJ A;  3MEX A;  2VOD A;  4KIC A;  3ABT A;  3IKV A;  1S3J A;  2QYO A;  4NQW A;  5LGT A;  3Q9V A;  1JHC A;  2JTV A;  3ZN1 A;  1F1Z A;  1R1U A;  2LF7 A;  4IHS A;  3DEU A;  2M87 A;  5L3E A;  1OMI A;  4OMZ A;  1U6G A;  5HDG A;  2YX7 A;  3FM5 A;  3DP7 A;  4P9U A;  4HQM A;  2P8T A;  4QLC U;  3R0J A;  4RB0 A;  2XVC A;  4HF0 A;  5ICF A;  5LEJ A;  2ETH A;  1UHM A;  3E6C C;  2ZXJ A;  2H09 A;  4A0Z A;  3TDU C;  1JHF A;  3FMS A;  2MH9 A;  2H6C A;  2ZME B;  3D0S A;  5CLS A;  3SZP A;  1XSD A;  4L9T A;  4FT8 A;  1ZG3 A;  3QU3 A;  2A61 A;  2MC3 A;  1FBQ A;  1SFX A;  1LQ1 A;  3T5X A;  1CF7 A;  3BDN A;  1STZ A;  4I01 A;  4EGZ A;  1W7P B;  1FYK A;  3VEP A;  5IT3 A;  2ADU A;  2KIU A;  1ZLK A;  2O3F A;  2VBZ A;  1IUY A;  5BMZ A;  3PFI A;  3R60 A;  4N0B A;  2HQR A;  4P5O A;  5D5U B;  5BPI A;  5FFX A;  3FWE A;  1SMY F;  2GXG A;  3BJ6 A;  3I71 A;  3PQK A;  2OQG A;  3WTS C;  1XSV A;  2GIV A;  1GXQ A;  3T8T A;  4NB5 A;  2COM A;  4Y15 A;  4EVI A;  2YPR A;  4UXN A;  4MTD A;  5HOO A;  4EGY A;  2M30 A;  1R1V A;  1REP C;  2K4B A;  2EFW A;  5DCF A;  3KP7 A;  1JHE A;  2EFO A;  5L3B A;  1D8K A;  5DYM A;  1KQ8 A;  3V4G A;  4XLP F;  3SZT A;  3M8F A;  5E1Z B;  1B6A A;  1FBU A;  3VB2 A;  3F3X A;  1T7D A;  5A2Q K;  2EK5 A;  2HDC A;  3WE2 A;  1KGS A;  1HKS A;  3WU1 B;  3GYH X;  3VOD A;  2EJR A;  2IVM A;  4BXU A;  3I59 B;  4KUM A;  1SD6 A;  3GFL A;  3O3K A;  3ABU A;  3L09 A;  5KVR A;  1O7L A;  3TKY A;  2D2W A;  3QAH A;  2PN6 A;  3T8R A;  2QLZ A;  3HHH A;  1Z05 A;  1X3U A;  2VN2 A;  5L3G A;  2EFP A;  4L0Z B;  4I0A A;  2FOK A;  2D1H A;  4JQF A;  3WTW C;  2MBF A;  4PCQ A;  2A5Y B;  2K7L A;  2EV0 A;  2HTS A;  3I64 A;  1DUX C;  3QP5 A;  1XB4 A;  5LLQ A;  2AS5 F;  2CO5 A;  1BJA A;  4UV9 A;  2QBY B;  1W7P D;  2Q0O A;  1RUN A;  2O03 A;  4Y17 A;  1I1G A;  1BI3 A;  2H94 A;  2XGX A;  1WSU A;  4YG2 F;  4BHB A;  3D5L A;  2LSO A;  4OMY A;  3KCC A;  5LHH A;  2E1C A;  2EB7 A;  4ZYE A;  2GA1 A;  3WTZ A;  1OYY A;  5HLI A;  2ZME A;  1RI7 A;  1OPC A;  1ON1 A;  3E6M A;  2FEZ A;  2PI0 A;  3GW2 A;  3WG9 A;  3J80 K;  2XRN A;  3C7J A;  2PMH A;  3KP2 A;  5FO5 A;  2Y75 A;  4K2E A;  3K69 A;  4AIH A;  1F9N A;  2W84 A;  3KLO A;  4WWC A;  2HEO A;  1W7P A;  2CG4 A;  2V1U A;  4XRF A;  3GEZ A;  3AAF A;  1P92 A;  3EUH A;  3HRT A;  1JXS A;  1YTY A;  3MZH A;  4HF2 A;  3CTA A;  2F2E A;  2R7F A;  3JSO A;  3QRF F;  2XAH A;  1QNT A;  4HV6 A;  3VFZ A;  2MH2 A;  1ZRD A;  4D0P A;  5E1W A;  4WX9 A;  2W57 A;  2Z99 A;  4I02 A;  3S04 A;  4L18 B;  1IXS B;  1LDD A;  3IWZ A;  3EYI A;  2STW A;  4M6X A;  5DD4 A;  3LFK A;  1L0O C;  1B59 A;  3NEU A;  2VC0 A;  1R58 A;  2F5F A;  3NRV A;  1ZAR A;  1XGO A;  2FML A;  1R5G A;  3KFW X;  3GZ6 A;  1XGM A;  4OIO F;  2MLG A;  3ZMU A;  3R4K A;  1BI0 A;  1Y0U A;  4KYW A;  2L54 A;  1TW3 A;  1G6N A;  1W5S A;  3KP5 A;  3B02 A;  4ENJ A;  1U78 A;  3O6B B;  1TNS A;  1PDN C;  4IVN A;  2YSR A;  3ZP5 A;  4PDK A;  1UMU A;  5L3F A;  4ZZL A;  4MGR A;  1MD0 A;  4WXD A;  2O61 A;  1KU7 A;  1NHA A;  2O0Y A;  1K7A A;  2K4J A;  2DU9 A;  2QQB A;  4H0E A;  5JHU A;  2D45 A;  2DAO A;  3FMQ A;  5ED4 A;  2OBP A;  1XGS A;  1XMA A;  3PQJ A;  1OYW A;  4BQA A;  2UXX A;  4HW0 A;  1MZB A;  1EH7 A;  4I98 B;  2KJC A;  3GF2 A;  2ELH A;  3HSR A;  4R79 A;  2HQN A;  4B8X A;  3HSE A;  3KEO A;  2ZJ2 A;  2L01 A;  1ONV A;  3GFI A;  1IF1 A;  2IT0 A;  2HS5 A;  1XCV A;  4IHT A;  3V8J A;  3W6K B;  4OIP F;  3H3U A;  3F8F A;  2O6G E;  2QM3 A;  4R1H A;  3LST A;  4RB1 A;  4GYI A;  2B0L A;  3IL2 A;  3BWG A;  3TO9 A;  1Z91 A;  2GZW A;  2UXN A;  3R6S A;  2FF4 A;  1KYW A;  1HKT A;  2BE5 F;  6PAX A;  1TLH B;  2YR2 A;  4Q47 A;  2YX4 A;  4R8H A;  3C1D A;  2V9V A;  3RPU A;  3L7W A;  2VXZ A;  1S29 A;  5ILS A;  5HVQ C;  3S2W A;  2DQL A;  2L02 A;  1B12 A;  3K1N A;  1AWC A;  1T0F A;  1R23 A;  4M72 A;  3E6D A;  1P4W A;  4NHJ A;  4S04 A;  4LLL A;  4UVB A;  3HIF A;  1HST A;  3RKW A;  3IIQ A;  1IW7 F;  4L9V A;  3RYR A;  2RQP A;  3RI4 A;  2Y48 A;  1G3S A;  2F5D A;  4KNY A;  4MTE A;  4YIF A;  3HHG A;  4Q48 A;  1QPM A;  2V1X A;  3F22 A;  2DO7 A;  2F5C A;  3BPV A;  4ZYD A;  5LEK A;  1ZN2 A;  5H20 A;  4RGX A;  4GYG A;  4DQ2 A;  2CGP A;  3ZMV A;  1IXC A;  4CDG A;  5D5V B;  2FBK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...