3JSRA

X-ray structure of all0216 protein from nostoc sp. pcc 7120 at the resolution 1.8a. northeast structural genomics consortium target nsr236
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
108
structure length
108
Chain Sequence
MKMQTYYYVLASRRFLLQEEPIEEVLKERTRHYHEQEKEIDFWLVPQPAFLEAPEFADIKAKCPQPAAAIISTNSQFITWLKLRLEYVVTGEFSAPSETIPNPLASLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords All0216 protein
publication title X-Ray structure of All0216 protein from Nostoc sp. PCC 7120 at the resolution 1.8A
rcsb
source organism Nostoc sp.
molecule tags Structural genomics, unknown function
total genus 29
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2009-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10674 Ycf54 Protein of unknown function (DUF2488)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1860 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3jsrA00
5M2UA 3HZEA 5M2RA 5M2PA 3JSRA
chains in the Genus database with same CATH superfamily
4K59A 4TY8B 1KNZA 4BLGA 1KS2A 3PNIA 4HHUA 2YKMB 1RAEB 1E6YA 3C6UB 3DLKB 7FDRA 3PDNA 4PEOA 1GEHA 3K89A 3OTOJ 2DH9A 3IWLA 4OYWA 2RSQA 2R2TA 5BYRA 5THWA 5KFUA 4ERDA 5KTQA 2DNNA 3LGMA 4KC5A 4LQ9A 1YZ6A 2CQ4A 1TKZA 1ZM2A 2FC8A 3IBWA 1C1BB 1V6HA 4QIFA 5J2NA 1B7YB 3CMES 2H54B 3ELHA 3MAAB 2E1PA 1UWAA 1XNRJ 3PV8A 3DRPA 1P1LA 3FCVA 2I2YA 4LF4F 3UO0A 4X4TA 2VG7B 3FEXB 5LJ5Y 2ASJA 1U1MA 1XMQF 3J7A1 2CZ9A 3MEEB 4F7VA 5DM7Q 2P5VA 3RZAA 1QSYA 4UOGA 5HMXA 1NM2A 2KG1A 1WI6A 1S7IA 5EHHA 1FWKA 4U96A 3LOUA 1J2VA 1YRXA 5A2QU 3AOBA 1KTQA 3K17A 1JWWA 1X9SA 2XLJA 3SI8A 4TVAB 1VLYA 1CS4B 3V6JA 2YNFB 4RW9A 4EK2A 1I94F 3DLEA 4YB7A 3BB5A 1HNZJ 3GJRB 1RT6B 5CZXA 2UU9J 1I1GA 4EYHB 2CQHA 1S48A 2OHDA 2IYGA 3D1HA 4DU7A 2KFYA 2OPRB 3CJKB 1TAQA 4RWWA 1D09B 3CF5Q 5F8MA 3T19A 4ZVOB 3W62A 3LPYA 5GAEI 2XY5A 4M5KA 3MEGB 1FE4A 1GMWA 5K8PA 1K1QA 1DFDA 2BJ3A 1QD1A 4OJ1A 1N5QA 2M9KA 1QAIA 1RACB 4LF6J 2V63A 2RQCA 1U1RA 3DMJA 3M32A 4ANCA 2E44A 4CP5A 1WI8A 2Q66A 5FLXY 3TQ1A 4EUVA 1IKVA 1XR6A 1E6YB 3A8KA 2W9AA 4J9SA 5F0WA 2OD6A 3C2PA 3AHPA 2QLFB 3U7JA 5F9LA 3UDEA 1TKZB 5GADI 2XCAA 1SUQA 5KFKA 3JS9A 4DR1F 5J2NB 1WC3A 3RRHA 2UXDF 4MTPA 3M9MB 4X4NA 3DRPB 4Z37A 3BDPA 2DB1A 1RT2A 1FRJA 1NU4A 4JI5F 1WHXA 1U4BA 1BD6A 3AAWB 3P8BB 1SKRA 3P49B 4UT4A 2VFVA 3OL8A 4CO0A 1UAWA 1DBDA 1S79A 3PO5A 4HDHA 3C15A 2I9SA 3N9UC 4GO7X 2RRNA 2V2QA 3NWRA 4CI0B 2JJ4D 3HT0A 3I9ZA 4DL7A 1RWWB 4FKXA 2HIQA 2UUWA 2W2MP 4FS1A 4RW9B 3DLEB 3Q2TC 3FBFA 5IV4A 4BDPA 4YHHF 2W7AA 3FJ2A 2QA1A 3BV8A 3QT6A 2V94A 5DZ6A 2APOA 2HS4A 2DXEA 4PWDA 1PG5B 5C25B 2VV5A 2ZFHA 2JC0A 2K1RA 1XIQA 1KLMB 2YWGA 2E9RX 4OYIA 2Y3YA 1SBRA 5FLXU 3FNNA 2Q3PA 4KFBA 4UUWA 1WORA 5IT4A 3NKYA 2IPOB 3T1HJ 3SSRA 3I5BA 4PPZA 4QJVA 3CD0A 1TFYA 1BY9A 3HX9A 3PYEA 3DMJB 3M32B 2HWIA 5DLFA 4U8VA 2WB4A 4USUA 1IN0A 4NXMJ 2G2ZA 3EM1A 1IKVB 3CDBA 4ECXA 4KAIA 2Z30B 3GQCA 3SV3A 3Q0AA 2MQLA 4RNOA 2GNKA 4QCLA 4GMKA 2K06A 2HFZA 1XNRF 4JI6F 1SUQB 4XDCA 3I31A 5E3PA 3K59A 4URGA 2BDPA 4N47A 1T03A 2ZOFA 1U25A 1X4BA 3TA1A 1RT2B 1KBRA 1YJRA 1UFWA 1UMJA 1NPKA 1H7WA 3I5AA 3VALA 1VC5A 1EP4B 4NLVA 4ECSA 2F9DA 3FK4A 2CJ9A 1L3SA 4P2XA 4ELVA 1YWXA 4ECVA 3C15B 2B51A 3QT5A 1KQSR 1FD2A 2AD9A 1CULA 4JI0J 1S6UA 4A8WA 4MH8A 3DDNA 5CYMA 3GIJA 1E6VA 3N79A 4DSEA 1HFEL 1UEVA 2ZZMA 2RF2A 2UVUA 5AXNA 4I7FA 3AB4B 1DY3A 4OI1A 4PRFA 4C3KA 5KT2A 5D0GA 5DGBA 1PC5A 4P9SA 4DR3F 4PWDB 3TZWA 5F9NA 4FKYA 4M8LA 3NWGA 2K1RB 4LF6F 2ZC3A 5IS2A 4Z7YA 3SQGA 3R2CJ 2YXLA 3HVAA 3UD4P 4KFBB 4ZOSA 2FGOA 4HTJA 3BQ1A 2RT3A 3C3LA 5K9FA 1NK0A 1TV6B 1Z1ZA 4Y6IA 3KTQA 2HHHJ 1Q8BA 4C8OA 5CHCB 3D6HB 3TZXA 1W2BR 1T9XA 3QZ7A 3HVRA 1IQTA 2BKPA 3K5NA 1EQ0A 3RJMB 2BE2A 3C19A 5L9NA 2B6AA 1WTFA 2J5AA 2KB2A 4X66J 4ZVGA 3U02A 4OHZA 1SIWB 2ZM6J 2R4FA 4X4SA 2EFNA 1LXNA 9RUBA 3MFIA 3VAMA 3THPA 1T03B 2BJEA 2H9ZA 2DD8S 2MLXA 4GKJF 2JC1A 4ZP7A 4MIWA 2VFSA 4NXNJ 4ED0A 4MKBA 3IN5A 4L6V3 3TZYA 4Y28C 4I56A 1JIHA 1QSLA 5KFXA 2ZBPA 3IMQJ 1I51B 2FJBB 3W5ZA 2R7SA 5D0HA 3BBBA 4MMOA 4C11A 1MSWD 3LUYA 3U1LA 1CULB 2RQMA 5CYMB 4B9MA 1WC4A 4PUOA 2UXBJ 2LXFA 1UVJA 2L9NA 3R27A 3PJXA 2RF2B 3D6TB 1X5OA 4I7FB 2CPDA 1NCLA 3UDLA 5BYQA 1XERA 2HSEB 3UD5A 3W3SA 2V5HG 2Y8WA 3CO9A 5DM6Q 1XR5A 2X1AA 1N32J 2CQCA 4O3PA 2XO7A 1L3VA 2ZVIA 1KHWA 2G4BA 3HMJG 1RWUA 3SQGB 3PY8A 2MZSA 4RBTA 1Z2LA 1R31A 1M1KT 1TELA 5KFMA 3GV8B 4C8LA 4C8NA 3CT9A 1JLEA 2I6WA 1YQHA 2ZH4A 2RU9A 1UW9A 3W63A 3BQ0A 1D0EA 4QYZJ 4F4YA 3QGHA 5HL7Q 1Q95G 4ZVFA 2B43A 3V4IA 2BE2B 2O5DA 2B6AB 3ZXWA 5DGAA 2HZCA 1H0HB 2YY3A 2EFOA 2WK4A 1P9QC 2ROPA 2HPUA 4YMEA 1NHVA 4UOHA 2GGPA 2IC3A 1J5EJ 2HHPA 2CPHA 4OI6A 5GAHI 1IKYA 4MFBA 2JWNA 4FYYB 2ABYA 2ZKTA 2EG1A 1S1VA 3R7BB 1NNDA 3BKFA 2XMAA 4JI0F 1RYRA 3MM8A 3NRBA 1URRA 1VR6A 2C3UA 1VRTA 4X4RA 2QLBB 2HS3A 3OTCA 2B8QA 3M8ZA 4PYDA 1I6JA 2BJDA 4C11B 4ECWA 3TUZC 4PUOB 3ICLA 3A12A 1FRLA 2V2KA 1R0BG 4X65J 3MUVP 1CEZA 1N33F 1Q1KA 3T1AA 1H74A 4ZPBA 4F36A 3R7NB 1IKXA 1X60A 3SEOA 4ED3A 2ALZA 3VVUA 2BM1A 1LK7A 5LXRA 2DH8A 3PACA 1LWFA 3GYXB 3GILA 1VQ6S 1KFSA 3PRVA 3MDFA 1Q8LA 3LANA 1QM9A 2C1EB 2R2UA 4NZ7A 1HNXJ 4NZ6A 4DZ6A 3J81Y 5B0AA 3TX0A 1LFPA 5BR8F 3TA2A 2W7OA 4R8UA 2CQ2A 1FTRA 3BYRA 4OL8A 5CD4A 4X66F 1U2RA 2JNJA 2NXJA 4I1TA 5LSRA 2ZD1A 3GU0A 5CCLA 1RU2A 1FNMA 2HZAA 3V4IB 4R25A 4FYVB 4KE5A 2VASA 4ZP9A 4Y34A 3UCGA 1K0TA 3L9ZA 3S1TA 5HLFA 3UN5A 5CYQB 3QZ8A 2VIHA 2QFJA 5IV3A 3S7RA 4NXNF 2IC3B 4NLPA 4PCQA 1IKYB 2XG8A 2CQPA 2J9DE 4TU8A 4NX9A 1S1VB 3P3DA 3ZZUA 1Q82T 3KJFB 3GYGA 4HEA9 2FJWA 2F7VA 5EN1A 1NJZA 1SVDA 4ZVSB 1V3RA 1S0VA 2J7WA 2IIHA 5ETQA 3OXLA 1SKWA 4U9RA 1WDTA 2HEKA 4LBHA 1UL3A 4FXWA 2X7IA 4NYZA 2Y1JA 2G0IA 3EGZA 4NRTA 3O8WA 2OSQA 1UZHA 3WIVA 3MEDB 4DWIA 2X1FA 2B9YA 3T3FA 3FFIA 5ETOA 1IKXB 2CJYB 1H3DA 3W9IA 2YWEA 3BO2A 2VQFF 3LGNA 4FBUA 2AU0A 1MNEA 1LWFB 3J81U 2C2NA 2CNNB 2IJFA 3HZGA 4RR5A 1VGYA 1VBYA 4NWBA 5C42A 1GAOA 2NREA 4ZLNA 1WKLA 5E2QA 3W5YA 3EX7B 2GIQA 4DX5A 4R8UB 3TANA 4QIVA 1VLOA 1ZZNA 1FF2A 4NYPA 3UE2A 1N56A 2B9XA 3VHQA 4UZCA 3MECA 4DDFA 3MPWA 2EFGA 3IBFB 2ZD1B 4B3OA 2RJZA 1IM4A 4ILLA 2MKHA 4R5PA 1F0XA 4QR1A 1F9FA 5L46A 1YZ7A 2CJQA 2AJFE 3Q8QB 4KHRA 3D9BA 4Y2KA 2XMWA 3DOMB 2R7VA 4WJBA 3QLHB 4C3LA 5HLFB 2BQ3A 4ZHRA 5T7LA 1S59A 2ZJQQ 3FVYA 4KQZA 2CNKB 1RCOB 1MLAA 2YNGA 2J8SA 5SUHA 3LWLA 4P7TA 2CJXB 4N7TA 2AMCB 2BUNA 1T02A 2KVQE 4OJGA 4ES3A 1HHQA 4IRDA 1MG7A 3G6VA 4JI1F 4U7CA 2LMIA 2CQ0A 3POTA 3MM7A 4ELTA 3I87A 4LBIA 3RBDA 2WTFA 2HVHA 3SBMA 4UTGA 3RB3A 1UFLA 2HLTA 3FC9A 1KDNA 3FFIB 2YKNA 3M8QA 3W9JA 2R8JA 3HHLD 4RNMA 2RHSB 1T9UA 2E5LJ 3L7UA 4LFAF 3KHGA 2BANA 1S5ZA 2MZ1A 4OLPA 3LWMA 2KJVA 2MEWA 3FGVA 4ZA1A 3A3PB 5KFZA 2Y1RI 2XGQA 4A47A 3EZ5A 3FCWA 2HQCA 2Z2ZA 4ZVPB 5C42B 3CO0P 3W8GA 3B54A 4YP3A 4FXVA 2B4PA 2FHJD 2IAJA 1ZTWA 3GB0A 2VFTA 3DU5A 3LP2A 3NS5A 3Q2SC 2A2DA 1RT1A 2F5GA 3MECB 4B3OB 2ZH5A 3UN2A 4ETXA 4QPXA 4JV5F 4R5PB 5L9XA 2JLFA 1Q0NA 4P75A 3JXOA 5HN0A 3O3LA 3CMAS 4I6AA 2U2FA 4MYUA 1JK9B 2ZOMA 4EBEA 4G3IA 5I3QA 2DPJA 1IM6A 4ZHRB 5T7LB 5GVQA 3HSZA 1M1GA 3JAMY 2MSTA 2FHMA 1UVIA 1DARA 3M6UA 3ZZOA 2FHKA 2XEXA 4DEZA 1M5OC 2YNGB 3CCTA 3CJQA 1XBWA 2VL1A 5GMKa 2M3DA 3FRYA 2VG6A 2CQGA 4PYAA 1TMMA 2C3PA 3NP5A 4B9TA 3R3TA 3ADAC 2BQUA 5IM0A 3POTB 3MM7B 3IA0A 5GAGI 4Y2IA 1X0PA 1NJWA 3R1LA 5A6PA 1WG4A 4RUAA 3RB4A 3KHRA 4WZQA 4RW6B 2YKNB 4ZDNA 3M8QB 3I9V9 3I6PA 5H9EK 2DXDA 3R1HA 2VA2A 2BJ7A 1URNA 3OUYA 4HR2A 2BANB 1TR0A 3D6FB 4JI2J 4OJ3A 1JLFA 3TARA 3LP1B 5H9FK 4P73A 3PW0A 1FXLA 1HNWJ 4KB7A 4JI4J 1WC0A 2FLOA 1G6BA 5D0EA 1N5SA 3C6TA 1N8RT 2IAJB 2CG8A 4LSNA 3O2IA 4IKAA 3KOAA 4KJIA 1WC1A 1HI1A 2LEPA 4CO5A 3LP2B 4BC9A 4QW8A 4ZLLA 3TZZA 3MAHA 1RT1B 2XY7A 3KDNA 2OELA 5DLGA 2XI3A 1L3UA 5B0CA 2F4FA 4PPDA 4N41A 1XNQJ 1UW4A 2JLGA 1NUEA 1WG5A 2HFNA 2CPXA 3DLBA 2AHOB 3JAMU 4ECQA 1N6QB 4M5MA 2Q79A 2MJNA 2B4UA 2F1FA 4FF1A 1M5HA 2C2OB 4ZJLA 1JB0C 1Q16B 2M2BA 2JZ5A 3F41A 1X4GA 4IDKA 2KFNA 2MLZA 2NSBA 3HD1A 1OJ4A 3SYZA 2FGCA 2MB0B 2HQ3A 3D0GE 3R6GB 3NOGA 2Y8YA 3UCZP 2E7WA 5JUMA 2VG6B 4GKKF 3TVYA 1B0PA 2PT0A 3MMCA 5IM0B 2HLUA 1SL1A 2H51B 4C8KA 1H2VZ 2VC1A 2C42A 4DJBA 2YBVA 2E5LF 5JMNA 3DLHA 1RI7A 3B82A 3CTRA 2PMHA 1SC1B 3K5MA 3PVXA 2DGQA 3HHDA 3RAQA 2ZVSA 1JLAA 1HNIA 3OUYB 3MM9A 2MQ8A 1YSJA 4V19J 4UW2A 3E01A 1F5BA 1JLFB 1FRMA 5A0YA 3NY0A 4FNIA 2HZVA 1T11A 2HK3A 3J7YU 1SJRA 3M6VA 2OP5A 1OSCA 5IOLA 2UV8G 5K8NA 1TUGB 2ZBQA 3C6TB 1X31C 3BZQA 3UDCA 1IJFB 3FUYA 4TLQA 4LSNB 4AD6A 3KUHA 3KK3A 3HHEA 2B5JA 3WC0A 2LQ8A 3OLAA 3H42A 2CA9A 1N88A 2EFQA 5HVFA 4A46A 4L76A 2ZEJA 2YTCA 4KH1B 2YX1A 2DGWA 2QSWA 1VIXA 3ETOA 1FJCA 4QWBA 3CDAA 3CD6S 4DL4A 4D3HA 4DX7A 4G1QA 4H4OA 1S0NA 3P4UB 6FDRA 4IR1A 1RT3A 2XYHB 5KG7A 1M5PC 4WIQA 3H4DA 4OV1A 4F3OA 4IDKB 2VG5A 3LQVA 2J9DA 3R6LB 1RB0A 2Q1LA 4UY8T 4A8QA 2X3DA 2XNQA 4DN0A 1FDDA 4DR7J 3ONQA 1LXJA 2CPEA 2E7VA 4DV0J 1RT5B 4DX6A 4QQBA 2XMJA 2CWKA 1GTHA 3H59A 3MMCB 4TQSA 2KXHA 3AD9C 1AW0A 2YPZA 4K0KF 3NGSA 1X4HA 4FVCA 2ZH2A 4JI2F 4CM0A 1G4CA 3T5HA 4OZNA 3WBZA 1FEHA 1JLAB 1NMEB 1HNIB 3B4DA 5FIIA 3GG0A 3NLCA 1HNWF 3MM9B 1LW0A 4JI4F 3E01B 5A0YB 5KFWA 4ZIWA 3OR2A 3NEKA 1X8DA 1LWCA 1RTIA 3MR2A 1WKKA 2QC3A 2YKOA 1BHNA 4PXCA 2J7KA 2NXCA 2E1AA 2HQDA 1NZAA 1X7VA 2DJWA 4FPIA 2HHXA 3KK3B 2B5JB 4RW8A 4J90A 1VI7A 4KGVB 1FRHA 2XB2D 4YB5A 3OL7A 4OQJA 4NCGA 1U26A 3NAHA 4BHQA 2OD4A 1FJGJ 2JFDA 2M7SA 3BGRA 3W7BA 1NK4A 3C16A 4G1QB 4H4OB 4WXOA 1RT3B 2AYGA 1S9FA 5KFQA 4O3OA 2LCWA 3N6MA 4KHPF 2DITA 2WBMA 5CQGA 2VG5B 4UZBA 1KSPA 3D4JA 3GR1A 1RHKB 4RO0A 1A7GE 4H4KA 2MZRA 4CLZA 4I2QA 1UJ5A 2BR0A 4QIEA 2FJVA 5HSPA 2JOQA 1KVIA 3NL0A 2N3LA 4ED7A 2BRKA 4B9LA 1BQNA 3P5TL 3OVAA 4JI8J 2XS7A 2IRYA 4GRSA 5K14A 4TY9A 4CLWA 1VQ8S 2DNPA 3DGVA 4WFYA 5C2CA 3HHKA 5I42A 4ZVEA 4N56A 4N5SA 4NA1A 3DRYA 3BGOP 4O3NA 4A8XA 2JEFA 3SCKE 3CWJA 1UEKA 3PHTA 3HSJA 1LW0B 3EMTA 3CJTA 2V8PA 1Q81T 2A6MA 1W26A 4JBCA 1D9FA 3IRXA 4RU9A 3B8HA 3HFKA 4ECYA 1KVJA 1U09A 3PIPQ 2V34A 4DQIA 3OT9A 3OR2B 4KSEB 5F3TA 1LWCB 3RW7A 4G65A 1RTIB 1S12A 3MEKA 1F2HA 2LFVA 2N3OA 5ETLA 4YEAA 3ZZYA 2VJUA 1FJEB 3WQPA 1KP6A 1CSJA 3TOQA 4EI2A 5KG0A 4FNHA 4AXIA 1Y3KA 3D7SB 5LMNF 1S6QA 3DKDA 1X9WA 1O51A 2PIIA 4NCGB 1IXKA 4RBVA 1U0SA 3M4XA 1ACMB 1FD8A 3PFEA 3BGRB 2CDQA 1YRUA 2V50A 3C16B 3H98A 1LKZA 4B17A 2GHWA 3GTYX 2MGZA 4M1KA 1RKIA 3CJRA 3K5PA 4DV0F 2FHOB 2WAQD 3PTWA 2BOAA 1RQ0A 1R8CA 3M8PB 2Z2MA 4ZVTB 2W2QP 4EU0A 4I2QB 3CCMS 3ILIA 1WJ9A 2OKQA 1AFJA 3MPUB 2D3ZA 3BBFA 1R8PA 4K5RA 2XULA 4FYXB 2MKJA 4I68A 2FZGB 3MR7A 3UNGC 2R3VA 4DQQA 5DJBA 5I42B 2CFXA 4FYWB 1UJ6A 2NZ4A 1RXOB 2GW8A 3Q8UA 4LJMA 3HD2A 2VC0A 4YDXA 2BE9B 1SC3B 4KHMA 3D2WA 2ZKUA 4P71A 3J80Y 3TAQA 1F1BB 2YX7A 4QU6A 5FD1A 3LA0A 4ALZA 4JV0A 4BWJA 2R7XA 2Z2LA 2VONA 2LLZA 3IRXB 1KRPA 1RTHA 1N5YB 3LO3A 1XMBA 2M70A 4DHVA 5KFDA 2ZBCA 3GSDA 2NQPA 4M5NA 4LFBJ 3ET6A 2GS8A 2IMOA 1TL1A 2V67A 4TLRA 2MLYA 2A6OA 4DV7J 2UUBJ 4RX6A 4CLPA 3IWNC 1KOHA 1SQEA 2GVZA 2ATLA 2BZ2A 2KHDA 4ES2A 2ALYB 3KG0A 4NLRA 1NRKA 1NKCA 1S6QB 2RNEA 4EGLA 3JB9k 3EVOA 3T9ZA 3BGUA 4LF7F 1EX8A 4J9RA 1DTQA 4DI6A 1HARA 5EWFA 2F4VJ 2R42A 2RILA 4WE1A 3U1NA 2Q43A 2MGZB 3RR7A 1S1XA 1N4LA 5CXTA 2MY7A 2OAUA 3ZTQA 2LECA 1S72S 2HW3A 4H4KC 3MUMP 2WVDA 1FRKA 4DU8A 2UXCF 4M5DA 1NPPA 2XCPA 3KLEA 1NJYA 3A4TA 3M9NB 2IM2A 3S01A 1SJ4P 1GH8A 2VUGA 3D0HE 4QIGA 3HVTA 2FTRA 1IWAA 2EW9A 2DRDA 4LVNP 3OJUA 4HYKA 1VBZA 2JHEA 1FEEA 4ENOA 4NA2A 3RB0A 1R0CB 2JDJA 3J80U 2O3DA 2X3GA 2XLKA 1IWGA 2RDIA 1TU0B 2VPXB 1ZA2B 2EK6A 1DLOA 1K8AT 2C22A 4ZCKA 5AT1B 4RKUC 3EDQB 4ED6A 4KGKA 1SV5B 5MLCV 1AFIA 5F0UA 1SC4B 4ZVHA 3LAMA 1RTHB 1PBUA 4WF9Q 3KK1A 3U1MA 4YS2A 1LWEA 3ET6B 2ZH7A 4B3RF 2DKOB 4KKOA 5KFBA 4EWTA 1GMWD 3K8WA 2KN4A 4PG5A 1HA1A 2K7KA 3PX6A 1U47A 3D1QA 1LFWA 3K2YA 4O3SA 4OX9F 4LSZB 5KFAA 2KTQA 2GVZB 3U27A 3MMBA 1RAHB 4F26A 1FA0A 4N76A 4F3QA 4WYWA 2E5IA 2FDNA 2IDLA 1W2IA 4ZK7M 3R5AA 2PI5A 4DLGA 1FX4A 4C98A 3D1OA 4H54A 4CNYA 1X5PA 3V81A 4WE1B 2KKHA 3ILOA 1S1XB 2AJ2A 4CO4A 4OYPA 4NLUA 5KT5A 3EGWB 2GQQA 1MMNA 4L3NA 3R5DA 4NMXA 5LOQA 1N5TA 3NXZA 4AL6A 4YY3J 4DUZF 1HR0J 4CWBA 4M5DB 3KLEB 4W4MA 4Q2LA 1IR0A 1R0AA 1APSA 1VMBA 1FFWB 2GMLA 2AEJA 1S57A 3HVTB 3UDVA 4E2FB 3DGPA 4MK7A 3UR3C 3BSNA 1U2CA 1VQ4S 2X1GA 4LRAA 3KMSA 4YB6A 1NK9A 1DLOB 3PW4A 4ZJQA 3PX4A 2G1DA 1S4FA 2QA4S 4LFBF 4ATNA 2XTJP 1TL7B 1QAXA 4WFBQ 1D9DA 5B7WA 4ID8A 3MPDA 3IM8A 3N5FA 2A1BA 1MW7A 4WBFA 2DNZA 5A8RA 2Z57B 4DV7F 2UUBF 3NS7B 2OTJS 4IQXA 2CJAA 2V4RA 3KK1B 1LWEB 1ZAXA 3LAKA 2G13A 4K8RA 5G4DA 2ASLA 4WKRA 1R3NA 2W2OP 5B0GA 3IR5B 4DPXA 1Q4RA 3NGUA 4NCBA 1WF1A 1S7HA 4DR6J 4GVBA 4YUDA 3MMBB 1S9EA 2D7SA 2HFVA 3C14B 3FSXA 4HT7A 4ICLA 2L41A 2F4VF 1OPZA 4B3SJ 3UVJA 1GQEA 1G1XA 1FDAA 1ZAVA 4ITSA 4LFCJ 1VRQC 2IJNA 4IRCA 2AJ1A 5D0RA 3V81B 4ILRA 3GFHA 2CZ4A 4DCJB 1ZOTA 2CKWA 1Q78A 4DV5J 3TX8A 1PYOB 1RBOB 1G3OA 5DQHA 2HHVA 2MZQA 4KH0B 4P52A 4K5SA 5IC4B 4ID5A 1R0AB 1AUDA 3PCOB 3DOLB 3US5A 3OR1A 1KEKA 5KFIA 2CVIA 3MI7X 3CDUA 4F8RA 3TEGA 1HBMA 4OZ0A 3DGPB 3DI6B 2WB1D 4KO0A 2HVZA 3CJ0A 2AYBA 2DCUB 2BW2A 4KIAA 2H65B 2GJIA 1T7PA 1NB7A 5C7PA 5KFFA 2CG4A 3WC2A 1CG2A 4E98A 5KT7A 2AT1B 4ZVUB 1RWKB 5DG7A 3OJSA 4Q0BA 2E1MC 3IWXA 1SJ1A 1SH2A 4CLLA 5RUBA 2ZH1A 2HRTA 5FDLA 1L3TA 1K73T 5KFVA 3ZNUA 3ENVA 3UFCX 2XHCA 3O1LA 2QIFA 3SSQA 2HRUA 2XMTA 3ZZPA 3M8YA 4I0WA 2DK2A 5KG5A 3MMJA 1S4EA 4IH7A 4JI7F 2L08A 3NGKA 4ZN3A 1PCAA 3G8QA 2CQ3A 4DS5A 1Z2ZA 1VHFA 1X4AA 1S9EB 3KG1A 1VQ9S 2DR9A 4ICLB 3HJFA 4DV1F 4P6QA 3K0JA 3UVJB 3BBCA 2HFUA 1JQGA 1OY6A 1VQYA 4NPOA 1U2FA 2R8KA 3VGSA 4EBCA 2JLEA 3ZC4A 3CXCR 5F8IA 1JLBA 2KL8A 4YY3F 4ZLPA 3NAIA 3GPAA 1QAJA 3GJSB 1HWUA 2DY1A 1FNOA 2V9WA 2AYMA 4OZ3A 4J9VA 4C8YA 2DYAA 2ZNYA 3DDKA 1RBAA 3OR1B 4WFNQ 1BGXT 3I0RA 3MR3A 1HBMB 1HW9A 3EUNA 4X64J 3HXMA 2GHVC 2FC9A 2ZUAA 4ANDA 4MKYA 3MAQA 4KO0B 2IDEA 1TKDA 2MXYA 2R7OA 4ZPDA 2KU7A 4ED8A 3T1YF 4OHXA 4CLYA 2KM8B 3E2EA 2G0JA 4KV8A 2HVDA 2ASYA 1S1UA 4Y65A 4Q0BB 3GJQB 2MKKA 1WWHA 4F2SA 5FDLB 1TP7A 2LDIA 3KDOA 3QFHA 5DDQC 4IG0A 2MQQA 4HL9A 3V5RA 5IC6B 2EBEA 3I4PA 3V6DB 4DR4F 2ZBIA 5CABA 2XM3A 2BE7D 4XAKA 2LQ5A 2CAJA 3K7RA 4WPAA 1CLFA 2LU1A 4HKQA 3QPIA 3KJQB 1TTHB 2RQKA 1Y11A 3QGPA 4A8OA 3NNCA 4I6WA 5EWEA 2RU3A 3QIPA 1S6OA 3O6QA 2B9WA 5MAOA 4DV5F 3N5BA 3QFWA 4LF8J 4URSA 5A2QY 2GFFA 4NLOA 1PYTA 1T8EA 1JLBB 1GMVA 3DHXA 2RQ4A 4EMDA 1IR2A 3K8VA 5EDWA 1NH8A 1FVQA 4F2RA 3IGVA 2IRUA 3Q8PB 1HQ2A 3R5GA 2R2SA 2YQ0A 2XWXA 1Y5NB 2CPYA 3N6LA 5KG4A 2FVSA 1UPPA 3HKWA 3KLHB 3G96A 1ZTTA 4BBYA 1RHUB 1YLXA 3I0RB 3J7Z5 2HFSA 3EICA 4M5HA 5J2QB 2HNYA 4DV4J 3H5XA 3FEYB 2XYPB 5KFSA 2KT5A 4EYIB 3O44A 4I69A 4N8NA 3ZZRA 5IT9Y 3CJSA 1ELOA 5KFTA 5DQGA 2NS1B 1PC4A 2KM8C 5IQQA 1RZMA 5LL6d 1N48A 2E5HA 1N34F 3PO4A 2HGLA 4EO6A 4IUFA 4PWUA 1MN9A 3CCSS 3GV7B 2YQ1A 1S1UB 4QBUA 1JNZB 1YKWA 2DGTA 4Q43A 1H72C 2RH3A 2V8VA 2DHAA 1WSRA 5ETTA 4LT6A 4U67Q 4IG0B 4DF4A 3ISZA 3QWUA 4QPTA 4OI2A 2CQIA 1PAEX 2UVVA 2MKIA 3P6YC 1RTDB 3LW5C 2QJ3A 1XWLA 3I4HX 2GX8A 1U6ZA 3IAS9 4TU7A 2E7XA 1AZSB 4DSJA 2GHPA 5GAEU 4WYLA 3QIPB 2EI5A 3JQMA 2IJRA 4ES1A 4KTQA 4F4XA 4LQ3A 4JYAJ 2HBYB 1MWZA 2D74B 4K4VA 1ROFA 3OV7A 4DV3J 2WSEC 3JSBA 1FRXA 4DMZA 1QY7A 3KWMA 4PG6A 2P6TA 3DXSX 2AIRB 1M0SA 4KBIA 1T9VA 1GT8A 2AEFA 2DR7A 1ZBTA 4B9UA 2RMLA 2AP6A 3FBEA 1ZH5A 1C0TA 3TW0A 4FDFA 5IT9U 1R6VA 5LM7E 4PXDA 2HNYB 2CIMA 5GADU 3EPIA 2UUCF 1S9GA 1LK5A 3CCJS 1X5TA 4URQU 2ZZTA 5CAAA 3MM5A 2V69A 4ZJOA 5HVGA 1VC0A 3GWCA 3PZPA 2RE1A 2R8IA 4IG3A 2N7YA 2RAQA 3AJDA 1IKWA 3CCZA 2YWKA 4R0EA 2QV6A 1RADB 3BKTA 3NCPA 3PKYA 4J37A 2ZC4A 3VTIA 1R8HA 1YITS 2XWYA 3FQKA 2H5JB 4EEYA 5T41A 2DPIA 3Q22A 4ZIVA 3R7SB 3HI9A 4B3MJ 3HK2A 4LF9F 1Q53A 2BMBA 4XDDA 5HO4A 4EZ6A 4USMA 2HS0A 3GSIA 2WVCA 3GCXP 3R5JB 2Y1LB 2MZTA 2OPQA 4HH1A 2ERRA 3QMQA 2Y0BB 3PJ9A 3ZZTA 3CEDA 4CRJA 1GNKA 2Q6BA 4USIA 3DN9A 2NUHA 3L95X 3NCRA 4USJC 3QGGA 2P6SA 2PE8A 5KFRA 1VQPS 2RS8A 5D6GA 1HIYA 4YOEA 5HI7A 1GXTA 3DM2A 1I3OB 4M5LA 3RGIA 1HL6A 3AQPA 1KR4A 2J0WA 3BM7A 4LIRA 3BO4A 2XY6A 1C0TB 5D4LA 4X4PA 3OTOF 1KHVA 3F73A 5HP1A 1S9GB 1UKUA 3Q8VA 4ZITA 3MM5B 3MURP 2MMYA 1FX2A 2ZHBA 1VQMS 1R27B 2R7WA 4UY85 2O1PA 5HMZA 1MMDA 3MM6A 4IG3B 1IKWB 5ETPA 5L8RC 1PKUA 2BRLA 4RWXA 2EPIA 3H40A 3NNAA 3N01A 1HQEA 3QRRA 1OWXA 1CJUA 2ZNZA 1FO1A 2MHEA 3H0PA 1MWYA 2CDRB 2QT7A 1HHSA 4IR9A 1GFWB 4O0IA 4CCHA 2CVEA 4JYAF 1QE1A 2CPZA 1HNZF 4B3TJ 2V4QA 2H4YB 2UU9F 4DG1A 1WC6A 4ELUA 4NLGA 3BH7B 4ZLJA 4RBUA 3AD8C 1N36J 1WC5A 4DF8A 4LR9A 4N77A 3W2WA 5IXUA 2OSRA 1SXLA 4PWWA 1XC9A 3DM2B 3DNCA 3C66A 3FEZA 2W4DA 1FKAF 1O8BA 4YFUA 1YJUA 4F4WA 4YQWA 4USKA 4NLSA 1U02A 5M2UA 2LVWA 4PQUA 3Q8YA 2DEJA 5HP1B 2YWWA 1VJWA 2HHSA 3KJNB 4X62J 4WWSA 4AFFA 4F02A 4G1IA 2XSFA 3ILJA 3PR4A 3L3CA 4JB8B 3HKZD 1UA1A 3RRKA 8AT1B 3EXYA 4IO1A 2BOPA 4X4QA 3MM6B 2HRYA 2B0GA 2J6UA 2M8HA 3BEGB 1KFDA 2BA9A 1NH7A 4J7CA 4WTYA 2Z8QA 3CJ5A 3BPDA 1HQEB 1YBTA 3M30A 3OL9A 5KFHA 3CCQS 2OIHA 1Y10A 1YBUA 2D41A 1DURA 4DFPA 1JJ2R 4K2XA 2RKIA 4PG4A 3SSSA 4F4ZA 3W65A 6AT1B 3OVSA 3NG8A 4DR5J 1WD6A 2KYZA 4KGZB 1OY9A 4CLSA 2C3MA 4ZP8A 2W25A 1HWJA 3GYNA 1QE1B 1YJ9S 4DG1B 1RAAB 3I0SA 2Z2YB 2MQOA 4LR8A 4N8OA 3R9LA 2XMMA 1JKHA 2XMVA 2CNOB 1E6VB 2XI2A 1BQXA 1K44A 4HHHA 3KYLA 2WSCC 3BF4A 1B4SA 1X4FA 3HJVA 1U8WA 2QGFB 4C0OC 3IAM9 4UQTA 4RW4A 1RWMB 2VJVA 2ZBRA 2MSSA 5AE2A 4F4AA 3W2WB 3CJ4A 3QNWB 3G82A 2GJ2A 1U6FA 4HDGA 3W5XA 3SV4A 2VKZG 2KZZA 3T1HF 4AQYJ 1RISA 4WK3A 1JJ4A 1P27B 2HFOA 2FVRA 4NXMF 3D0IE 4PQUB 1FWLA 1L3KA 3KUEA 3TVZA 4XK8C 1AT1B 2FVQA 2D1CA 4M94A 2J0SD 1P8GA 1FK9A 2PDAA 3ISNC 1GTEA 4K4TA 4F0KA 1Q7YT 4IH5A 5GAHU 2O66A 3TQEA 1UJ4A 4DSIA 1RCXB 5HJYA 4Z7CA 3WDOA 5LT5A 1S97A 1ZM9A 3G9CA 1ZYQA 2HBRB 2AW0A 2A18A 4LF5J 5DG8A 1ITPA 3M30B 1RSCA 1HKAA 3E8OA 2DO4A 2J6TA 3MFHA 3PEJA 5HATA 4MK8A 1CBKA 2RKIB 2Q6CA 4B3TF 1A6LA 4K4ZA 4MIAA 2VA3A 1M90T 3VQSA 3N0VA 3EPGA 5I3UA 5CZVA 2QEXS 3CC7S 4EZ9A 2F63A 3M8SA 3TVKA 3I0SB 2DR5A 1D8YA 1JKHB 2RIJA 1B0VA 4LSLA 5JXSA 3M05A 1D3WA 4RZRA 1X5SA 1J5OA 3OHAA 4RW4B 1RGVA 3MCSA 3WX8A 2W8LA 1RJJA 1FKPA 2AGOA 4M95A 2E1RA 3CCVS 4ZKAA 2DY9A 2PA3A 4MK9A 4L3KA 4P74A 1KN6A 1FFGB 3G6YA 4ZVQB 3V6KA 2YWFA 2CADA 3F44A 4ZPCA 2CYYA 3ILLA 5J1EA 3DDIA 2E5JA 4RL1A 2DXFA 2E9TA 1WF0A 5J2PA 4K4UA 2HHHF 2M52A 1JJHA 2EBGA 3DHWC 5DQIA 3MHYA 5A8WA 2Y1IA 1FJ7A 3RAMA 1OO0B 2VHGA 2XMKA 1JLEB 4LF4J 2PI4A 1FK9B 3BDEA 1XMQJ 2NXEA 1NK8A 3B78A 2V68A 1KC8T 1XK8A 1DTTA 1WG1A 2ZM6F 1RTJA 5SZTA 1SJ3P 2CNLB 4J9OA 2VFUA 3M7VA 1F2GA 2W9BA 5HANA 3CB4A 4LREA 2NXUA 1I94J 2C2DA 4DV2J 2JFKA 2QN6B 2J8AA 1FKOA 2CPIA 3AOCA 2GGPB 1EIYB 4O3QA 1HYSA 4J9MA 5E5NA 2B7BB 4MFBB 1VQ5S 1AROP 3QAUA 2FJEB 1AYEA 3LPEA 1NSKL 4K4YA 4BCAA 4U7UD 3SFGA 4JV1A 3RTVA 2YVSA 2XHWA 5DS7A 3MM8B 2UVRA 1Y5IB 2R7TA 1REGX 4CO1A 5I3UB 3NGTA 1VRTB 1RE1B 2UXBF 2QTWA 2AGQA 1QJHA 4L75A 2OI2A 1NB2A 3HLUA 4C8MA 1FNXH 4FBTA 1NDCA 5DO2A 4S0MA 1JMTA 1RHQB 4LSLB 4DV6J 3OW2R 4RUCA 3JTNA 2PFDA 3K57A 2VBYA 4FXDA 1HLWA 3ZNJ1 1J5OB 3SCJE 4YB1P 1N32F 3LALA 1RWVB 1KLNA 1FKPB 4O4RA 2IVMA 1F9EB 1H38A 2FY1A 2C2KB 2O01C 2WVEA 3Q23A 4QU7A 2XZTB 4FVMA 2AZ3A 5J1EB 3K58A 2H1YA 4O23A 5J2PB 1ZZFA 2LYVA 3ENAA 1WHVA 1IVZA 1TL4A 2GQCA 5A8WB 2UXDJ 2VQEJ 2MPUA 4Q7AA 4NASA 3G4SS 2VOOA 1C1CA 1J27A 3CDEA 2DIUA 4PXBA 2FY8A 9ATCB 5IWAJ 4JI5J 1FESA 1TFWA 2GV1A 5FJ4A 1FE0A 4LF5F 4OIXA 5B08A 1DTTB 4OJHA 1RTJB 4TXSA 5KFYA 3W2VA 3UD3P 1J5EF 3OHBA 3PKMA 1U1PA 2HNZA 2CRLA 2W9BB 2NPIA 2BQRA 1VISA 2W24A 2FLNA 1VBKA 2MYFA 5KT6A 4QW9A 1FKOB 3SFUA 3MEGA 2G0CA 4DSLA 1HYSB 1ULRA 2K3IA 1VS3A 1WHWA 1IUJA 1F6TA 3T41A 1WEXA 2W8KA 4DPWA 2F8MA 3DC2A 2EVZA 2C28A 3CD7A 2MKYA 2DO0A 4Q44A 1FTCA 4BWMA 3JQKA 1U1NA 2EEYA 4ZCIA 4X65F 3KHLA 4DN9A 2E66A 4HI1A 1LEOA 2J0QD 1EJ7L 2HBQB 1NK7A 1U48A 3P5BP 2HURA 3P45B 4YR2A 4OI3A 3NS6A 1KONA 1ZETA 3W9HA 4UQGA 3EWGA 1B64A 5KOXA 3BSOA 3KG4A 3IO1A 4QR0A 5E3QA 2J9CA 1N0VC 1JXVA 2OUGA 1HNXF 2LKZA 2X51A 3KXDA 3M9OB 1PILA 3CIMA 2XNRA 4WK1A 4JI6J 4WCEQ 1S0OA 2LEAA 3OFEA 1JX4A 3BKUA 4ZCMA 4AL5A 4NL5A 2OTLS 1QAYA 1RAIB 1FXDA 2HHWA 4CYUA 3IRWP 2P9CA 1C1CB 1OS5A 2V9KA 2AZ1A 2UP1A 2AJ4A 2MQPA 4OFZA 2NR0A 1JNRB 3FBBA 3MTKA 1FHTA 2B8PA 3DRRA 4NOHA 2QYGA 4DV2F 2ZDPA 3W2VB 1T9TA 3J7ZT 2HNZB 2GIFA 3AQOA 1OYEA 3A8JA 4Q2MA 1FDBA 5C25A 5H1SV 4X4OA 3BYPA 2VPWB 1G7CB 4J9KA 1YJTA 4HACA 5LJ3Y 2CQBA 5GAGU 3WHIA 1KLMA 1RWNB 1F9HA 3DRXA 2GIRA 4DR3J 3MCMA 4GC7A 1TL5A 4DV6F 3H4BA 5HROA 4MIBA 3WZ0A 2VDHA 1S6PA 4CO2A 3CCUS 1X4EA 1TK8A 4B9NA 4CZCA 2LXUA 2ZHOA 3C46A 4QIWD 3JYTA 4JOUA 4LR7A 1OIAA 4BC7A 2C2EA 4U7UK 4M63A 5C2GA 2AWZA 3QQCD 1H98A 1KKHA 5HAOA 3GE9A 2W2NP 2IVYA 1VYAA 4UUXA 1HI0P 3VAHA 4CNZA 3AXMA 4K4WA 4AT1B 4G6VB 1T9YA 2VQEF 3VZHA 1B70B 2P9GA 1XEZA 3FMWA 1X4CA 3AOAA 3GIRA 4OZ1A 2DNHA 5IWAF 4EFAC 4LF2A 4DFMA 1EP4A 3HVWA 1XR7A 3JQJA 5K5MA 1NHUA 4P7VA 4CYUB 4YR0A 2M88A 2MJUA 4M5IA 4GKJJ 3VWSA 2HQIA 2MQMA 1U49A 5G0RA 2WONA 3DRRB 3R5BA 2V2ZA 3CCLS 2K8GA 2BM0A 3V6HA 3VVTA 2OH2A 4C7QA 4Q5VA 2HIYA 2VODA 4X4VA 3TAPA 3VAGA 3CD5A 4FS2A 3VGUA 2HG4A 3M8RA 2OO4A 4HACB 1R7IA 4MKVA 2QLXA 2CUYA 2AX1A 7FD1A 1RAJA 2HHQA 3CULA 3OFFA 3EYZA 4RNHA 4Y2MA 5A6WA 3AH6A 1UVLA 4HH0A 4DX8H 5HROB 3OTBA 4CT8A 2HGMA 1S6PB 2GAHC 1TV6A 2J0XA 4RLEA 2RRAA 1DRZA 4L72B 4QYRA 4IQMA 1VHIA 5ETRA 3JYTB 2NSCA 2DHHA 3RR8A 1TVRA 1B3TA 4RUBA 2EKNA 5GMEA 2D9PA 5D3GA 3FZ2A 3UWTA 1RKJA 4C6AA 1U7LA 4DXLA 3H5YA 5HQLA 2H48B 1RDRA 1NXIA 2C3OA 1F5CA 1RHMB 1YTYA 1VBXA 1HBOA 5F41A 1L5UA 3PG9A 5L39A 2VPZB 3GCWP 2VKRA 3GIIA 3KLIA 3MUTP 1OMSA 2WHOA 4FF4A 2F65A 2N4DA 3VV2B 2DR8A 4XIUA 4G1PA 3RUBL 2MTLA 5M2RA 2QMUB 1IQZA 1PBAA 2IHR1 3OXGA 1EAYC 2F8HA 5A8KA 4CLTA 3Q8SB 2OPPA 4DSKA 2POKA 2V0NA 4B08A 2GA7A 2JRSA 1BE4A 2PMZD 4EBDA 1RABB 5KG2A 2V8HA 2HBZB 5G0RB 4RNFA 2ROGA 2WONB 1ZM4A 4GC6A 1R6YA 1UVKA 2CPJA 4I6YA 5M2PA 3FRZA 4Y2CA 4FZVA 4F50A 2GZOA 3N6NA 4NCAA 3TNVA 2KI2A 2C2ZB 2QSFA 5D4OA 1SKUB 2ACYA 1XMOJ 4KT0C 1BQMA 1N33J 2HKEA 2JEIA 3CC4S 4CH7A 3AA9A 2VBXA 2V2VA 5AE3A 2DGUA 4O3RA 1C4AA 5BXIA 3PIOQ 2E29A 2QZ8A 3K5LA 2YH0A 4WP8A 3H5UA 4DQPA 1XN9A 4QWCA 1N0UA 5D78A 4Y2AA 3BN7A 4USVA 4P2FA 5CH7B 2QLJB 2UVWA 5ADZA 3QRPA 4C4WA 4RPFA 1TVRB 5BR8J 1IJEB 2MDAA 2PEHA 3BGLA 5D3GB 4KGXB 5ITHA 1HMVA 1KQKA 4F0MA 4LRBA 1QLNA 1H73A 3DYAA 2C2RA 3A13A 1HBOB 4LMZA 2P9EA 3JSYA 3HO1A 1Q5VA 3KLIB 3R8YA 1QUVA 1DQ8A 1RT4A 2GJFA 1BLUA 1EB0A 2BXJA 3F56A 2ILZA 2DNMA 3FBCA 1AUSL 1RWPB 4PG7A 1S99A 2Z58B 1XNQF 4P2MA 5A8KB 4K4XA 4DBQA 3HDSA 2KH9A 1H6KX 2OPPB 3EZOA 4LRDA 2DNLA 4WU2A 4C8ZA 1HHTP 5JJBA 1DZ5A 1U1OA 1JLQA 3MPYA 2R9LA 1V9OA 4H4MA 5E33A 4OX8A 5KFEA 4DSFA 5KOWA 4P72A 1BQMB 4V19X 3M6WA 5U47A 3HSDA 1PJ5A 3F0NA 1CQNA 3TUIC 1VQSA 3EXCX 2HQGA 2VQFJ 3MMAA 2QFIA 4DL0C 2XMUA 2F3JA 2FLPA 4DCPB 1VQOS 2KZMA 3TEHB 2PD1A 2ZH8A 2VU5A 1YIJS 1DAXA 4XTTA 3Q24A 2BKNA 3BSAA 3G86A 4X2BA 4W92B 3PYGA 3HM9A 2DR6A 3R5CA 1WHYA 2N7CA 4WP3A 3QJPA 2F40A 2YH1A 3DOKA 2MHNA 1HMVB 1UTAA 1R8BA 1VFJA 3DYAB 2KRRA 4QR2A 2DNRA 2W01A 1NSPA 3H90A 1FI4A 5AXKA 5CYQA 1MWQA 3D5MA 2DT9A 1RT4B 3QWPA 1IBLJ 2KT3A 3RG6A 1YX2A 4D3GA 2DNYA 5HBMA 2KJWA 2OEJA 5T14A 1EKRA 1HWLA 1UWBA 4RW8B 2LDYA 4DZDA 4NEYA 4OZ5A 1F5AA 2JEGA 2RS2A 3W61A 5E0OA 2IRXA 1XMOF 5LSOA 4ECRA 2V8GA 4JI1J 3J7AN 3MEDA 1JLQB 1TKTA 2WOMA 3BPSP 3OFHA 4H4MB 1CVJA 3UR0A 1Y0HA 5KG6A 1BUXA 5F8NA 1M5VC 5D77A 1GK8A 1SKSA 4ZP6A 4DR7F 1WACA 2ZWPA 2QA2A 3HT3A 3LF0A 2Z0GA 5L1LA 2FVCA 3H2UB 2XGPA 1C4CA 4LFAJ 3MMAB 1O0PA 1B0TA 5HMYA 3QT7A 5C5JA 5F3ZA 1BQNB 2BW7A 3FSYA 3CJ2A 4PXEA 2OFHX 2ZZNA 5K14B 5EWGA 3C8YA 4FN5A 2ZHAA 2VZ9A 1U1LA 2G2YA 4DOZA 3FDSA 3OSNA 2WVBA 2FZCB 4TKTA 4TNOA 3JSMA 2AV5A 4ECZA 3DOKB 5E41A 3AD7C 3GG1A 1RT7A 3DOMA 3P96A 3OFGA 1FT8A 3QLHA 2W7PA 4CO3A 2BJ1A 4JV5J 3L09A 2LU2A 2AKWB 4KPCA 5B0BA 2EG2A 2C2MB 4E0DA 5K8MA 5KFPA 3TUJC 3MD1A 1YJ7A 4ZMMA 1TUWA 3R97A 1KQGB 2ZH9A 3ETMA 1FFSB 3T6JA 5HBMB 1N52B 5E3RA 5L1KA 1YI2S 3QT8A 4K2JA 3IS9A 3IG1A 1FJGF 1UWBB 2XSJA 4GO5X 2GVDA 1NSAA 1T3OA 3VAIA 4NLWA 4DL2A 1V5IB 2N4CA 4HVZA 1SH0A 1TKTB 2WOMB 1W25A 3NOCA 4CLKA 4UOCA 5KG1A 3KFWX 5K8OA 3PFOA 1NZ8A 1S1WA 2PSZA 4DR2J 1G2EA 2PFFB 5B09A 3VAKA 4JI8F 3M1VA 3I96A 3OXFA 3CJ3A 3EE3A 2OEMA 1SH3A 1ZM3A 5J1PA 5EX3A 2WSFC 3T5LA 3I32A 2XO6A 2YNHA 3TJ9A 2OMOA 1NDPA 4NZ0A 1T05A 1JLCA 5ETSA 1YJNS 2NXNA 4ED4A 3M6XA 2HNDA 3LGHA 2DISA 4LUBA 2FZKB 4A8SA 3JSMB 3KLFA 1X9MA 4LRCA 2Z4PA 3ENWA 2BYCA 2YWHA 1RT7B 3HFZB 2BX6A 1IBLF 1RWXB 4FF3A 2IYIA 1PYSB 2BEFA 4AYBD 3FCHA 3PEHA 3W64A 5AE1A 1VCTA 2ADCA 3AJ2A 2H3EB 3K5OA 1T3NA 3DFEA 4C2MA 1TL1B 1U45A 4OYZA 3Q86A 2I38A 3D67A 5CCMA 3A3NB 4OHVA 3GFZA 1UPMB 3ITHA 3IS9B 3IG1B 3CCES 1UETA 1B99A 1SI9A 1PAUB 1TMJA 2XSJB 2GVDB 2NPFA 4Q8FA 2B56A 1UVMA 1B7FA 4GKKJ 1CQMA 2AX0A 1DTQB 2G9OA 3GR0A 2QRRA 4NLTA 2H5IB 3SXLA 2XYGB 4RW6A 1JJCB 4OV6A 2WW4A 3VAJA 2IM1A 3NGRA 3I5CA 4OI0A 2A3JA 2AYEA 1S1WB 1NEEA 5CYJA 3LP1A 2HVIA 2LA4A 2HAFA 3M1VB 5C24A 3CIZA 1WOSA 2QL9B 2XBPA 2RUSA 3IR6B 2E1CA 2FYXA 2YNHB 2D9OA 3GONA 3Q89A 2PMWA 1T05B 1HQUA 1PIEA 1GXUA 1JLCB 1LOUA 1S77D 1PJ6A 1R43A 4ZPVR 2HNDB 2HAIA 2DRBA 2K2PA 5B0FA 2RHQB 1WOPA 5ETKA 3KLFB 5LSLA 1N6QA 3QGIA 4ED1A 1HWIA 2ASDA 5BYSA 3NMAA 1GX5A 3HF5A 5DDOC 4HHJA 3ZTSA 3BSCA 4OX6A 2OMLA 3MOZA 4TYAA 1GMUA 4OZ2A 4JV2A 4KKOB 4ZN1A 4USTA 4PQAA 2Y0SD 2PEBA 4ECTA 3CMQA 2R8GA 3ITHB 2W9CA 3GIKA 3W1YC 4AUKA 1C0UA 2DHSA 3OSPA 4TN2A 4NE9C 5CD4H 4DPOA 1HD0A 4OHYA 3Q83A 3MGJA 2PO4A 4ZVRB 4C48A 3TRGA 2FJAB 3IR7B 1NHKL 2KG0A 1V3ZA 2GMJA 4K7QA 3ISND 4DR2F 1SL2A 4J9UE 4ED5A 4FP9A 1WKJA 4J5OA 4OLOA 2KVIA 4K0KJ 1OQ6A 2G2OA 1IBCB 1Y9OA 4HI2A 3NMRA 4LRFA 1VK8A 2PGCA 2L48A 4O44A 1TZ0A 3OD2A 3OVBA 5C24B 3QJJA 2H5EA 2P8IA 5HQ8A 3E51A 4Z2XA 4CLFA 2B4VA 4RW7A 3BN4A 2B7CB 3H2LA 2BJ9A 1JLGA 3SQOP 1HQUB 2HGNA 1FDNA 3CCRS 3WIUA 4ETZA 2YPYA 4NLYA 5B0DA 1A9NB 1VC6A 3GLJA 1REVA 3MWBA 2JL9A 5LMUJ 1I5OB 2L3MA 2RVJA 2AGPA 4Y3CA 1O5JA 1VQ7S 3MZIA 3WX4A 1GX6A 2VPYB 3OL6A 1K0VA 2M0GB 3DU6A 2I5JA 1LQ9A 3PW7A 2IBKA 2XZDB 2I0XA 4V1Ak 4KPYA 5A8RB 1RAFB 5EUHA 2M4MA 3OTDA 1BWEA 2BABA 1XJWB 2IY5B 1RLDA 1RYSA 2W1BA 3QO9A 2MKCA 1ZPWX 4RJVA 4KGMA 1QDUB 2B4OA 5E7OB 1CPZA 3D28A 1ZPVA 5ETVA 1A0OB 5HJXA 1S10A 4KHPJ 2AEMA 1R8AA 4GVBB 3AB2B 2W9CB 1RT5A 2OEKA 1NAQA 3R2DJ 2IBOA 2PA8D 1C0UB 1NLKL 4DL6A 2W4PA 5KFOA 4OYBA 3ULHA 5DRKA 4QOTA 2WBRA 2IM0A 1EZZB 3UCUP 3SMZA 2ZJRQ 4FYDA 4A4JA 3ZTOA 2B3TB 1AXQA 4P10A 3IM9A 5BJRA 1QTNB 1UFKA 1H2UX 1SQGA 5IT0A 2AJ0A 1HR0F 4QWDA 3G2XA 1QVGR 4LIWA 1NJXA 1HD1A 4FPRA 1Y3JA 2GO9A 2EK1A 2IA6A 5D15A 5GMDA 4OX7A 4CTAA 4O44B 1BC6A 5F8LA 5H9EJ 1FCAA 4DUTA 4ID5B 1UCNA 2B9EA 2C3YA 4NA3A 4RW7B 3CE8A 1WUUA 1W7WA 2IA0A 3AT1B 1SL0A 5H9FJ 2RDJA 2GCFA 1JLGB 3VF0B 3FQLA 2VOPA 3MR6A 1VK3A 3J7YI 2ADBA 4NRUA 2QYCA 3M2RA 2CPFA 1REVB 1HPZA 1WELA 1SQFA 1H2TZ 1UP1A 3H8YA 2PC6A 2F9JA 4L73A 1P9YA 2FB0A 3NBPA 2O67A 4WTOB 3CW2C 3UN3A 5LMNJ 5HVHA 2DVIA 1UVNA 3I56S 2V6AA 2I5JB 1SJQA 3DLGA 1YVFA 1NKBA 1T94A 2JH3A 4I2PA 4QWAA 1FXRA 4DR6F 3EGVA 3G8SA 2HVEA 3MCNA 4Y0FA 1C2PA 3QO9B 3ZO7A 1H7XA 1VRUA 3VZIA 3KJVA 1HBUA 2MZJA 2JVRA 2WRMA 5AXMA 2DHGA 2YKPA 1WDDA 3JTOA 5DETA 2N82B 4KR0B 1TK5A 2GAGC 2FPHX 1OQ3A 4B3SF 1NPRA 4M5GA 2DIVA 4CH0S 4J9PA 4LFCF 3V2UC 4NMLA 3D3CJ 3QRQA 2YX4A 1RK8A 3IFEA 1Z4UA 4PG8A 1P6TA 4J9QA 3NNHA 3S8SA 2P2CB 2EC0A 3JSRA 2QE5A 1T0TV 4A8KA 2LXIA 3HULA 5L1JA 1VJQA 4A8MP 4X84A 2QMXA 3JTPA 4USHA 1PGZA 1OSDA 4UF4A 3QBCA 3RRGA 1NDKA 2IMWP 1RTZA 4XPCA 1VIOA 1YK9A 4CTAB 2UUAJ 4I4BA 2DNKA 4WIIA 5KT4A 2FIUA 1RAGB 1QSSA 2DNGA 1Y7PA 2QLWA 5AJ3J 3M8WA 1IBMJ 2VH7A 4QWEA 2L9DA 3AA8A 1X4DA 5LMUF 1EKSA 2HYIB 3BQ2A 1MU2A 4HTIA 1BWVA 2VDIA 2FLLA 3CUNA 1U24A 3A3OB 3RW6A 4KY3A 4IRKA 2HQFA 3CC2S 4IFVA 3M2RB 3W66A 3CCWA 1HPZB 4NI2A 2VB6A 3NBPB 4L74A 3MXHP 2KXNB 3THVA 2F8EX 4KV8B 4QZVB 1NKEA 8ATCB 3ENQA 2AJQA 3I82A 3DLGB 1VOMA 3PW5A 3PYFA 5HMWA 4LF7J 4I2PB 4ZPAA 3AY0A 3Q8RB 2QA4G 3W60A 3QJLA 3LTOA 2HK2A 1VRUB 5DDRC 3KJVB 1SPBP 3M8PA 1HBUB 3H25A 3MPVA 4OI4A 5DZ7A 2WVFA 2NYIA 4IFYA 5I4MA 1RA6A 3E3XA 3IBCB 2UXCJ 1HWKA 3KMQA 2NZCA 3FZBA 2DGSA 6FD1A 3PHEA 1ZS6A 4ZS6A 4I64A 3L7PA 2NLWA 1Q5YA 3GFYA 5D4NA 3PRBA 4Q8EA 3ZTRA 1DQAA 3KNGA 3GZ7A 4C0HA 3L4BC 2EFPA 1NDLA 3KNAA 2RB7A 2RUGA 4ILMA 3FMBA 1M1HA 4OZLA 2XC9A 1N5YA 1WNEA 1YDLA 2OLWA 3V4MA 3HP6A 4X64F 5F8HA 1JXEA 1R89A 2GC8A 3DCAA 3SZ2A 2KYXA 1CJTA 3GMGA 3KLGA 4AXJA 3TO8A 1CC7A 4XO0A 1UZDA 2VFRA 4A8YA 1D1UA 4B3RJ 3RB6A 1MU2B 2U1AA 2OGUA 1ICEB 2J7UA 1WTBA 2ZE2A 4IFVB 4OX9J 3PX0A 4NI2B 3OPKA 3EDRB 4WXWA 2DTJA 3HHLA 4B02A 4F25A 1CJVA 2IFXA 4CQ1A 3H20A 2JVOA 5ETNA 3T6BA 4E8UA 4KYZA 1Y5LB 2I8EA 3UI3A 3VAFA 1N54B 2EC2A 1Y00A 5J2MA 5DG9A 4OYOA 3W8PA 2LQBA 4X4UA 3BREA 3HSGA 2ZH3A 3OLBA 4NLXA 3KLVA 2CWXA 2ZDOA 1LNQA 5KFNA 3TJAA 2HMIA 2FHJA 5KT3A 4BS2A 4IFYB 3HFVA 3HCXA 5I3PA 1HNVA 4LF8F 3GV5B 4DUZJ 3TYTA 4DL5A 4CM2A 3TUPA 2XZWA 2CJBA 2V8DA 2E5GA 3GFXA 2A2CA 5CA5A 5HK4A 3VGVA 5KAKA 5IQ6A 4DL3A 4R0JA 2GO8A 3MD3A 2BBEA 4DFJA 4RNNA 4TQRA 1IR1A 1D9AA 5IFMA 2QL7B 3T5JA 4K50A 2D3O1 2UUAF 1SV5A 3IP0A 1KWMA 2ILYA 4PKDB 5AJ3F 1IBMF 4I67A 1NK6A 4CIOA 1PO6A 2QO3A 4K4SA 5L1IA 3VR1A 2RRBA 4DV4F 2ATCB 1T95A 3SIPB 3KHHA 1CJTB 3KLGB 5KFCA 1P1TA 3D6MB 3CSKA 1LW2A 3O5TB 5L38A 3L7OA 3M2UA 4HLBA 1TQLA 3EZUA 4DUYJ 4IH6A 2KFZA 2ZE2B 1QTMA 4WFAQ 3N28A 1HW8A 4MJKA 1NSQA 3HHLB 1RU1A 3DXBA 1QVFR 2G1HA 1CJVB 3ZZ0A 4JP8A 4WFZA 5K20B 2J6SA 1Q8IA 1O6XA 1YG0A 4HT5A 5J2MB 3CPWR 1U1QA 1VQKS 4DPTA 5KFJA 2WW8A 2EXUA 3PW2A 4NYOA 4O4GA 2DRAA 3SCIE 1EARA 1MMLA 2LQ9A 5KFGA 2HMIB 2CJKA 3B4MA 1WOOA 2ROEA 4W98A 3SDEA 2R2RA 3OBIA 5D4PA 2DBBA 3EVWA 1HNVB 4YDDB 2DHXA 1HBNA 3KKFA 4OHWA 3DLJA 1X0FA 5IZHA 2OPQB 3THTA 4DV3F 1Q86T 1NJIT 2WZ1A 1RP5A 1TKXA 3G6ES 3X1LB 3BJYA 1VDHA 2DNQA 1YGYA 5JVHQ 3ZFVA 4AL7A 1TL7A 2NUUG 3CVKA 4JI3J 3TI0A 4O0NA 4XPEA 2DNOA 2ZJPQ 3UW1A 4YR3A 4PR6A 4LBPA 2SXLA 4DQSA 4J91A 4OMFG 1IBKJ 2FVPA 2MQNA 4ZPTR 2L9WA 1TAUA 4ED2A 4QYZK 2RDDA 2HHTA 3BH6B 3HHNB 3RAXA 2IVFB 1LW2B 2CQDA 4U95A 2LQJA 2HWHA 3MOJB 3M2UB 4PABA 1BMQB 4IYQA 1U0HA 3H2VE 5J1NA 2KHCA 2QX0A 3C14A 5EGYA 1YHQS 4TU9A 1VQLS 4JI7J 3ZZZA 3FKBA 2XLIA 3HHLC 4NLQA 5E3CA 3LP0A 3AXKA 1KTVA 2AF6A 3QIDA 1M5SA 1JXLA 1S49A 2MKSA 5HQMA 1CC8A 1KQFB 3H5SA 4DV1J 1WEYA 3PR5B 3VGTA 1PSDA 1SIZA 5F8JA 5KFLA 1Q79A 4B3MF 1NO8A 2EKYA 1CJUB 3M2VA 4JUZA 4O4GB 1V5VA 3UPFA 1S0MA 1TUVA 2BV3A 1F3VA 5E3AA 3OQ2A 1EHWA 3CNQP 2CZVC 1K9MT 3EJMA 3DOLA 2HHUA 3MR5A 3MCOA 1TL3A 5EX0A 3SDEB 7AT1B 2Z56B 3UQSA 4WP9A 2QL5B 3DLLQ 1HBNB 5B0EA 3DI6A 1SC6A 4Q45A 2R7QA 1OY8A 1S76D 3VCDA 2YKQA 1M5KC 2XQCA 3AJ1A 2M8DB 1TKXB 4B9VA 2FD2A 1RHRB 1D8ZA 3IXQA 2WCXA 2CQ1A 2LEBA 4WKYA 1Q8KA 5AXLA 1S1TA 1DJ0A 1KVKA 3PJWA 4TYBA 2BVZA 3S6EA 4NLDA 3T1YJ 3T5KA 3CJ8A 2D69A 1UEUA 4FF2A 2QG9B 1NK5A 1WEZA 1DHMA 1WF2A 1RAOA 4DUYF 2DGXA 3TP2A 4A8FA 3D66A 3QSYB 4GVLA 2ZITA 1K47A 2K7JA 4Y00A 3VQTA 3TWZA 2COLA 3TAMA 4OZJA 3BR8A 3AFGA 1U0HB 4DR4J 1YRTA 2V4JA 4UOFA 2EWHA 1N5VA 1AA1B 3ZTPA 1U8SA 1LWXA 2A10A 1YJWS 2IM3A 3HPOA 4OYXA 1UA0A 4B9SA 3J81j 3LP0B 1FERA 4MT1A 3A8EA 3D3BJ 3MF5A 1V3SA 8RUCA 3D54A 3NGDA 2EFVA 2JX2A 5ETMA 3G8TA 2GQ2A 3DRSA 1XQIA 3RBXA 3M2VB 1WSVA 3IC1A 4NEZA 1OYDA 3KK2A 1SB6A 4C97A 1EETA 1NBEB 3EGNA 4AE5A 2OFGX 1TL3B 3TJ8A 2H4WB 3NCQA 1YJVA 4LF1A 2FJDB 4OYMA 3BS9A 2X1BA 4IOCQ 3I55S 1N36F 1PJ7A 4DQRA 3GIMA 4PAAA 1FVSA 4JI3F 2KO1A 2YKAA 4F67A 1TK0A 2D3OR 2OJ3A 2M5YA 3X3UA 3H7HB 3RU0A 1IBKF 4MAKA 2YQ3A 2YNIA 1S1TB 2UUTA 4USWA 2I1RA 5JVGQ 3G82B 4DS4A 1KOOA 4DFKA 4F4KA 1N34J 4IOAQ 4DPYA 2LP4A 3V6DA 1EQMA 1K1SA 2VD3A 2CXEA 2E9ZA 4X62F 1SJFA 4PZVA 3QYYA 3TA0A 2VBZA 5LXYA 3QSIA 2UZAA 1BXNA 2FJXA 3B6BA 3TAMB 2A0FB 2JSXA 4U6PA 3MTJA 2V4JB 4WFXA 4DCOB 4C0BA 1T9WA 4IOBA 5A76A 1FRIA 4ZPWR 2VBWA 2W4CA 1U6BA 1MROA 2BKOA 2XS2A 2NCKL 1RWOB 4C9DA 2MY8A 2DCLA 3FSIA 2AQ4A 2OPSA 4MYTA 1RA7A 2NYHA 2GMHA 3BGFA 2UV8A 1RHJB 4M5JA 3RYLA 1FWPA 1RUSA 4DR5F 2ACMA 3DRSB 1CJKA 2ZOGA 3AODA 4CLUA 2R8HA 2J9EA 2D3UA 4YN3B 2JEJA 1MN7A 3KK2B 3KLHA 3OTEA 1AB8A 1DQ9A 3CDWA 1YBAA 1EETB 4ER8A 3HZEA 4DLEA 4TY8A 4EO8A 5J2QA 4WZMA 5DDPC 3GJTB 4CDIA 1RLCL 2YKMA 1SCJB 3C6UA 3DLKA 2VF3A 5D8HB 1KD1T 3IGNA 2KDOA 4F0HA 2PN6A 3KUGA 2UUCJ 2BJ8A 3PYDA 3GP9A 4AQYF 3PXGa 2DEIA 1OPIA 2YNIB 2XS5A 3SCLE 2W2PP 3A1YG 1C1BA 4DPUA 4IO9Q 1QUPA 4J9LA 3CGIA 4OYAA 2DGVA 4ANEA 4CH1A 3N4WA 4U8YA 3MAAA 3G6XA 4C3MA 2DGOA 2LA6A 1RBLA 2VG7A 3BR9A 2R7RA 4F04B 3RBZA 1GXLA 1F3FA 2VICA 1RTDA 2FQQB 3QATA 2R7UA 3MEEA 4DR1J 3LH2S 4J9NA 2K3KA 4RU2A 3G87A 2KXFA 2ZH6A 4ZCLA 3PM9A 4LF9J 1LV5A 5KG3A 1AZSA 3T9NA 2DH7A 1CS4A 4A48A 2YNFA 4ECUA 1ZAWA 1ZA1B 1Y4ZB 3BO3A 2FUG9 4CT9A 1VQNS 1MROB 2RD5C 1RT6A 2KRBA 4WU3A 3EVMA 3UNYA 1HI8A 3A8IA 2OPSB 2J76E 2OPRA 3PRDA 3CJKA 1F60B 2HWTA 2QMWA 2Y9HA 2BACA 3D68A 4YHHJ 2ZUGA 4RUHA 2ZWOA 1CJKB 4F3MA 1U1KA 4LVOP 3RBEA 1Q7LB 4KRWA 5F8GA 1XTZA 3TR5A 4W90B 3QAEA 2KT2A 4MKAA 4P2SA 3G71S
chains in the Genus database with same CATH topology
2M8HA 3BEGB 4K59A 4TY8B 1KFDA 3OR2A 1KNZA 1CQMA 1KS2A 2AX0A 1X8DA 2BA9A 1LWCA 1NH7A 1RTIA 4WTYA 1DTQB 2G9OA 3MR2A 2Z8QA 3PNIA 3GR0A 2YKOA 3CJ5A 2QRRA 1HQEB 4NLTA 3M30A 3OL9A 2YKMB 3SXLA 4PXCA 2J7KA 4RW6A 1E6YA 5KFHA 3C6UB 3DLKB 2E1AA 3CCQS 2OIHA 1NZAA 7FDRA 2D41A 3PDNA 1DURA 4DFPA 1JJ2R 1X7VA 2IM1A 4K2XA 3VAJA 2DH9A 2DJWA 3I5CA 4OI0A 3IWLA 2HHXA 2RKIA 3KK3B 4PG4A 2RSQA 2A3JA 2AYEA 1S1WB 2B5JB 3SSSA 4RW8A 4F4ZA 2R2TA 5BYRA 1NEEA 5THWA 5KFUA 4ERDA 5CYJA 3OVSA 3NG8A 5KTQA 1VI7A 2DNNA 3LGMA 3LP1A 4KC5A 1WD6A 2KYZA 4LQ9A 1FRHA 2CQ4A 1TKZA 4YB5A 2XB2D 5F8NA 1ZM2A 3OL7A 4OQJA 4NCGA 2FC8A 3IBWA 1U26A 2C3MA 4ZP8A 2LA4A 2HVIA 3M1VB 2W25A 3NAHA 1HWJA 3GYNA 4BHQA 2OD4A 5C24A 1C1BB 1V6HA 1QE1B 2JFDA 3CIZA 1YJ9S 2M7SA 3BGRA 2XBPA 4QIFA 5J2NA 3W7BA 3CMES 4DG1B 1NK4A 3I0SA 4G1QB 2MQOA 4N8OA 4H4OB 2XMMA 4WXOA 1JKHA 3IR6B 2XMVA 2E1CA 1E6VB 2YNHB 1RT3B 2D9OA 3PV8A 2XI2A 3DRPA 1P1LA 1BQXA 2I2YA 2AYGA 1S9FA 4LF4F 5KFQA 4X4TA 2VG7B 3FEXB 5LJ5Y 2WSCC 3BF4A 3KYLA 1X4FA 2ASJA 4O3OA 1U1MA 4C0OC 1T05B 1XMQF 1HQUA 2LCWA 3IAM9 4UQTA 3J7A1 3N6MA 4RW4A 1GXUA 2DITA 1JLCB 2WBMA 5CQGA 4KHPF 3MEEB 2VG5B 1LOUA 5DM7Q 2P5VA 3RZAA 2MSSA 1QSYA 1S77D 1R43A 5AE2A 5HMXA 1KSPA 4ZPVR 2KG1A 3GR1A 2HNDB 1WI6A 2HAIA 5EHHA 2DRBA 1A7GE 2K2PA 3W2WB 4H4KA 2MZRA 3CJ4A 3LOUA 4I2QA 1UJ5A 5B0FA 2BR0A 1J2VA 2GJ2A 4QIEA 1YRXA 2FJVA 2JOQA 1U6FA 1KTQA 3NL0A 4HDGA 3KLFB 5LSLA 1KVIA 3SV4A 2N3LA 2VKZG 1N6QA 1JWWA 4ED7A 3T1HF 2KZZA 3QGIA 4ED1A 1X9SA 2BRKA 2XLJA 3SI8A 4B9LA 1VLYA 1BQNA 3P5TL 1RISA 3V6JA 4WK3A 1JJ4A 2YNFB 1HWIA 1P27B 2HFOA 5BYSA 2ASDA 2FVRA 3OVAA 4RW9A 3NMAA 1GX5A 1I94F 2XS7A 2IRYA 3HF5A 5DDOC 3DLEA 5K14A 4HHJA 4TY9A 4YB7A 1VQ8S 4NXMF 3BB5A 3D0IE 3BSCA 4OX6A 2DNPA 4PQUB 2OMLA 3MOZA 1RT6B 5CZXA 1L3KA 1I1GA 4TYAA 4WFYA 4XK8C 3TVZA 2CQHA 1S48A 3HHKA 4EYHB 2FVQA 2D1CA 5I42A 2IYGA 4ZVEA 3D1HA 2KFYA 2OPRB 4N56A 4JV2A 3CJKB 1TAQA 4RWWA 4M94A 4KKOB 4N5SA 3CF5Q 4NA1A 5F8MA 3T19A 2J0SD 1P8GA 3DRYA 4PQAA 1FK9A 3LPYA 2Y0SD 2PDAA 5GAEI 2XY5A 3ISNC 3MEGB 4ECTA 1FE4A 1GTEA 4O3NA 4A8XA 2JEFA 3SCKE 2R8GA 5K8PA 3ITHB 4K4TA 1K1QA 3CWJA 1Q7YT 1DFDA 2W9CA 3GIKA 4IH5A 5GAHU 2O66A 1LW0B 4AUKA 4OJ1A 1C0UA 2DHSA 1UJ4A 1Q81T 3OSPA 4TN2A 4DSIA 4JBCA 1D9FA 5CD4H 3IRXA 4DPOA 4RU9A 1HD0A 3B8HA 3HFKA 1N5QA 2M9KA 4ECYA 3WDOA 1QAIA 4OHYA 1KVJA 3MGJA 2PO4A 1U09A 5LT5A 1S97A 1ZM9A 3PIPQ 3G9CA 1ZYQA 3TRGA 4DQIA 3OR2B 4KSEB 5F3TA 2FJAB 1LWCB 2AW0A 2A18A 3RW7A 2RQCA 1U1RA 3DMJA 3M32A 1RTIB 5DG8A 3IR7B 2E44A 2KG0A 1V3ZA 2GMJA 1WI8A 3ISND 4DR2F 3MEKA 5FLXY 2Q66A 3M30B 1SL2A 3TQ1A 4EUVA 3E8OA 2N3OA 1IKVA 2DO4A 1XR6A 1E6YB 2J6TA 4ED5A 4YEAA 3ZZYA 3MFHA 2W9AA 4J9SA 4FP9A 3PEJA 1FJEB 5F0WA 2OD6A 4J5OA 3C2PA 4MK8A 3AHPA 4OLOA 1CSJA 2KVIA 2RKIB 3TOQA 2Q6CA 4B3TF 5KG0A 1OQ6A 1A6LA 4FNHA 4AXIA 1Y3KA 4K4ZA 4MIAA 3U7JA 1Y9OA 2VA3A 4HI2A 1M90T 5LMNF 3VQSA 3N0VA 5F9LA 1S6QA 3EPGA 3NMRA 1X9WA 1O51A 2PIIA 1TKZB 1VK8A 5GADI 2XCAA 5I3UA 2PGCA 5CZVA 2QEXS 2L48A 4NCGB 4O44A 3CC7S 1TZ0A 4EZ9A 1IXKA 4RBVA 1SUQA 3M4XA 3OVBA 5C24B 3QJJA 2H5EA 5HQ8A 5KFKA 1FD8A 3PFEA 3TVKA 3BGRB 3M8SA 2CDQA 3E51A 4Z2XA 1YRUA 5J2NB 4DR1F 3RRHA 2B4VA 3I0SB 2DR5A 4RW7A 1D8YA 3H98A 1LKZA 2UXDF 3BN4A 2B7CB 1JKHB 2RIJA 4B17A 1B0VA 4MTPA 4LSLA 5JXSA 2GHWA 3M05A 2MGZA 3M9MB 4M1KA 3DRPB 4X4NA 4Z37A 1D3WA 1RKIA 3BDPA 4RZRA 3H2LA 2DB1A 1X5SA 1JLGA 1RT2A 1FRJA 1J5OA 1HQUB 1NU4A 2HGNA 1FDNA 3OHAA 4JI5F 4RW4B 3CCRS 1RGVA 1WHXA 1U4BA 3MCSA 1BD6A 4ETZA 3AAWB 2W8LA 4NLYA 1RJJA 1FKPA 3K5PA 2AGOA 5B0DA 1SKRA 3P49B 1VC6A 1A9NB 4DV0F 1VBZA 2FHOB 2VFVA 4M95A 3OL8A 2E1RA 4CO0A 2WAQD 3CCVS 1REVA 1UAWA 1RQ0A 1R8CA 1DBDA 3MWBA 2JL9A 4ZKAA 2PA3A 3M8PB 2Z2MA 1S79A 4MK9A 2L3MA 4I2QB 4EU0A 3CCMS 4HDHA 3PO5A 2RVJA 1KN6A 2I9SA 2AGPA 3N9UC 4GO7X 2RRNA 3G6YA 4Y3CA 3V6KA 1O5JA 2YWFA 1VQ7S 3MZIA 4CI0B 2JJ4D 3WX4A 3I9ZA 3F44A 4ZPCA 4DL7A 2CYYA 1GX6A 2OKQA 2VPYB 5J1EA 1AFJA 3OL6A 1K0VA 2HIQA 2UUWA 2E5JA 2M0GB 3DU6A 2I5JA 4FS1A 1LQ9A 2D3ZA 4RW9B 1R8PA 4K5RA 3PW7A 2IBKA 2XULA 2I0XA 4KPYA 2E9TA 5A8RB 3DLEB 3Q2TC 1WF0A 4BDPA 5J2PA 4K4UA 2MKJA 4YHHF 5EUHA 2HHHF 2M4MA 3OTDA 2M52A 1JJHA 2EBGA 2BABA 4I68A 1BWEA 2W7AA 3FJ2A 3DHWC 5DQIA 2QA1A 3MHYA 5A8WA 4DQQA 3UNGC 1RYSA 2Y1IA 5DJBA 3QO9A 2V94A 5I42B 1FJ7A 2CFXA 2APOA 2MKCA 3RAMA 1OO0B 2HS4A 1ZPWX 1UJ6A 2XMKA 4PWDA 4KGMA 2NZ4A 5C25B 2GW8A 2VV5A 4LJMA 2B4OA 1JLEB 5E7OB 1CPZA 3D28A 2PI4A 1FK9B 1ZPVA 2VC0A 3BDEA 4YDXA 1S10A 4KHMA 3D2WA 2ZKUA 2ZFHA 2JC0A 3J80Y 1NK8A 3TAQA 2K1RA 2YX7A 1R8AA 1KLMB 4QU6A 3B78A 2YWGA 2E9RX 3AB2B 2W9CB 1RT5A 1NAQA 1KC8T 2IBOA 5FD1A 1XK8A 2PA8D 1SBRA 1DTTA 1C0UB 1WG1A 4ALZA 4JV0A 2ZM6F 4BWJA 3FNNA 2W4PA 2Z2LA 5KFOA 1RTJA 2Q3PA 4DL6A 2VONA 2R7XA 4KFBA 2LLZA 3IRXB 3ULHA 1RTHA 1KRPA 5DRKA 4UUWA 4QOTA 4W92B 1N5YB 2WBRA 3LO3A 1XMBA 2M70A 4DHVA 5SZTA 5IT4A 1SJ3P 3NKYA 5KFDA 2ZBCA 2IM0A 3GSDA 4J9OA 2VFUA 2NQPA 3SSRA 3I5BA 4PPZA 4QJVA 1F2GA 3CD0A 1TFYA 2W9BA 3UCUP 3SMZA 3CB4A 1BY9A 2ZJRQ 2IMOA 3HX9A 4FYDA 1TL1A 3DMJB 4A4JA 3M32B 2NXUA 4TLRA 2C2DA 2HWIA 5DLFA 2B3TB 1AXQA 2JFKA 2WB4A 2J8AA 1IN0A 1FKOA 3KOAA 4RX6A 5BJRA 1IKVB 2CPIA 2GGPB 4O3QA 1HYSA 4J9MA 5E5NA 3IWNC 1KOHA 3CDBA 4ECXA 1SQEA 2B7BB 4MFBB 1VQ5S 1AROP 4KAIA 1H2UX 3QAUA 5IT0A 2AJ0A 2FJEB 3GQCA 4QWDA 3SV3A 1HR0F 3Q0AA 2ATLA 2MQLA 4RNOA 2BZ2A 2KHDA 1QVGR 4ES2A 4LIWA 4K4YA 3KG0A 4BCAA 1NJXA 1HD1A 3SFGA 4JV1A 4NLRA 2GNKA 3RTVA 1NRKA 1NKCA 4QCLA 4FPRA 1S6QB 1Y3JA 2YVSA 2XHWA 2GO9A 4GMKA 5DS7A 2HFZA 3MM8B 2UVRA 2EK1A 2RNEA 4EGLA 1Y5IB 2IA6A 4OX7A 4CO1A 1XNRF 5I3UB 3JB9k 2R7TA 4JI6F 1VRTB 4O44B 4CTAA 2UXBF 1BC6A 5F8LA 2AGQA 1SUQB 1QJHA 5H9EJ 3T9ZA 3BGUA 4XDCA 1FCAA 4LF7F 4J9RA 1DTQA 3I31A 5E3PA 3HLUA 4ID5B 3K59A 4C8MA 4URGA 1FNXH 1HARA 2C3YA 5EWFA 4FBTA 2BDPA 5DO2A 4NA3A 4RW7B 1JMTA 4N47A 3CE8A 2RILA 4WE1A 3U1NA 4LSLB 3OW2R 2Q43A 4RUCA 1T03A 2ZOFA 2IA0A 2MGZB 3JTNA 1U25A 1X4BA 1S1XA 1SL0A 5H9FJ 1N4LA 2RDJA 3RR7A 2GCFA 3K57A 3TA1A 2VBYA 5CXTA 4FXDA 1JLGB 1RT2B 1YJRA 1UFWA 1UMJA 3VF0B 1J5OB 3FQLA 3SCJE 4YB1P 2UVUA 1N32F 3LALA 2VOPA 2MY7A 1H7WA 3MR6A 3I5AA 2OAUA 3VALA 1VK3A 1KLNA 1VC5A 1EP4B 3J7YI 1FKPB 4O4RA 2IVMA 4NLVA 2ADBA 2LECA 4NRUA 1S72S 4ECSA 2QYCA 2F9DA 4H4KC 3M2RA 3MUMP 2HW3A 2CJ9A 1REVB 2CPFA 1L3SA 1HPZA 1FRKA 1H38A 2FY1A 4ELVA 1WELA 1H2TZ 1UP1A 2UXCF 1YWXA 3H8YA 2O01C 3Q23A 4ECVA 2PC6A 2F9JA 4QU7A 2FB0A 3NBPA 4M5DA 2XCPA 3KLEA 1NJYA 2B51A 3M9NB 2IM2A 2O67A 3S01A 1KQSR 1FD2A 2DVIA 2AD9A 1SJ4P 4FVMA 1GH8A 1S6UA 2VUGA 3D0HE 5J1EB 4A8WA 4QIGA 3I56S 1UVNA 4MH8A 3DDNA 2I5JB 3HVTA 5CYMA 3GIJA 1SJQA 1E6VA 2FTRA 3N79A 3K58A 3DLGA 1YVFA 2EW9A 4DSEA 1NKBA 1T94A 2JH3A 1HFEL 1UEVA 4LVNP 4O23A 2JHEA 1FEEA 2RF2A 4I2PA 4HYKA 5AXNA 4I7FA 5J2PB 4NA2A 4QWAA 1ZZFA 3OJUA 3AB4B 3RB0A 1FXRA 2LYVA 4OI1A 1WHVA 4DR6F 2JDJA 2O3DA 4PRFA 1TL4A 2GQCA 2X3GA 3G8SA 2XLKA 5A8WB 4C3KA 5KT2A 4Y0FA 1C2PA 5DGBA 2MPUA 1PC5A 3QO9B 4Q7AA 1H7XA 2RDIA 4DR3F 1VRUA 3G4SS 3VZIA 3KJVA 2VOOA 4PWDB 1C1CA 2VPXB 1HBUA 2MZJA 2EK6A 2JVRA 2WRMA 1DLOA 5AXMA 1K8AT 2DHGA 5F9NA 3CDEA 2YKPA 5DETA 3JTOA 2N82B 2DIUA 4KR0B 1TK5A 4PXBA 4M8LA 2C22A 1FESA 1OQ3A 2FPHX 3NWGA 4ZCKA 4B3SF 1TFWA 2GV1A 2K1RB 5FJ4A 4LF6F 1FE0A 2ZC3A 4RKUC 5IS2A 4ED6A 4KGKA 1SV5B 4OIXA 4LF5F 5MLCV 5B08A 1DTTB 5F0UA 3SQGA 2DIVA 4CH0S 1AFIA 4OJHA 4ZVHA 3HVAA 3LAMA 3UD4P 1RTJB 4TXSA 5KFYA 4J9PA 4KFBB 4ZOSA 4LFCF 1RTHB 3W2VA 2FGOA 4HTJA 3V2UC 3BQ1A 3UD3P 1J5EF 3OHBA 3PKMA 1U1PA 2RT3A 4WF9Q 3KK1A 3U1MA 3C3LA 4NMLA 2HNZA 5K9FA 1LWEA 1NK0A 2CRLA 2YX4A 2W9BB 2ZH7A 1RK8A 4B3RF 2NPIA 4KKOA 5KFBA 3IFEA 1Z4UA 2BQRA 4PG8A 4EWTA 1P6TA 4J9QA 2W24A 1TV6B 3NNHA 3K8WA 1Z1ZA 3S8SA 2FLNA 2MYFA 5KT6A 2EC0A 2KN4A 3JSRA 4Y6IA 4QW9A 2QE5A 4PG5A 1FKOB 3SFUA 3KTQA 4A8KA 1HA1A 3MEGA 2G0CA 2LXIA 4DSLA 2K7KA 5L1JA 3PX6A 1U47A 1Q8BA 3D1QA 1HYSB 1ULRA 2K3IA 4C8OA 1VS3A 1LFWA 4A8MP 4X84A 3K2YA 5CHCB 4OX9F 4O3SA 1WHWA 1IUJA 5KFAA 2KTQA 1W2BR 3U27A 1WEXA 2QMXA 3MMBA 3JTPA 3QZ7A 3HVRA 2W8KA 1IQTA 2F8MA 3K5NA 4USHA 1PGZA 3DC2A 1OSDA 4F26A 1FA0A 2EVZA 2BE2A 4N76A 4F3QA 5L9NA 2B6AA 4WYWA 2C28A 1WTFA 3CD7A 2E5IA 2J5AA 2KB2A 3RRGA 2FDNA 2IMWP 4ZVGA 3U02A 2DO0A 4XPCA 1VIOA 1W2IA 4CTAB 4OHZA 4Q44A 1SIWB 1FTCA 4BWMA 4ZK7M 4I4BA 3R5AA 2PI5A 4DLGA 2DNKA 4WIIA 1U1NA 4ZCIA 4X65F 5KT4A 2FIUA 2R4FA 1QSSA 2DNGA 1Y7PA 2QLWA 3D1OA 4C98A 4X4SA 4H54A 3KHLA 4CNYA 2VH7A 4QWEA 2EFNA 1LXNA 1X5PA 4DN9A 2L9DA 2E66A 3MFIA 3VAMA 3V81A 4WE1B 2KKHA 3AA8A 3THPA 4HI1A 1T03B 1X4DA 5LMUF 1S1XB 2J0QD 2HYIB 1NK7A 2BJEA 2H9ZA 2DD8S 4CO4A 4NLUA 3BQ2A 1U48A 4GKJF 2JC1A 5KT5A 1MU2A 3EGWB 4HTIA 2GQQA 1MMNA 4YR2A 4OI3A 4ZP7A 4MIWA 2VFSA 3NS6A 4L3NA 2FLLA 1KONA 3CUNA 1U24A 3RW6A 4ED0A 4MKBA 1ZETA 3R5DA 3IN5A 4IRKA 4L6V3 3CC2S 4UQGA 4IFVA 1N5TA 1B64A 3M2RB 5KOXA 3BSOA 4Y28C 3CCWA 4I56A 1HPZB 1JIHA