3JSUA

Quadruple mutant(n51i+c59r+s108n+i164l) plasmodium falciparum dihydrofolate reductase-thymidylate synthase(pfdhfr-ts) complexed with qn254, nadph, and dump
Total Genus 177
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
177
sequence length
606
structure length
545
Chain Sequence
MMEQVCDVFDIYAICACCKVESKNEGKKNEVFNNYTFRGLGNKGVLPWKCISLDMKYFRAVTTYVNESKYEKLKYKRCKYLNKETKKLQNVVVMGRTNWESIPKKFKPLSNRINVILSRTLKKEDFDEDVYIINKVEDLIVLLGKLNYYKCFILGGSVVYQEFLEKKLIKKIYFTRINSTYECDVFFPEINENEYQIISVSDVYTSNNTTLDFIIYKKTNNDDEEEDDFVYFNFNKEKEEKNKNSIHPNDFQIYNSLKYKYHPEYQYLNIIYDIMMNGNKQSDRTGVGVLSKFGYIMKFDLSQYFPLLTTKKLFLRGIIEELLWFIRGETNGNTLLNKNVRIWEANGTREFLDNRKLFHREVNDLGPIYGFQWRHFGAEYTNMYDNYENKGVDQLKNIINLIKNDPTSRRILLCAWNVKDLDQMALPPCHILCQFYVFDGKLSCIMYQRSCDLGLGVPFNIASYSIFTHMIAQVCNLQPAQFIHVLGNAHVYNNHIDSLKIQLNRIPYPFPTLKLNPDIKNIEDFTISDFTIQNYVHHEKISMDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Preclinical evaluation of the antifolate QN254, 5-chloro- N'6'-(2,5-dimethoxy-benzyl)-quinazoline-2,4,6-triamine, as an antimalarial drug candidate
pubmed doi rcsb
molecule keywords Dihydrofolate reductase-thymidylate synthase
molecule tags Oxidoreductase, transferase
source organism Plasmodium falciparum
total genus 177
structure length 545
sequence length 606
chains with identical sequence B
ec nomenclature ec 1.5.1.3: Dihydrofolate reductase.
pdb deposition date 2009-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00186 DHFR_1 Dihydrofolate reductase
A PF00303 Thymidylat_synt Thymidylate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.572.10 Alpha Beta 2-Layer Sandwich Thymidylate Synthase; Chain A Thymidylate synthase/dCMP hydroxymethylase domain 3jsuA03
3.40.430.10 Alpha Beta 3-Layer(aba) Sandwich Dihydrofolate Reductase, subunit A Dihydrofolate Reductase, subunit A 3jsuA01
1PD8A 3FY8X 4M6KA 4KJJA 1NCEA 3IK0A 1TSDA 3B5BA 3SRSX 5ECXA 5HT5A 4GH8A 1E26A 3M08A 4NX7A 1AN5A 3EDWX 3FRAX 1TVWA 3SR5X 1DYIA 3Q1HA 2ZZAA 4KL9A 1DDUA 1RA2A 3BYXA 3ZPGA 6DFRA 3QLYA 3DGAA 2AZNA 3QLRA 1SEJA 1RX5A 3JWFA 4P3QA 1TYSA 1JUTA 2W3WA 4HOGA 1LCAA 1TSYA 2RD8A 3L3RA 1YPVA 4HOEA 5HT4A 4DFRA 2BBQA 1DG5A 5ECCA 1BO8A 5HPBA 3SRUX 5J7WA 3RG9A 5DXVA 1TSVA 2JYBA 1J3KA 1OHKA 4KY8A 3FQVA 1EVFA 5U27A 1BDUA 1DYHA 4KLXA 2G8XA 1BO7A 1F4DA 3KJRA 3QJ7A 3JWKA 2TSCA 3EBUA 2HM9A 3EGYX 1JMGA 3DAUA 1YHOA 2CIGA 2L28A 5JG0X 1DDSA 3GHWA 1VZBA 3EHIX 1DISA 1VZDA 1JUVA 1B5EA 1KLKA 3FRFX 4XSDA 3UM6A 1PDBA 1M7AA 3S9UA 2VF0A 1DLSA 1RE7A 3NU0A 1DR4A 5HSRA 5HVBA 3BFIA 2XW7A 2TDDA 4H1IA 3F0XX 3NZ6X 5HVEA 2CD2A 4XSCA 7DFRA 4KJLA 1JTUA 1JG0A 3FYVX 3NXYA 3F0QX 2RD8B 4I13A 3CL9A 1BKPA 3SRWX 1BKOA 3EJLA 3BHLA 2BLAA 4EINA 1IA1A 1BJGA 4G95A 1RH3A 3IX6A 3EELA 4FGGA 2ITHA 3QG2A 4M2XA 3IRMA 4KD7A 3IROA 1CD2A 3NZDA 1NJCA 4ELHA 4PSSA 2A9WA 3F0VX 2FZHA 1J3JC 3F0SX 3NXTA 1VDRA 1DF7A 4KM2A 4Q67A 5BY6A 1NJEA 1THYA 1TJSA 3DL5A 4X5HA 3JTWA 4KNEA 4PSTA 2BLBA 1DR1A 3K74A 4QLEA 1NJAA 3INVA 3EEJA 4ISKA 4H96A 4ELEA 4XT4A 1B49A 4FOXA 1ZPRA 1TSNA 1TVVA 3EEMA 3EF9A 1DHIA 1J3IA 1TSLA 4DPDA 3ZPCA 1TDRA 4XRBA 2FTQA 3K2HA 1AJMA 1TDBA 1DR2A 4UP1A 1TDAA 1KZJA 1J3JA 3IA5A 3M09A 1RG7A 4EIZA 1B02A 4KY4A 3DFRA 3F8YA 1S3VA 1BSFA 1CZ3A 1DYJA 3FY9X 4FOGA 2G8DA 4Q0DA 2H2QA 1DR3A 1J3KC 3NZ9X 1TLCA 2B3ZA 3GI2A 1DHFA 5FCTA 4DP3A 3NRRA 3CD2A 5HSUA 2W9GA 3HB8A 3GG5A 3I8AX 4XT7A 1RTSA 1RX8A 3CLBA 5HQZA 1F4CA 3D80A 4PTJA 4F2VA 3IJZA 3UM5A 4X5GA 5HF0X 2ANOA 4FHBA 3FQZA 1KMVA 4GEVA 3R33A 4KBNA 2FZJA 1TSZA 3FL9A 1S3WA 1JMFA 3K45A 3GH2X 4KJKA 3SAIA 3V8HA 1RX9A 3FRDX 1IA4A 1DLRA 2VETA 2KCEA 2W9TA 3QLSA 1DRAA 2ONBA 3ED7A 1RB2A 4G6WX 3UM8A 3F0UX 1JUJA 1IA3A 5E8QA 3C06A 3SRRX 1TSXA 2G6VA 4LAEX 4H95A 3VCOA 1MVTA 3K47A 3KFYA 3NZAX 1LY4A 1NJBA 1DRFA 3QGTA 2W3VA 1BZFA 1HFQA 3FL8A 3SA2A 4X5FA 3TMSA 4FGHA 4IXFX 3QLXA 3FS6A 2FZIA 4CD2A 1RX3A 1S3YA 1QZFA 3NXOA 4QJCA 1JMIA 5FDAA 1DHJA 4ISWA 1ZDRA 4G3MA 4KYAA 3QLWA 4XECX 4XSEA 3ROAA 4PDJA 1LCBA 1LUDA 3FREX 4HOFA 5HUIA 4HA7A 4HA9A 3TQBA 3BHRA 4RGCA 2AAZA 1TVUA 2O7PA 1DRBA 1F4EA 2FTNA 3KGYA 2W3BA 4KFJA 3F8ZA 3NXVA 5HQYA 2D5NA 4M7VA 1HFPA 4EB4A 3OCHA 1J3IC 3SQYX 4XT5A 3SRQX 3SH2A 1AI9A 3BZ0A 1TRGA 3JW5A 4M6LA 1DYRA 4ECKA 4E28A 1HZWA 5HF2X 4O1XD 4ELGA 3DG8A 1DNAA 4O1XA 1F28A 4P66A 4XT8A 4IRRA 3IX9A 1D1GA 1JTQA 4LAHX 1BP6A 1RD7A 3QL0A 4PTHA 3C0AA 1BPJA 4FQSA 1KMSA 3HJ3A 3QYOA 1TISA 3CSEA 4LRRA 1BSPA 4JEFA 4H0UA 1U72A 4EZ8A 2G89A 4NX6A 4QLGA 4EJ1A 2G8AA 1LY3A 3JWCA 1BP0A 4P68A 4OR7A 3EIGA 4LEKX 4H0RA 3EAWX 4P3RA 3B9HA 1RA3A 4X5IA 1TLSA 1F4BA 3KJSA 3E0BA 1TSWA 2W9HA 1FWMA 3FQOA 2DRCA 1M78A 3F91A 4GD7A 3SGYA 1DDRA 2BLCA 4M7UA 4ELBA 3OB7A 1S3UA 1RX6A 1RC4A 3GHVA 4X5JA 1JOMA 1U71A 1F4FA 3S7AA 1QQQA 4H98A 4LAGX 1BQ2A 4Q0EA 5EAJA 3OAFA 1BOZA 1RA8A 1RA1A 2D0KA 2W3AA 3NTZA 2G86A 4IXED 1RX7A 1OHJA 1JMHA 4TU5X 4KM0A 5HI6A 3N5EA 3QYLA 4E5OA 3DL6A 1IA2A 3IK1A 4TMSA 4PSYA 1B5DA 1PD9A 1EVGA 4DDRA 1AIQA 5JA3A 1EV5A 1FFLA 4EILA 1RB3A 4XE6X 2INQA 2W3MA 2QK8A 3I3RA 2P4GA 5CC9A 3RO9A 3UWLA 3QFXA 3IRNA 3FQ0A 1TDUA 1DR6A 1JOLA 3IA4A 3NXRA 2FTOX 2C2SA 4QLFA 3SA1A 3QL3A 4PSGA 3NZCX 3EEKA 1I00A 2TDMA 3FYWX 3JW3A 2HQPA 1AOEA 2ANQA 4KNZA 1BIDA 1VJ3A 3FQCA 4KAKA 2RDAA 3DG8C 4EIGA 4QJZD 1HFRA 5H3AA 1DREA 1NJDA 1RX2A 3BGXA 3NXXA 1M79A 3JSUA 2TSRA 2DHFA 3KGBA 4O1UA 1U70A 8DFRA 1VZCA 1VZAA 1TSMA 1DG8A 1DRHA 1DR5A 1RX1A 3N5EB 5H39A 4G8ZX 1LCEA 2OBCA 3TQ9A 4H97A 2BL9A 1MVSA 2OIPA 4G2OX 2LF1A 4FOAA 3BNZA 5WRNA 3GYFA 3EX8A 1EV8A 3N0HA 1RF7A 4QI9A 2C2TA 3D84X 4O7UA 3F0BX 4DPHA 3UWLB 2HXVA 5DFRA 4Q6AA 3DATA 1HW4A 4DQ1A 5U26A 1DG7A 3FQFA 3LG4A 1KCEA 3NZBX 4IQBA 1AOBA 1HVYA 1KZIA 5CCCA 4M6JA 3JWMA 3H9KA 1F4GA 3N5GA 1AO8A 4GYHA 3TQAA 3HBBA 4OSGA 3JVXA 1HW3A 4KPWA 1TDCA 3IHIA 4QHVA 3S3VA 3TQ8A 4ELFA 4IXGX 2W9SA 1DIUA 3DRCA 4KEBA 3TD8A 1RA9A 3QLZA 3KY8A 4IQQA 5HS3A 1RX4A 1DR7A 1CI7A 3GHCA 4FGTA 4I1NA 3FRBX 3GH0A 1BQ1A 1SYNA 1DAJA 5H38A 3DGAC 4XT6A 2GD9A 2KGKA 1VZEA 1AXWA 1JU6A
chains in the Genus database with same CATH superfamily
1PD8A 3FY8X 4M6KA 4KJJA 1NCEA 3IK0A 1TSDA 3B5BA 3SRSX 5ECXA 5HT5A 4GH8A 1E26A 3M08A 4NX7A 1AN5A 3EDWX 3FRAX 1TVWA 3SR5X 1DYIA 3Q1HA 2ZZAA 4KL9A 1DDUA 1RA2A 3BYXA 3ZPGA 6DFRA 3QLYA 3DGAA 2AZNA 3QLRA 1SEJA 1RX5A 3JWFA 4P3QA 1TYSA 1JUTA 2W3WA 4HOGA 1LCAA 1TSYA 2RD8A 3L3RA 1YPVA 4HOEA 5HT4A 4DFRA 2BBQA 1DG5A 5ECCA 1BO8A 5HPBA 3SRUX 5J7WA 3RG9A 5DXVA 1TSVA 2JYBA 1J3KA 1OHKA 4KY8A 3FQVA 1EVFA 5U27A 1BDUA 1DYHA 4KLXA 2G8XA 1BO7A 1F4DA 3KJRA 3QJ7A 3JWKA 2TSCA 3EBUA 2HM9A 3EGYX 1JMGA 3DAUA 1YHOA 2CIGA 2L28A 5JG0X 1DDSA 3GHWA 1VZBA 3EHIX 1DISA 1VZDA 1JUVA 1B5EA 1KLKA 3FRFX 4XSDA 3UM6A 1PDBA 1M7AA 3S9UA 2VF0A 1DLSA 1RE7A 3NU0A 1DR4A 5HSRA 5HVBA 3BFIA 2XW7A 2TDDA 4H1IA 3F0XX 3NZ6X 5HVEA 2CD2A 4XSCA 7DFRA 4KJLA 1JTUA 1JG0A 3FYVX 3NXYA 3F0QX 2RD8B 4I13A 3CL9A 1BKPA 3SRWX 1BKOA 3EJLA 3BHLA 2BLAA 4EINA 1IA1A 1BJGA 4G95A 1RH3A 3IX6A 3EELA 4FGGA 2ITHA 3QG2A 4M2XA 3IRMA 4KD7A 3IROA 1CD2A 3NZDA 1NJCA 4ELHA 4PSSA 2A9WA 3F0VX 2FZHA 1J3JC 3F0SX 3NXTA 1VDRA 1DF7A 4KM2A 4Q67A 5BY6A 1NJEA 1THYA 1TJSA 3DL5A 4X5HA 3JTWA 4KNEA 4PSTA 2BLBA 1DR1A 3K74A 4QLEA 1NJAA 3INVA 3EEJA 4ISKA 4H96A 4ELEA 4XT4A 1B49A 4FOXA 1ZPRA 1TSNA 1TVVA 3EEMA 3EF9A 1DHIA 1J3IA 1TSLA 4DPDA 3ZPCA 1TDRA 4XRBA 2FTQA 3K2HA 1AJMA 1TDBA 1DR2A 4UP1A 1TDAA 1KZJA 1J3JA 3IA5A 3M09A 1RG7A 4EIZA 1B02A 4KY4A 3DFRA 3F8YA 1S3VA 1BSFA 1CZ3A 1DYJA 3FY9X 4FOGA 2G8DA 4Q0DA 2H2QA 1DR3A 1J3KC 3NZ9X 1TLCA 2B3ZA 3GI2A 1DHFA 5FCTA 4DP3A 3NRRA 3CD2A 5HSUA 2W9GA 3HB8A 3GG5A 3I8AX 4XT7A 1RTSA 1RX8A 3CLBA 5HQZA 1F4CA 3D80A 4PTJA 4F2VA 3IJZA 3UM5A 4X5GA 5HF0X 2ANOA 4FHBA 3FQZA 1KMVA 4GEVA 3R33A 4KBNA 2FZJA 1TSZA 3FL9A 1S3WA 1JMFA 3K45A 3GH2X 4KJKA 3SAIA 3V8HA 1RX9A 3FRDX 1IA4A 1DLRA 2VETA 2KCEA 2W9TA 3QLSA 1DRAA 2ONBA 3ED7A 1RB2A 4G6WX 3UM8A 3F0UX 1JUJA 1IA3A 5E8QA 3C06A 3SRRX 1TSXA 2G6VA 4LAEX 4H95A 3VCOA 1MVTA 3K47A 3KFYA 3NZAX 1LY4A 1NJBA 1DRFA 3QGTA 2W3VA 1BZFA 1HFQA 3FL8A 3SA2A 4X5FA 3TMSA 4FGHA 4IXFX 3QLXA 3FS6A 2FZIA 4CD2A 1RX3A 1S3YA 1QZFA 3NXOA 4QJCA 1JMIA 5FDAA 1DHJA 4ISWA 1ZDRA 4G3MA 4KYAA 3QLWA 4XECX 4XSEA 3ROAA 4PDJA 1LCBA 1LUDA 3FREX 4HOFA 5HUIA 4HA7A 4HA9A 3TQBA 3BHRA 4RGCA 2AAZA 1TVUA 2O7PA 1DRBA 1F4EA 2FTNA 3KGYA 2W3BA 4KFJA 3F8ZA 3NXVA 5HQYA 2D5NA 4M7VA 1HFPA 4EB4A 3OCHA 1J3IC 3SQYX 4XT5A 3SRQX 3SH2A 1AI9A 3BZ0A 1TRGA 3JW5A 4M6LA 1DYRA 4ECKA 4E28A 1HZWA 5HF2X 4O1XD 4ELGA 3DG8A 1DNAA 4O1XA 1F28A 4P66A 4XT8A 4IRRA 3IX9A 1D1GA 1JTQA 4LAHX 1BP6A 1RD7A 3QL0A 4PTHA 3C0AA 1BPJA 4FQSA 1KMSA 3HJ3A 3QYOA 1TISA 3CSEA 4LRRA 1BSPA 4JEFA 4H0UA 1U72A 4EZ8A 2G89A 4NX6A 4QLGA 4EJ1A 2G8AA 1LY3A 3JWCA 1BP0A 4P68A 4OR7A 3EIGA 4LEKX 4H0RA 3EAWX 4P3RA 3B9HA 1RA3A 4X5IA 1TLSA 1F4BA 3KJSA 3E0BA 1TSWA 2W9HA 1FWMA 3FQOA 2DRCA 1M78A 3F91A 4GD7A 3SGYA 1DDRA 2BLCA 4M7UA 4ELBA 3OB7A 1S3UA 1RX6A 1RC4A 3GHVA 4X5JA 1JOMA 1U71A 1F4FA 3S7AA 1QQQA 4H98A 4LAGX 1BQ2A 4Q0EA 5EAJA 3OAFA 1BOZA 1RA8A 1RA1A 2D0KA 2W3AA 3NTZA 2G86A 4IXED 1RX7A 1OHJA 1JMHA 4TU5X 4KM0A 5HI6A 3N5EA 3QYLA 4E5OA 3DL6A 1IA2A 3IK1A 4TMSA 4PSYA 1B5DA 1PD9A 1EVGA 4DDRA 1AIQA 5JA3A 1EV5A 1FFLA 4EILA 1RB3A 4XE6X 2INQA 2W3MA 2QK8A 3I3RA 2P4GA 5CC9A 3RO9A 3UWLA 3QFXA 3IRNA 3FQ0A 1TDUA 1DR6A 1JOLA 3IA4A 3NXRA 2FTOX 2C2SA 4QLFA 3SA1A 3QL3A 4PSGA 3NZCX 3EEKA 1I00A 2TDMA 3FYWX 3JW3A 2HQPA 1AOEA 2ANQA 4KNZA 1BIDA 1VJ3A 3FQCA 4KAKA 2RDAA 3DG8C 4EIGA 4QJZD 1HFRA 5H3AA 1DREA 1NJDA 1RX2A 3BGXA 3NXXA 1M79A 3JSUA 2TSRA 2DHFA 3KGBA 4O1UA 1U70A 8DFRA 1VZCA 1VZAA 1TSMA 1DG8A 1DRHA 1DR5A 1RX1A 3N5EB 5H39A 4G8ZX 1LCEA 2OBCA 3TQ9A 4H97A 2BL9A 1MVSA 2OIPA 4G2OX 2LF1A 4FOAA 3BNZA 5WRNA 3GYFA 3EX8A 1EV8A 3N0HA 1RF7A 4QI9A 2C2TA 3D84X 4O7UA 3F0BX 4DPHA 3UWLB 2HXVA 5DFRA 4Q6AA 3DATA 1HW4A 4DQ1A 5U26A 1DG7A 3FQFA 3LG4A 1KCEA 3NZBX 4IQBA 1AOBA 1HVYA 1KZIA 5CCCA 4M6JA 3JWMA 3H9KA 1F4GA 3N5GA 1AO8A 4GYHA 3TQAA 3HBBA 4OSGA 3JVXA 1HW3A 4KPWA 1TDCA 3IHIA 4QHVA 3S3VA 3TQ8A 4ELFA 4IXGX 2W9SA 1DIUA 3DRCA 4KEBA 3TD8A 1RA9A 3QLZA 3KY8A 4IQQA 5HS3A 1RX4A 1DR7A 1CI7A 3GHCA 4FGTA 4I1NA 3FRBX 3GH0A 1BQ1A 1SYNA 1DAJA 5H38A 3DGAC 4XT6A 2GD9A 2KGKA 1VZEA 1AXWA 1JU6A
chains in the Genus database with same CATH topology
1PD8A 3FY8X 4M6KA 4KJJA 1NCEA 3IK0A 1TSDA 3B5BA 3SRSX 5ECXA 5HT5A 4GH8A 1E26A 3M08A 4NX7A 1AN5A 3EDWX 3FRAX 1TVWA 3SR5X 1DYIA 3Q1HA 2ZZAA 4KL9A 1DDUA 1RA2A 3BYXA 3ZPGA 6DFRA 3QLYA 3DGAA 2AZNA 3QLRA 1SEJA 1RX5A 3JWFA 4P3QA 1TYSA 1JUTA 2W3WA 4HOGA 1LCAA 1TSYA 2RD8A 3L3RA 1YPVA 4HOEA 5HT4A 4DFRA 2BBQA 1DG5A 5ECCA 1BO8A 5HPBA 3SRUX 5J7WA 3RG9A 5DXVA 1TSVA 2JYBA 1J3KA 1OHKA 4KY8A 3FQVA 1EVFA 5U27A 1BDUA 1DYHA 4KLXA 2G8XA 1BO7A 1F4DA 3KJRA 3QJ7A 3JWKA 2TSCA 3EBUA 2HM9A 3EGYX 1JMGA 3DAUA 1YHOA 2CIGA 2L28A 5JG0X 1DDSA 3GHWA 1VZBA 3EHIX 1DISA 1VZDA 1JUVA 1B5EA 1KLKA 3FRFX 4XSDA 3UM6A 1PDBA 1M7AA 3S9UA 2VF0A 1DLSA 1RE7A 3NU0A 1DR4A 5HSRA 5HVBA 3BFIA 2XW7A 2TDDA 4H1IA 3F0XX 3NZ6X 5HVEA 2CD2A 4XSCA 7DFRA 4KJLA 1JTUA 1JG0A 3FYVX 3NXYA 3F0QX 2RD8B 4I13A 3CL9A 1BKPA 3SRWX 1BKOA 3EJLA 3BHLA 2BLAA 4EINA 1IA1A 1BJGA 4G95A 1RH3A 3IX6A 3EELA 4FGGA 2ITHA 3QG2A 4M2XA 3IRMA 4KD7A 3IROA 1CD2A 3NZDA 1NJCA 4ELHA 4PSSA 2A9WA 3F0VX 2FZHA 1J3JC 3F0SX 3NXTA 1VDRA 1DF7A 4KM2A 4Q67A 5BY6A 1NJEA 1THYA 1TJSA 3DL5A 4X5HA 3JTWA 4KNEA 4PSTA 2BLBA 1DR1A 3K74A 4QLEA 1NJAA 3INVA 3EEJA 4ISKA 4H96A 4ELEA 4XT4A 1B49A 4FOXA 1ZPRA 1TSNA 1TVVA 3EEMA 3EF9A 1DHIA 1J3IA 1TSLA 4DPDA 3ZPCA 1TDRA 4XRBA 2FTQA 3K2HA 1AJMA 1TDBA 1DR2A 4UP1A 1TDAA 1KZJA 1J3JA 3IA5A 3M09A 1RG7A 4EIZA 1B02A 4KY4A 3DFRA 3F8YA 1S3VA 1BSFA 1CZ3A 1DYJA 3FY9X 4FOGA 2G8DA 4Q0DA 2H2QA 1DR3A 1J3KC 3NZ9X 1TLCA 2B3ZA 3GI2A 1DHFA 5FCTA 4DP3A 3NRRA 3CD2A 5HSUA 2W9GA 3HB8A 3GG5A 3I8AX 4XT7A 1RTSA 1RX8A 3CLBA 5HQZA 1F4CA 3D80A 4PTJA 4F2VA 3IJZA 3UM5A 4X5GA 5HF0X 2ANOA 4FHBA 3FQZA 1KMVA 4GEVA 3R33A 4KBNA 2FZJA 1TSZA 3FL9A 1S3WA 1JMFA 3K45A 3GH2X 4KJKA 3SAIA 3V8HA 1RX9A 3FRDX 1IA4A 1DLRA 2VETA 2KCEA 2W9TA 3QLSA 1DRAA 2ONBA 3ED7A 1RB2A 4G6WX 3UM8A 3F0UX 1JUJA 1IA3A 5E8QA 3C06A 3SRRX 1TSXA 2G6VA 4LAEX 4H95A 3VCOA 1MVTA 3K47A 3KFYA 3NZAX 1LY4A 1NJBA 1DRFA 3QGTA 2W3VA 1BZFA 1HFQA 3FL8A 3SA2A 4X5FA 3TMSA 4FGHA 4IXFX 3QLXA 3FS6A 2FZIA 4CD2A 1RX3A 1S3YA 1QZFA 3NXOA 4QJCA 1JMIA 5FDAA 1DHJA 4ISWA 1ZDRA 4G3MA 4KYAA 3QLWA 4XECX 4XSEA 3ROAA 4PDJA 1LCBA 1LUDA 3FREX 4HOFA 5HUIA 4HA7A 4HA9A 3TQBA 3BHRA 4RGCA 2AAZA 1TVUA 2O7PA 1DRBA 1F4EA 2FTNA 3KGYA 2W3BA 4KFJA 3F8ZA 3NXVA 5HQYA 2D5NA 4M7VA 1HFPA 4EB4A 3OCHA 1J3IC 3SQYX 4XT5A 3SRQX 3SH2A 1AI9A 3BZ0A 1TRGA 3JW5A 4M6LA 1DYRA 4ECKA 4E28A 1HZWA 5HF2X 4O1XD 4ELGA 3DG8A 1DNAA 4O1XA 1F28A 4P66A 4XT8A 4IRRA 3IX9A 1D1GA 1JTQA 4LAHX 1BP6A 1RD7A 3QL0A 4PTHA 3C0AA 1BPJA 4FQSA 1KMSA 3HJ3A 3QYOA 1TISA 3CSEA 4LRRA 1BSPA 4JEFA 4H0UA 1U72A 4EZ8A 2G89A 4NX6A 4QLGA 4EJ1A 2G8AA 1LY3A 3JWCA 1BP0A 4P68A 4OR7A 3EIGA 4LEKX 4H0RA 3EAWX 4P3RA 3B9HA 1RA3A 4X5IA 1TLSA 1F4BA 3KJSA 3E0BA 1TSWA 2W9HA 1FWMA 3FQOA 2DRCA 1M78A 3F91A 4GD7A 3SGYA 1DDRA 2BLCA 4M7UA 4ELBA 3OB7A 1S3UA 1RX6A 1RC4A 3GHVA 4X5JA 1JOMA 1U71A 1F4FA 3S7AA 1QQQA 4H98A 4LAGX 1BQ2A 4Q0EA 5EAJA 3OAFA 1BOZA 1RA8A 1RA1A 2D0KA 2W3AA 3NTZA 2G86A 4IXED 1RX7A 1OHJA 1JMHA 4TU5X 4KM0A 5HI6A 3N5EA 3QYLA 4E5OA 3DL6A 1IA2A 3IK1A 4TMSA 4PSYA 1B5DA 1PD9A 1EVGA 4DDRA 1AIQA 5JA3A 1EV5A 1FFLA 4EILA 1RB3A 4XE6X 2INQA 2W3MA 2QK8A 3I3RA 2P4GA 5CC9A 3RO9A 3UWLA 3QFXA 3IRNA 3FQ0A 1TDUA 1DR6A 1JOLA 3IA4A 3NXRA 2FTOX 2C2SA 4QLFA 3SA1A 3QL3A 4PSGA 3NZCX 3EEKA 1I00A 2TDMA 3FYWX 3JW3A 2HQPA 1AOEA 2ANQA 4KNZA 1BIDA 1VJ3A 3FQCA 4KAKA 2RDAA 3DG8C 4EIGA 4QJZD 1HFRA 5H3AA 1DREA 1NJDA 1RX2A 3BGXA 3NXXA 1M79A 3JSUA 2TSRA 2DHFA 3KGBA 4O1UA 1U70A 8DFRA 1VZCA 1VZAA 1TSMA 1DG8A 1DRHA 1DR5A 1RX1A 3N5EB 5H39A 4G8ZX 1LCEA 2OBCA 3TQ9A 4H97A 2BL9A 1MVSA 2OIPA 4G2OX 2LF1A 4FOAA 3BNZA 5WRNA 3GYFA 3EX8A 1EV8A 3N0HA 1RF7A 4QI9A 2C2TA 3D84X 4O7UA 3F0BX 4DPHA 3UWLB 2HXVA 5DFRA 4Q6AA 3DATA 1HW4A 4DQ1A 5U26A 1DG7A 3FQFA 3LG4A 1KCEA 3NZBX 4IQBA 1AOBA 1HVYA 1KZIA 5CCCA 4M6JA 3JWMA 3H9KA 1F4GA 3N5GA 1AO8A 4GYHA 3TQAA 3HBBA 4OSGA 3JVXA 1HW3A 4KPWA 1TDCA 3IHIA 4QHVA 3S3VA 3TQ8A 4ELFA 4IXGX 2W9SA 1DIUA 3DRCA 4KEBA 3TD8A 1RA9A 3QLZA 3KY8A 4IQQA 5HS3A 1RX4A 1DR7A 1CI7A 3GHCA 4FGTA 4I1NA 3FRBX 3GH0A 1BQ1A 1SYNA 1DAJA 5H38A 3DGAC 4XT6A 2GD9A 2KGKA 1VZEA 1AXWA 1JU6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PD8 A;  3FY8 X;  4M6K A;  4KJJ A;  1NCE A;  3IK0 A;  1TSD A;  3B5B A;  3SRS X;  5ECX A;  5HT5 A;  4GH8 A;  1E26 A;  3M08 A;  4NX7 A;  1AN5 A;  3EDW X;  3FRA X;  1TVW A;  3SR5 X;  1DYI A;  3Q1H A;  2ZZA A;  4KL9 A;  1DDU A;  1RA2 A;  3BYX A;  3ZPG A;  6DFR A;  3QLY A;  3DGA A;  2AZN A;  3QLR A;  1SEJ A;  1RX5 A;  3JWF A;  4P3Q A;  1TYS A;  1JUT A;  2W3W A;  4HOG A;  1LCA A;  1TSY A;  2RD8 A;  3L3R A;  1YPV A;  4HOE A;  5HT4 A;  4DFR A;  2BBQ A;  1DG5 A;  5ECC A;  1BO8 A;  5HPB A;  3SRU X;  5J7W A;  3RG9 A;  5DXV A;  1TSV A;  2JYB A;  1J3K A;  1OHK A;  4KY8 A;  3FQV A;  1EVF A;  5U27 A;  1BDU A;  1DYH A;  4KLX A;  2G8X A;  1BO7 A;  1F4D A;  3KJR A;  3QJ7 A;  3JWK A;  2TSC A;  3EBU A;  2HM9 A;  3EGY X;  1JMG A;  3DAU A;  1YHO A;  2CIG A;  2L28 A;  5JG0 X;  1DDS A;  3GHW A;  1VZB A;  3EHI X;  1DIS A;  1VZD A;  1JUV A;  1B5E A;  1KLK A;  3FRF X;  4XSD A;  3UM6 A;  1PDB A;  1M7A A;  3S9U A;  2VF0 A;  1DLS A;  1RE7 A;  3NU0 A;  1DR4 A;  5HSR A;  5HVB A;  3BFI A;  2XW7 A;  2TDD A;  4H1I A;  3F0X X;  3NZ6 X;  5HVE A;  2CD2 A;  4XSC A;  7DFR A;  4KJL A;  1JTU A;  1JG0 A;  3FYV X;  3NXY A;  3F0Q X;  2RD8 B;  4I13 A;  3CL9 A;  1BKP A;  3SRW X;  1BKO A;  3EJL A;  3BHL A;  2BLA A;  4EIN A;  1IA1 A;  1BJG A;  4G95 A;  1RH3 A;  3IX6 A;  3EEL A;  4FGG A;  2ITH A;  3QG2 A;  4M2X A;  3IRM A;  4KD7 A;  3IRO A;  1CD2 A;  3NZD A;  1NJC A;  4ELH A;  4PSS A;  2A9W A;  3F0V X;  2FZH A;  1J3J C;  3F0S X;  3NXT A;  1VDR A;  1DF7 A;  4KM2 A;  4Q67 A;  5BY6 A;  1NJE A;  1THY A;  1TJS A;  3DL5 A;  4X5H A;  3JTW A;  4KNE A;  4PST A;  2BLB A;  1DR1 A;  3K74 A;  4QLE A;  1NJA A;  3INV A;  3EEJ A;  4ISK A;  4H96 A;  4ELE A;  4XT4 A;  1B49 A;  4FOX A;  1ZPR A;  1TSN A;  1TVV A;  3EEM A;  3EF9 A;  1DHI A;  1J3I A;  1TSL A;  4DPD A;  3ZPC A;  1TDR A;  4XRB A;  2FTQ A;  3K2H A;  1AJM A;  1TDB A;  1DR2 A;  4UP1 A;  1TDA A;  1KZJ A;  1J3J A;  3IA5 A;  3M09 A;  1RG7 A;  4EIZ A;  1B02 A;  4KY4 A;  3DFR A;  3F8Y A;  1S3V A;  1BSF A;  1CZ3 A;  1DYJ A;  3FY9 X;  4FOG A;  2G8D A;  4Q0D A;  2H2Q A;  1DR3 A;  1J3K C;  3NZ9 X;  1TLC A;  2B3Z A;  3GI2 A;  1DHF A;  5FCT A;  4DP3 A;  3NRR A;  3CD2 A;  5HSU A;  2W9G A;  3HB8 A;  3GG5 A;  3I8A X;  4XT7 A;  1RTS A;  1RX8 A;  3CLB A;  5HQZ A;  1F4C A;  3D80 A;  4PTJ A;  4F2V A;  3IJZ A;  3UM5 A;  4X5G A;  5HF0 X;  2ANO A;  4FHB A;  3FQZ A;  1KMV A;  4GEV A;  3R33 A;  4KBN A;  2FZJ A;  1TSZ A;  3FL9 A;  1S3W A;  1JMF A;  3K45 A;  3GH2 X;  4KJK A;  3SAI A;  3V8H A;  1RX9 A;  3FRD X;  1IA4 A;  1DLR A;  2VET A;  2KCE A;  2W9T A;  3QLS A;  1DRA A;  2ONB A;  3ED7 A;  1RB2 A;  4G6W X;  3UM8 A;  3F0U X;  1JUJ A;  1IA3 A;  5E8Q A;  3C06 A;  3SRR X;  1TSX A;  2G6V A;  4LAE X;  4H95 A;  3VCO A;  1MVT A;  3K47 A;  3KFY A;  3NZA X;  1LY4 A;  1NJB A;  1DRF A;  3QGT A;  2W3V A;  1BZF A;  1HFQ A;  3FL8 A;  3SA2 A;  4X5F A;  3TMS A;  4FGH A;  4IXF X;  3QLX A;  3FS6 A;  2FZI A;  4CD2 A;  1RX3 A;  1S3Y A;  1QZF A;  3NXO A;  4QJC A;  1JMI A;  5FDA A;  1DHJ A;  4ISW A;  1ZDR A;  4G3M A;  4KYA A;  3QLW A;  4XEC X;  4XSE A;  3ROA A;  4PDJ A;  1LCB A;  1LUD A;  3FRE X;  4HOF A;  5HUI A;  4HA7 A;  4HA9 A;  3TQB A;  3BHR A;  4RGC A;  2AAZ A;  1TVU A;  2O7P A;  1DRB A;  1F4E A;  2FTN A;  3KGY A;  2W3B A;  4KFJ A;  3F8Z A;  3NXV A;  5HQY A;  2D5N A;  4M7V A;  1HFP A;  4EB4 A;  3OCH A;  1J3I C;  3SQY X;  4XT5 A;  3SRQ X;  3SH2 A;  1AI9 A;  3BZ0 A;  1TRG A;  3JW5 A;  4M6L A;  1DYR A;  4ECK A;  4E28 A;  1HZW A;  5HF2 X;  4O1X D;  4ELG A;  3DG8 A;  1DNA A;  4O1X A;  1F28 A;  4P66 A;  4XT8 A;  4IRR A;  3IX9 A;  1D1G A;  1JTQ A;  4LAH X;  1BP6 A;  1RD7 A;  3QL0 A;  4PTH A;  3C0A A;  1BPJ A;  4FQS A;  1KMS A;  3HJ3 A;  3QYO A;  1TIS A;  3CSE A;  4LRR A;  1BSP A;  4JEF A;  4H0U A;  1U72 A;  4EZ8 A;  2G89 A;  4NX6 A;  4QLG A;  4EJ1 A;  2G8A A;  1LY3 A;  3JWC A;  1BP0 A;  4P68 A;  4OR7 A;  3EIG A;  4LEK X;  4H0R A;  3EAW X;  4P3R A;  3B9H A;  1RA3 A;  4X5I A;  1TLS A;  1F4B A;  3KJS A;  3E0B A;  1TSW A;  2W9H A;  1FWM A;  3FQO A;  2DRC A;  1M78 A;  3F91 A;  4GD7 A;  3SGY A;  1DDR A;  2BLC A;  4M7U A;  4ELB A;  3OB7 A;  1S3U A;  1RX6 A;  1RC4 A;  3GHV A;  4X5J A;  1JOM A;  1U71 A;  1F4F A;  3S7A A;  1QQQ A;  4H98 A;  4LAG X;  1BQ2 A;  4Q0E A;  5EAJ A;  3OAF A;  1BOZ A;  1RA8 A;  1RA1 A;  2D0K A;  2W3A A;  3NTZ A;  2G86 A;  4IXE D;  1RX7 A;  1OHJ A;  1JMH A;  4TU5 X;  4KM0 A;  5HI6 A;  3N5E A;  3QYL A;  4E5O A;  3DL6 A;  1IA2 A;  3IK1 A;  4TMS A;  4PSY A;  1B5D A;  1PD9 A;  1EVG A;  4DDR A;  1AIQ A;  5JA3 A;  1EV5 A;  1FFL A;  4EIL A;  1RB3 A;  4XE6 X;  2INQ A;  2W3M A;  2QK8 A;  3I3R A;  2P4G A;  5CC9 A;  3RO9 A;  3UWL A;  3QFX A;  3IRN A;  3FQ0 A;  1TDU A;  1DR6 A;  1JOL A;  3IA4 A;  3NXR A;  2FTO X;  2C2S A;  4QLF A;  3SA1 A;  3QL3 A;  4PSG A;  3NZC X;  3EEK A;  1I00 A;  2TDM A;  3FYW X;  3JW3 A;  2HQP A;  1AOE A;  2ANQ A;  4KNZ A;  1BID A;  1VJ3 A;  3FQC A;  4KAK A;  2RDA A;  3DG8 C;  4EIG A;  4QJZ D;  1HFR A;  5H3A A;  1DRE A;  1NJD A;  1RX2 A;  3BGX A;  3NXX A;  1M79 A;  3JSU A;  2TSR A;  2DHF A;  3KGB A;  4O1U A;  1U70 A;  8DFR A;  1VZC A;  1VZA A;  1TSM A;  1DG8 A;  1DRH A;  1DR5 A;  1RX1 A;  3N5E B;  5H39 A;  4G8Z X;  1LCE A;  2OBC A;  3TQ9 A;  4H97 A;  2BL9 A;  1MVS A;  2OIP A;  4G2O X;  2LF1 A;  4FOA A;  3BNZ A;  5WRN A;  3GYF A;  3EX8 A;  1EV8 A;  3N0H A;  1RF7 A;  4QI9 A;  2C2T A;  3D84 X;  4O7U A;  3F0B X;  4DPH A;  3UWL B;  2HXV A;  5DFR A;  4Q6A A;  3DAT A;  1HW4 A;  4DQ1 A;  5U26 A;  1DG7 A;  3FQF A;  3LG4 A;  1KCE A;  3NZB X;  4IQB A;  1AOB A;  1HVY A;  1KZI A;  5CCC A;  4M6J A;  3JWM A;  3H9K A;  1F4G A;  3N5G A;  1AO8 A;  4GYH A;  3TQA A;  3HBB A;  4OSG A;  3JVX A;  1HW3 A;  4KPW A;  1TDC A;  3IHI A;  4QHV A;  3S3V A;  3TQ8 A;  4ELF A;  4IXG X;  2W9S A;  1DIU A;  3DRC A;  4KEB A;  3TD8 A;  1RA9 A;  3QLZ A;  3KY8 A;  4IQQ A;  5HS3 A;  1RX4 A;  1DR7 A;  1CI7 A;  3GHC A;  4FGT A;  4I1N A;  3FRB X;  3GH0 A;  1BQ1 A;  1SYN A;  1DAJ A;  5H38 A;  3DGA C;  4XT6 A;  2GD9 A;  2KGK A;  1VZE A;  1AXW A;  1JU6 A; 
#chains in the Genus database with same CATH topology
 1PD8 A;  3FY8 X;  4M6K A;  4KJJ A;  1NCE A;  3IK0 A;  1TSD A;  3B5B A;  3SRS X;  5ECX A;  5HT5 A;  4GH8 A;  1E26 A;  3M08 A;  4NX7 A;  1AN5 A;  3EDW X;  3FRA X;  1TVW A;  3SR5 X;  1DYI A;  3Q1H A;  2ZZA A;  4KL9 A;  1DDU A;  1RA2 A;  3BYX A;  3ZPG A;  6DFR A;  3QLY A;  3DGA A;  2AZN A;  3QLR A;  1SEJ A;  1RX5 A;  3JWF A;  4P3Q A;  1TYS A;  1JUT A;  2W3W A;  4HOG A;  1LCA A;  1TSY A;  2RD8 A;  3L3R A;  1YPV A;  4HOE A;  5HT4 A;  4DFR A;  2BBQ A;  1DG5 A;  5ECC A;  1BO8 A;  5HPB A;  3SRU X;  5J7W A;  3RG9 A;  5DXV A;  1TSV A;  2JYB A;  1J3K A;  1OHK A;  4KY8 A;  3FQV A;  1EVF A;  5U27 A;  1BDU A;  1DYH A;  4KLX A;  2G8X A;  1BO7 A;  1F4D A;  3KJR A;  3QJ7 A;  3JWK A;  2TSC A;  3EBU A;  2HM9 A;  3EGY X;  1JMG A;  3DAU A;  1YHO A;  2CIG A;  2L28 A;  5JG0 X;  1DDS A;  3GHW A;  1VZB A;  3EHI X;  1DIS A;  1VZD A;  1JUV A;  1B5E A;  1KLK A;  3FRF X;  4XSD A;  3UM6 A;  1PDB A;  1M7A A;  3S9U A;  2VF0 A;  1DLS A;  1RE7 A;  3NU0 A;  1DR4 A;  5HSR A;  5HVB A;  3BFI A;  2XW7 A;  2TDD A;  4H1I A;  3F0X X;  3NZ6 X;  5HVE A;  2CD2 A;  4XSC A;  7DFR A;  4KJL A;  1JTU A;  1JG0 A;  3FYV X;  3NXY A;  3F0Q X;  2RD8 B;  4I13 A;  3CL9 A;  1BKP A;  3SRW X;  1BKO A;  3EJL A;  3BHL A;  2BLA A;  4EIN A;  1IA1 A;  1BJG A;  4G95 A;  1RH3 A;  3IX6 A;  3EEL A;  4FGG A;  2ITH A;  3QG2 A;  4M2X A;  3IRM A;  4KD7 A;  3IRO A;  1CD2 A;  3NZD A;  1NJC A;  4ELH A;  4PSS A;  2A9W A;  3F0V X;  2FZH A;  1J3J C;  3F0S X;  3NXT A;  1VDR A;  1DF7 A;  4KM2 A;  4Q67 A;  5BY6 A;  1NJE A;  1THY A;  1TJS A;  3DL5 A;  4X5H A;  3JTW A;  4KNE A;  4PST A;  2BLB A;  1DR1 A;  3K74 A;  4QLE A;  1NJA A;  3INV A;  3EEJ A;  4ISK A;  4H96 A;  4ELE A;  4XT4 A;  1B49 A;  4FOX A;  1ZPR A;  1TSN A;  1TVV A;  3EEM A;  3EF9 A;  1DHI A;  1J3I A;  1TSL A;  4DPD A;  3ZPC A;  1TDR A;  4XRB A;  2FTQ A;  3K2H A;  1AJM A;  1TDB A;  1DR2 A;  4UP1 A;  1TDA A;  1KZJ A;  1J3J A;  3IA5 A;  3M09 A;  1RG7 A;  4EIZ A;  1B02 A;  4KY4 A;  3DFR A;  3F8Y A;  1S3V A;  1BSF A;  1CZ3 A;  1DYJ A;  3FY9 X;  4FOG A;  2G8D A;  4Q0D A;  2H2Q A;  1DR3 A;  1J3K C;  3NZ9 X;  1TLC A;  2B3Z A;  3GI2 A;  1DHF A;  5FCT A;  4DP3 A;  3NRR A;  3CD2 A;  5HSU A;  2W9G A;  3HB8 A;  3GG5 A;  3I8A X;  4XT7 A;  1RTS A;  1RX8 A;  3CLB A;  5HQZ A;  1F4C A;  3D80 A;  4PTJ A;  4F2V A;  3IJZ A;  3UM5 A;  4X5G A;  5HF0 X;  2ANO A;  4FHB A;  3FQZ A;  1KMV A;  4GEV A;  3R33 A;  4KBN A;  2FZJ A;  1TSZ A;  3FL9 A;  1S3W A;  1JMF A;  3K45 A;  3GH2 X;  4KJK A;  3SAI A;  3V8H A;  1RX9 A;  3FRD X;  1IA4 A;  1DLR A;  2VET A;  2KCE A;  2W9T A;  3QLS A;  1DRA A;  2ONB A;  3ED7 A;  1RB2 A;  4G6W X;  3UM8 A;  3F0U X;  1JUJ A;  1IA3 A;  5E8Q A;  3C06 A;  3SRR X;  1TSX A;  2G6V A;  4LAE X;  4H95 A;  3VCO A;  1MVT A;  3K47 A;  3KFY A;  3NZA X;  1LY4 A;  1NJB A;  1DRF A;  3QGT A;  2W3V A;  1BZF A;  1HFQ A;  3FL8 A;  3SA2 A;  4X5F A;  3TMS A;  4FGH A;  4IXF X;  3QLX A;  3FS6 A;  2FZI A;  4CD2 A;  1RX3 A;  1S3Y A;  1QZF A;  3NXO A;  4QJC A;  1JMI A;  5FDA A;  1DHJ A;  4ISW A;  1ZDR A;  4G3M A;  4KYA A;  3QLW A;  4XEC X;  4XSE A;  3ROA A;  4PDJ A;  1LCB A;  1LUD A;  3FRE X;  4HOF A;  5HUI A;  4HA7 A;  4HA9 A;  3TQB A;  3BHR A;  4RGC A;  2AAZ A;  1TVU A;  2O7P A;  1DRB A;  1F4E A;  2FTN A;  3KGY A;  2W3B A;  4KFJ A;  3F8Z A;  3NXV A;  5HQY A;  2D5N A;  4M7V A;  1HFP A;  4EB4 A;  3OCH A;  1J3I C;  3SQY X;  4XT5 A;  3SRQ X;  3SH2 A;  1AI9 A;  3BZ0 A;  1TRG A;  3JW5 A;  4M6L A;  1DYR A;  4ECK A;  4E28 A;  1HZW A;  5HF2 X;  4O1X D;  4ELG A;  3DG8 A;  1DNA A;  4O1X A;  1F28 A;  4P66 A;  4XT8 A;  4IRR A;  3IX9 A;  1D1G A;  1JTQ A;  4LAH X;  1BP6 A;  1RD7 A;  3QL0 A;  4PTH A;  3C0A A;  1BPJ A;  4FQS A;  1KMS A;  3HJ3 A;  3QYO A;  1TIS A;  3CSE A;  4LRR A;  1BSP A;  4JEF A;  4H0U A;  1U72 A;  4EZ8 A;  2G89 A;  4NX6 A;  4QLG A;  4EJ1 A;  2G8A A;  1LY3 A;  3JWC A;  1BP0 A;  4P68 A;  4OR7 A;  3EIG A;  4LEK X;  4H0R A;  3EAW X;  4P3R A;  3B9H A;  1RA3 A;  4X5I A;  1TLS A;  1F4B A;  3KJS A;  3E0B A;  1TSW A;  2W9H A;  1FWM A;  3FQO A;  2DRC A;  1M78 A;  3F91 A;  4GD7 A;  3SGY A;  1DDR A;  2BLC A;  4M7U A;  4ELB A;  3OB7 A;  1S3U A;  1RX6 A;  1RC4 A;  3GHV A;  4X5J A;  1JOM A;  1U71 A;  1F4F A;  3S7A A;  1QQQ A;  4H98 A;  4LAG X;  1BQ2 A;  4Q0E A;  5EAJ A;  3OAF A;  1BOZ A;  1RA8 A;  1RA1 A;  2D0K A;  2W3A A;  3NTZ A;  2G86 A;  4IXE D;  1RX7 A;  1OHJ A;  1JMH A;  4TU5 X;  4KM0 A;  5HI6 A;  3N5E A;  3QYL A;  4E5O A;  3DL6 A;  1IA2 A;  3IK1 A;  4TMS A;  4PSY A;  1B5D A;  1PD9 A;  1EVG A;  4DDR A;  1AIQ A;  5JA3 A;  1EV5 A;  1FFL A;  4EIL A;  1RB3 A;  4XE6 X;  2INQ A;  2W3M A;  2QK8 A;  3I3R A;  2P4G A;  5CC9 A;  3RO9 A;  3UWL A;  3QFX A;  3IRN A;  3FQ0 A;  1TDU A;  1DR6 A;  1JOL A;  3IA4 A;  3NXR A;  2FTO X;  2C2S A;  4QLF A;  3SA1 A;  3QL3 A;  4PSG A;  3NZC X;  3EEK A;  1I00 A;  2TDM A;  3FYW X;  3JW3 A;  2HQP A;  1AOE A;  2ANQ A;  4KNZ A;  1BID A;  1VJ3 A;  3FQC A;  4KAK A;  2RDA A;  3DG8 C;  4EIG A;  4QJZ D;  1HFR A;  5H3A A;  1DRE A;  1NJD A;  1RX2 A;  3BGX A;  3NXX A;  1M79 A;  3JSU A;  2TSR A;  2DHF A;  3KGB A;  4O1U A;  1U70 A;  8DFR A;  1VZC A;  1VZA A;  1TSM A;  1DG8 A;  1DRH A;  1DR5 A;  1RX1 A;  3N5E B;  5H39 A;  4G8Z X;  1LCE A;  2OBC A;  3TQ9 A;  4H97 A;  2BL9 A;  1MVS A;  2OIP A;  4G2O X;  2LF1 A;  4FOA A;  3BNZ A;  5WRN A;  3GYF A;  3EX8 A;  1EV8 A;  3N0H A;  1RF7 A;  4QI9 A;  2C2T A;  3D84 X;  4O7U A;  3F0B X;  4DPH A;  3UWL B;  2HXV A;  5DFR A;  4Q6A A;  3DAT A;  1HW4 A;  4DQ1 A;  5U26 A;  1DG7 A;  3FQF A;  3LG4 A;  1KCE A;  3NZB X;  4IQB A;  1AOB A;  1HVY A;  1KZI A;  5CCC A;  4M6J A;  3JWM A;  3H9K A;  1F4G A;  3N5G A;  1AO8 A;  4GYH A;  3TQA A;  3HBB A;  4OSG A;  3JVX A;  1HW3 A;  4KPW A;  1TDC A;  3IHI A;  4QHV A;  3S3V A;  3TQ8 A;  4ELF A;  4IXG X;  2W9S A;  1DIU A;  3DRC A;  4KEB A;  3TD8 A;  1RA9 A;  3QLZ A;  3KY8 A;  4IQQ A;  5HS3 A;  1RX4 A;  1DR7 A;  1CI7 A;  3GHC A;  4FGT A;  4I1N A;  3FRB X;  3GH0 A;  1BQ1 A;  1SYN A;  1DAJ A;  5H38 A;  3DGA C;  4XT6 A;  2GD9 A;  2KGK A;  1VZE A;  1AXW A;  1JU6 A; 
#chains in the Genus database with same CATH homology
 1PD8 A;  3FY8 X;  4M6K A;  4KJJ A;  1NCE A;  3IK0 A;  1TSD A;  3B5B A;  3SRS X;  5ECX A;  5HT5 A;  4GH8 A;  1E26 A;  3M08 A;  4NX7 A;  1AN5 A;  3EDW X;  3FRA X;  1TVW A;  3SR5 X;  1DYI A;  3Q1H A;  2ZZA A;  4KL9 A;  1DDU A;  1RA2 A;  3BYX A;  3ZPG A;  6DFR A;  3QLY A;  3DGA A;  2AZN A;  3QLR A;  1SEJ A;  1RX5 A;  3JWF A;  4P3Q A;  1TYS A;  1JUT A;  2W3W A;  4HOG A;  1LCA A;  1TSY A;  2RD8 A;  3L3R A;  1YPV A;  4HOE A;  5HT4 A;  4DFR A;  2BBQ A;  1DG5 A;  5ECC A;  1BO8 A;  5HPB A;  3SRU X;  5J7W A;  3RG9 A;  5DXV A;  1TSV A;  2JYB A;  1J3K A;  1OHK A;  4KY8 A;  3FQV A;  1EVF A;  5U27 A;  1BDU A;  1DYH A;  4KLX A;  2G8X A;  1BO7 A;  1F4D A;  3KJR A;  3QJ7 A;  3JWK A;  2TSC A;  3EBU A;  2HM9 A;  3EGY X;  1JMG A;  3DAU A;  1YHO A;  2CIG A;  2L28 A;  5JG0 X;  1DDS A;  3GHW A;  1VZB A;  3EHI X;  1DIS A;  1VZD A;  1JUV A;  1B5E A;  1KLK A;  3FRF X;  4XSD A;  3UM6 A;  1PDB A;  1M7A A;  3S9U A;  2VF0 A;  1DLS A;  1RE7 A;  3NU0 A;  1DR4 A;  5HSR A;  5HVB A;  3BFI A;  2XW7 A;  2TDD A;  4H1I A;  3F0X X;  3NZ6 X;  5HVE A;  2CD2 A;  4XSC A;  7DFR A;  4KJL A;  1JTU A;  1JG0 A;  3FYV X;  3NXY A;  3F0Q X;  2RD8 B;  4I13 A;  3CL9 A;  1BKP A;  3SRW X;  1BKO A;  3EJL A;  3BHL A;  2BLA A;  4EIN A;  1IA1 A;  1BJG A;  4G95 A;  1RH3 A;  3IX6 A;  3EEL A;  4FGG A;  2ITH A;  3QG2 A;  4M2X A;  3IRM A;  4KD7 A;  3IRO A;  1CD2 A;  3NZD A;  1NJC A;  4ELH A;  4PSS A;  2A9W A;  3F0V X;  2FZH A;  1J3J C;  3F0S X;  3NXT A;  1VDR A;  1DF7 A;  4KM2 A;  4Q67 A;  5BY6 A;  1NJE A;  1THY A;  1TJS A;  3DL5 A;  4X5H A;  3JTW A;  4KNE A;  4PST A;  2BLB A;  1DR1 A;  3K74 A;  4QLE A;  1NJA A;  3INV A;  3EEJ A;  4ISK A;  4H96 A;  4ELE A;  4XT4 A;  1B49 A;  4FOX A;  1ZPR A;  1TSN A;  1TVV A;  3EEM A;  3EF9 A;  1DHI A;  1J3I A;  1TSL A;  4DPD A;  3ZPC A;  1TDR A;  4XRB A;  2FTQ A;  3K2H A;  1AJM A;  1TDB A;  1DR2 A;  4UP1 A;  1TDA A;  1KZJ A;  1J3J A;  3IA5 A;  3M09 A;  1RG7 A;  4EIZ A;  1B02 A;  4KY4 A;  3DFR A;  3F8Y A;  1S3V A;  1BSF A;  1CZ3 A;  1DYJ A;  3FY9 X;  4FOG A;  2G8D A;  4Q0D A;  2H2Q A;  1DR3 A;  1J3K C;  3NZ9 X;  1TLC A;  2B3Z A;  3GI2 A;  1DHF A;  5FCT A;  4DP3 A;  3NRR A;  3CD2 A;  5HSU A;  2W9G A;  3HB8 A;  3GG5 A;  3I8A X;  4XT7 A;  1RTS A;  1RX8 A;  3CLB A;  5HQZ A;  1F4C A;  3D80 A;  4PTJ A;  4F2V A;  3IJZ A;  3UM5 A;  4X5G A;  5HF0 X;  2ANO A;  4FHB A;  3FQZ A;  1KMV A;  4GEV A;  3R33 A;  4KBN A;  2FZJ A;  1TSZ A;  3FL9 A;  1S3W A;  1JMF A;  3K45 A;  3GH2 X;  4KJK A;  3SAI A;  3V8H A;  1RX9 A;  3FRD X;  1IA4 A;  1DLR A;  2VET A;  2KCE A;  2W9T A;  3QLS A;  1DRA A;  2ONB A;  3ED7 A;  1RB2 A;  4G6W X;  3UM8 A;  3F0U X;  1JUJ A;  1IA3 A;  5E8Q A;  3C06 A;  3SRR X;  1TSX A;  2G6V A;  4LAE X;  4H95 A;  3VCO A;  1MVT A;  3K47 A;  3KFY A;  3NZA X;  1LY4 A;  1NJB A;  1DRF A;  3QGT A;  2W3V A;  1BZF A;  1HFQ A;  3FL8 A;  3SA2 A;  4X5F A;  3TMS A;  4FGH A;  4IXF X;  3QLX A;  3FS6 A;  2FZI A;  4CD2 A;  1RX3 A;  1S3Y A;  1QZF A;  3NXO A;  4QJC A;  1JMI A;  5FDA A;  1DHJ A;  4ISW A;  1ZDR A;  4G3M A;  4KYA A;  3QLW A;  4XEC X;  4XSE A;  3ROA A;  4PDJ A;  1LCB A;  1LUD A;  3FRE X;  4HOF A;  5HUI A;  4HA7 A;  4HA9 A;  3TQB A;  3BHR A;  4RGC A;  2AAZ A;  1TVU A;  2O7P A;  1DRB A;  1F4E A;  2FTN A;  3KGY A;  2W3B A;  4KFJ A;  3F8Z A;  3NXV A;  5HQY A;  2D5N A;  4M7V A;  1HFP A;  4EB4 A;  3OCH A;  1J3I C;  3SQY X;  4XT5 A;  3SRQ X;  3SH2 A;  1AI9 A;  3BZ0 A;  1TRG A;  3JW5 A;  4M6L A;  1DYR A;  4ECK A;  4E28 A;  1HZW A;  5HF2 X;  4O1X D;  4ELG A;  3DG8 A;  1DNA A;  4O1X A;  1F28 A;  4P66 A;  4XT8 A;  4IRR A;  3IX9 A;  1D1G A;  1JTQ A;  4LAH X;  1BP6 A;  1RD7 A;  3QL0 A;  4PTH A;  3C0A A;  1BPJ A;  4FQS A;  1KMS A;  3HJ3 A;  3QYO A;  1TIS A;  3CSE A;  4LRR A;  1BSP A;  4JEF A;  4H0U A;  1U72 A;  4EZ8 A;  2G89 A;  4NX6 A;  4QLG A;  4EJ1 A;  2G8A A;  1LY3 A;  3JWC A;  1BP0 A;  4P68 A;  4OR7 A;  3EIG A;  4LEK X;  4H0R A;  3EAW X;  4P3R A;  3B9H A;  1RA3 A;  4X5I A;  1TLS A;  1F4B A;  3KJS A;  3E0B A;  1TSW A;  2W9H A;  1FWM A;  3FQO A;  2DRC A;  1M78 A;  3F91 A;  4GD7 A;  3SGY A;  1DDR A;  2BLC A;  4M7U A;  4ELB A;  3OB7 A;  1S3U A;  1RX6 A;  1RC4 A;  3GHV A;  4X5J A;  1JOM A;  1U71 A;  1F4F A;  3S7A A;  1QQQ A;  4H98 A;  4LAG X;  1BQ2 A;  4Q0E A;  5EAJ A;  3OAF A;  1BOZ A;  1RA8 A;  1RA1 A;  2D0K A;  2W3A A;  3NTZ A;  2G86 A;  4IXE D;  1RX7 A;  1OHJ A;  1JMH A;  4TU5 X;  4KM0 A;  5HI6 A;  3N5E A;  3QYL A;  4E5O A;  3DL6 A;  1IA2 A;  3IK1 A;  4TMS A;  4PSY A;  1B5D A;  1PD9 A;  1EVG A;  4DDR A;  1AIQ A;  5JA3 A;  1EV5 A;  1FFL A;  4EIL A;  1RB3 A;  4XE6 X;  2INQ A;  2W3M A;  2QK8 A;  3I3R A;  2P4G A;  5CC9 A;  3RO9 A;  3UWL A;  3QFX A;  3IRN A;  3FQ0 A;  1TDU A;  1DR6 A;  1JOL A;  3IA4 A;  3NXR A;  2FTO X;  2C2S A;  4QLF A;  3SA1 A;  3QL3 A;  4PSG A;  3NZC X;  3EEK A;  1I00 A;  2TDM A;  3FYW X;  3JW3 A;  2HQP A;  1AOE A;  2ANQ A;  4KNZ A;  1BID A;  1VJ3 A;  3FQC A;  4KAK A;  2RDA A;  3DG8 C;  4EIG A;  4QJZ D;  1HFR A;  5H3A A;  1DRE A;  1NJD A;  1RX2 A;  3BGX A;  3NXX A;  1M79 A;  3JSU A;  2TSR A;  2DHF A;  3KGB A;  4O1U A;  1U70 A;  8DFR A;  1VZC A;  1VZA A;  1TSM A;  1DG8 A;  1DRH A;  1DR5 A;  1RX1 A;  3N5E B;  5H39 A;  4G8Z X;  1LCE A;  2OBC A;  3TQ9 A;  4H97 A;  2BL9 A;  1MVS A;  2OIP A;  4G2O X;  2LF1 A;  4FOA A;  3BNZ A;  5WRN A;  3GYF A;  3EX8 A;  1EV8 A;  3N0H A;  1RF7 A;  4QI9 A;  2C2T A;  3D84 X;  4O7U A;  3F0B X;  4DPH A;  3UWL B;  2HXV A;  5DFR A;  4Q6A A;  3DAT A;  1HW4 A;  4DQ1 A;  5U26 A;  1DG7 A;  3FQF A;  3LG4 A;  1KCE A;  3NZB X;  4IQB A;  1AOB A;  1HVY A;  1KZI A;  5CCC A;  4M6J A;  3JWM A;  3H9K A;  1F4G A;  3N5G A;  1AO8 A;  4GYH A;  3TQA A;  3HBB A;  4OSG A;  3JVX A;  1HW3 A;  4KPW A;  1TDC A;  3IHI A;  4QHV A;  3S3V A;  3TQ8 A;  4ELF A;  4IXG X;  2W9S A;  1DIU A;  3DRC A;  4KEB A;  3TD8 A;  1RA9 A;  3QLZ A;  3KY8 A;  4IQQ A;  5HS3 A;  1RX4 A;  1DR7 A;  1CI7 A;  3GHC A;  4FGT A;  4I1N A;  3FRB X;  3GH0 A;  1BQ1 A;  1SYN A;  1DAJ A;  5H38 A;  3DGA C;  4XT6 A;  2GD9 A;  2KGK A;  1VZE A;  1AXW A;  1JU6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...