3JTCA

Importance of mg2+ in the ca2+-dependent folding of the gamma-carboxyglutamic acid domains of vitamin k-dependent clotting and anticlotting proteins
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
172
structure length
172
Chain Sequence
GLQRLHMLQISYFRDPYHVWYQGNASLGGHLTHVLEGPDTNTTIIQLQPLQEPESWARTQSGLQSYLLQFHGLVRLVHQERTLAFPLTIRCFLGCELPPEGSRAHVFFEVAVNGSSFVSFRPERALWQADTQVTSGVVTFTLQQLNAYNRTRYELREFLEDTCVQYVQKHIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endothelial protein C receptor
publication title Structural and Functional Studies of gamma-Carboxyglutamic Acid Domains of Factor VIIa and Activated Protein C: Role of Magnesium at Physiological Calcium.
pubmed doi rcsb
molecule tags Blood clotting
total genus 50
structure length 172
sequence length 172
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3jtcA00
2AXFA 2VLJA 1FO0H 5SWQA 1S7VA 2X4NA 3GJFA 2FO4A 3RL2A 3DXAA 3QQ4A 3C9NA 3VXSA 3L3HA 1G7QA 4U1LA 3H7BA 3RZCA 1KPRA 2V2WA 4GUPA 3PWUA 2BSRA 4MNQA 1QQDA 1FZJA 4ZUSA 5IM7A 1LK2A 1S7XA 4CW1A 4F7TA 5MEPA 3MROA 3TPUE 2X4UA 4PG9A 4G59A 3SDDA 1JE6A 5SWZA 1AGDA 3QUXA 2X4SA 1FZKA 3CC5A 1FFOA 2CIKA 2ZSWA 3I6KA 2X4PA 2CLZA 2UWEA 5C0AA 1RJZA 1LQVA 3QFJA 1HHIA 3GMMA 4L9LC 5D2NA 4PG2A 2X4OA 4PJ9A 5EUOA 3SDCA 3X13A 3BH8A 3D25A 4LCCC 4WJ5A 3QUKA 4JFDA 5D7JC 3VXOA 4ZUUA 3BEWA 1N5AA 1TVBA 3QDMA 3ILQC 3TVMA 4L4TA 4MVBA 4N0FA 1JF1A 3AU1A 3E3QA 3KPRA 3DX8A 1W0VA 5J6GA 3MYJA 4Y4HA 3QDJA 1T1YA 3KPNA 4K71B 1ZHNA 4QRSA 2X4QA 2X70A 1T1ZA 3BXNA 1CE6A 3TO4A 2XFXA 1T21A 1QEWA 3M1BA 4HKJA 4U1KA 3OV6A 4PRHA 3GMNA 4N5EA 5ISZA 5HGAA 3TO2A 3ARBA 3VXNA 4Y2DA 5IB2A 1JGEA 1G7PA 4NO0A 3VWKA 3MV9A 5MENA 5HHMA 1P1ZA 1S7SA 1MHEA 3WL9A 3CPLA 5HYJA 3BGMA 2BVOA 2BVQA 1IM9A 4NQVA 1S9XA 1JGDA 3MRRA 3KPSA 3SKMA 2D31A 4NO2A 3NFNA 4S0UC 4PDCE 3TF7A 2HN7A 1I4FA 3LKPA 2CKBH 4L4VA 1QO3A 4NSKA 4X6CA 2GUOA 3BP7A 5HHNA 1R3HA 5E00A 3FQNA 3UBXA 3VFMA 3TBWA 4E0RA 2ZSVA 3BW9A 4PRIA 3KPPA 4PGCA 4PJHA 4Y4FA 4PRBA 3TIEA 5INDA 1VACA 3MREA 2BSSA 1SYSA 3TJHA 3H9HA 4NNYA 4NT6A 1A9BA 3QULA 1ZT4A 3TBSA 3BZFA 3FOLA 3O3AA 5FA3A 4ZUTA 5F7DA 3ERYA 4MX7A 1S7UA 4JFEA 3D39A 3TBYA 4NO5A 3LKRA 4G42A 4NO3A 1QVOA 3U0PA 1HHGA 5C0EA 3VFRA 3T8XA 3D2UA 3BUYA 2VLLA 3GSNH 1OGTA 1T1XA 4WW2C 1UXSA 3QZWA 3O3DA 1B0GA 1WBZA 2RFXA 5EU4A 4EUPA 3KXFA 4MNGA 3PQYA 4U1SA 5EOTA 1FZMA 3CCHA 3RTQA 5EU3A 1GZPA 1VGKA 2VLKA 3VFUA 2J8UA 4JRXA 4JRYA 4F7CA 1EEYA 3B3IA 1TVHA 4PREA 3D18A 1T1WA 2YPLA 1A1NA 3SDAA 1Z5LA 4I4WA 3QQ3A 1L8JA 3FT4A 3L3GA 3E6FA 1KJ2H 2VE6A 2H6PA 2C7UA 5MEOA 4N0UA 4Z77A 1RK1A 5C0IA 1HHHA 2BSTA 3GSOA 3P4OA 4PGEA 3TFKA 3JTTA 1K5NA 2AKRA 4ZAKA 3V5HA 1Q94A 2BVPA 3LKOA 1RK0A 3PWNA 5IB4A 5J1AA 3VWJA 5BS0A 3HAEA 4PGDA 1HHKA 1MHCA 3P77A 3MRJA 4L8BA 1SYVA 3KWWA 1AGBA 2AV7A 3VJ6A 4HV8A 2GTWA 1JFMA 2HJKA 4O2EA 1AGEA 3VFTA 2OI9A 3QI9A 1ZVSA 3T1FA 3MGTA 3L3JA 3VFSA 1T0NA 5HGBA 2FYYA 4MS8A 5C9JA 3X11A 1BD2A 1YN7A 3O3BA 1B0RA 1GZQA 1HYRC 1FFNA 5D7IA 5ENWA 2CLVA 2FZ3A 3HLAA 4PJ5A 3MRFA 1W72A 2X4TA 3MV7A 5L2JA 3FQRA 3GSVA 4CVXA 3P9LA 4HUWA 1OF2A 3MRMA 3RWJA 5MEQA 1ZT7A 1FFPA 2BNRA 1YPZA 3CH1A 5L2KA 3L9RA 3FFCA 5D7LA 1I1YA 3D3VA 4U1NA 5IB5A 2NW3A 3RUGA 3MA7A 2F54A 4D0DA 2YPKA 4NHUE 5F1IA 4XXCA 3GMOA 2NX5A 1ZSDA 1ZHBA 4MJ5A 1ONQA 4D0CA 4PJBA 4HX1A 4F7MA 1DE4A 1PQZA 4APQA 3CZFA 4O2FA 1K8DA 4X6DA 3RWHA 3SPVA 1A6ZA 3FT3A 4U1JA 4FFEX 4L3CA 2ZOKA 3O4LA 3P4MA 3REWA 1UQSA 4PJAA 1DUZA 2P5EA 3MRLA 4JQVA 4MJIA 4U6YA 3O8XA 1T7YA 3L3DA 3RWCA 4PV8A 5MERA 3L3IA 5EU5A 4MQ7A 1T80A 2HJLA 2PO6A 4QOKA 3BHBA 4PRPA 3MRHA 4WU5A 4Y4KA 4PJ7A 1P7QA 3VFOA 4LHUA 1I7RA 3W39A 3VFPA 3SJVA 3GMRA 3OXSA 3P73A 1DUYA 1FZOA 4X6EA 4JFFA 2PYEA 1T7VA 3BVNA 4NQCA 3ARFA 4U1HA 1VADA 1S7RA 3LN4A 3X12A 1UXWA 3VFVA 3X14A 1M6OA 4JQXA 3OXRA 1QRNA 4JFQA 4K7FA 3VFNA 4Z76A 4D0BA 3MRPA 5E6IC 3LKSA 5C08A 3TN0A 5HHPA 3S6CA 1JUFA 3UTSA 1WBXA 4IIQC 2FWOA 3GSRA 1XZ0A 3GSXA 3RGVC 1T0MA 4EI5A 1HSAA 1I1AA 3DX7A 1LP9A 5FA4A 1AGFA 2F74A 1T20A 4L8DA 1N59A 1S7QA 4U1MA 4PP8C 1KPUA 5EO1A 1QR1A 1A1MA 1X7QA 5F9JA 4HS3A 4L3EA 4MJ6A 4QRUA 3QEQA 3VCLA 5IROA 4HWZA 5D9SA 3ROLA 3MGOA 1S8DA 3RWDA 1HSBA 4WU7A 5B39A 1T7XA 3M17A 4HUVA 1TMCA 1B3JA 4ONOA 4PJDA 4QRTA 1E27A 3QUZA 1BIIA 4PJFA 3JTSA 4LNRA 4WDIA 3I6GA 3IXAA 3CVHA 4PJIA 3C8KA 3E2HA 2GJ6A 2VABA 1S7TA 2VAAA 3QFDA 2H26A 4L8SC 4PGBA 1QLFA 1C16A 3ILPA 1WBYA 4HUXA 1KJ3H 1AO7A 3P9MA 5EO0A 3RWIA 5B38A 4CVZA 5C0GA 3VRIA 5IVXA 1INQA 3QUYA 1QSFA 3B6SA 3SDXA 4F7EA 2VLRA 2ESVA 1CG9A 1T7ZA 3BEVA 5D5MA 4PJGA 1T22A 3FTGA 4V3EB 3UTTA 3FQTA 2JCCA 3TIDA 4IRSA 1JPFA 5HHOA 3MRCA 2P5WA 1MI5A 5HGDA 4JFOA 1P4LA 5C0CA 1ZAGA 1EEZA 4UQ2A 4PJEA 5JHDA 4U6XA 3PWJA 2GAZA 1LDPH 3FRUA 5E8PA 3AREA 3TBTA 2E7LE 1I7UA 2FIKA 3WLBA 4IHOA 2YEZA 3PABA 3WS3A 1ZS8A 4FTVA 3UPRA 3KYNA 3VRJA 3WUWA 4WUUA 1LD9A 1OGAA 1U58A 3GSQA 3HE6A 4PV9A 5E9DA 5GSRA 1QSEA 3RWGA 3DBXA 5C07A 4LCYA 1FG2A 3RL1A 4NNXA 5C0BA 3VXPA 3H9SA 4QRPA 5J6HA 3LV3A 4ZUWA 1ZT1A 3BWAA 1NANH 3MRNA 1I7TA 3PWLA 4PJ8A 2AV1A 2CIIA 4I48A 3JTCA 3KPMA 3OX8A 3FT2A 3O3EA 3MRDA 5FKPA 1BZ9A 1JHTA 3PWVA 1S9WA 4IRJA 3ROOA 5IEHA 3MRBA 3HG1A 5C0JA 3DTXA 1E28A 5D2LA 5IB3A 1ZHLA 4N8VA 3VFWA 3PWPA 1LEKA 3WS6A 1RJYA 3JVGA 4L29A 1AGCA 1ZHKA 5INCA 5FDWA 4ZUVA 3GIVA 2OL3H 4LCWA 3P4NA 5EFIA 1DDHA 3MRIA 4MXQA 4WWKC 4ZFZA 5F1NA 1KJVA 1YN6A 1EXUA 5HGHA 3HPJA 4F7PA 4G9FA 3AM8A 3VXRA 4EN3C 3SKOA 2GTZA 4GKSA 4NQXA 1EFXA 5E8OA 1KCGC 3FQXA 4HUUA 4X6FA 4UQ3A 3V5DA 1S7WA 4Y16A 4N0CA 3MRKA 3GSWA 2DYPA 1XR8A 3KPLA 5DDHA 5BXFA 4PJCA 5BRZA 4G8GA 2GT9A 4U1IA 3IT8D 5IB1A 3KPOA 3KLAA 1N2RA 1I1FA 4G8IA 4PJXA 3RWEA 4O2CA 3ARDA 3SCMA 4PR5A 3TBVA 1IM3A 5SWSA 3UTQA 1HHJA 2AK4A 3MR9A 3GMQA 3DMMA 1LEGA 2AXGA 1T7WA 2XPGA 3MRGA 3FQUA 4PRAA 2HLAA 3W0WA 1KBGH 3BZEA 1CD1A 1ED3A 1XH3A 2ZOLA 3FONA 3GMPA 4L8CA 4Z78A 5BJTA 4V3DB 5C09A 3LN5A 2V2XA 5AD0A 1MWAH 3I6LD 3LKQA 3TZVC 3RWFA 2Q7YA 1KJMA 4QRQA 5EU6A 5GSVA 1M05A 3VXUA 3TA3A 1OSZA 1BQHA 1S9YA 2BCKA 5C0FA 5HHQA 4PRDA 5DEGA 1NEZA 1KTLA 2A83A 5ACZA 4G9DA 5H94A 2MHAA 2WY3A 1KPVA 3KYOA 3VXMA 3ECBA 4E5XA 3BO8A 3HUJA 4NQEA 3VH8A 5IEKA 3MV8A 3HE7A 3CDGA 3G08A 5DEFA 1XR9A 3ARGA 3FOMA 3HCVA 4NQDA 1G6RH 4ELMA 1JPGA 1AKJA 3GSUA 1A1OA 4WO4A 1W0WA 1YDPA 3O9WA 3QDGA 4JFPA 1N3NA 4QRRA 3GMLA 3L3KA 4PRNA 1NAMH 3MRQA 2F53A 2CLRA 1HOCA 3BH9A 3E6HA 5C0DA 2GITA 3DX6A 2BNQA 3FQWA 3KPQA 1A9EA 4G43A 3V5KA 2X4RA 3BP4A 3LKNA 4GKNA 3ES6A 5E8NA
chains in the Genus database with same CATH superfamily
2AXFA 2VLJA 1FO0H 5SWQA 1S7VA 2X4NA 3GJFA 2FO4A 3RL2A 3DXAA 3QQ4A 3C9NA 3VXSA 3L3HA 1G7QA 4U1LA 3H7BA 3RZCA 1KPRA 2V2WA 4GUPA 3PWUA 2BSRA 4MNQA 1QQDA 1FZJA 4ZUSA 5IM7A 1LK2A 1S7XA 4CW1A 4F7TA 5MEPA 3MROA 3TPUE 2X4UA 4PG9A 4G59A 3SDDA 1JE6A 5SWZA 1AGDA 3QUXA 2X4SA 1FZKA 3CC5A 1FFOA 2CIKA 2ZSWA 3I6KA 2X4PA 2CLZA 2UWEA 5C0AA 1RJZA 1LQVA 3QFJA 1HHIA 3GMMA 4L9LC 5D2NA 4PG2A 2X4OA 4PJ9A 5EUOA 3SDCA 3X13A 3BH8A 3D25A 4LCCC 4WJ5A 3QUKA 4JFDA 5D7JC 3VXOA 4ZUUA 3BEWA 1N5AA 1TVBA 3QDMA 3ILQC 3TVMA 4L4TA 4MVBA 4N0FA 1JF1A 3AU1A 3E3QA 3KPRA 3DX8A 1W0VA 5J6GA 3MYJA 4Y4HA 3QDJA 1T1YA 3KPNA 4K71B 1ZHNA 4QRSA 2X4QA 2X70A 1T1ZA 3BXNA 1CE6A 3TO4A 2XFXA 1T21A 1QEWA 3M1BA 4HKJA 4U1KA 3OV6A 4PRHA 3GMNA 4N5EA 5ISZA 5HGAA 3TO2A 3ARBA 3VXNA 3I0TA 4Y2DA 5IB2A 1JGEA 1G7PA 4NO0A 3VWKA 3MV9A 5MENA 5HHMA 1P1ZA 1S7SA 1MHEA 3WL9A 3CPLA 5HYJA 3BGMA 2BVOA 2BVQA 1IM9A 4NQVA 1S9XA 1JGDA 3MRRA 3KPSA 3SKMA 2D31A 4NO2A 3NFNA 4S0UC 4PDCE 3TF7A 2HN7A 1I4FA 3LKPA 2CKBH 4L4VA 1QO3A 4NSKA 4X6CA 2GUOA 3BP7A 5HHNA 1R3HA 5E00A 3FQNA 3UBXA 3VFMA 3TBWA 4E0RA 2ZSVA 3BW9A 4PRIA 3KPPA 4PGCA 4PJHA 4Y4FA 4PRBA 3TIEA 5INDA 1VACA 3MREA 2BSSA 1SYSA 3TJHA 3H9HA 4NNYA 4NT6A 1A9BA 3QULA 1ZT4A 3TBSA 3BZFA 3FOLA 3O3AA 5FA3A 4ZUTA 5F7DA 3ERYA 4MX7A 1S7UA 4JFEA 3D39A 3TBYA 4NO5A 3LKRA 4G42A 4NO3A 1QVOA 3U0PA 1HHGA 5C0EA 3VFRA 3T8XA 3D2UA 3BUYA 2VLLA 3GSNH 1OGTA 1T1XA 4WW2C 1UXSA 3QZWA 3O3DA 1B0GA 1WBZA 2RFXA 5EU4A 4EUPA 3KXFA 4MNGA 3PQYA 4U1SA 5EOTA 1FZMA 3CCHA 3RTQA 5EU3A 1GZPA 1VGKA 2VLKA 3VFUA 2J8UA 4JRXA 4JRYA 4F7CA 1EEYA 3B3IA 1TVHA 4PREA 3D18A 1T1WA 2YPLA 1A1NA 3SDAA 1Z5LA 4I4WA 3QQ3A 1L8JA 3FT4A 3L3GA 3E6FA 1KJ2H 2VE6A 2H6PA 2C7UA 5MEOA 4N0UA 4Z77A 1RK1A 5C0IA 1HHHA 2BSTA 3GSOA 3P4OA 4PGEA 3TFKA 3JTTA 1K5NA 2AKRA 4ZAKA 3V5HA 1Q94A 2BVPA 3LKOA 1RK0A 3PWNA 5IB4A 5J1AA 3VWJA 5BS0A 3HAEA 4PGDA 1HHKA 1MHCA 3P77A 3MRJA 4L8BA 1SYVA 3KWWA 1AGBA 2AV7A 3VJ6A 4HV8A 2GTWA 1JFMA 2HJKA 4O2EA 1AGEA 3VFTA 2OI9A 3QI9A 1ZVSA 3T1FA 4G59C 3MGTA 3L3JA 3VFSA 1T0NA 5HGBA 2FYYA 4MS8A 5C9JA 3X11A 1BD2A 1YN7A 3O3BA 1B0RA 1GZQA 1HYRC 1FFNA 5D7IA 5ENWA 2CLVA 2FZ3A 3HLAA 4PJ5A 3MRFA 1W72A 2X4TA 3MV7A 5L2JA 3FQRA 3GSVA 4CVXA 3P9LA 4HUWA 1OF2A 3MRMA 3RWJA 5MEQA 1ZT7A 1FFPA 2BNRA 1YPZA 3CH1A 5L2KA 3L9RA 3FFCA 5D7LA 1I1YA 3D3VA 4U1NA 5IB5A 2NW3A 3RUGA 3MA7A 2F54A 4D0DA 2YPKA 4NHUE 5F1IA 4XXCA 3GMOA 2NX5A 1ZSDA 1ZHBA 4MJ5A 1ONQA 4D0CA 4PJBA 4HX1A 4F7MA 1DE4A 1PQZA 4APQA 3CZFA 4O2FA 1K8DA 4X6DA 3RWHA 3SPVA 1A6ZA 3FT3A 4U1JA 4FFEX 4L3CA 2ZOKA 3O4LA 3P4MA 3REWA 1UQSA 4PJAA 1DUZA 2P5EA 3MRLA 4JQVA 4MJIA 4U6YA 3O8XA 1T7YA 3L3DA 3RWCA 4PV8A 5MERA 3L3IA 5EU5A 4MQ7A 1T80A 2HJLA 2PO6A 4QOKA 3BHBA 4PRPA 3MRHA 4WU5A 4Y4KA 4PJ7A 1P7QA 3VFOA 4LHUA 1I7RA 3W39A 3VFPA 3SJVA 3GMRA 3OXSA 3P73A 1DUYA 1FZOA 4X6EA 4JFFA 2PYEA 1T7VA 3BVNA 4NQCA 3ARFA 4U1HA 1VADA 1S7RA 3LN4A 3X12A 1UXWA 3VFVA 3X14A 1M6OA 4JQXA 3OXRA 1QRNA 4JFQA 4K7FA 3VFNA 2IA1A 4Z76A 4D0BA 3MRPA 5E6IC 3LKSA 5C08A 3TN0A 5HHPA 3S6CA 1JUFA 4BKWA 3UTSA 1WBXA 4IIQC 2FWOA 3GSRA 1XZ0A 3GSXA 3RGVC 1T0MA 4EI5A 1HSAA 1I1AA 3DX7A 1LP9A 5FA4A 1AGFA 2F74A 1T20A 4L8DA 1N59A 1S7QA 4U1MA 4PP8C 1KPUA 5EO1A 1QR1A 1A1MA 1X7QA 5F9JA 4HS3A 4L3EA 4MJ6A 4QRUA 3QEQA 3VCLA 5IROA 4HWZA 5D9SA 3ROLA 3MGOA 1S8DA 3RWDA 1HSBA 4WU7A 5B39A 1T7XA 3M17A 4HUVA 2NYKA 1TMCA 1B3JA 4ONOA 4PJDA 4QRTA 1E27A 3QUZA 1BIIA 4PJFA 3JTSA 4LNRA 4WDIA 3I6GA 3IXAA 3CVHA 4PJIA 3C8KA 3E2HA 2GJ6A 2VABA 1S7TA 2VAAA 3QFDA 2H26A 4L8SC 4PGBA 1QLFA 1C16A 3ILPA 1WBYA 4HUXA 1KJ3H 1AO7A 3P9MA 5EO0A 3RWIA 5B38A 4CVZA 5C0GA 3VRIA 5IVXA 1INQA 3QUYA 1QSFA 3B6SA 3SDXA 4F7EA 2VLRA 2ESVA 1CG9A 1T7ZA 3BEVA 5D5MA 4PJGA 1T22A 3FTGA 4V3EB 3UTTA 3FQTA 2JCCA 3TIDA 4IRSA 1JPFA 5HHOA 3MRCA 2P5WA 1MI5A 5HGDA 4JFOA 1P4LA 5C0CA 1ZAGA 1EEZA 4UQ2A 4PJEA 5JHDA 4U6XA 3PWJA 2GAZA 1LDPH 3FRUA 5E8PA 3AREA 3TBTA 2E7LE 1I7UA 2FIKA 3WLBA 4IHOA 2YEZA 3PABA 3WS3A 1ZS8A 4FTVA 3UPRA 3KYNA 3VRJA 3WUWA 4WUUA 1LD9A 1OGAA 1U58A 3GSQA 3HE6A 4PV9A 5E9DA 5GSRA 1QSEA 3RWGA 3DBXA 5C07A 4LCYA 1FG2A 3RL1A 4NNXA 5C0BA 3VXPA 3H9SA 4QRPA 5J6HA 3LV3A 4ZUWA 1ZT1A 3BWAA 1NANH 3MRNA 1I7TA 3PWLA 4PJ8A 2AV1A 2CIIA 4I48A 3JTCA 3KPMA 3OX8A 3FT2A 3O3EA 3MRDA 5FKPA 1BZ9A 1JHTA 3PWVA 1S9WA 4IRJA 3ROOA 5IEHA 3MRBA 3HG1A 5C0JA 3DTXA 1E28A 5D2LA 5IB3A 1ZHLA 4N8VA 3VFWA 3PWPA 1LEKA 3WS6A 1RJYA 3JVGA 4L29A 1AGCA 1ZHKA 5INCA 5FDWA 4ZUVA 3GIVA 2OL3H 4LCWA 3P4NA 5EFIA 1DDHA 3MRIA 4MXQA 4WWKC 4ZFZA 5F1NA 1KJVA 4JO8A 1YN6A 1EXUA 5HGHA 3HPJA 4F7PA 4G9FA 3AM8A 3VXRA 4EN3C 3SKOA 2GTZA 4GKSA 4NQXA 1EFXA 5E8OA 1KCGC 3FQXA 4HUUA 4X6FA 4UQ3A 3V5DA 1S7WA 4Y16A 4N0CA 3MRKA 3GSWA 2DYPA 1XR8A 3KPLA 5DDHA 5BXFA 4PJCA 5BRZA 2O5NA 2GT9A 4G8GA 4U1IA 3IT8D 5IB1A 3KPOA 3KLAA 1N2RA 1I1FA 4G8IA 4PJXA 3RWEA 4O2CA 3ARDA 3SCMA 4PR5A 3TBVA 1IM3A 5SWSA 3UTQA 1HHJA 2AK4A 3MR9A 3GMQA 3DMMA 1LEGA 2AXGA 1T7WA 2XPGA 3MRGA 3FQUA 4PRAA 2HLAA 3W0WA 1KBGH 3BZEA 1CD1A 1ED3A 1XH3A 2ZOLA 3FONA 3GMPA 4L8CA 4Z78A 5BJTA 4V3DB 5C09A 3LN5A 2V2XA 5AD0A 1MWAH 3I6LD 3LKQA 3TZVC 3RWFA 2Q7YA 1KJMA 4QRQA 5EU6A 5GSVA 1M05A 3VXUA 3TA3A 1OSZA 1BQHA 1S9YA 2BCKA 5C0FA 5HHQA 4PRDA 5DEGA 1NEZA 1KTLA 2A83A 5ACZA 4G9DA 5H94A 2MHAA 2WY3A 1KPVA 3KYOA 3VXMA 3ECBA 4E5XA 3BO8A 3HUJA 4NQEA 3VH8A 5IEKA 3MV8A 3HE7A 3CDGA 3G08A 5DEFA 1XR9A 3ARGA 3FOMA 3HCVA 4NQDA 1G6RH 4ELMA 1JPGA 1AKJA 3GSUA 1A1OA 4WO4A 1W0WA 1YDPA 3O9WA 3QDGA 4JFPA 1N3NA 4QRRA 3GMLA 3L3KA 4PRNA 1NAMH 3MRQA 2F53A 2CLRA 1HOCA 3BH9A 3E6HA 5C0DA 2GITA 3DX6A 2BNQA 3FQWA 3KPQA 1A9EA 4G43A 3V5KA 2X4RA 3BP4A 3LKNA 4GKNA 3ES6A 5E8NA
chains in the Genus database with same CATH topology
2AXFA 2VLJA 1FO0H 5SWQA 1S7VA 2X4NA 3GJFA 2FO4A 3RL2A 3DXAA 3QQ4A 3C9NA 3VXSA 3L3HA 1G7QA 4U1LA 3H7BA 3RZCA 1KPRA 2V2WA 4GUPA 3PWUA 2BSRA 4MNQA 1QQDA 1FZJA 4ZUSA 5IM7A 1LK2A 1S7XA 4CW1A 4F7TA 5MEPA 3MROA 3TPUE 2X4UA 4PG9A 4G59A 3SDDA 1JE6A 5SWZA 1AGDA 3QUXA 2X4SA 1FZKA 3CC5A 1FFOA 2CIKA 2ZSWA 3I6KA 2X4PA 2CLZA 2UWEA 5C0AA 1RJZA 1LQVA 3QFJA 1HHIA 3GMMA 4L9LC 5D2NA 4PG2A 2X4OA 4PJ9A 5EUOA 3SDCA 3X13A 3BH8A 3D25A 4LCCC 4WJ5A 3QUKA 4JFDA 5D7JC 3VXOA 4ZUUA 3BEWA 1N5AA 1TVBA 3QDMA 3ILQC 3TVMA 4L4TA 4MVBA 4N0FA 1JF1A 3AU1A 3E3QA 3KPRA 3DX8A 1W0VA 5J6GA 3MYJA 4Y4HA 3QDJA 1T1YA 3KPNA 4K71B 1ZHNA 4QRSA 2X4QA 2X70A 1T1ZA 3BXNA 1CE6A 3TO4A 2XFXA 1T21A 1QEWA 3M1BA 4HKJA 4U1KA 3OV6A 4PRHA 3GMNA 4N5EA 5ISZA 5HGAA 3TO2A 3ARBA 3VXNA 4Y2DA 5IB2A 1JGEA 1G7PA 4NO0A 3VWKA 3MV9A 5MENA 5HHMA 1P1ZA 1S7SA 1MHEA 3WL9A 3CPLA 5HYJA 3BGMA 2BVOA 2BVQA 1IM9A 4NQVA 1S9XA 1JGDA 3MRRA 3KPSA 3SKMA 2D31A 4NO2A 3NFNA 4S0UC 4PDCE 3TF7A 2HN7A 1I4FA 3LKPA 2CKBH 4L4VA 1QO3A 4NSKA 4X6CA 2GUOA 3BP7A 5HHNA 1R3HA 5E00A 3FQNA 3UBXA 3VFMA 3TBWA 4E0RA 2ZSVA 3BW9A 4PRIA 3KPPA 4PGCA 4PJHA 4Y4FA 4PRBA 3TIEA 5INDA 1VACA 3MREA 2BSSA 1SYSA 3TJHA 3H9HA 4NNYA 4NT6A 1A9BA 3QULA 1ZT4A 3TBSA 3BZFA 3FOLA 3O3AA 5FA3A 4ZUTA 5F7DA 3ERYA 4MX7A 1S7UA 4JFEA 3D39A 3TBYA 4NO5A 3LKRA 4G42A 4NO3A 1QVOA 3U0PA 1HHGA 5C0EA 3VFRA 3T8XA 3D2UA 3BUYA 2VLLA 3GSNH 1OGTA 1T1XA 4WW2C 1UXSA 3QZWA 3O3DA 1B0GA 1WBZA 2RFXA 5EU4A 4EUPA 3KXFA 4MNGA 3PQYA 4U1SA 5EOTA 1FZMA 3CCHA 3RTQA 5EU3A 1GZPA 1VGKA 2VLKA 3VFUA 2J8UA 4JRXA 4JRYA 4F7CA 1EEYA 3B3IA 1TVHA 4PREA 3D18A 1T1WA 2YPLA 1A1NA 3SDAA 1Z5LA 4I4WA 3QQ3A 1L8JA 3FT4A 3L3GA 3E6FA 1KJ2H 2VE6A 2H6PA 2C7UA 5MEOA 4N0UA 4Z77A 1RK1A 5C0IA 1HHHA 2BSTA 3GSOA 3P4OA 4PGEA 3TFKA 3JTTA 1K5NA 2AKRA 4ZAKA 3V5HA 1Q94A 2BVPA 3LKOA 1RK0A 3PWNA 5IB4A 5J1AA 3VWJA 5BS0A 3HAEA 4PGDA 1HHKA 1MHCA 3P77A 3MRJA 4L8BA 1SYVA 3KWWA 1AGBA 2AV7A 3VJ6A 4HV8A 2GTWA 1JFMA 2HJKA 4O2EA 1AGEA 3VFTA 2OI9A 3QI9A 1ZVSA 3T1FA 3MGTA 3L3JA 3VFSA 1T0NA 5HGBA 2FYYA 4MS8A 5C9JA 3X11A 1BD2A 1YN7A 3O3BA 1B0RA 1GZQA 1HYRC 1FFNA 5D7IA 5ENWA 2CLVA 2FZ3A 3HLAA 4PJ5A 3MRFA 1W72A 2X4TA 3MV7A 5L2JA 3FQRA 3GSVA 4CVXA 3P9LA 4HUWA 1OF2A 3MRMA 3RWJA 5MEQA 1ZT7A 1FFPA 2BNRA 1YPZA 3CH1A 5L2KA 3L9RA 3FFCA 5D7LA 1I1YA 3D3VA 4U1NA 5IB5A 2NW3A 3RUGA 3MA7A 2F54A 4D0DA 2YPKA 4NHUE 5F1IA 4XXCA 3GMOA 2NX5A 1ZSDA 1ZHBA 4MJ5A 1ONQA 4D0CA 4PJBA 4HX1A 4F7MA 1DE4A 1PQZA 4APQA 3CZFA 4O2FA 1K8DA 4X6DA 3RWHA 3SPVA 1A6ZA 3FT3A 4U1JA 4FFEX 4L3CA 2ZOKA 3O4LA 3P4MA 3REWA 1UQSA 4PJAA 1DUZA 2P5EA 3MRLA 4JQVA 4MJIA 4U6YA 3O8XA 1T7YA 3L3DA 3RWCA 4PV8A 5MERA 3L3IA 5EU5A 4MQ7A 1T80A 2HJLA 2PO6A 4QOKA 3BHBA 4PRPA 3MRHA 4WU5A 4Y4KA 4PJ7A 1P7QA 3VFOA 4LHUA 1I7RA 3W39A 3VFPA 3SJVA 3GMRA 3OXSA 3P73A 1DUYA 1FZOA 4X6EA 4JFFA 2PYEA 1T7VA 3BVNA 4NQCA 3ARFA 4U1HA 1VADA 1S7RA 3LN4A 3X12A 1UXWA 3VFVA 3X14A 1M6OA 4JQXA 3OXRA 1QRNA 4JFQA 4K7FA 3VFNA 4Z76A 4D0BA 3MRPA 5E6IC 3LKSA 5C08A 3TN0A 5HHPA 3S6CA 1JUFA 3UTSA 1WBXA 4IIQC 2FWOA 3GSRA 1XZ0A 3GSXA 3RGVC 1T0MA 4EI5A 1HSAA 1I1AA 3DX7A 1LP9A 5FA4A 1AGFA 2F74A 1T20A 4L8DA 1N59A 1S7QA 4U1MA 4PP8C 1KPUA 5EO1A 1QR1A 1A1MA 1X7QA 5F9JA 4HS3A 4L3EA 4MJ6A 4QRUA 3QEQA 3VCLA 5IROA 4HWZA 5D9SA 3ROLA 3MGOA 1S8DA 3RWDA 1HSBA 4WU7A 5B39A 1T7XA 3M17A 4HUVA 1TMCA 1B3JA 4ONOA 4PJDA 4QRTA 1E27A 3QUZA 1BIIA 4PJFA 3JTSA 4LNRA 4WDIA 3I6GA 3IXAA 3CVHA 4PJIA 3C8KA 3E2HA 2GJ6A 2VABA 1S7TA 2VAAA 3QFDA 2H26A 4L8SC 4PGBA 1QLFA 1C16A 3ILPA 1WBYA 4HUXA 1KJ3H 1AO7A 3P9MA 5EO0A 3RWIA 5B38A 4CVZA 5C0GA 3VRIA 5IVXA 1INQA 3QUYA 1QSFA 3B6SA 3SDXA 4F7EA 2VLRA 2ESVA 1CG9A 1T7ZA 3BEVA 5D5MA 4PJGA 1T22A 3FTGA 4V3EB 3UTTA 3FQTA 2JCCA 3TIDA 4IRSA 1JPFA 5HHOA 3MRCA 2P5WA 1MI5A 5HGDA 4JFOA 1P4LA 5C0CA 1ZAGA 1EEZA 4UQ2A 4PJEA 5JHDA 4U6XA 3PWJA 2GAZA 1LDPH 3FRUA 5E8PA 3AREA 3TBTA 2E7LE 1I7UA 2FIKA 3WLBA 4IHOA 2YEZA 3PABA 3WS3A 1ZS8A 4FTVA 3UPRA 3KYNA 3VRJA 3WUWA 4WUUA 1LD9A 1OGAA 1U58A 3GSQA 3HE6A 4PV9A 5E9DA 5GSRA 1QSEA 3RWGA 3DBXA 5C07A 4LCYA 1FG2A 3RL1A 4NNXA 5C0BA 3VXPA 3H9SA 4QRPA 5J6HA 3LV3A 4ZUWA 1ZT1A 3BWAA 1NANH 3MRNA 1I7TA 3PWLA 4PJ8A 2AV1A 2CIIA 4I48A 3JTCA 3KPMA 3OX8A 3FT2A 3O3EA 3MRDA 5FKPA 1BZ9A 1JHTA 3PWVA 1S9WA 4IRJA 3ROOA 5IEHA 3MRBA 3HG1A 5C0JA 3DTXA 1E28A 5D2LA 5IB3A 1ZHLA 4N8VA 3VFWA 3PWPA 1LEKA 3WS6A 1RJYA 3JVGA 4L29A 1AGCA 1ZHKA 5INCA 5FDWA 4ZUVA 3GIVA 2OL3H 4LCWA 3P4NA 5EFIA 1DDHA 3MRIA 4MXQA 4WWKC 4ZFZA 5F1NA 1KJVA 1YN6A 1EXUA 5HGHA 3HPJA 4F7PA 4G9FA 3AM8A 3VXRA 4EN3C 3SKOA 2GTZA 4GKSA 4NQXA 1EFXA 5E8OA 1KCGC 3FQXA 4HUUA 4X6FA 4UQ3A 3V5DA 1S7WA 4Y16A 4N0CA 3MRKA 3GSWA 2DYPA 1XR8A 3KPLA 5DDHA 5BXFA 4PJCA 5BRZA 4G8GA 2GT9A 4U1IA 3IT8D 5IB1A 3KPOA 3KLAA 1N2RA 1I1FA 4G8IA 4PJXA 3RWEA 4O2CA 3ARDA 3SCMA 4PR5A 3TBVA 1IM3A 5SWSA 3UTQA 1HHJA 2AK4A 3MR9A 3GMQA 3DMMA 1LEGA 2AXGA 1T7WA 2XPGA 3MRGA 3FQUA 4PRAA 2HLAA 3W0WA 1KBGH 3BZEA 1CD1A 1ED3A 1XH3A 2ZOLA 3FONA 3GMPA 4L8CA 4Z78A 5BJTA 4V3DB 5C09A 3LN5A 2V2XA 5AD0A 1MWAH 3I6LD 3LKQA 3TZVC 3RWFA 2Q7YA 1KJMA 4QRQA 5EU6A 5GSVA 1M05A 3VXUA 3TA3A 1OSZA 1BQHA 1S9YA 2BCKA 5C0FA 5HHQA 4PRDA 5DEGA 1NEZA 1KTLA 2A83A 5ACZA 4G9DA 5H94A 2MHAA 2WY3A 1KPVA 3KYOA 3VXMA 3ECBA 4E5XA 3BO8A 3HUJA 4NQEA 3VH8A 5IEKA 3MV8A 3HE7A 3CDGA 3G08A 5DEFA 1XR9A 3ARGA 3FOMA 3HCVA 4NQDA 1G6RH 4ELMA 1JPGA 1AKJA 3GSUA 1A1OA 4WO4A 1W0WA 1YDPA 3O9WA 3QDGA 4JFPA 1N3NA 4QRRA 3GMLA 3L3KA 4PRNA 1NAMH 3MRQA 2F53A 2CLRA 1HOCA 3BH9A 3E6HA 5C0DA 2GITA 3DX6A 2BNQA 3FQWA 3KPQA 1A9EA 4G43A 3V5KA 2X4RA 3BP4A 3LKNA 4GKNA 3ES6A 5E8NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AXF A;  2VLJ A;  1FO0 H;  5SWQ A;  1S7V A;  2X4N A;  3GJF A;  2FO4 A;  3RL2 A;  3DXA A;  3QQ4 A;  3C9N A;  3VXS A;  3L3H A;  1G7Q A;  4U1L A;  3H7B A;  3RZC A;  1KPR A;  2V2W A;  4GUP A;  3PWU A;  2BSR A;  4MNQ A;  1QQD A;  1FZJ A;  4ZUS A;  5IM7 A;  1LK2 A;  1S7X A;  4CW1 A;  4F7T A;  5MEP A;  3MRO A;  3TPU E;  2X4U A;  4PG9 A;  4G59 A;  3SDD A;  1JE6 A;  5SWZ A;  1AGD A;  3QUX A;  2X4S A;  1FZK A;  3CC5 A;  1FFO A;  2CIK A;  2ZSW A;  3I6K A;  2X4P A;  2CLZ A;  2UWE A;  5C0A A;  1RJZ A;  1LQV A;  3QFJ A;  1HHI A;  3GMM A;  4L9L C;  5D2N A;  4PG2 A;  2X4O A;  4PJ9 A;  5EUO A;  3SDC A;  3X13 A;  3BH8 A;  3D25 A;  4LCC C;  4WJ5 A;  3QUK A;  4JFD A;  5D7J C;  3VXO A;  4ZUU A;  3BEW A;  1N5A A;  1TVB A;  3QDM A;  3ILQ C;  3TVM A;  4L4T A;  4MVB A;  4N0F A;  1JF1 A;  3AU1 A;  3E3Q A;  3KPR A;  3DX8 A;  1W0V A;  5J6G A;  3MYJ A;  4Y4H A;  3QDJ A;  1T1Y A;  3KPN A;  4K71 B;  1ZHN A;  4QRS A;  2X4Q A;  2X70 A;  1T1Z A;  3BXN A;  1CE6 A;  3TO4 A;  2XFX A;  1T21 A;  1QEW A;  3M1B A;  4HKJ A;  4U1K A;  3OV6 A;  4PRH A;  3GMN A;  4N5E A;  5ISZ A;  5HGA A;  3TO2 A;  3ARB A;  3VXN A;  4Y2D A;  5IB2 A;  1JGE A;  1G7P A;  4NO0 A;  3VWK A;  3MV9 A;  5MEN A;  5HHM A;  1P1Z A;  1S7S A;  1MHE A;  3WL9 A;  3CPL A;  5HYJ A;  3BGM A;  2BVO A;  2BVQ A;  1IM9 A;  4NQV A;  1S9X A;  1JGD A;  3MRR A;  3KPS A;  3SKM A;  2D31 A;  4NO2 A;  3NFN A;  4S0U C;  4PDC E;  3TF7 A;  2HN7 A;  1I4F A;  3LKP A;  2CKB H;  4L4V A;  1QO3 A;  4NSK A;  4X6C A;  2GUO A;  3BP7 A;  5HHN A;  1R3H A;  5E00 A;  3FQN A;  3UBX A;  3VFM A;  3TBW A;  4E0R A;  2ZSV A;  3BW9 A;  4PRI A;  3KPP A;  4PGC A;  4PJH A;  4Y4F A;  4PRB A;  3TIE A;  5IND A;  1VAC A;  3MRE A;  2BSS A;  1SYS A;  3TJH A;  3H9H A;  4NNY A;  4NT6 A;  1A9B A;  3QUL A;  1ZT4 A;  3TBS A;  3BZF A;  3FOL A;  3O3A A;  5FA3 A;  4ZUT A;  5F7D A;  3ERY A;  4MX7 A;  1S7U A;  4JFE A;  3D39 A;  3TBY A;  4NO5 A;  3LKR A;  4G42 A;  4NO3 A;  1QVO A;  3U0P A;  1HHG A;  5C0E A;  3VFR A;  3T8X A;  3D2U A;  3BUY A;  2VLL A;  3GSN H;  1OGT A;  1T1X A;  4WW2 C;  1UXS A;  3QZW A;  3O3D A;  1B0G A;  1WBZ A;  2RFX A;  5EU4 A;  4EUP A;  3KXF A;  4MNG A;  3PQY A;  4U1S A;  5EOT A;  1FZM A;  3CCH A;  3RTQ A;  5EU3 A;  1GZP A;  1VGK A;  2VLK A;  3VFU A;  2J8U A;  4JRX A;  4JRY A;  4F7C A;  1EEY A;  3B3I A;  1TVH A;  4PRE A;  3D18 A;  1T1W A;  2YPL A;  1A1N A;  3SDA A;  1Z5L A;  4I4W A;  3QQ3 A;  1L8J A;  3FT4 A;  3L3G A;  3E6F A;  1KJ2 H;  2VE6 A;  2H6P A;  2C7U A;  5MEO A;  4N0U A;  4Z77 A;  1RK1 A;  5C0I A;  1HHH A;  2BST A;  3GSO A;  3P4O A;  4PGE A;  3TFK A;  3JTT A;  1K5N A;  2AKR A;  4ZAK A;  3V5H A;  1Q94 A;  2BVP A;  3LKO A;  1RK0 A;  3PWN A;  5IB4 A;  5J1A A;  3VWJ A;  5BS0 A;  3HAE A;  4PGD A;  1HHK A;  1MHC A;  3P77 A;  3MRJ A;  4L8B A;  1SYV A;  3KWW A;  1AGB A;  2AV7 A;  3VJ6 A;  4HV8 A;  2GTW A;  1JFM A;  2HJK A;  4O2E A;  1AGE A;  3VFT A;  2OI9 A;  3QI9 A;  1ZVS A;  3T1F A;  3MGT A;  3L3J A;  3VFS A;  1T0N A;  5HGB A;  2FYY A;  4MS8 A;  5C9J A;  3X11 A;  1BD2 A;  1YN7 A;  3O3B A;  1B0R A;  1GZQ A;  1HYR C;  1FFN A;  5D7I A;  5ENW A;  2CLV A;  2FZ3 A;  3HLA A;  4PJ5 A;  3MRF A;  1W72 A;  2X4T A;  3MV7 A;  5L2J A;  3FQR A;  3GSV A;  4CVX A;  3P9L A;  4HUW A;  1OF2 A;  3MRM A;  3RWJ A;  5MEQ A;  1ZT7 A;  1FFP A;  2BNR A;  1YPZ A;  3CH1 A;  5L2K A;  3L9R A;  3FFC A;  5D7L A;  1I1Y A;  3D3V A;  4U1N A;  5IB5 A;  2NW3 A;  3RUG A;  3MA7 A;  2F54 A;  4D0D A;  2YPK A;  4NHU E;  5F1I A;  4XXC A;  3GMO A;  2NX5 A;  1ZSD A;  1ZHB A;  4MJ5 A;  1ONQ A;  4D0C A;  4PJB A;  4HX1 A;  4F7M A;  1DE4 A;  1PQZ A;  4APQ A;  3CZF A;  4O2F A;  1K8D A;  4X6D A;  3RWH A;  3SPV A;  1A6Z A;  3FT3 A;  4U1J A;  4FFE X;  4L3C A;  2ZOK A;  3O4L A;  3P4M A;  3REW A;  1UQS A;  4PJA A;  1DUZ A;  2P5E A;  3MRL A;  4JQV A;  4MJI A;  4U6Y A;  3O8X A;  1T7Y A;  3L3D A;  3RWC A;  4PV8 A;  5MER A;  3L3I A;  5EU5 A;  4MQ7 A;  1T80 A;  2HJL A;  2PO6 A;  4QOK A;  3BHB A;  4PRP A;  3MRH A;  4WU5 A;  4Y4K A;  4PJ7 A;  1P7Q A;  3VFO A;  4LHU A;  1I7R A;  3W39 A;  3VFP A;  3SJV A;  3GMR A;  3OXS A;  3P73 A;  1DUY A;  1FZO A;  4X6E A;  4JFF A;  2PYE A;  1T7V A;  3BVN A;  4NQC A;  3ARF A;  4U1H A;  1VAD A;  1S7R A;  3LN4 A;  3X12 A;  1UXW A;  3VFV A;  3X14 A;  1M6O A;  4JQX A;  3OXR A;  1QRN A;  4JFQ A;  4K7F A;  3VFN A;  4Z76 A;  4D0B A;  3MRP A;  5E6I C;  3LKS A;  5C08 A;  3TN0 A;  5HHP A;  3S6C A;  1JUF A;  3UTS A;  1WBX A;  4IIQ C;  2FWO A;  3GSR A;  1XZ0 A;  3GSX A;  3RGV C;  1T0M A;  4EI5 A;  1HSA A;  1I1A A;  3DX7 A;  1LP9 A;  5FA4 A;  1AGF A;  2F74 A;  1T20 A;  4L8D A;  1N59 A;  1S7Q A;  4U1M A;  4PP8 C;  1KPU A;  5EO1 A;  1QR1 A;  1A1M A;  1X7Q A;  5F9J A;  4HS3 A;  4L3E A;  4MJ6 A;  4QRU A;  3QEQ A;  3VCL A;  5IRO A;  4HWZ A;  5D9S A;  3ROL A;  3MGO A;  1S8D A;  3RWD A;  1HSB A;  4WU7 A;  5B39 A;  1T7X A;  3M17 A;  4HUV A;  1TMC A;  1B3J A;  4ONO A;  4PJD A;  4QRT A;  1E27 A;  3QUZ A;  1BII A;  4PJF A;  3JTS A;  4LNR A;  4WDI A;  3I6G A;  3IXA A;  3CVH A;  4PJI A;  3C8K A;  3E2H A;  2GJ6 A;  2VAB A;  1S7T A;  2VAA A;  3QFD A;  2H26 A;  4L8S C;  4PGB A;  1QLF A;  1C16 A;  3ILP A;  1WBY A;  4HUX A;  1KJ3 H;  1AO7 A;  3P9M A;  5EO0 A;  3RWI A;  5B38 A;  4CVZ A;  5C0G A;  3VRI A;  5IVX A;  1INQ A;  3QUY A;  1QSF A;  3B6S A;  3SDX A;  4F7E A;  2VLR A;  2ESV A;  1CG9 A;  1T7Z A;  3BEV A;  5D5M A;  4PJG A;  1T22 A;  3FTG A;  4V3E B;  3UTT A;  3FQT A;  2JCC A;  3TID A;  4IRS A;  1JPF A;  5HHO A;  3MRC A;  2P5W A;  1MI5 A;  5HGD A;  4JFO A;  1P4L A;  5C0C A;  1ZAG A;  1EEZ A;  4UQ2 A;  4PJE A;  5JHD A;  4U6X A;  3PWJ A;  2GAZ A;  1LDP H;  3FRU A;  5E8P A;  3ARE A;  3TBT A;  2E7L E;  1I7U A;  2FIK A;  3WLB A;  4IHO A;  2YEZ A;  3PAB A;  3WS3 A;  1ZS8 A;  4FTV A;  3UPR A;  3KYN A;  3VRJ A;  3WUW A;  4WUU A;  1LD9 A;  1OGA A;  1U58 A;  3GSQ A;  3HE6 A;  4PV9 A;  5E9D A;  5GSR A;  1QSE A;  3RWG A;  3DBX A;  5C07 A;  4LCY A;  1FG2 A;  3RL1 A;  4NNX A;  5C0B A;  3VXP A;  3H9S A;  4QRP A;  5J6H A;  3LV3 A;  4ZUW A;  1ZT1 A;  3BWA A;  1NAN H;  3MRN A;  1I7T A;  3PWL A;  4PJ8 A;  2AV1 A;  2CII A;  4I48 A;  3JTC A;  3KPM A;  3OX8 A;  3FT2 A;  3O3E A;  3MRD A;  5FKP A;  1BZ9 A;  1JHT A;  3PWV A;  1S9W A;  4IRJ A;  3ROO A;  5IEH A;  3MRB A;  3HG1 A;  5C0J A;  3DTX A;  1E28 A;  5D2L A;  5IB3 A;  1ZHL A;  4N8V A;  3VFW A;  3PWP A;  1LEK A;  3WS6 A;  1RJY A;  3JVG A;  4L29 A;  1AGC A;  1ZHK A;  5INC A;  5FDW A;  4ZUV A;  3GIV A;  2OL3 H;  4LCW A;  3P4N A;  5EFI A;  1DDH A;  3MRI A;  4MXQ A;  4WWK C;  4ZFZ A;  5F1N A;  1KJV A;  1YN6 A;  1EXU A;  5HGH A;  3HPJ A;  4F7P A;  4G9F A;  3AM8 A;  3VXR A;  4EN3 C;  3SKO A;  2GTZ A;  4GKS A;  4NQX A;  1EFX A;  5E8O A;  1KCG C;  3FQX A;  4HUU A;  4X6F A;  4UQ3 A;  3V5D A;  1S7W A;  4Y16 A;  4N0C A;  3MRK A;  3GSW A;  2DYP A;  1XR8 A;  3KPL A;  5DDH A;  5BXF A;  4PJC A;  5BRZ A;  4G8G A;  2GT9 A;  4U1I A;  3IT8 D;  5IB1 A;  3KPO A;  3KLA A;  1N2R A;  1I1F A;  4G8I A;  4PJX A;  3RWE A;  4O2C A;  3ARD A;  3SCM A;  4PR5 A;  3TBV A;  1IM3 A;  5SWS A;  3UTQ A;  1HHJ A;  2AK4 A;  3MR9 A;  3GMQ A;  3DMM A;  1LEG A;  2AXG A;  1T7W A;  2XPG A;  3MRG A;  3FQU A;  4PRA A;  2HLA A;  3W0W A;  1KBG H;  3BZE A;  1CD1 A;  1ED3 A;  1XH3 A;  2ZOL A;  3FON A;  3GMP A;  4L8C A;  4Z78 A;  5BJT A;  4V3D B;  5C09 A;  3LN5 A;  2V2X A;  5AD0 A;  1MWA H;  3I6L D;  3LKQ A;  3TZV C;  3RWF A;  2Q7Y A;  1KJM A;  4QRQ A;  5EU6 A;  5GSV A;  1M05 A;  3VXU A;  3TA3 A;  1OSZ A;  1BQH A;  1S9Y A;  2BCK A;  5C0F A;  5HHQ A;  4PRD A;  5DEG A;  1NEZ A;  1KTL A;  2A83 A;  5ACZ A;  4G9D A;  5H94 A;  2MHA A;  2WY3 A;  1KPV A;  3KYO A;  3VXM A;  3ECB A;  4E5X A;  3BO8 A;  3HUJ A;  4NQE A;  3VH8 A;  5IEK A;  3MV8 A;  3HE7 A;  3CDG A;  3G08 A;  5DEF A;  1XR9 A;  3ARG A;  3FOM A;  3HCV A;  4NQD A;  1G6R H;  4ELM A;  1JPG A;  1AKJ A;  3GSU A;  1A1O A;  4WO4 A;  1W0W A;  1YDP A;  3O9W A;  3QDG A;  4JFP A;  1N3N A;  4QRR A;  3GML A;  3L3K A;  4PRN A;  1NAM H;  3MRQ A;  2F53 A;  2CLR A;  1HOC A;  3BH9 A;  3E6H A;  5C0D A;  2GIT A;  3DX6 A;  2BNQ A;  3FQW A;  3KPQ A;  1A9E A;  4G43 A;  3V5K A;  2X4R A;  3BP4 A;  3LKN A;  4GKN A;  3ES6 A;  5E8N A; 
#chains in the Genus database with same CATH topology
 2AXF A;  2VLJ A;  1FO0 H;  5SWQ A;  1S7V A;  2X4N A;  3GJF A;  2FO4 A;  3RL2 A;  3DXA A;  3QQ4 A;  3C9N A;  3VXS A;  3L3H A;  1G7Q A;  4U1L A;  3H7B A;  3RZC A;  1KPR A;  2V2W A;  4GUP A;  3PWU A;  2BSR A;  4MNQ A;  1QQD A;  1FZJ A;  4ZUS A;  5IM7 A;  1LK2 A;  1S7X A;  4CW1 A;  4F7T A;  5MEP A;  3MRO A;  3TPU E;  2X4U A;  4PG9 A;  4G59 A;  3SDD A;  1JE6 A;  5SWZ A;  1AGD A;  3QUX A;  2X4S A;  1FZK A;  3CC5 A;  1FFO A;  2CIK A;  2ZSW A;  3I6K A;  2X4P A;  2CLZ A;  2UWE A;  5C0A A;  1RJZ A;  1LQV A;  3QFJ A;  1HHI A;  3GMM A;  4L9L C;  5D2N A;  4PG2 A;  2X4O A;  4PJ9 A;  5EUO A;  3SDC A;  3X13 A;  3BH8 A;  3D25 A;  4LCC C;  4WJ5 A;  3QUK A;  4JFD A;  5D7J C;  3VXO A;  4ZUU A;  3BEW A;  1N5A A;  1TVB A;  3QDM A;  3ILQ C;  3TVM A;  4L4T A;  4MVB A;  4N0F A;  1JF1 A;  3AU1 A;  3E3Q A;  3KPR A;  3DX8 A;  1W0V A;  5J6G A;  3MYJ A;  4Y4H A;  3QDJ A;  1T1Y A;  3KPN A;  4K71 B;  1ZHN A;  4QRS A;  2X4Q A;  2X70 A;  1T1Z A;  3BXN A;  1CE6 A;  3TO4 A;  2XFX A;  1T21 A;  1QEW A;  3M1B A;  4HKJ A;  4U1K A;  3OV6 A;  4PRH A;  3GMN A;  4N5E A;  5ISZ A;  5HGA A;  3TO2 A;  3ARB A;  3VXN A;  3I0T A;  4Y2D A;  5IB2 A;  1JGE A;  1G7P A;  4NO0 A;  3VWK A;  3MV9 A;  5MEN A;  5HHM A;  1P1Z A;  1S7S A;  1MHE A;  3WL9 A;  3CPL A;  5HYJ A;  3BGM A;  2BVO A;  2BVQ A;  1IM9 A;  4NQV A;  1S9X A;  1JGD A;  3MRR A;  3KPS A;  3SKM A;  2D31 A;  4NO2 A;  3NFN A;  4S0U C;  4PDC E;  3TF7 A;  2HN7 A;  1I4F A;  3LKP A;  2CKB H;  4L4V A;  1QO3 A;  4NSK A;  4X6C A;  2GUO A;  3BP7 A;  5HHN A;  1R3H A;  5E00 A;  3FQN A;  3UBX A;  3VFM A;  3TBW A;  4E0R A;  2ZSV A;  3BW9 A;  4PRI A;  3KPP A;  4PGC A;  4PJH A;  4Y4F A;  4PRB A;  3TIE A;  5IND A;  1VAC A;  3MRE A;  2BSS A;  1SYS A;  3TJH A;  3H9H A;  4NNY A;  4NT6 A;  1A9B A;  3QUL A;  1ZT4 A;  3TBS A;  3BZF A;  3FOL A;  3O3A A;  5FA3 A;  4ZUT A;  5F7D A;  3ERY A;  4MX7 A;  1S7U A;  4JFE A;  3D39 A;  3TBY A;  4NO5 A;  3LKR A;  4G42 A;  4NO3 A;  1QVO A;  3U0P A;  1HHG A;  5C0E A;  3VFR A;  3T8X A;  3D2U A;  3BUY A;  2VLL A;  3GSN H;  1OGT A;  1T1X A;  4WW2 C;  1UXS A;  3QZW A;  3O3D A;  1B0G A;  1WBZ A;  2RFX A;  5EU4 A;  4EUP A;  3KXF A;  4MNG A;  3PQY A;  4U1S A;  5EOT A;  1FZM A;  3CCH A;  3RTQ A;  5EU3 A;  1GZP A;  1VGK A;  2VLK A;  3VFU A;  2J8U A;  4JRX A;  4JRY A;  4F7C A;  1EEY A;  3B3I A;  1TVH A;  4PRE A;  3D18 A;  1T1W A;  2YPL A;  1A1N A;  3SDA A;  1Z5L A;  4I4W A;  3QQ3 A;  1L8J A;  3FT4 A;  3L3G A;  3E6F A;  1KJ2 H;  2VE6 A;  2H6P A;  2C7U A;  5MEO A;  4N0U A;  4Z77 A;  1RK1 A;  5C0I A;  1HHH A;  2BST A;  3GSO A;  3P4O A;  4PGE A;  3TFK A;  3JTT A;  1K5N A;  2AKR A;  4ZAK A;  3V5H A;  1Q94 A;  2BVP A;  3LKO A;  1RK0 A;  3PWN A;  5IB4 A;  5J1A A;  3VWJ A;  5BS0 A;  3HAE A;  4PGD A;  1HHK A;  1MHC A;  3P77 A;  3MRJ A;  4L8B A;  1SYV A;  3KWW A;  1AGB A;  2AV7 A;  3VJ6 A;  4HV8 A;  2GTW A;  1JFM A;  2HJK A;  4O2E A;  1AGE A;  3VFT A;  2OI9 A;  3QI9 A;  1ZVS A;  3T1F A;  4G59 C;  3MGT A;  3L3J A;  3VFS A;  1T0N A;  5HGB A;  2FYY A;  4MS8 A;  5C9J A;  3X11 A;  1BD2 A;  1YN7 A;  3O3B A;  1B0R A;  1GZQ A;  1HYR C;  1FFN A;  5D7I A;  5ENW A;  2CLV A;  2FZ3 A;  3HLA A;  4PJ5 A;  3MRF A;  1W72 A;  2X4T A;  3MV7 A;  5L2J A;  3FQR A;  3GSV A;  4CVX A;  3P9L A;  4HUW A;  1OF2 A;  3MRM A;  3RWJ A;  5MEQ A;  1ZT7 A;  1FFP A;  2BNR A;  1YPZ A;  3CH1 A;  5L2K A;  3L9R A;  3FFC A;  5D7L A;  1I1Y A;  3D3V A;  4U1N A;  5IB5 A;  2NW3 A;  3RUG A;  3MA7 A;  2F54 A;  4D0D A;  2YPK A;  4NHU E;  5F1I A;  4XXC A;  3GMO A;  2NX5 A;  1ZSD A;  1ZHB A;  4MJ5 A;  1ONQ A;  4D0C A;  4PJB A;  4HX1 A;  4F7M A;  1DE4 A;  1PQZ A;  4APQ A;  3CZF A;  4O2F A;  1K8D A;  4X6D A;  3RWH A;  3SPV A;  1A6Z A;  3FT3 A;  4U1J A;  4FFE X;  4L3C A;  2ZOK A;  3O4L A;  3P4M A;  3REW A;  1UQS A;  4PJA A;  1DUZ A;  2P5E A;  3MRL A;  4JQV A;  4MJI A;  4U6Y A;  3O8X A;  1T7Y A;  3L3D A;  3RWC A;  4PV8 A;  5MER A;  3L3I A;  5EU5 A;  4MQ7 A;  1T80 A;  2HJL A;  2PO6 A;  4QOK A;  3BHB A;  4PRP A;  3MRH A;  4WU5 A;  4Y4K A;  4PJ7 A;  1P7Q A;  3VFO A;  4LHU A;  1I7R A;  3W39 A;  3VFP A;  3SJV A;  3GMR A;  3OXS A;  3P73 A;  1DUY A;  1FZO A;  4X6E A;  4JFF A;  2PYE A;  1T7V A;  3BVN A;  4NQC A;  3ARF A;  4U1H A;  1VAD A;  1S7R A;  3LN4 A;  3X12 A;  1UXW A;  3VFV A;  3X14 A;  1M6O A;  4JQX A;  3OXR A;  1QRN A;  4JFQ A;  4K7F A;  3VFN A;  2IA1 A;  4Z76 A;  4D0B A;  3MRP A;  5E6I C;  3LKS A;  5C08 A;  3TN0 A;  5HHP A;  3S6C A;  1JUF A;  4BKW A;  3UTS A;  1WBX A;  4IIQ C;  2FWO A;  3GSR A;  1XZ0 A;  3GSX A;  3RGV C;  1T0M A;  4EI5 A;  1HSA A;  1I1A A;  3DX7 A;  1LP9 A;  5FA4 A;  1AGF A;  2F74 A;  1T20 A;  4L8D A;  1N59 A;  1S7Q A;  4U1M A;  4PP8 C;  1KPU A;  5EO1 A;  1QR1 A;  1A1M A;  1X7Q A;  5F9J A;  4HS3 A;  4L3E A;  4MJ6 A;  4QRU A;  3QEQ A;  3VCL A;  5IRO A;  4HWZ A;  5D9S A;  3ROL A;  3MGO A;  1S8D A;  3RWD A;  1HSB A;  4WU7 A;  5B39 A;  1T7X A;  3M17 A;  4HUV A;  2NYK A;  1TMC A;  1B3J A;  4ONO A;  4PJD A;  4QRT A;  1E27 A;  3QUZ A;  1BII A;  4PJF A;  3JTS A;  4LNR A;  4WDI A;  3I6G A;  3IXA A;  3CVH A;  4PJI A;  3C8K A;  3E2H A;  2GJ6 A;  2VAB A;  1S7T A;  2VAA A;  3QFD A;  2H26 A;  4L8S C;  4PGB A;  1QLF A;  1C16 A;  3ILP A;  1WBY A;  4HUX A;  1KJ3 H;  1AO7 A;  3P9M A;  5EO0 A;  3RWI A;  5B38 A;  4CVZ A;  5C0G A;  3VRI A;  5IVX A;  1INQ A;  3QUY A;  1QSF A;  3B6S A;  3SDX A;  4F7E A;  2VLR A;  2ESV A;  1CG9 A;  1T7Z A;  3BEV A;  5D5M A;  4PJG A;  1T22 A;  3FTG A;  4V3E B;  3UTT A;  3FQT A;  2JCC A;  3TID A;  4IRS A;  1JPF A;  5HHO A;  3MRC A;  2P5W A;  1MI5 A;  5HGD A;  4JFO A;  1P4L A;  5C0C A;  1ZAG A;  1EEZ A;  4UQ2 A;  4PJE A;  5JHD A;  4U6X A;  3PWJ A;  2GAZ A;  1LDP H;  3FRU A;  5E8P A;  3ARE A;  3TBT A;  2E7L E;  1I7U A;  2FIK A;  3WLB A;  4IHO A;  2YEZ A;  3PAB A;  3WS3 A;  1ZS8 A;  4FTV A;  3UPR A;  3KYN A;  3VRJ A;  3WUW A;  4WUU A;  1LD9 A;  1OGA A;  1U58 A;  3GSQ A;  3HE6 A;  4PV9 A;  5E9D A;  5GSR A;  1QSE A;  3RWG A;  3DBX A;  5C07 A;  4LCY A;  1FG2 A;  3RL1 A;  4NNX A;  5C0B A;  3VXP A;  3H9S A;  4QRP A;  5J6H A;  3LV3 A;  4ZUW A;  1ZT1 A;  3BWA A;  1NAN H;  3MRN A;  1I7T A;  3PWL A;  4PJ8 A;  2AV1 A;  2CII A;  4I48 A;  3JTC A;  3KPM A;  3OX8 A;  3FT2 A;  3O3E A;  3MRD A;  5FKP A;  1BZ9 A;  1JHT A;  3PWV A;  1S9W A;  4IRJ A;  3ROO A;  5IEH A;  3MRB A;  3HG1 A;  5C0J A;  3DTX A;  1E28 A;  5D2L A;  5IB3 A;  1ZHL A;  4N8V A;  3VFW A;  3PWP A;  1LEK A;  3WS6 A;  1RJY A;  3JVG A;  4L29 A;  1AGC A;  1ZHK A;  5INC A;  5FDW A;  4ZUV A;  3GIV A;  2OL3 H;  4LCW A;  3P4N A;  5EFI A;  1DDH A;  3MRI A;  4MXQ A;  4WWK C;  4ZFZ A;  5F1N A;  1KJV A;  4JO8 A;  1YN6 A;  1EXU A;  5HGH A;  3HPJ A;  4F7P A;  4G9F A;  3AM8 A;  3VXR A;  4EN3 C;  3SKO A;  2GTZ A;  4GKS A;  4NQX A;  1EFX A;  5E8O A;  1KCG C;  3FQX A;  4HUU A;  4X6F A;  4UQ3 A;  3V5D A;  1S7W A;  4Y16 A;  4N0C A;  3MRK A;  3GSW A;  2DYP A;  1XR8 A;  3KPL A;  5DDH A;  5BXF A;  4PJC A;  5BRZ A;  2O5N A;  2GT9 A;  4G8G A;  4U1I A;  3IT8 D;  5IB1 A;  3KPO A;  3KLA A;  1N2R A;  1I1F A;  4G8I A;  4PJX A;  3RWE A;  4O2C A;  3ARD A;  3SCM A;  4PR5 A;  3TBV A;  1IM3 A;  5SWS A;  3UTQ A;  1HHJ A;  2AK4 A;  3MR9 A;  3GMQ A;  3DMM A;  1LEG A;  2AXG A;  1T7W A;  2XPG A;  3MRG A;  3FQU A;  4PRA A;  2HLA A;  3W0W A;  1KBG H;  3BZE A;  1CD1 A;  1ED3 A;  1XH3 A;  2ZOL A;  3FON A;  3GMP A;  4L8C A;  4Z78 A;  5BJT A;  4V3D B;  5C09 A;  3LN5 A;  2V2X A;  5AD0 A;  1MWA H;  3I6L D;  3LKQ A;  3TZV C;  3RWF A;  2Q7Y A;  1KJM A;  4QRQ A;  5EU6 A;  5GSV A;  1M05 A;  3VXU A;  3TA3 A;  1OSZ A;  1BQH A;  1S9Y A;  2BCK A;  5C0F A;  5HHQ A;  4PRD A;  5DEG A;  1NEZ A;  1KTL A;  2A83 A;  5ACZ A;  4G9D A;  5H94 A;  2MHA A;  2WY3 A;  1KPV A;  3KYO A;  3VXM A;  3ECB A;  4E5X A;  3BO8 A;  3HUJ A;  4NQE A;  3VH8 A;  5IEK A;  3MV8 A;  3HE7 A;  3CDG A;  3G08 A;  5DEF A;  1XR9 A;  3ARG A;  3FOM A;  3HCV A;  4NQD A;  1G6R H;  4ELM A;  1JPG A;  1AKJ A;  3GSU A;  1A1O A;  4WO4 A;  1W0W A;  1YDP A;  3O9W A;  3QDG A;  4JFP A;  1N3N A;  4QRR A;  3GML A;  3L3K A;  4PRN A;  1NAM H;  3MRQ A;  2F53 A;  2CLR A;  1HOC A;  3BH9 A;  3E6H A;  5C0D A;  2GIT A;  3DX6 A;  2BNQ A;  3FQW A;  3KPQ A;  1A9E A;  4G43 A;  3V5K A;  2X4R A;  3BP4 A;  3LKN A;  4GKN A;  3ES6 A;  5E8N A; 
#chains in the Genus database with same CATH homology
 2AXF A;  2VLJ A;  1FO0 H;  5SWQ A;  1S7V A;  2X4N A;  3GJF A;  2FO4 A;  3RL2 A;  3DXA A;  3QQ4 A;  3C9N A;  3VXS A;  3L3H A;  1G7Q A;  4U1L A;  3H7B A;  3RZC A;  1KPR A;  2V2W A;  4GUP A;  3PWU A;  2BSR A;  4MNQ A;  1QQD A;  1FZJ A;  4ZUS A;  5IM7 A;  1LK2 A;  1S7X A;  4CW1 A;  4F7T A;  5MEP A;  3MRO A;  3TPU E;  2X4U A;  4PG9 A;  4G59 A;  3SDD A;  1JE6 A;  5SWZ A;  1AGD A;  3QUX A;  2X4S A;  1FZK A;  3CC5 A;  1FFO A;  2CIK A;  2ZSW A;  3I6K A;  2X4P A;  2CLZ A;  2UWE A;  5C0A A;  1RJZ A;  1LQV A;  3QFJ A;  1HHI A;  3GMM A;  4L9L C;  5D2N A;  4PG2 A;  2X4O A;  4PJ9 A;  5EUO A;  3SDC A;  3X13 A;  3BH8 A;  3D25 A;  4LCC C;  4WJ5 A;  3QUK A;  4JFD A;  5D7J C;  3VXO A;  4ZUU A;  3BEW A;  1N5A A;  1TVB A;  3QDM A;  3ILQ C;  3TVM A;  4L4T A;  4MVB A;  4N0F A;  1JF1 A;  3AU1 A;  3E3Q A;  3KPR A;  3DX8 A;  1W0V A;  5J6G A;  3MYJ A;  4Y4H A;  3QDJ A;  1T1Y A;  3KPN A;  4K71 B;  1ZHN A;  4QRS A;  2X4Q A;  2X70 A;  1T1Z A;  3BXN A;  1CE6 A;  3TO4 A;  2XFX A;  1T21 A;  1QEW A;  3M1B A;  4HKJ A;  4U1K A;  3OV6 A;  4PRH A;  3GMN A;  4N5E A;  5ISZ A;  5HGA A;  3TO2 A;  3ARB A;  3VXN A;  4Y2D A;  5IB2 A;  1JGE A;  1G7P A;  4NO0 A;  3VWK A;  3MV9 A;  5MEN A;  5HHM A;  1P1Z A;  1S7S A;  1MHE A;  3WL9 A;  3CPL A;  5HYJ A;  3BGM A;  2BVO A;  2BVQ A;  1IM9 A;  4NQV A;  1S9X A;  1JGD A;  3MRR A;  3KPS A;  3SKM A;  2D31 A;  4NO2 A;  3NFN A;  4S0U C;  4PDC E;  3TF7 A;  2HN7 A;  1I4F A;  3LKP A;  2CKB H;  4L4V A;  1QO3 A;  4NSK A;  4X6C A;  2GUO A;  3BP7 A;  5HHN A;  1R3H A;  5E00 A;  3FQN A;  3UBX A;  3VFM A;  3TBW A;  4E0R A;  2ZSV A;  3BW9 A;  4PRI A;  3KPP A;  4PGC A;  4PJH A;  4Y4F A;  4PRB A;  3TIE A;  5IND A;  1VAC A;  3MRE A;  2BSS A;  1SYS A;  3TJH A;  3H9H A;  4NNY A;  4NT6 A;  1A9B A;  3QUL A;  1ZT4 A;  3TBS A;  3BZF A;  3FOL A;  3O3A A;  5FA3 A;  4ZUT A;  5F7D A;  3ERY A;  4MX7 A;  1S7U A;  4JFE A;  3D39 A;  3TBY A;  4NO5 A;  3LKR A;  4G42 A;  4NO3 A;  1QVO A;  3U0P A;  1HHG A;  5C0E A;  3VFR A;  3T8X A;  3D2U A;  3BUY A;  2VLL A;  3GSN H;  1OGT A;  1T1X A;  4WW2 C;  1UXS A;  3QZW A;  3O3D A;  1B0G A;  1WBZ A;  2RFX A;  5EU4 A;  4EUP A;  3KXF A;  4MNG A;  3PQY A;  4U1S A;  5EOT A;  1FZM A;  3CCH A;  3RTQ A;  5EU3 A;  1GZP A;  1VGK A;  2VLK A;  3VFU A;  2J8U A;  4JRX A;  4JRY A;  4F7C A;  1EEY A;  3B3I A;  1TVH A;  4PRE A;  3D18 A;  1T1W A;  2YPL A;  1A1N A;  3SDA A;  1Z5L A;  4I4W A;  3QQ3 A;  1L8J A;  3FT4 A;  3L3G A;  3E6F A;  1KJ2 H;  2VE6 A;  2H6P A;  2C7U A;  5MEO A;  4N0U A;  4Z77 A;  1RK1 A;  5C0I A;  1HHH A;  2BST A;  3GSO A;  3P4O A;  4PGE A;  3TFK A;  3JTT A;  1K5N A;  2AKR A;  4ZAK A;  3V5H A;  1Q94 A;  2BVP A;  3LKO A;  1RK0 A;  3PWN A;  5IB4 A;  5J1A A;  3VWJ A;  5BS0 A;  3HAE A;  4PGD A;  1HHK A;  1MHC A;  3P77 A;  3MRJ A;  4L8B A;  1SYV A;  3KWW A;  1AGB A;  2AV7 A;  3VJ6 A;  4HV8 A;  2GTW A;  1JFM A;  2HJK A;  4O2E A;  1AGE A;  3VFT A;  2OI9 A;  3QI9 A;  1ZVS A;  3T1F A;  3MGT A;  3L3J A;  3VFS A;  1T0N A;  5HGB A;  2FYY A;  4MS8 A;  5C9J A;  3X11 A;  1BD2 A;  1YN7 A;  3O3B A;  1B0R A;  1GZQ A;  1HYR C;  1FFN A;  5D7I A;  5ENW A;  2CLV A;  2FZ3 A;  3HLA A;  4PJ5 A;  3MRF A;  1W72 A;  2X4T A;  3MV7 A;  5L2J A;  3FQR A;  3GSV A;  4CVX A;  3P9L A;  4HUW A;  1OF2 A;  3MRM A;  3RWJ A;  5MEQ A;  1ZT7 A;  1FFP A;  2BNR A;  1YPZ A;  3CH1 A;  5L2K A;  3L9R A;  3FFC A;  5D7L A;  1I1Y A;  3D3V A;  4U1N A;  5IB5 A;  2NW3 A;  3RUG A;  3MA7 A;  2F54 A;  4D0D A;  2YPK A;  4NHU E;  5F1I A;  4XXC A;  3GMO A;  2NX5 A;  1ZSD A;  1ZHB A;  4MJ5 A;  1ONQ A;  4D0C A;  4PJB A;  4HX1 A;  4F7M A;  1DE4 A;  1PQZ A;  4APQ A;  3CZF A;  4O2F A;  1K8D A;  4X6D A;  3RWH A;  3SPV A;  1A6Z A;  3FT3 A;  4U1J A;  4FFE X;  4L3C A;  2ZOK A;  3O4L A;  3P4M A;  3REW A;  1UQS A;  4PJA A;  1DUZ A;  2P5E A;  3MRL A;  4JQV A;  4MJI A;  4U6Y A;  3O8X A;  1T7Y A;  3L3D A;  3RWC A;  4PV8 A;  5MER A;  3L3I A;  5EU5 A;  4MQ7 A;  1T80 A;  2HJL A;  2PO6 A;  4QOK A;  3BHB A;  4PRP A;  3MRH A;  4WU5 A;  4Y4K A;  4PJ7 A;  1P7Q A;  3VFO A;  4LHU A;  1I7R A;  3W39 A;  3VFP A;  3SJV A;  3GMR A;  3OXS A;  3P73 A;  1DUY A;  1FZO A;  4X6E A;  4JFF A;  2PYE A;  1T7V A;  3BVN A;  4NQC A;  3ARF A;  4U1H A;  1VAD A;  1S7R A;  3LN4 A;  3X12 A;  1UXW A;  3VFV A;  3X14 A;  1M6O A;  4JQX A;  3OXR A;  1QRN A;  4JFQ A;  4K7F A;  3VFN A;  4Z76 A;  4D0B A;  3MRP A;  5E6I C;  3LKS A;  5C08 A;  3TN0 A;  5HHP A;  3S6C A;  1JUF A;  3UTS A;  1WBX A;  4IIQ C;  2FWO A;  3GSR A;  1XZ0 A;  3GSX A;  3RGV C;  1T0M A;  4EI5 A;  1HSA A;  1I1A A;  3DX7 A;  1LP9 A;  5FA4 A;  1AGF A;  2F74 A;  1T20 A;  4L8D A;  1N59 A;  1S7Q A;  4U1M A;  4PP8 C;  1KPU A;  5EO1 A;  1QR1 A;  1A1M A;  1X7Q A;  5F9J A;  4HS3 A;  4L3E A;  4MJ6 A;  4QRU A;  3QEQ A;  3VCL A;  5IRO A;  4HWZ A;  5D9S A;  3ROL A;  3MGO A;  1S8D A;  3RWD A;  1HSB A;  4WU7 A;  5B39 A;  1T7X A;  3M17 A;  4HUV A;  1TMC A;  1B3J A;  4ONO A;  4PJD A;  4QRT A;  1E27 A;  3QUZ A;  1BII A;  4PJF A;  3JTS A;  4LNR A;  4WDI A;  3I6G A;  3IXA A;  3CVH A;  4PJI A;  3C8K A;  3E2H A;  2GJ6 A;  2VAB A;  1S7T A;  2VAA A;  3QFD A;  2H26 A;  4L8S C;  4PGB A;  1QLF A;  1C16 A;  3ILP A;  1WBY A;  4HUX A;  1KJ3 H;  1AO7 A;  3P9M A;  5EO0 A;  3RWI A;  5B38 A;  4CVZ A;  5C0G A;  3VRI A;  5IVX A;  1INQ A;  3QUY A;  1QSF A;  3B6S A;  3SDX A;  4F7E A;  2VLR A;  2ESV A;  1CG9 A;  1T7Z A;  3BEV A;  5D5M A;  4PJG A;  1T22 A;  3FTG A;  4V3E B;  3UTT A;  3FQT A;  2JCC A;  3TID A;  4IRS A;  1JPF A;  5HHO A;  3MRC A;  2P5W A;  1MI5 A;  5HGD A;  4JFO A;  1P4L A;  5C0C A;  1ZAG A;  1EEZ A;  4UQ2 A;  4PJE A;  5JHD A;  4U6X A;  3PWJ A;  2GAZ A;  1LDP H;  3FRU A;  5E8P A;  3ARE A;  3TBT A;  2E7L E;  1I7U A;  2FIK A;  3WLB A;  4IHO A;  2YEZ A;  3PAB A;  3WS3 A;  1ZS8 A;  4FTV A;  3UPR A;  3KYN A;  3VRJ A;  3WUW A;  4WUU A;  1LD9 A;  1OGA A;  1U58 A;  3GSQ A;  3HE6 A;  4PV9 A;  5E9D A;  5GSR A;  1QSE A;  3RWG A;  3DBX A;  5C07 A;  4LCY A;  1FG2 A;  3RL1 A;  4NNX A;  5C0B A;  3VXP A;  3H9S A;  4QRP A;  5J6H A;  3LV3 A;  4ZUW A;  1ZT1 A;  3BWA A;  1NAN H;  3MRN A;  1I7T A;  3PWL A;  4PJ8 A;  2AV1 A;  2CII A;  4I48 A;  3JTC A;  3KPM A;  3OX8 A;  3FT2 A;  3O3E A;  3MRD A;  5FKP A;  1BZ9 A;  1JHT A;  3PWV A;  1S9W A;  4IRJ A;  3ROO A;  5IEH A;  3MRB A;  3HG1 A;  5C0J A;  3DTX A;  1E28 A;  5D2L A;  5IB3 A;  1ZHL A;  4N8V A;  3VFW A;  3PWP A;  1LEK A;  3WS6 A;  1RJY A;  3JVG A;  4L29 A;  1AGC A;  1ZHK A;  5INC A;  5FDW A;  4ZUV A;  3GIV A;  2OL3 H;  4LCW A;  3P4N A;  5EFI A;  1DDH A;  3MRI A;  4MXQ A;  4WWK C;  4ZFZ A;  5F1N A;  1KJV A;  1YN6 A;  1EXU A;  5HGH A;  3HPJ A;  4F7P A;  4G9F A;  3AM8 A;  3VXR A;  4EN3 C;  3SKO A;  2GTZ A;  4GKS A;  4NQX A;  1EFX A;  5E8O A;  1KCG C;  3FQX A;  4HUU A;  4X6F A;  4UQ3 A;  3V5D A;  1S7W A;  4Y16 A;  4N0C A;  3MRK A;  3GSW A;  2DYP A;  1XR8 A;  3KPL A;  5DDH A;  5BXF A;  4PJC A;  5BRZ A;  4G8G A;  2GT9 A;  4U1I A;  3IT8 D;  5IB1 A;  3KPO A;  3KLA A;  1N2R A;  1I1F A;  4G8I A;  4PJX A;  3RWE A;  4O2C A;  3ARD A;  3SCM A;  4PR5 A;  3TBV A;  1IM3 A;  5SWS A;  3UTQ A;  1HHJ A;  2AK4 A;  3MR9 A;  3GMQ A;  3DMM A;  1LEG A;  2AXG A;  1T7W A;  2XPG A;  3MRG A;  3FQU A;  4PRA A;  2HLA A;  3W0W A;  1KBG H;  3BZE A;  1CD1 A;  1ED3 A;  1XH3 A;  2ZOL A;  3FON A;  3GMP A;  4L8C A;  4Z78 A;  5BJT A;  4V3D B;  5C09 A;  3LN5 A;  2V2X A;  5AD0 A;  1MWA H;  3I6L D;  3LKQ A;  3TZV C;  3RWF A;  2Q7Y A;  1KJM A;  4QRQ A;  5EU6 A;  5GSV A;  1M05 A;  3VXU A;  3TA3 A;  1OSZ A;  1BQH A;  1S9Y A;  2BCK A;  5C0F A;  5HHQ A;  4PRD A;  5DEG A;  1NEZ A;  1KTL A;  2A83 A;  5ACZ A;  4G9D A;  5H94 A;  2MHA A;  2WY3 A;  1KPV A;  3KYO A;  3VXM A;  3ECB A;  4E5X A;  3BO8 A;  3HUJ A;  4NQE A;  3VH8 A;  5IEK A;  3MV8 A;  3HE7 A;  3CDG A;  3G08 A;  5DEF A;  1XR9 A;  3ARG A;  3FOM A;  3HCV A;  4NQD A;  1G6R H;  4ELM A;  1JPG A;  1AKJ A;  3GSU A;  1A1O A;  4WO4 A;  1W0W A;  1YDP A;  3O9W A;  3QDG A;  4JFP A;  1N3N A;  4QRR A;  3GML A;  3L3K A;  4PRN A;  1NAM H;  3MRQ A;  2F53 A;  2CLR A;  1HOC A;  3BH9 A;  3E6H A;  5C0D A;  2GIT A;  3DX6 A;  2BNQ A;  3FQW A;  3KPQ A;  1A9E A;  4G43 A;  3V5K A;  2X4R A;  3BP4 A;  3LKN A;  4GKN A;  3ES6 A;  5E8N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...