3JTCA

Importance of mg2+ in the ca2+-dependent folding of the gamma-carboxyglutamic acid domains of vitamin k-dependent clotting and anticlotting proteins
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
172
structure length
172
Chain Sequence
GLQRLHMLQISYFRDPYHVWYQGNASLGGHLTHVLEGPDTNTTIIQLQPLQEPESWARTQSGLQSYLLQFHGLVRLVHQERTLAFPLTIRCFLGCELPPEGSRAHVFFEVAVNGSSFVSFRPERALWQADTQVTSGVVTFTLQQLNAYNRTRYELREFLEDTCVQYVQKHIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Functional Studies of gamma-Carboxyglutamic Acid Domains of Factor VIIa and Activated Protein C: Role of Magnesium at Physiological Calcium.
pubmed doi rcsb
molecule tags Blood clotting
molecule keywords Endothelial protein C receptor
total genus 50
structure length 172
sequence length 172
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3jtcA00
1I1FA 5E8PA 1INQA 1DUZA 4U1NA 3RWIA 5IEKA 2HJKA 4V3DB 1GZQA 5IM7A 4NQXA 4PJIA 3RUGA 2AKRA 5J6GA 1FO0H 3VFPA 3OV6A 3LKQA 1LK2A 4N8VA 1T1ZA 2FO4A 1NANH 3BO8A 3HE6A 3ROLA 1A9EA 4HV8A 1B0GA 1N59A 3QUYA 1Q94A 2GTWA 3FT4A 4L4TA 5E8OA 1LDPH 1S7QA 3MGOA 4WUUA 3TBYA 5L2JA 3TZVC 3SJVA 1AO7A 2AV7A 3FFCA 1A6ZA 4IRJA 1ZT1A 1SYSA 2VLKA 2X4RA 5L2KA 2VLLA 1CG9A 3BGMA 1KBGH 4O2FA 2E7LE 3P73A 5SWZA 1GZPA 3E2HA 4S0UC 3SDDA 1AGFA 3GMOA 3MV9A 2VLJA 4NO3A 5E8NA 2PO6A 3FQRA 4L9LC 5HGBA 4E5XA 1P4LA 4E0RA 1KJMA 3VXOA 5AD0A 3UPRA 1JGDA 1XR8A 1MHCA 1T7ZA 2Q7YA 2X4NA 3MRGA 4IRSA 3WUWA 3MRKA 5D2LA 3SKOA 1VACA 1N2RA 4HX1A 3VH8A 3OX8A 3SDCA 3L3JA 4NHUE 1N3NA 2CIIA 1S9YA 3I6LD 1E28A 3ARBA 3QFDA 4PJ5A 4G8IA 5C08A 3H7BA 3QDMA 2UWEA 4F7MA 5F9JA 2FWOA 3PWLA 3T1FA 3B6SA 4Z78A 3KPLA 3MGTA 4PDCE 4PGDA 5C0BA 4X6DA 4CVZA 4U1KA 3H9SA 5C0EA 2V2XA 4QRUA 3KYOA 4WW2C 5EU4A 1AGBA 4PG9A 1T1XA 3FQNA 3MRMA 1W0WA 1S7TA 1QLFA 1QSEA 3LKOA 3FOLA 5D7LA 5FA3A 3KPOA 4PGCA 4I48A 4PJFA 1S7WA 4NO2A 1RK1A 4O2CA 5C07A 4PR5A 3L3DA 4ZFZA 1JPFA 3BUYA 3PQYA 3FQXA 3AM8A 1A1MA 3ARFA 3SKMA 3G08A 4G8GA 3VRJA 3KPNA 1ONQA 3KPSA 5DEGA 3UTTA 3BVNA 1TMCA 1LP9A 3QQ4A 5J6HA 5E9DA 3BWAA 1P1ZA 4U6YA 3D3VA 1AGEA 3UTQA 2X4QA 1CD1A 3IT8D 3LKNA 3PWPA 2CLZA 3VCLA 5B39A 3QDGA 4X6EA 3MV7A 3QI9A 3CH1A 3DX6A 1L8JA 1QR1A 3HAEA 1KJ2H 1X7QA 3GIVA 4PJDA 3P9MA 5C0CA 5C0FA 2GT9A 3MRLA 2NW3A 5EUOA 1QO3A 5MEOA 4HUXA 3PABA 2CIKA 1KJVA 1P7QA 4PRHA 3HG1A 5HHMA 1ZHKA 3VFRA 1VADA 3TVMA 4D0CA 4HWZA 3MRPA 3KXFA 1YN7A 1OGAA 4MNGA 3VXUA 4ELMA 1MI5A 1DUYA 3X13A 3BXNA 3CVHA 2CKBH 2F74A 1K5NA 4PJ7A 1FZJA 1T7XA 1TVHA 5EU6A 3MRBA 3ILQC 3O9WA 5FKPA 5ISZA 4D0DA 2AV1A 3MREA 4L29A 4N0FA 3DX7A 4WWKC 3CC5A 5IEHA 3GSUA 1FFPA 3HCVA 3BH9A 3LKRA 1G7PA 3VFSA 4PRAA 1KPUA 3OXRA 1C16A 1T0NA 4HKJA 4JFOA 4PJAA 3T8XA 4O2EA 3TA3A 3FONA 4V3EB 3P4MA 1LQVA 2P5WA 3VFUA 3CDGA 3O8XA 4Z77A 2OI9A 1M05A 3TBSA 4JFPA 4PJ8A 4F7TA 3SCMA 1JPGA 3TO4A 1ZHBA 1I7UA 3P77A 4PREA 4Y4KA 3V5DA 4JQXA 2V2WA 3TIEA 5D7IA 5D2NA 3E6FA 3LN4A 1MWAH 3FQTA 1QQDA 4MJ6A 3VRIA 3GSQA 3FT2A 1KPRA 5IB3A 3CCHA 1T1WA 3BZFA 2FYYA 5D5MA 1T0MA 3QQ3A 4EI5A 3BHBA 1S7SA 4L3EA 4QRSA 5EO1A 2GAZA 3ECBA 3GSWA 3VFNA 3JVGA 3KWWA 4N0CA 3QUZA 3BP7A 2C7UA 4PRNA 3MRFA 3RZCA 1QSFA 3H9HA 1BQHA 3SPVA 3QUXA 3MRCA 4NNXA 3REWA 2MHAA 1EEZA 1NAMH 3TN0A 3VFWA 3MRJA 2CLRA 3TPUE 1EFXA 3I6GA 4G9FA 5H94A 5MERA 5IB5A 2FIKA 3P9LA 1ZT7A 3TO2A 5JHDA 3ARGA 3JTSA 1A1NA 2HLAA 4G43A 1IM9A 4PJHA 1HHKA 1FFNA 3NFNA 4NO0A 3AU1A 1S7RA 4HUVA 5HGHA 4LCYA 3GSVA 1Z5LA 4MXQA 3DX8A 1PQZA 2VE6A 5B38A 5C9JA 1KJ3H 3VXMA 3PWUA 3VJ6A 4LNRA 3FTGA 2BVOA 1AKJA 3JTTA 5HHNA 2X4SA 4G59A 4EUPA 3M17A 3MRRA 3MA7A 3D18A 3RWEA 1YN6A 1BD2A 1JHTA 3GSOA 1S7VA 2ZOLA 1ZHLA 1G7QA 4F7CA 5SWQA 3X12A 1B0RA 3GMPA 3P4NA 5MENA 5ENWA 3DMMA 5HGAA 4L4VA 4PRPA 4U6XA 5DDHA 3TBVA 4L8SC 3MR9A 5IB4A 5EU3A 3GSRA 4IIQC 2AXFA 1W72A 2OL3H 4LHUA 4L3CA 4LCCC 5FDWA 1FZOA 5SWSA 3FRUA 1LEKA 4MJIA 5C09A 2BSRA 4MNQA 3MRDA 3X14A 5BXFA 3QDJA 5HHOA 3O3AA 1RJZA 4NT6A 3GMLA 3RWGA 5BS0A 4U1MA 5MEPA 5EOTA 4U1LA 4WU5A 4F7PA 1XZ0A 3PWJA 4LCWA 3O4LA 3L9RA 1WBYA 2PYEA 2P5EA 3O3EA 5BRZA 3KPQA 4JQVA 1QEWA 1XR9A 4MVBA 5F1IA 5FA4A 4ZUTA 1A1OA 1RJYA 1I4FA 4MJ5A 4Y2DA 2BNRA 3GSXA 5IB1A 4L8BA 2ZOKA 3D25A 2GJ6A 2H26A 3GMRA 3HPJA 4X6CA 3HUJA 4U1JA 1ZT4A 1I7RA 4Y16A 4WU7A 3IXAA 2F53A 2D31A 4MS8A 1YDPA 2J8UA 3VWJA 2BSTA 2ESVA 3I6KA 5INDA 4ZUVA 3QFJA 4PGBA 4PJGA 1ZAGA 1T80A 3FQWA 3BEVA 3HE7A 4HUUA 1R3HA 3D2UA 1FFOA 1UXSA 3L3GA 3CZFA 4IHOA 1QVOA 3TJHA 3PWNA 3RTQA 5E00A 3RL2A 1JE6A 3C8KA 5INCA 4G9DA 4FTVA 2X4TA 4NSKA 2BVQA 5DEFA 1UXWA 5IVXA 1ED3A 1AGCA 1T22A 4L8DA 3FOMA 3SDAA 1VGKA 4PJBA 1JUFA 1MHEA 3LKPA 4ZUUA 4K71B 2YPKA 1HHJA 2F54A 3KYNA 1N5AA 1S7UA 3D39A 3QULA 3SDXA 1JGEA 3GMNA 5EU5A 3V5HA 4JRXA 1HHIA 2VABA 1NEZA 4NQVA 3L3KA 2X4UA 3MV8A 4ZAKA 5HYJA 3MYJA 4WDIA 2HN7A 3VFTA 2A83A 3AREA 2YPLA 1G6RH 1YPZA 3KPRA 5C0DA 3QUKA 3ERYA 4U1IA 3BW9A 3S6CA 1A9BA 4ONOA 3LKSA 3FT3A 1CE6A 3TBTA 3L3HA 1I7TA 1BIIA 3LV3A 2YEZA 1OSZA 1LD9A 4NQDA 5ACZA 1LEGA 2XPGA 1E27A 3RGVC 3TFKA 3WL9A 3O3DA 3ROOA 4WO4A 2H6PA 3HLAA 1ZVSA 3TIDA 3X11A 4UQ2A 3WS3A 1I1AA 1T20A 3GJFA 1RK0A 2GITA 4NNYA 3WLBA 5MEQA 4N5EA 2VLRA 3BZEA 1K8DA 4Z76A 4NO5A 1JFMA 3TF7A 4Y4HA 1HOCA 1T7YA 3U0PA 2GUOA 4GKNA 2DYPA 1ZHNA 3OXSA 3BEWA 4MX7A 1KCGC 1W0VA 3ILPA 3VFOA 1UQSA 3P4OA 4U1HA 2BNQA 1TVBA 3E6HA 1T7VA 3BP4A 2HJLA 3V5KA 4MQ7A 4ZUWA 3W0WA 2GTZA 4I4WA 3VXPA 2ZSVA 1FZMA 3W39A 3PWVA 3MROA 4GKSA 1BZ9A 4HUWA 2BSSA 1ZSDA 4UQ3A 4N0UA 4CW1A 3L3IA 4PJEA 5E6IC 4NQCA 2X70A 1B3JA 3MRNA 2FZ3A 1DDHA 4XXCA 3RL1A 3MRIA 4JFDA 3RWDA 3VXNA 2NX5A 3GMQA 1DE4A 1T7WA 3KPMA 3TBWA 1WBZA 5EO0A 4QOKA 1S8DA 4ZUSA 2XFXA 1FZKA 3VWKA 3B3IA 3RWCA 5J1AA 3VXRA 4Y4FA 4HS3A 1SYVA 1HHHA 3RWJA 5C0JA 4QRPA 3M1BA 4X6FA 3UTSA 3CPLA 3VFMA 2WY3A 3QZWA 1KTLA 2BCKA 4F7EA 3O3BA 4PJ9A 2JCCA 1ZS8A 3DTXA 3ARDA 3MRHA 4G42A 5F7DA 1IM3A 4PV9A 4JFQA 4JFEA 3GMMA 2X4OA 5C0IA 1EXUA 5HGDA 2AK4A 5BJTA 1HYRC 3KPPA 3DXAA 1KPVA 1U58A 3QEQA 4PRDA 4QRQA 4NQEA 2CLVA 1S7XA 2X4PA 2RFXA 1QRNA 1S9XA 2VAAA 1T21A 5EFIA 5IROA 2ZSWA 1EEYA 3MRQA 4WJ5A 2BVPA 1HSBA 4FFEX 1OF2A 3ES6A 1T1YA 1HSAA 4PP8C 4PGEA 1OGTA 5D7JC 4PV8A 4QRRA 1S9WA 3FQUA 3C9NA 4K7FA 4PG2A 5C0GA 3BH8A 3KLAA 3GSNH 3WS6A 4EN3C 1AGDA 4D0BA 1FG2A 4PJXA 4JFFA 5IB2A 4L8CA 3DBXA 1I1YA 4QRTA 5F1NA 1HHGA 1WBXA 4PJCA 1M6OA 4GUPA 4PRIA 3LN5A 4CVXA 5HHQA 3RWFA 5C0AA 5HHPA 3VFVA 3E3QA 4JRYA 1JF1A 2AXGA 5GSRA 3VXSA 4APQA 5GSVA 4PRBA 5D9SA 3UBXA 4U1SA 1XH3A 3RWHA 3JTCA
chains in the Genus database with same CATH superfamily
1I1FA 5E8PA 1INQA 1DUZA 4U1NA 3RWIA 5IEKA 2HJKA 4V3DB 1GZQA 5IM7A 4NQXA 4PJIA 3RUGA 2AKRA 5J6GA 1FO0H 3VFPA 3OV6A 3LKQA 1LK2A 4N8VA 1T1ZA 2FO4A 1NANH 3BO8A 3HE6A 3ROLA 1A9EA 4HV8A 1B0GA 1N59A 3QUYA 1Q94A 2GTWA 3FT4A 4L4TA 5E8OA 4BKWA 1LDPH 1S7QA 3MGOA 4WUUA 3TBYA 5L2JA 3TZVC 3SJVA 1AO7A 2AV7A 3FFCA 1A6ZA 4IRJA 1ZT1A 1SYSA 2VLKA 2X4RA 5L2KA 2VLLA 1CG9A 3BGMA 1KBGH 4O2FA 2E7LE 3P73A 5SWZA 1GZPA 3E2HA 4S0UC 3SDDA 1AGFA 3GMOA 3MV9A 2VLJA 4NO3A 5E8NA 2PO6A 3FQRA 4L9LC 5HGBA 4E5XA 1P4LA 4E0RA 1KJMA 3VXOA 5AD0A 3UPRA 1JGDA 1XR8A 1MHCA 1T7ZA 2Q7YA 2X4NA 3MRGA 4IRSA 3WUWA 3MRKA 5D2LA 3SKOA 1VACA 1N2RA 4HX1A 3VH8A 3OX8A 3SDCA 3L3JA 4NHUE 1N3NA 2CIIA 1S9YA 3I6LD 1E28A 3ARBA 3QFDA 4PJ5A 4G8IA 5C08A 3H7BA 3QDMA 2UWEA 4F7MA 5F9JA 2FWOA 3PWLA 3T1FA 3B6SA 4Z78A 3KPLA 3MGTA 4PDCE 4PGDA 5C0BA 4X6DA 4CVZA 4U1KA 3H9SA 5C0EA 2V2XA 4QRUA 3KYOA 4WW2C 5EU4A 1AGBA 4PG9A 1T1XA 3FQNA 3MRMA 1W0WA 1S7TA 1QLFA 1QSEA 3LKOA 3FOLA 5D7LA 5FA3A 3KPOA 4PGCA 4I48A 4PJFA 1S7WA 4NO2A 1RK1A 4O2CA 5C07A 4PR5A 3L3DA 4ZFZA 1JPFA 3BUYA 3PQYA 4G59C 3FQXA 3AM8A 1A1MA 3ARFA 3SKMA 3G08A 4G8GA 3VRJA 3KPNA 1ONQA 3KPSA 5DEGA 3UTTA 3BVNA 1TMCA 1LP9A 3QQ4A 5J6HA 5E9DA 3BWAA 1P1ZA 4U6YA 3D3VA 1AGEA 3UTQA 2X4QA 1CD1A 3IT8D 3LKNA 3PWPA 2CLZA 3VCLA 5B39A 3QDGA 4X6EA 3MV7A 3QI9A 3CH1A 3DX6A 1L8JA 1QR1A 3HAEA 1KJ2H 1X7QA 3GIVA 4PJDA 3P9MA 5C0CA 5C0FA 2GT9A 3MRLA 2NW3A 5EUOA 1QO3A 5MEOA 4HUXA 3PABA 2CIKA 1KJVA 1P7QA 4PRHA 3HG1A 5HHMA 1ZHKA 3VFRA 1VADA 3TVMA 4D0CA 4HWZA 3MRPA 3KXFA 1YN7A 1OGAA 4MNGA 3VXUA 4ELMA 1MI5A 1DUYA 3X13A 3BXNA 3CVHA 2CKBH 2F74A 1K5NA 4PJ7A 1FZJA 1T7XA 1TVHA 5EU6A 3MRBA 3ILQC 3O9WA 4JO8A 5FKPA 5ISZA 4D0DA 2AV1A 3MREA 4L29A 4N0FA 3DX7A 4WWKC 3CC5A 5IEHA 3GSUA 1FFPA 3HCVA 3BH9A 3LKRA 1G7PA 3VFSA 4PRAA 1KPUA 3OXRA 1C16A 1T0NA 4HKJA 4JFOA 4PJAA 3T8XA 4O2EA 3TA3A 3FONA 4V3EB 3P4MA 1LQVA 2P5WA 3VFUA 3CDGA 3O8XA 4Z77A 2OI9A 1M05A 3TBSA 4JFPA 4PJ8A 4F7TA 3SCMA 1JPGA 3TO4A 1ZHBA 1I7UA 3P77A 4PREA 4Y4KA 3V5DA 4JQXA 2V2WA 3TIEA 5D7IA 5D2NA 3E6FA 3LN4A 1MWAH 3FQTA 1QQDA 4MJ6A 3VRIA 3GSQA 3FT2A 1KPRA 5IB3A 3CCHA 1T1WA 3BZFA 2FYYA 5D5MA 1T0MA 3QQ3A 4EI5A 3BHBA 1S7SA 4L3EA 4QRSA 5EO1A 2GAZA 3ECBA 3GSWA 3VFNA 3JVGA 3KWWA 4N0CA 3QUZA 3BP7A 2C7UA 4PRNA 3MRFA 3RZCA 1QSFA 3H9HA 1BQHA 3SPVA 3QUXA 3MRCA 4NNXA 3REWA 2MHAA 1EEZA 1NAMH 3TN0A 3VFWA 3MRJA 2CLRA 3TPUE 1EFXA 3I6GA 4G9FA 5H94A 5MERA 5IB5A 2FIKA 3P9LA 1ZT7A 3TO2A 5JHDA 3ARGA 3JTSA 1A1NA 2HLAA 4G43A 1IM9A 4PJHA 1HHKA 1FFNA 3NFNA 4NO0A 3AU1A 3I0TA 1S7RA 4HUVA 5HGHA 4LCYA 3GSVA 1Z5LA 4MXQA 3DX8A 1PQZA 2VE6A 5B38A 5C9JA 1KJ3H 3VXMA 3PWUA 3VJ6A 4LNRA 3FTGA 2BVOA 1AKJA 3JTTA 5HHNA 2X4SA 4G59A 4EUPA 3M17A 3MRRA 3MA7A 3D18A 3RWEA 1YN6A 1BD2A 1JHTA 3GSOA 1S7VA 2ZOLA 1ZHLA 1G7QA 4F7CA 5SWQA 3X12A 1B0RA 2NYKA 3GMPA 3P4NA 5MENA 5ENWA 3DMMA 5HGAA 4L4VA 4PRPA 4U6XA 5DDHA 3TBVA 4L8SC 3MR9A 5IB4A 5EU3A 3GSRA 4IIQC 2AXFA 1W72A 2OL3H 4LHUA 4L3CA 4LCCC 5FDWA 1FZOA 5SWSA 3FRUA 1LEKA 4MJIA 5C09A 2BSRA 4MNQA 3MRDA 3X14A 5BXFA 3QDJA 5HHOA 3O3AA 1RJZA 4NT6A 3GMLA 3RWGA 5BS0A 4U1MA 5MEPA 5EOTA 4U1LA 4WU5A 4F7PA 1XZ0A 3PWJA 4LCWA 3O4LA 3L9RA 1WBYA 2PYEA 2P5EA 3O3EA 5BRZA 3KPQA 4JQVA 1QEWA 1XR9A 4MVBA 5F1IA 5FA4A 4ZUTA 1A1OA 1RJYA 1I4FA 4MJ5A 4Y2DA 2BNRA 3GSXA 5IB1A 4L8BA 2ZOKA 3D25A 2GJ6A 2H26A 3GMRA 3HPJA 4X6CA 3HUJA 4U1JA 1ZT4A 1I7RA 4Y16A 4WU7A 3IXAA 2F53A 2D31A 4MS8A 1YDPA 2J8UA 3VWJA 2BSTA 2ESVA 3I6KA 5INDA 4ZUVA 3QFJA 4PGBA 4PJGA 1ZAGA 1T80A 3FQWA 3BEVA 3HE7A 4HUUA 1R3HA 3D2UA 1FFOA 1UXSA 3L3GA 3CZFA 4IHOA 1QVOA 3TJHA 3PWNA 3RTQA 5E00A 3RL2A 1JE6A 3C8KA 5INCA 4G9DA 4FTVA 2X4TA 4NSKA 2BVQA 5DEFA 1UXWA 5IVXA 1ED3A 1AGCA 1T22A 4L8DA 3FOMA 3SDAA 1VGKA 4PJBA 1JUFA 1MHEA 3LKPA 4ZUUA 4K71B 2YPKA 1HHJA 2F54A 3KYNA 1N5AA 1S7UA 3D39A 3QULA 3SDXA 1JGEA 3GMNA 5EU5A 3V5HA 4JRXA 1HHIA 2VABA 1NEZA 4NQVA 3L3KA 2X4UA 3MV8A 4ZAKA 5HYJA 3MYJA 4WDIA 2HN7A 3VFTA 2A83A 3AREA 2YPLA 1G6RH 1YPZA 3KPRA 5C0DA 3QUKA 3ERYA 4U1IA 3BW9A 3S6CA 1A9BA 4ONOA 3LKSA 3FT3A 1CE6A 3TBTA 3L3HA 1I7TA 1BIIA 3LV3A 2YEZA 1OSZA 1LD9A 2IA1A 4NQDA 5ACZA 1LEGA 2XPGA 1E27A 3RGVC 3TFKA 3WL9A 3O3DA 3ROOA 4WO4A 2H6PA 3HLAA 1ZVSA 3TIDA 3X11A 4UQ2A 3WS3A 1I1AA 1T20A 3GJFA 1RK0A 2GITA 4NNYA 3WLBA 5MEQA 4N5EA 2VLRA 3BZEA 1K8DA 4Z76A 4NO5A 1JFMA 3TF7A 4Y4HA 1HOCA 1T7YA 3U0PA 2GUOA 4GKNA 2DYPA 1ZHNA 3OXSA 3BEWA 4MX7A 1KCGC 1W0VA 3ILPA 3VFOA 1UQSA 3P4OA 4U1HA 2BNQA 1TVBA 3E6HA 1T7VA 3BP4A 2HJLA 3V5KA 4MQ7A 4ZUWA 3W0WA 2GTZA 4I4WA 3VXPA 2ZSVA 1FZMA 3W39A 3PWVA 3MROA 4GKSA 1BZ9A 4HUWA 2BSSA 1ZSDA 4UQ3A 4N0UA 4CW1A 3L3IA 4PJEA 5E6IC 4NQCA 2X70A 1B3JA 3MRNA 2FZ3A 1DDHA 4XXCA 3RL1A 3MRIA 4JFDA 3RWDA 3VXNA 2NX5A 3GMQA 1DE4A 1T7WA 3KPMA 3TBWA 1WBZA 5EO0A 4QOKA 1S8DA 4ZUSA 2XFXA 1FZKA 2O5NA 3B3IA 3VWKA 3RWCA 5J1AA 3VXRA 4Y4FA 4HS3A 1SYVA 1HHHA 3RWJA 5C0JA 4QRPA 3M1BA 4X6FA 3UTSA 3CPLA 3VFMA 2WY3A 3QZWA 1KTLA 2BCKA 4F7EA 3O3BA 4PJ9A 2JCCA 1ZS8A 3DTXA 3ARDA 3MRHA 4G42A 5F7DA 1IM3A 4PV9A 4JFQA 4JFEA 3GMMA 2X4OA 5C0IA 1EXUA 5HGDA 2AK4A 5BJTA 1HYRC 3KPPA 3DXAA 1KPVA 1U58A 3QEQA 4PRDA 4QRQA 4NQEA 2CLVA 1S7XA 2X4PA 2RFXA 1QRNA 1S9XA 2VAAA 1T21A 5EFIA 5IROA 2ZSWA 1EEYA 3MRQA 4WJ5A 2BVPA 1HSBA 4FFEX 1OF2A 3ES6A 1T1YA 1HSAA 4PP8C 4PGEA 1OGTA 5D7JC 4PV8A 4QRRA 1S9WA 3FQUA 3C9NA 4K7FA 4PG2A 5C0GA 3BH8A 3KLAA 3GSNH 3WS6A 4EN3C 1AGDA 4D0BA 1FG2A 4PJXA 4JFFA 5IB2A 4L8CA 3DBXA 1I1YA 4QRTA 5F1NA 1HHGA 1WBXA 4PJCA 1M6OA 4GUPA 4PRIA 3LN5A 4CVXA 5HHQA 3RWFA 5C0AA 5HHPA 3VFVA 3E3QA 4JRYA 1JF1A 2AXGA 5GSRA 3VXSA 4APQA 5GSVA 4PRBA 5D9SA 3UBXA 4U1SA 1XH3A 3RWHA 3JTCA
chains in the Genus database with same CATH topology
1I1FA 5E8PA 1INQA 1DUZA 4U1NA 3RWIA 5IEKA 2HJKA 4V3DB 1GZQA 5IM7A 4NQXA 4PJIA 3RUGA 2AKRA 5J6GA 1FO0H 3VFPA 3OV6A 3LKQA 1LK2A 4N8VA 1T1ZA 2FO4A 1NANH 3BO8A 3HE6A 3ROLA 1A9EA 4HV8A 1B0GA 1N59A 3QUYA 1Q94A 2GTWA 3FT4A 4L4TA 5E8OA 1LDPH 1S7QA 3MGOA 4WUUA 3TBYA 5L2JA 3TZVC 3SJVA 1AO7A 2AV7A 3FFCA 1A6ZA 4IRJA 1ZT1A 1SYSA 2VLKA 2X4RA 5L2KA 2VLLA 1CG9A 3BGMA 1KBGH 4O2FA 2E7LE 3P73A 5SWZA 1GZPA 3E2HA 4S0UC 3SDDA 1AGFA 3GMOA 3MV9A 2VLJA 4NO3A 5E8NA 2PO6A 3FQRA 4L9LC 5HGBA 4E5XA 1P4LA 4E0RA 1KJMA 3VXOA 5AD0A 3UPRA 1JGDA 1XR8A 1MHCA 1T7ZA 2Q7YA 2X4NA 3MRGA 4IRSA 3WUWA 3MRKA 5D2LA 3SKOA 1VACA 1N2RA 4HX1A 3VH8A 3OX8A 3SDCA 3L3JA 4NHUE 1N3NA 2CIIA 1S9YA 3I6LD 1E28A 3ARBA 3QFDA 4PJ5A 4G8IA 5C08A 3H7BA 3QDMA 2UWEA 4F7MA 5F9JA 2FWOA 3PWLA 3T1FA 3B6SA 4Z78A 3KPLA 3MGTA 4PDCE 4PGDA 5C0BA 4X6DA 4CVZA 4U1KA 3H9SA 5C0EA 2V2XA 4QRUA 3KYOA 4WW2C 5EU4A 1AGBA 4PG9A 1T1XA 3FQNA 3MRMA 1W0WA 1S7TA 1QLFA 1QSEA 3LKOA 3FOLA 5D7LA 5FA3A 3KPOA 4PGCA 4I48A 4PJFA 1S7WA 4NO2A 1RK1A 4O2CA 5C07A 4PR5A 3L3DA 4ZFZA 1JPFA 3BUYA 3PQYA 3FQXA 3AM8A 1A1MA 3ARFA 3SKMA 3G08A 4G8GA 3VRJA 3KPNA 1ONQA 3KPSA 5DEGA 3UTTA 3BVNA 1TMCA 1LP9A 3QQ4A 5J6HA 5E9DA 3BWAA 1P1ZA 4U6YA 3D3VA 1AGEA 3UTQA 2X4QA 1CD1A 3IT8D 3LKNA 3PWPA 2CLZA 3VCLA 5B39A 3QDGA 4X6EA 3MV7A 3QI9A 3CH1A 3DX6A 1L8JA 1QR1A 3HAEA 1KJ2H 1X7QA 3GIVA 4PJDA 3P9MA 5C0CA 5C0FA 2GT9A 3MRLA 2NW3A 5EUOA 1QO3A 5MEOA 4HUXA 3PABA 2CIKA 1KJVA 1P7QA 4PRHA 3HG1A 5HHMA 1ZHKA 3VFRA 1VADA 3TVMA 4D0CA 4HWZA 3MRPA 3KXFA 1YN7A 1OGAA 4MNGA 3VXUA 4ELMA 1MI5A 1DUYA 3X13A 3BXNA 3CVHA 2CKBH 2F74A 1K5NA 4PJ7A 1FZJA 1T7XA 1TVHA 5EU6A 3MRBA 3ILQC 3O9WA 5FKPA 5ISZA 4D0DA 2AV1A 3MREA 4L29A 4N0FA 3DX7A 4WWKC 3CC5A 5IEHA 3GSUA 1FFPA 3HCVA 3BH9A 3LKRA 1G7PA 3VFSA 4PRAA 1KPUA 3OXRA 1C16A 1T0NA 4HKJA 4JFOA 4PJAA 3T8XA 4O2EA 3TA3A 3FONA 4V3EB 3P4MA 1LQVA 2P5WA 3VFUA 3CDGA 3O8XA 4Z77A 2OI9A 1M05A 3TBSA 4JFPA 4PJ8A 4F7TA 3SCMA 1JPGA 3TO4A 1ZHBA 1I7UA 3P77A 4PREA 4Y4KA 3V5DA 4JQXA 2V2WA 3TIEA 5D7IA 5D2NA 3E6FA 3LN4A 1MWAH 3FQTA 1QQDA 4MJ6A 3VRIA 3GSQA 3FT2A 1KPRA 5IB3A 3CCHA 1T1WA 3BZFA 2FYYA 5D5MA 1T0MA 3QQ3A 4EI5A 3BHBA 1S7SA 4L3EA 4QRSA 5EO1A 2GAZA 3ECBA 3GSWA 3VFNA 3JVGA 3KWWA 4N0CA 3QUZA 3BP7A 2C7UA 4PRNA 3MRFA 3RZCA 1QSFA 3H9HA 1BQHA 3SPVA 3QUXA 3MRCA 4NNXA 3REWA 2MHAA 1EEZA 1NAMH 3TN0A 3VFWA 3MRJA 2CLRA 3TPUE 1EFXA 3I6GA 4G9FA 5H94A 5MERA 5IB5A 2FIKA 3P9LA 1ZT7A 3TO2A 5JHDA 3ARGA 3JTSA 1A1NA 2HLAA 4G43A 1IM9A 4PJHA 1HHKA 1FFNA 3NFNA 4NO0A 3AU1A 1S7RA 4HUVA 5HGHA 4LCYA 3GSVA 1Z5LA 4MXQA 3DX8A 1PQZA 2VE6A 5B38A 5C9JA 1KJ3H 3VXMA 3PWUA 3VJ6A 4LNRA 3FTGA 2BVOA 1AKJA 3JTTA 5HHNA 2X4SA 4G59A 4EUPA 3M17A 3MRRA 3MA7A 3D18A 3RWEA 1YN6A 1BD2A 1JHTA 3GSOA 1S7VA 2ZOLA 1ZHLA 1G7QA 4F7CA 5SWQA 3X12A 1B0RA 3GMPA 3P4NA 5MENA 5ENWA 3DMMA 5HGAA 4L4VA 4PRPA 4U6XA 5DDHA 3TBVA 4L8SC 3MR9A 5IB4A 5EU3A 3GSRA 4IIQC 2AXFA 1W72A 2OL3H 4LHUA 4L3CA 4LCCC 5FDWA 1FZOA 5SWSA 3FRUA 1LEKA 4MJIA 5C09A 2BSRA 4MNQA 3MRDA 3X14A 5BXFA 3QDJA 5HHOA 3O3AA 1RJZA 4NT6A 3GMLA 3RWGA 5BS0A 4U1MA 5MEPA 5EOTA 4U1LA 4WU5A 4F7PA 1XZ0A 3PWJA 4LCWA 3O4LA 3L9RA 1WBYA 2PYEA 2P5EA 3O3EA 5BRZA 3KPQA 4JQVA 1QEWA 1XR9A 4MVBA 5F1IA 5FA4A 4ZUTA 1A1OA 1RJYA 1I4FA 4MJ5A 4Y2DA 2BNRA 3GSXA 5IB1A 4L8BA 2ZOKA 3D25A 2GJ6A 2H26A 3GMRA 3HPJA 4X6CA 3HUJA 4U1JA 1ZT4A 1I7RA 4Y16A 4WU7A 3IXAA 2F53A 2D31A 4MS8A 1YDPA 2J8UA 3VWJA 2BSTA 2ESVA 3I6KA 5INDA 4ZUVA 3QFJA 4PGBA 4PJGA 1ZAGA 1T80A 3FQWA 3BEVA 3HE7A 4HUUA 1R3HA 3D2UA 1FFOA 1UXSA 3L3GA 3CZFA 4IHOA 1QVOA 3TJHA 3PWNA 3RTQA 5E00A 3RL2A 1JE6A 3C8KA 5INCA 4G9DA 4FTVA 2X4TA 4NSKA 2BVQA 5DEFA 1UXWA 5IVXA 1ED3A 1AGCA 1T22A 4L8DA 3FOMA 3SDAA 1VGKA 4PJBA 1JUFA 1MHEA 3LKPA 4ZUUA 4K71B 2YPKA 1HHJA 2F54A 3KYNA 1N5AA 1S7UA 3D39A 3QULA 3SDXA 1JGEA 3GMNA 5EU5A 3V5HA 4JRXA 1HHIA 2VABA 1NEZA 4NQVA 3L3KA 2X4UA 3MV8A 4ZAKA 5HYJA 3MYJA 4WDIA 2HN7A 3VFTA 2A83A 3AREA 2YPLA 1G6RH 1YPZA 3KPRA 5C0DA 3QUKA 3ERYA 4U1IA 3BW9A 3S6CA 1A9BA 4ONOA 3LKSA 3FT3A 1CE6A 3TBTA 3L3HA 1I7TA 1BIIA 3LV3A 2YEZA 1OSZA 1LD9A 4NQDA 5ACZA 1LEGA 2XPGA 1E27A 3RGVC 3TFKA 3WL9A 3O3DA 3ROOA 4WO4A 2H6PA 3HLAA 1ZVSA 3TIDA 3X11A 4UQ2A 3WS3A 1I1AA 1T20A 3GJFA 1RK0A 2GITA 4NNYA 3WLBA 5MEQA 4N5EA 2VLRA 3BZEA 1K8DA 4Z76A 4NO5A 1JFMA 3TF7A 4Y4HA 1HOCA 1T7YA 3U0PA 2GUOA 4GKNA 2DYPA 1ZHNA 3OXSA 3BEWA 4MX7A 1KCGC 1W0VA 3ILPA 3VFOA 1UQSA 3P4OA 4U1HA 2BNQA 1TVBA 3E6HA 1T7VA 3BP4A 2HJLA 3V5KA 4MQ7A 4ZUWA 3W0WA 2GTZA 4I4WA 3VXPA 2ZSVA 1FZMA 3W39A 3PWVA 3MROA 4GKSA 1BZ9A 4HUWA 2BSSA 1ZSDA 4UQ3A 4N0UA 4CW1A 3L3IA 4PJEA 5E6IC 4NQCA 2X70A 1B3JA 3MRNA 2FZ3A 1DDHA 4XXCA 3RL1A 3MRIA 4JFDA 3RWDA 3VXNA 2NX5A 3GMQA 1DE4A 1T7WA 3KPMA 3TBWA 1WBZA 5EO0A 4QOKA 1S8DA 4ZUSA 2XFXA 1FZKA 3VWKA 3B3IA 3RWCA 5J1AA 3VXRA 4Y4FA 4HS3A 1SYVA 1HHHA 3RWJA 5C0JA 4QRPA 3M1BA 4X6FA 3UTSA 3CPLA 3VFMA 2WY3A 3QZWA 1KTLA 2BCKA 4F7EA 3O3BA 4PJ9A 2JCCA 1ZS8A 3DTXA 3ARDA 3MRHA 4G42A 5F7DA 1IM3A 4PV9A 4JFQA 4JFEA 3GMMA 2X4OA 5C0IA 1EXUA 5HGDA 2AK4A 5BJTA 1HYRC 3KPPA 3DXAA 1KPVA 1U58A 3QEQA 4PRDA 4QRQA 4NQEA 2CLVA 1S7XA 2X4PA 2RFXA 1QRNA 1S9XA 2VAAA 1T21A 5EFIA 5IROA 2ZSWA 1EEYA 3MRQA 4WJ5A 2BVPA 1HSBA 4FFEX 1OF2A 3ES6A 1T1YA 1HSAA 4PP8C 4PGEA 1OGTA 5D7JC 4PV8A 4QRRA 1S9WA 3FQUA 3C9NA 4K7FA 4PG2A 5C0GA 3BH8A 3KLAA 3GSNH 3WS6A 4EN3C 1AGDA 4D0BA 1FG2A 4PJXA 4JFFA 5IB2A 4L8CA 3DBXA 1I1YA 4QRTA 5F1NA 1HHGA 1WBXA 4PJCA 1M6OA 4GUPA 4PRIA 3LN5A 4CVXA 5HHQA 3RWFA 5C0AA 5HHPA 3VFVA 3E3QA 4JRYA 1JF1A 2AXGA 5GSRA 3VXSA 4APQA 5GSVA 4PRBA 5D9SA 3UBXA 4U1SA 1XH3A 3RWHA 3JTCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I1F A;  5E8P A;  1INQ A;  1DUZ A;  4U1N A;  3RWI A;  5IEK A;  2HJK A;  4V3D B;  1GZQ A;  5IM7 A;  4NQX A;  4PJI A;  3RUG A;  2AKR A;  5J6G A;  1FO0 H;  3VFP A;  3OV6 A;  3LKQ A;  1LK2 A;  4N8V A;  1T1Z A;  2FO4 A;  1NAN H;  3BO8 A;  3HE6 A;  3ROL A;  1A9E A;  4HV8 A;  1B0G A;  1N59 A;  3QUY A;  1Q94 A;  2GTW A;  3FT4 A;  4L4T A;  5E8O A;  1LDP H;  1S7Q A;  3MGO A;  4WUU A;  3TBY A;  5L2J A;  3TZV C;  3SJV A;  1AO7 A;  2AV7 A;  3FFC A;  1A6Z A;  4IRJ A;  1ZT1 A;  1SYS A;  2VLK A;  2X4R A;  5L2K A;  2VLL A;  1CG9 A;  3BGM A;  1KBG H;  4O2F A;  2E7L E;  3P73 A;  5SWZ A;  1GZP A;  3E2H A;  4S0U C;  3SDD A;  1AGF A;  3GMO A;  3MV9 A;  2VLJ A;  4NO3 A;  5E8N A;  2PO6 A;  3FQR A;  4L9L C;  5HGB A;  4E5X A;  1P4L A;  4E0R A;  1KJM A;  3VXO A;  5AD0 A;  3UPR A;  1JGD A;  1XR8 A;  1MHC A;  1T7Z A;  2Q7Y A;  2X4N A;  3MRG A;  4IRS A;  3WUW A;  3MRK A;  5D2L A;  3SKO A;  1VAC A;  1N2R A;  4HX1 A;  3VH8 A;  3OX8 A;  3SDC A;  3L3J A;  4NHU E;  1N3N A;  2CII A;  1S9Y A;  3I6L D;  1E28 A;  3ARB A;  3QFD A;  4PJ5 A;  4G8I A;  5C08 A;  3H7B A;  3QDM A;  2UWE A;  4F7M A;  5F9J A;  2FWO A;  3PWL A;  3T1F A;  3B6S A;  4Z78 A;  3KPL A;  3MGT A;  4PDC E;  4PGD A;  5C0B A;  4X6D A;  4CVZ A;  4U1K A;  3H9S A;  5C0E A;  2V2X A;  4QRU A;  3KYO A;  4WW2 C;  5EU4 A;  1AGB A;  4PG9 A;  1T1X A;  3FQN A;  3MRM A;  1W0W A;  1S7T A;  1QLF A;  1QSE A;  3LKO A;  3FOL A;  5D7L A;  5FA3 A;  3KPO A;  4PGC A;  4I48 A;  4PJF A;  1S7W A;  4NO2 A;  1RK1 A;  4O2C A;  5C07 A;  4PR5 A;  3L3D A;  4ZFZ A;  1JPF A;  3BUY A;  3PQY A;  3FQX A;  3AM8 A;  1A1M A;  3ARF A;  3SKM A;  3G08 A;  4G8G A;  3VRJ A;  3KPN A;  1ONQ A;  3KPS A;  5DEG A;  3UTT A;  3BVN A;  1TMC A;  1LP9 A;  3QQ4 A;  5J6H A;  5E9D A;  3BWA A;  1P1Z A;  4U6Y A;  3D3V A;  1AGE A;  3UTQ A;  2X4Q A;  1CD1 A;  3IT8 D;  3LKN A;  3PWP A;  2CLZ A;  3VCL A;  5B39 A;  3QDG A;  4X6E A;  3MV7 A;  3QI9 A;  3CH1 A;  3DX6 A;  1L8J A;  1QR1 A;  3HAE A;  1KJ2 H;  1X7Q A;  3GIV A;  4PJD A;  3P9M A;  5C0C A;  5C0F A;  2GT9 A;  3MRL A;  2NW3 A;  5EUO A;  1QO3 A;  5MEO A;  4HUX A;  3PAB A;  2CIK A;  1KJV A;  1P7Q A;  4PRH A;  3HG1 A;  5HHM A;  1ZHK A;  3VFR A;  1VAD A;  3TVM A;  4D0C A;  4HWZ A;  3MRP A;  3KXF A;  1YN7 A;  1OGA A;  4MNG A;  3VXU A;  4ELM A;  1MI5 A;  1DUY A;  3X13 A;  3BXN A;  3CVH A;  2CKB H;  2F74 A;  1K5N A;  4PJ7 A;  1FZJ A;  1T7X A;  1TVH A;  5EU6 A;  3MRB A;  3ILQ C;  3O9W A;  5FKP A;  5ISZ A;  4D0D A;  2AV1 A;  3MRE A;  4L29 A;  4N0F A;  3DX7 A;  4WWK C;  3CC5 A;  5IEH A;  3GSU A;  1FFP A;  3HCV A;  3BH9 A;  3LKR A;  1G7P A;  3VFS A;  4PRA A;  1KPU A;  3OXR A;  1C16 A;  1T0N A;  4HKJ A;  4JFO A;  4PJA A;  3T8X A;  4O2E A;  3TA3 A;  3FON A;  4V3E B;  3P4M A;  1LQV A;  2P5W A;  3VFU A;  3CDG A;  3O8X A;  4Z77 A;  2OI9 A;  1M05 A;  3TBS A;  4JFP A;  4PJ8 A;  4F7T A;  3SCM A;  1JPG A;  3TO4 A;  1ZHB A;  1I7U A;  3P77 A;  4PRE A;  4Y4K A;  3V5D A;  4JQX A;  2V2W A;  3TIE A;  5D7I A;  5D2N A;  3E6F A;  3LN4 A;  1MWA H;  3FQT A;  1QQD A;  4MJ6 A;  3VRI A;  3GSQ A;  3FT2 A;  1KPR A;  5IB3 A;  3CCH A;  1T1W A;  3BZF A;  2FYY A;  5D5M A;  1T0M A;  3QQ3 A;  4EI5 A;  3BHB A;  1S7S A;  4L3E A;  4QRS A;  5EO1 A;  2GAZ A;  3ECB A;  3GSW A;  3VFN A;  3JVG A;  3KWW A;  4N0C A;  3QUZ A;  3BP7 A;  2C7U A;  4PRN A;  3MRF A;  3RZC A;  1QSF A;  3H9H A;  1BQH A;  3SPV A;  3QUX A;  3MRC A;  4NNX A;  3REW A;  2MHA A;  1EEZ A;  1NAM H;  3TN0 A;  3VFW A;  3MRJ A;  2CLR A;  3TPU E;  1EFX A;  3I6G A;  4G9F A;  5H94 A;  5MER A;  5IB5 A;  2FIK A;  3P9L A;  1ZT7 A;  3TO2 A;  5JHD A;  3ARG A;  3JTS A;  1A1N A;  2HLA A;  4G43 A;  1IM9 A;  4PJH A;  1HHK A;  1FFN A;  3NFN A;  4NO0 A;  3AU1 A;  1S7R A;  4HUV A;  5HGH A;  4LCY A;  3GSV A;  1Z5L A;  4MXQ A;  3DX8 A;  1PQZ A;  2VE6 A;  5B38 A;  5C9J A;  1KJ3 H;  3VXM A;  3PWU A;  3VJ6 A;  4LNR A;  3FTG A;  2BVO A;  1AKJ A;  3JTT A;  5HHN A;  2X4S A;  4G59 A;  4EUP A;  3M17 A;  3MRR A;  3MA7 A;  3D18 A;  3RWE A;  1YN6 A;  1BD2 A;  1JHT A;  3GSO A;  1S7V A;  2ZOL A;  1ZHL A;  1G7Q A;  4F7C A;  5SWQ A;  3X12 A;  1B0R A;  3GMP A;  3P4N A;  5MEN A;  5ENW A;  3DMM A;  5HGA A;  4L4V A;  4PRP A;  4U6X A;  5DDH A;  3TBV A;  4L8S C;  3MR9 A;  5IB4 A;  5EU3 A;  3GSR A;  4IIQ C;  2AXF A;  1W72 A;  2OL3 H;  4LHU A;  4L3C A;  4LCC C;  5FDW A;  1FZO A;  5SWS A;  3FRU A;  1LEK A;  4MJI A;  5C09 A;  2BSR A;  4MNQ A;  3MRD A;  3X14 A;  5BXF A;  3QDJ A;  5HHO A;  3O3A A;  1RJZ A;  4NT6 A;  3GML A;  3RWG A;  5BS0 A;  4U1M A;  5MEP A;  5EOT A;  4U1L A;  4WU5 A;  4F7P A;  1XZ0 A;  3PWJ A;  4LCW A;  3O4L A;  3L9R A;  1WBY A;  2PYE A;  2P5E A;  3O3E A;  5BRZ A;  3KPQ A;  4JQV A;  1QEW A;  1XR9 A;  4MVB A;  5F1I A;  5FA4 A;  4ZUT A;  1A1O A;  1RJY A;  1I4F A;  4MJ5 A;  4Y2D A;  2BNR A;  3GSX A;  5IB1 A;  4L8B A;  2ZOK A;  3D25 A;  2GJ6 A;  2H26 A;  3GMR A;  3HPJ A;  4X6C A;  3HUJ A;  4U1J A;  1ZT4 A;  1I7R A;  4Y16 A;  4WU7 A;  3IXA A;  2F53 A;  2D31 A;  4MS8 A;  1YDP A;  2J8U A;  3VWJ A;  2BST A;  2ESV A;  3I6K A;  5IND A;  4ZUV A;  3QFJ A;  4PGB A;  4PJG A;  1ZAG A;  1T80 A;  3FQW A;  3BEV A;  3HE7 A;  4HUU A;  1R3H A;  3D2U A;  1FFO A;  1UXS A;  3L3G A;  3CZF A;  4IHO A;  1QVO A;  3TJH A;  3PWN A;  3RTQ A;  5E00 A;  3RL2 A;  1JE6 A;  3C8K A;  5INC A;  4G9D A;  4FTV A;  2X4T A;  4NSK A;  2BVQ A;  5DEF A;  1UXW A;  5IVX A;  1ED3 A;  1AGC A;  1T22 A;  4L8D A;  3FOM A;  3SDA A;  1VGK A;  4PJB A;  1JUF A;  1MHE A;  3LKP A;  4ZUU A;  4K71 B;  2YPK A;  1HHJ A;  2F54 A;  3KYN A;  1N5A A;  1S7U A;  3D39 A;  3QUL A;  3SDX A;  1JGE A;  3GMN A;  5EU5 A;  3V5H A;  4JRX A;  1HHI A;  2VAB A;  1NEZ A;  4NQV A;  3L3K A;  2X4U A;  3MV8 A;  4ZAK A;  5HYJ A;  3MYJ A;  4WDI A;  2HN7 A;  3VFT A;  2A83 A;  3ARE A;  2YPL A;  1G6R H;  1YPZ A;  3KPR A;  5C0D A;  3QUK A;  3ERY A;  4U1I A;  3BW9 A;  3S6C A;  1A9B A;  4ONO A;  3LKS A;  3FT3 A;  1CE6 A;  3TBT A;  3L3H A;  1I7T A;  1BII A;  3LV3 A;  2YEZ A;  1OSZ A;  1LD9 A;  4NQD A;  5ACZ A;  1LEG A;  2XPG A;  1E27 A;  3RGV C;  3TFK A;  3WL9 A;  3O3D A;  3ROO A;  4WO4 A;  2H6P A;  3HLA A;  1ZVS A;  3TID A;  3X11 A;  4UQ2 A;  3WS3 A;  1I1A A;  1T20 A;  3GJF A;  1RK0 A;  2GIT A;  4NNY A;  3WLB A;  5MEQ A;  4N5E A;  2VLR A;  3BZE A;  1K8D A;  4Z76 A;  4NO5 A;  1JFM A;  3TF7 A;  4Y4H A;  1HOC A;  1T7Y A;  3U0P A;  2GUO A;  4GKN A;  2DYP A;  1ZHN A;  3OXS A;  3BEW A;  4MX7 A;  1KCG C;  1W0V A;  3ILP A;  3VFO A;  1UQS A;  3P4O A;  4U1H A;  2BNQ A;  1TVB A;  3E6H A;  1T7V A;  3BP4 A;  2HJL A;  3V5K A;  4MQ7 A;  4ZUW A;  3W0W A;  2GTZ A;  4I4W A;  3VXP A;  2ZSV A;  1FZM A;  3W39 A;  3PWV A;  3MRO A;  4GKS A;  1BZ9 A;  4HUW A;  2BSS A;  1ZSD A;  4UQ3 A;  4N0U A;  4CW1 A;  3L3I A;  4PJE A;  5E6I C;  4NQC A;  2X70 A;  1B3J A;  3MRN A;  2FZ3 A;  1DDH A;  4XXC A;  3RL1 A;  3MRI A;  4JFD A;  3RWD A;  3VXN A;  2NX5 A;  3GMQ A;  1DE4 A;  1T7W A;  3KPM A;  3TBW A;  1WBZ A;  5EO0 A;  4QOK A;  1S8D A;  4ZUS A;  2XFX A;  1FZK A;  3VWK A;  3B3I A;  3RWC A;  5J1A A;  3VXR A;  4Y4F A;  4HS3 A;  1SYV A;  1HHH A;  3RWJ A;  5C0J A;  4QRP A;  3M1B A;  4X6F A;  3UTS A;  3CPL A;  3VFM A;  2WY3 A;  3QZW A;  1KTL A;  2BCK A;  4F7E A;  3O3B A;  4PJ9 A;  2JCC A;  1ZS8 A;  3DTX A;  3ARD A;  3MRH A;  4G42 A;  5F7D A;  1IM3 A;  4PV9 A;  4JFQ A;  4JFE A;  3GMM A;  2X4O A;  5C0I A;  1EXU A;  5HGD A;  2AK4 A;  5BJT A;  1HYR C;  3KPP A;  3DXA A;  1KPV A;  1U58 A;  3QEQ A;  4PRD A;  4QRQ A;  4NQE A;  2CLV A;  1S7X A;  2X4P A;  2RFX A;  1QRN A;  1S9X A;  2VAA A;  1T21 A;  5EFI A;  5IRO A;  2ZSW A;  1EEY A;  3MRQ A;  4WJ5 A;  2BVP A;  1HSB A;  4FFE X;  1OF2 A;  3ES6 A;  1T1Y A;  1HSA A;  4PP8 C;  4PGE A;  1OGT A;  5D7J C;  4PV8 A;  4QRR A;  1S9W A;  3FQU A;  3C9N A;  4K7F A;  4PG2 A;  5C0G A;  3BH8 A;  3KLA A;  3GSN H;  3WS6 A;  4EN3 C;  1AGD A;  4D0B A;  1FG2 A;  4PJX A;  4JFF A;  5IB2 A;  4L8C A;  3DBX A;  1I1Y A;  4QRT A;  5F1N A;  1HHG A;  1WBX A;  4PJC A;  1M6O A;  4GUP A;  4PRI A;  3LN5 A;  4CVX A;  5HHQ A;  3RWF A;  5C0A A;  5HHP A;  3VFV A;  3E3Q A;  4JRY A;  1JF1 A;  2AXG A;  5GSR A;  3VXS A;  4APQ A;  5GSV A;  4PRB A;  5D9S A;  3UBX A;  4U1S A;  1XH3 A;  3RWH A;  3JTC A; 
#chains in the Genus database with same CATH topology
 1I1F A;  5E8P A;  1INQ A;  1DUZ A;  4U1N A;  3RWI A;  5IEK A;  2HJK A;  4V3D B;  1GZQ A;  5IM7 A;  4NQX A;  4PJI A;  3RUG A;  2AKR A;  5J6G A;  1FO0 H;  3VFP A;  3OV6 A;  3LKQ A;  1LK2 A;  4N8V A;  1T1Z A;  2FO4 A;  1NAN H;  3BO8 A;  3HE6 A;  3ROL A;  1A9E A;  4HV8 A;  1B0G A;  1N59 A;  3QUY A;  1Q94 A;  2GTW A;  3FT4 A;  4L4T A;  5E8O A;  4BKW A;  1LDP H;  1S7Q A;  3MGO A;  4WUU A;  3TBY A;  5L2J A;  3TZV C;  3SJV A;  1AO7 A;  2AV7 A;  3FFC A;  1A6Z A;  4IRJ A;  1ZT1 A;  1SYS A;  2VLK A;  2X4R A;  5L2K A;  2VLL A;  1CG9 A;  3BGM A;  1KBG H;  4O2F A;  2E7L E;  3P73 A;  5SWZ A;  1GZP A;  3E2H A;  4S0U C;  3SDD A;  1AGF A;  3GMO A;  3MV9 A;  2VLJ A;  4NO3 A;  5E8N A;  2PO6 A;  3FQR A;  4L9L C;  5HGB A;  4E5X A;  1P4L A;  4E0R A;  1KJM A;  3VXO A;  5AD0 A;  3UPR A;  1JGD A;  1XR8 A;  1MHC A;  1T7Z A;  2Q7Y A;  2X4N A;  3MRG A;  4IRS A;  3WUW A;  3MRK A;  5D2L A;  3SKO A;  1VAC A;  1N2R A;  4HX1 A;  3VH8 A;  3OX8 A;  3SDC A;  3L3J A;  4NHU E;  1N3N A;  2CII A;  1S9Y A;  3I6L D;  1E28 A;  3ARB A;  3QFD A;  4PJ5 A;  4G8I A;  5C08 A;  3H7B A;  3QDM A;  2UWE A;  4F7M A;  5F9J A;  2FWO A;  3PWL A;  3T1F A;  3B6S A;  4Z78 A;  3KPL A;  3MGT A;  4PDC E;  4PGD A;  5C0B A;  4X6D A;  4CVZ A;  4U1K A;  3H9S A;  5C0E A;  2V2X A;  4QRU A;  3KYO A;  4WW2 C;  5EU4 A;  1AGB A;  4PG9 A;  1T1X A;  3FQN A;  3MRM A;  1W0W A;  1S7T A;  1QLF A;  1QSE A;  3LKO A;  3FOL A;  5D7L A;  5FA3 A;  3KPO A;  4PGC A;  4I48 A;  4PJF A;  1S7W A;  4NO2 A;  1RK1 A;  4O2C A;  5C07 A;  4PR5 A;  3L3D A;  4ZFZ A;  1JPF A;  3BUY A;  3PQY A;  4G59 C;  3FQX A;  3AM8 A;  1A1M A;  3ARF A;  3SKM A;  3G08 A;  4G8G A;  3VRJ A;  3KPN A;  1ONQ A;  3KPS A;  5DEG A;  3UTT A;  3BVN A;  1TMC A;  1LP9 A;  3QQ4 A;  5J6H A;  5E9D A;  3BWA A;  1P1Z A;  4U6Y A;  3D3V A;  1AGE A;  3UTQ A;  2X4Q A;  1CD1 A;  3IT8 D;  3LKN A;  3PWP A;  2CLZ A;  3VCL A;  5B39 A;  3QDG A;  4X6E A;  3MV7 A;  3QI9 A;  3CH1 A;  3DX6 A;  1L8J A;  1QR1 A;  3HAE A;  1KJ2 H;  1X7Q A;  3GIV A;  4PJD A;  3P9M A;  5C0C A;  5C0F A;  2GT9 A;  3MRL A;  2NW3 A;  5EUO A;  1QO3 A;  5MEO A;  4HUX A;  3PAB A;  2CIK A;  1KJV A;  1P7Q A;  4PRH A;  3HG1 A;  5HHM A;  1ZHK A;  3VFR A;  1VAD A;  3TVM A;  4D0C A;  4HWZ A;  3MRP A;  3KXF A;  1YN7 A;  1OGA A;  4MNG A;  3VXU A;  4ELM A;  1MI5 A;  1DUY A;  3X13 A;  3BXN A;  3CVH A;  2CKB H;  2F74 A;  1K5N A;  4PJ7 A;  1FZJ A;  1T7X A;  1TVH A;  5EU6 A;  3MRB A;  3ILQ C;  3O9W A;  4JO8 A;  5FKP A;  5ISZ A;  4D0D A;  2AV1 A;  3MRE A;  4L29 A;  4N0F A;  3DX7 A;  4WWK C;  3CC5 A;  5IEH A;  3GSU A;  1FFP A;  3HCV A;  3BH9 A;  3LKR A;  1G7P A;  3VFS A;  4PRA A;  1KPU A;  3OXR A;  1C16 A;  1T0N A;  4HKJ A;  4JFO A;  4PJA A;  3T8X A;  4O2E A;  3TA3 A;  3FON A;  4V3E B;  3P4M A;  1LQV A;  2P5W A;  3VFU A;  3CDG A;  3O8X A;  4Z77 A;  2OI9 A;  1M05 A;  3TBS A;  4JFP A;  4PJ8 A;  4F7T A;  3SCM A;  1JPG A;  3TO4 A;  1ZHB A;  1I7U A;  3P77 A;  4PRE A;  4Y4K A;  3V5D A;  4JQX A;  2V2W A;  3TIE A;  5D7I A;  5D2N A;  3E6F A;  3LN4 A;  1MWA H;  3FQT A;  1QQD A;  4MJ6 A;  3VRI A;  3GSQ A;  3FT2 A;  1KPR A;  5IB3 A;  3CCH A;  1T1W A;  3BZF A;  2FYY A;  5D5M A;  1T0M A;  3QQ3 A;  4EI5 A;  3BHB A;  1S7S A;  4L3E A;  4QRS A;  5EO1 A;  2GAZ A;  3ECB A;  3GSW A;  3VFN A;  3JVG A;  3KWW A;  4N0C A;  3QUZ A;  3BP7 A;  2C7U A;  4PRN A;  3MRF A;  3RZC A;  1QSF A;  3H9H A;  1BQH A;  3SPV A;  3QUX A;  3MRC A;  4NNX A;  3REW A;  2MHA A;  1EEZ A;  1NAM H;  3TN0 A;  3VFW A;  3MRJ A;  2CLR A;  3TPU E;  1EFX A;  3I6G A;  4G9F A;  5H94 A;  5MER A;  5IB5 A;  2FIK A;  3P9L A;  1ZT7 A;  3TO2 A;  5JHD A;  3ARG A;  3JTS A;  1A1N A;  2HLA A;  4G43 A;  1IM9 A;  4PJH A;  1HHK A;  1FFN A;  3NFN A;  4NO0 A;  3AU1 A;  3I0T A;  1S7R A;  4HUV A;  5HGH A;  4LCY A;  3GSV A;  1Z5L A;  4MXQ A;  3DX8 A;  1PQZ A;  2VE6 A;  5B38 A;  5C9J A;  1KJ3 H;  3VXM A;  3PWU A;  3VJ6 A;  4LNR A;  3FTG A;  2BVO A;  1AKJ A;  3JTT A;  5HHN A;  2X4S A;  4G59 A;  4EUP A;  3M17 A;  3MRR A;  3MA7 A;  3D18 A;  3RWE A;  1YN6 A;  1BD2 A;  1JHT A;  3GSO A;  1S7V A;  2ZOL A;  1ZHL A;  1G7Q A;  4F7C A;  5SWQ A;  3X12 A;  1B0R A;  2NYK A;  3GMP A;  3P4N A;  5MEN A;  5ENW A;  3DMM A;  5HGA A;  4L4V A;  4PRP A;  4U6X A;  5DDH A;  3TBV A;  4L8S C;  3MR9 A;  5IB4 A;  5EU3 A;  3GSR A;  4IIQ C;  2AXF A;  1W72 A;  2OL3 H;  4LHU A;  4L3C A;  4LCC C;  5FDW A;  1FZO A;  5SWS A;  3FRU A;  1LEK A;  4MJI A;  5C09 A;  2BSR A;  4MNQ A;  3MRD A;  3X14 A;  5BXF A;  3QDJ A;  5HHO A;  3O3A A;  1RJZ A;  4NT6 A;  3GML A;  3RWG A;  5BS0 A;  4U1M A;  5MEP A;  5EOT A;  4U1L A;  4WU5 A;  4F7P A;  1XZ0 A;  3PWJ A;  4LCW A;  3O4L A;  3L9R A;  1WBY A;  2PYE A;  2P5E A;  3O3E A;  5BRZ A;  3KPQ A;  4JQV A;  1QEW A;  1XR9 A;  4MVB A;  5F1I A;  5FA4 A;  4ZUT A;  1A1O A;  1RJY A;  1I4F A;  4MJ5 A;  4Y2D A;  2BNR A;  3GSX A;  5IB1 A;  4L8B A;  2ZOK A;  3D25 A;  2GJ6 A;  2H26 A;  3GMR A;  3HPJ A;  4X6C A;  3HUJ A;  4U1J A;  1ZT4 A;  1I7R A;  4Y16 A;  4WU7 A;  3IXA A;  2F53 A;  2D31 A;  4MS8 A;  1YDP A;  2J8U A;  3VWJ A;  2BST A;  2ESV A;  3I6K A;  5IND A;  4ZUV A;  3QFJ A;  4PGB A;  4PJG A;  1ZAG A;  1T80 A;  3FQW A;  3BEV A;  3HE7 A;  4HUU A;  1R3H A;  3D2U A;  1FFO A;  1UXS A;  3L3G A;  3CZF A;  4IHO A;  1QVO A;  3TJH A;  3PWN A;  3RTQ A;  5E00 A;  3RL2 A;  1JE6 A;  3C8K A;  5INC A;  4G9D A;  4FTV A;  2X4T A;  4NSK A;  2BVQ A;  5DEF A;  1UXW A;  5IVX A;  1ED3 A;  1AGC A;  1T22 A;  4L8D A;  3FOM A;  3SDA A;  1VGK A;  4PJB A;  1JUF A;  1MHE A;  3LKP A;  4ZUU A;  4K71 B;  2YPK A;  1HHJ A;  2F54 A;  3KYN A;  1N5A A;  1S7U A;  3D39 A;  3QUL A;  3SDX A;  1JGE A;  3GMN A;  5EU5 A;  3V5H A;  4JRX A;  1HHI A;  2VAB A;  1NEZ A;  4NQV A;  3L3K A;  2X4U A;  3MV8 A;  4ZAK A;  5HYJ A;  3MYJ A;  4WDI A;  2HN7 A;  3VFT A;  2A83 A;  3ARE A;  2YPL A;  1G6R H;  1YPZ A;  3KPR A;  5C0D A;  3QUK A;  3ERY A;  4U1I A;  3BW9 A;  3S6C A;  1A9B A;  4ONO A;  3LKS A;  3FT3 A;  1CE6 A;  3TBT A;  3L3H A;  1I7T A;  1BII A;  3LV3 A;  2YEZ A;  1OSZ A;  1LD9 A;  2IA1 A;  4NQD A;  5ACZ A;  1LEG A;  2XPG A;  1E27 A;  3RGV C;  3TFK A;  3WL9 A;  3O3D A;  3ROO A;  4WO4 A;  2H6P A;  3HLA A;  1ZVS A;  3TID A;  3X11 A;  4UQ2 A;  3WS3 A;  1I1A A;  1T20 A;  3GJF A;  1RK0 A;  2GIT A;  4NNY A;  3WLB A;  5MEQ A;  4N5E A;  2VLR A;  3BZE A;  1K8D A;  4Z76 A;  4NO5 A;  1JFM A;  3TF7 A;  4Y4H A;  1HOC A;  1T7Y A;  3U0P A;  2GUO A;  4GKN A;  2DYP A;  1ZHN A;  3OXS A;  3BEW A;  4MX7 A;  1KCG C;  1W0V A;  3ILP A;  3VFO A;  1UQS A;  3P4O A;  4U1H A;  2BNQ A;  1TVB A;  3E6H A;  1T7V A;  3BP4 A;  2HJL A;  3V5K A;  4MQ7 A;  4ZUW A;  3W0W A;  2GTZ A;  4I4W A;  3VXP A;  2ZSV A;  1FZM A;  3W39 A;  3PWV A;  3MRO A;  4GKS A;  1BZ9 A;  4HUW A;  2BSS A;  1ZSD A;  4UQ3 A;  4N0U A;  4CW1 A;  3L3I A;  4PJE A;  5E6I C;  4NQC A;  2X70 A;  1B3J A;  3MRN A;  2FZ3 A;  1DDH A;  4XXC A;  3RL1 A;  3MRI A;  4JFD A;  3RWD A;  3VXN A;  2NX5 A;  3GMQ A;  1DE4 A;  1T7W A;  3KPM A;  3TBW A;  1WBZ A;  5EO0 A;  4QOK A;  1S8D A;  4ZUS A;  2XFX A;  1FZK A;  2O5N A;  3B3I A;  3VWK A;  3RWC A;  5J1A A;  3VXR A;  4Y4F A;  4HS3 A;  1SYV A;  1HHH A;  3RWJ A;  5C0J A;  4QRP A;  3M1B A;  4X6F A;  3UTS A;  3CPL A;  3VFM A;  2WY3 A;  3QZW A;  1KTL A;  2BCK A;  4F7E A;  3O3B A;  4PJ9 A;  2JCC A;  1ZS8 A;  3DTX A;  3ARD A;  3MRH A;  4G42 A;  5F7D A;  1IM3 A;  4PV9 A;  4JFQ A;  4JFE A;  3GMM A;  2X4O A;  5C0I A;  1EXU A;  5HGD A;  2AK4 A;  5BJT A;  1HYR C;  3KPP A;  3DXA A;  1KPV A;  1U58 A;  3QEQ A;  4PRD A;  4QRQ A;  4NQE A;  2CLV A;  1S7X A;  2X4P A;  2RFX A;  1QRN A;  1S9X A;  2VAA A;  1T21 A;  5EFI A;  5IRO A;  2ZSW A;  1EEY A;  3MRQ A;  4WJ5 A;  2BVP A;  1HSB A;  4FFE X;  1OF2 A;  3ES6 A;  1T1Y A;  1HSA A;  4PP8 C;  4PGE A;  1OGT A;  5D7J C;  4PV8 A;  4QRR A;  1S9W A;  3FQU A;  3C9N A;  4K7F A;  4PG2 A;  5C0G A;  3BH8 A;  3KLA A;  3GSN H;  3WS6 A;  4EN3 C;  1AGD A;  4D0B A;  1FG2 A;  4PJX A;  4JFF A;  5IB2 A;  4L8C A;  3DBX A;  1I1Y A;  4QRT A;  5F1N A;  1HHG A;  1WBX A;  4PJC A;  1M6O A;  4GUP A;  4PRI A;  3LN5 A;  4CVX A;  5HHQ A;  3RWF A;  5C0A A;  5HHP A;  3VFV A;  3E3Q A;  4JRY A;  1JF1 A;  2AXG A;  5GSR A;  3VXS A;  4APQ A;  5GSV A;  4PRB A;  5D9S A;  3UBX A;  4U1S A;  1XH3 A;  3RWH A;  3JTC A; 
#chains in the Genus database with same CATH homology
 1I1F A;  5E8P A;  1INQ A;  1DUZ A;  4U1N A;  3RWI A;  5IEK A;  2HJK A;  4V3D B;  1GZQ A;  5IM7 A;  4NQX A;  4PJI A;  3RUG A;  2AKR A;  5J6G A;  1FO0 H;  3VFP A;  3OV6 A;  3LKQ A;  1LK2 A;  4N8V A;  1T1Z A;  2FO4 A;  1NAN H;  3BO8 A;  3HE6 A;  3ROL A;  1A9E A;  4HV8 A;  1B0G A;  1N59 A;  3QUY A;  1Q94 A;  2GTW A;  3FT4 A;  4L4T A;  5E8O A;  1LDP H;  1S7Q A;  3MGO A;  4WUU A;  3TBY A;  5L2J A;  3TZV C;  3SJV A;  1AO7 A;  2AV7 A;  3FFC A;  1A6Z A;  4IRJ A;  1ZT1 A;  1SYS A;  2VLK A;  2X4R A;  5L2K A;  2VLL A;  1CG9 A;  3BGM A;  1KBG H;  4O2F A;  2E7L E;  3P73 A;  5SWZ A;  1GZP A;  3E2H A;  4S0U C;  3SDD A;  1AGF A;  3GMO A;  3MV9 A;  2VLJ A;  4NO3 A;  5E8N A;  2PO6 A;  3FQR A;  4L9L C;  5HGB A;  4E5X A;  1P4L A;  4E0R A;  1KJM A;  3VXO A;  5AD0 A;  3UPR A;  1JGD A;  1XR8 A;  1MHC A;  1T7Z A;  2Q7Y A;  2X4N A;  3MRG A;  4IRS A;  3WUW A;  3MRK A;  5D2L A;  3SKO A;  1VAC A;  1N2R A;  4HX1 A;  3VH8 A;  3OX8 A;  3SDC A;  3L3J A;  4NHU E;  1N3N A;  2CII A;  1S9Y A;  3I6L D;  1E28 A;  3ARB A;  3QFD A;  4PJ5 A;  4G8I A;  5C08 A;  3H7B A;  3QDM A;  2UWE A;  4F7M A;  5F9J A;  2FWO A;  3PWL A;  3T1F A;  3B6S A;  4Z78 A;  3KPL A;  3MGT A;  4PDC E;  4PGD A;  5C0B A;  4X6D A;  4CVZ A;  4U1K A;  3H9S A;  5C0E A;  2V2X A;  4QRU A;  3KYO A;  4WW2 C;  5EU4 A;  1AGB A;  4PG9 A;  1T1X A;  3FQN A;  3MRM A;  1W0W A;  1S7T A;  1QLF A;  1QSE A;  3LKO A;  3FOL A;  5D7L A;  5FA3 A;  3KPO A;  4PGC A;  4I48 A;  4PJF A;  1S7W A;  4NO2 A;  1RK1 A;  4O2C A;  5C07 A;  4PR5 A;  3L3D A;  4ZFZ A;  1JPF A;  3BUY A;  3PQY A;  3FQX A;  3AM8 A;  1A1M A;  3ARF A;  3SKM A;  3G08 A;  4G8G A;  3VRJ A;  3KPN A;  1ONQ A;  3KPS A;  5DEG A;  3UTT A;  3BVN A;  1TMC A;  1LP9 A;  3QQ4 A;  5J6H A;  5E9D A;  3BWA A;  1P1Z A;  4U6Y A;  3D3V A;  1AGE A;  3UTQ A;  2X4Q A;  1CD1 A;  3IT8 D;  3LKN A;  3PWP A;  2CLZ A;  3VCL A;  5B39 A;  3QDG A;  4X6E A;  3MV7 A;  3QI9 A;  3CH1 A;  3DX6 A;  1L8J A;  1QR1 A;  3HAE A;  1KJ2 H;  1X7Q A;  3GIV A;  4PJD A;  3P9M A;  5C0C A;  5C0F A;  2GT9 A;  3MRL A;  2NW3 A;  5EUO A;  1QO3 A;  5MEO A;  4HUX A;  3PAB A;  2CIK A;  1KJV A;  1P7Q A;  4PRH A;  3HG1 A;  5HHM A;  1ZHK A;  3VFR A;  1VAD A;  3TVM A;  4D0C A;  4HWZ A;  3MRP A;  3KXF A;  1YN7 A;  1OGA A;  4MNG A;  3VXU A;  4ELM A;  1MI5 A;  1DUY A;  3X13 A;  3BXN A;  3CVH A;  2CKB H;  2F74 A;  1K5N A;  4PJ7 A;  1FZJ A;  1T7X A;  1TVH A;  5EU6 A;  3MRB A;  3ILQ C;  3O9W A;  5FKP A;  5ISZ A;  4D0D A;  2AV1 A;  3MRE A;  4L29 A;  4N0F A;  3DX7 A;  4WWK C;  3CC5 A;  5IEH A;  3GSU A;  1FFP A;  3HCV A;  3BH9 A;  3LKR A;  1G7P A;  3VFS A;  4PRA A;  1KPU A;  3OXR A;  1C16 A;  1T0N A;  4HKJ A;  4JFO A;  4PJA A;  3T8X A;  4O2E A;  3TA3 A;  3FON A;  4V3E B;  3P4M A;  1LQV A;  2P5W A;  3VFU A;  3CDG A;  3O8X A;  4Z77 A;  2OI9 A;  1M05 A;  3TBS A;  4JFP A;  4PJ8 A;  4F7T A;  3SCM A;  1JPG A;  3TO4 A;  1ZHB A;  1I7U A;  3P77 A;  4PRE A;  4Y4K A;  3V5D A;  4JQX A;  2V2W A;  3TIE A;  5D7I A;  5D2N A;  3E6F A;  3LN4 A;  1MWA H;  3FQT A;  1QQD A;  4MJ6 A;  3VRI A;  3GSQ A;  3FT2 A;  1KPR A;  5IB3 A;  3CCH A;  1T1W A;  3BZF A;  2FYY A;  5D5M A;  1T0M A;  3QQ3 A;  4EI5 A;  3BHB A;  1S7S A;  4L3E A;  4QRS A;  5EO1 A;  2GAZ A;  3ECB A;  3GSW A;  3VFN A;  3JVG A;  3KWW A;  4N0C A;  3QUZ A;  3BP7 A;  2C7U A;  4PRN A;  3MRF A;  3RZC A;  1QSF A;  3H9H A;  1BQH A;  3SPV A;  3QUX A;  3MRC A;  4NNX A;  3REW A;  2MHA A;  1EEZ A;  1NAM H;  3TN0 A;  3VFW A;  3MRJ A;  2CLR A;  3TPU E;  1EFX A;  3I6G A;  4G9F A;  5H94 A;  5MER A;  5IB5 A;  2FIK A;  3P9L A;  1ZT7 A;  3TO2 A;  5JHD A;  3ARG A;  3JTS A;  1A1N A;  2HLA A;  4G43 A;  1IM9 A;  4PJH A;  1HHK A;  1FFN A;  3NFN A;  4NO0 A;  3AU1 A;  1S7R A;  4HUV A;  5HGH A;  4LCY A;  3GSV A;  1Z5L A;  4MXQ A;  3DX8 A;  1PQZ A;  2VE6 A;  5B38 A;  5C9J A;  1KJ3 H;  3VXM A;  3PWU A;  3VJ6 A;  4LNR A;  3FTG A;  2BVO A;  1AKJ A;  3JTT A;  5HHN A;  2X4S A;  4G59 A;  4EUP A;  3M17 A;  3MRR A;  3MA7 A;  3D18 A;  3RWE A;  1YN6 A;  1BD2 A;  1JHT A;  3GSO A;  1S7V A;  2ZOL A;  1ZHL A;  1G7Q A;  4F7C A;  5SWQ A;  3X12 A;  1B0R A;  3GMP A;  3P4N A;  5MEN A;  5ENW A;  3DMM A;  5HGA A;  4L4V A;  4PRP A;  4U6X A;  5DDH A;  3TBV A;  4L8S C;  3MR9 A;  5IB4 A;  5EU3 A;  3GSR A;  4IIQ C;  2AXF A;  1W72 A;  2OL3 H;  4LHU A;  4L3C A;  4LCC C;  5FDW A;  1FZO A;  5SWS A;  3FRU A;  1LEK A;  4MJI A;  5C09 A;  2BSR A;  4MNQ A;  3MRD A;  3X14 A;  5BXF A;  3QDJ A;  5HHO A;  3O3A A;  1RJZ A;  4NT6 A;  3GML A;  3RWG A;  5BS0 A;  4U1M A;  5MEP A;  5EOT A;  4U1L A;  4WU5 A;  4F7P A;  1XZ0 A;  3PWJ A;  4LCW A;  3O4L A;  3L9R A;  1WBY A;  2PYE A;  2P5E A;  3O3E A;  5BRZ A;  3KPQ A;  4JQV A;  1QEW A;  1XR9 A;  4MVB A;  5F1I A;  5FA4 A;  4ZUT A;  1A1O A;  1RJY A;  1I4F A;  4MJ5 A;  4Y2D A;  2BNR A;  3GSX A;  5IB1 A;  4L8B A;  2ZOK A;  3D25 A;  2GJ6 A;  2H26 A;  3GMR A;  3HPJ A;  4X6C A;  3HUJ A;  4U1J A;  1ZT4 A;  1I7R A;  4Y16 A;  4WU7 A;  3IXA A;  2F53 A;  2D31 A;  4MS8 A;  1YDP A;  2J8U A;  3VWJ A;  2BST A;  2ESV A;  3I6K A;  5IND A;  4ZUV A;  3QFJ A;  4PGB A;  4PJG A;  1ZAG A;  1T80 A;  3FQW A;  3BEV A;  3HE7 A;  4HUU A;  1R3H A;  3D2U A;  1FFO A;  1UXS A;  3L3G A;  3CZF A;  4IHO A;  1QVO A;  3TJH A;  3PWN A;  3RTQ A;  5E00 A;  3RL2 A;  1JE6 A;  3C8K A;  5INC A;  4G9D A;  4FTV A;  2X4T A;  4NSK A;  2BVQ A;  5DEF A;  1UXW A;  5IVX A;  1ED3 A;  1AGC A;  1T22 A;  4L8D A;  3FOM A;  3SDA A;  1VGK A;  4PJB A;  1JUF A;  1MHE A;  3LKP A;  4ZUU A;  4K71 B;  2YPK A;  1HHJ A;  2F54 A;  3KYN A;  1N5A A;  1S7U A;  3D39 A;  3QUL A;  3SDX A;  1JGE A;  3GMN A;  5EU5 A;  3V5H A;  4JRX A;  1HHI A;  2VAB A;  1NEZ A;  4NQV A;  3L3K A;  2X4U A;  3MV8 A;  4ZAK A;  5HYJ A;  3MYJ A;  4WDI A;  2HN7 A;  3VFT A;  2A83 A;  3ARE A;  2YPL A;  1G6R H;  1YPZ A;  3KPR A;  5C0D A;  3QUK A;  3ERY A;  4U1I A;  3BW9 A;  3S6C A;  1A9B A;  4ONO A;  3LKS A;  3FT3 A;  1CE6 A;  3TBT A;  3L3H A;  1I7T A;  1BII A;  3LV3 A;  2YEZ A;  1OSZ A;  1LD9 A;  4NQD A;  5ACZ A;  1LEG A;  2XPG A;  1E27 A;  3RGV C;  3TFK A;  3WL9 A;  3O3D A;  3ROO A;  4WO4 A;  2H6P A;  3HLA A;  1ZVS A;  3TID A;  3X11 A;  4UQ2 A;  3WS3 A;  1I1A A;  1T20 A;  3GJF A;  1RK0 A;  2GIT A;  4NNY A;  3WLB A;  5MEQ A;  4N5E A;  2VLR A;  3BZE A;  1K8D A;  4Z76 A;  4NO5 A;  1JFM A;  3TF7 A;  4Y4H A;  1HOC A;  1T7Y A;  3U0P A;  2GUO A;  4GKN A;  2DYP A;  1ZHN A;  3OXS A;  3BEW A;  4MX7 A;  1KCG C;  1W0V A;  3ILP A;  3VFO A;  1UQS A;  3P4O A;  4U1H A;  2BNQ A;  1TVB A;  3E6H A;  1T7V A;  3BP4 A;  2HJL A;  3V5K A;  4MQ7 A;  4ZUW A;  3W0W A;  2GTZ A;  4I4W A;  3VXP A;  2ZSV A;  1FZM A;  3W39 A;  3PWV A;  3MRO A;  4GKS A;  1BZ9 A;  4HUW A;  2BSS A;  1ZSD A;  4UQ3 A;  4N0U A;  4CW1 A;  3L3I A;  4PJE A;  5E6I C;  4NQC A;  2X70 A;  1B3J A;  3MRN A;  2FZ3 A;  1DDH A;  4XXC A;  3RL1 A;  3MRI A;  4JFD A;  3RWD A;  3VXN A;  2NX5 A;  3GMQ A;  1DE4 A;  1T7W A;  3KPM A;  3TBW A;  1WBZ A;  5EO0 A;  4QOK A;  1S8D A;  4ZUS A;  2XFX A;  1FZK A;  3VWK A;  3B3I A;  3RWC A;  5J1A A;  3VXR A;  4Y4F A;  4HS3 A;  1SYV A;  1HHH A;  3RWJ A;  5C0J A;  4QRP A;  3M1B A;  4X6F A;  3UTS A;  3CPL A;  3VFM A;  2WY3 A;  3QZW A;  1KTL A;  2BCK A;  4F7E A;  3O3B A;  4PJ9 A;  2JCC A;  1ZS8 A;  3DTX A;  3ARD A;  3MRH A;  4G42 A;  5F7D A;  1IM3 A;  4PV9 A;  4JFQ A;  4JFE A;  3GMM A;  2X4O A;  5C0I A;  1EXU A;  5HGD A;  2AK4 A;  5BJT A;  1HYR C;  3KPP A;  3DXA A;  1KPV A;  1U58 A;  3QEQ A;  4PRD A;  4QRQ A;  4NQE A;  2CLV A;  1S7X A;  2X4P A;  2RFX A;  1QRN A;  1S9X A;  2VAA A;  1T21 A;  5EFI A;  5IRO A;  2ZSW A;  1EEY A;  3MRQ A;  4WJ5 A;  2BVP A;  1HSB A;  4FFE X;  1OF2 A;  3ES6 A;  1T1Y A;  1HSA A;  4PP8 C;  4PGE A;  1OGT A;  5D7J C;  4PV8 A;  4QRR A;  1S9W A;  3FQU A;  3C9N A;  4K7F A;  4PG2 A;  5C0G A;  3BH8 A;  3KLA A;  3GSN H;  3WS6 A;  4EN3 C;  1AGD A;  4D0B A;  1FG2 A;  4PJX A;  4JFF A;  5IB2 A;  4L8C A;  3DBX A;  1I1Y A;  4QRT A;  5F1N A;  1HHG A;  1WBX A;  4PJC A;  1M6O A;  4GUP A;  4PRI A;  3LN5 A;  4CVX A;  5HHQ A;  3RWF A;  5C0A A;  5HHP A;  3VFV A;  3E3Q A;  4JRY A;  1JF1 A;  2AXG A;  5GSR A;  3VXS A;  4APQ A;  5GSV A;  4PRB A;  5D9S A;  3UBX A;  4U1S A;  1XH3 A;  3RWH A;  3JTC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...