The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
59
|
sequence length |
213
|
structure length |
213
|
Chain Sequence |
MAPWKIEEVKTLKGLIKSKPVVAIVDMMDVPAPQLQEIRDKIRDKVKLRMSRNTLIIRALKEAAEELNNPKLAELANYVERGAAILVTDMNPFKLYKLLEENKSPAPVRGGQIAPCDIKVEKGSTGMPPGPFLGELKSVGIPAAIEKGKIAIKEDKVVVKKGEVVSPKLAAVLDRLGIKPIKVGLNILAVYEDGIIYTPDVLKVDEEKLLADI
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Structure of a two-domain N-terminal fragment of ribosomal protein L10 from Methanococcus jannaschii reveals a specific piece of the archaeal ribosomal stalk
pubmed doi rcsb |
| molecule tags |
Ribosomal protein
|
| source organism |
Methanocaldococcus jannaschii
|
| molecule keywords |
Acidic ribosomal protein P0 homolog
|
| total genus |
59
|
| structure length |
213
|
| sequence length |
213
|
| chains with identical sequence |
B
|
| ec nomenclature | |
| pdb deposition date | 2009-09-11 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF17777 | RL10P_insert | Insertion domain in 60S ribosomal protein L10P |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 2-Layer Sandwich | Alpha-Beta Plaits | Alpha-Beta Plaits | ||
| Alpha Beta | Alpha-Beta Complex | Molybdopterin biosynthesis moea protein, domain 2 | Molybdopterin biosynthesis moea protein, domain 2 |
