3JTEA

Crystal structure of response regulator receiver domain protein from clostridium thermocellum
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
126
structure length
126
Chain Sequence
LAKILVIDDESTILQNIKFLLEIDGNEVLTASSSTEGLRIFTENCNSIDVVITDMKMPKLSGMDILREIKKITPHMAVIILTGHGDLDNAILAMKEGAFEYLRKPVTAQDLSIAINNAINRKKLLM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of response regulator receiver domain Protein from clostridium thermocellum
rcsb
source organism Clostridium thermocellum atcc 27405
molecule tags Protein binding
molecule keywords Response regulator receiver protein
total genus 48
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2009-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3jteA00
2WRZA 2FKAA 4GNRA 1BDIA 1Z18A 1VRVA 1ZESA 4KK4A 4N0PA 4Z9AA 4RXTA 5DTEA 5EWMA 4DN6A 3HXMA 2E4ZA 1BA2A 2JB9A 3KKEA 4KZKA 3CZCA 4WT7A 4YO7A 4M88A 2MYPA 3SG0A 3RVKA 4Y9TA 3HJFA 3P9YA 1EAYA 4PE5B 5CNMA 3GBPA 2IYNA 4UHKA 5BRAA 3SY8A 1Z25A 2OQRA 1U04A 1Z13A 3Q7TA 2FQYA 3NNDA 5JNUA 2M98A 4PZ0A 2RJNA 1PEAA 3CZ5A 1E6MA 5T7BA 3ILYA 4OTZA 4NQRA 1DJMA 1W25A 3GBVA 3JVIA 3I45A 4G86A 2NZVG 2YHAA 1B00A 4Z9BA 5FBKA 4KREA 3FFXA 5IUKC 3DGFC 4Z4GA 4LX8A 1GCGA 4FE7A 2LP4Y 2IPAB 2VK2A 4G0ZA 5CNJA 5GQSA 3CS3A 3A10A 3URMA 4KPYA 3H5WA 1E2BA 1QQBA 4Z4CA 3BBLA 1NXSA 4RKQA 3OQNA 1EHCA 1SXHA 5DCLA 5IUNC 2MYUA 1EFAA 1USKA 2LUOA 1D4ZA 5IUJC 1XHEA 4EVQA 1SXGA 1YMUA 3N0RA 2IPMA 1QMPA 4CBVA 1A04A 2L18A 4YS6A 3O1HB 3O75A 4ZMSA 3SQNA 3OM1A 3KS9A 1MAVA 2FLWA 2GI4A 3EQZA 3LMKA 4PEVA 3A0UA 3EDCA 3HK2A 5JNTA 4ZMRA 1J56A 3G85A 1TLFA 1ISSA 5TQ2B 5ABPA 3O1IC 3HDGA 5IC5A 1C4WA 3EAFA 4JB0A 4W5TA 4NV3A 3O74A 4RK6A 3RVJA 3BILA 4P98A 1ABFA 4LRQA 4KRFA 1M2EA 5CHYA 3GRCA 4LE0A 2GWRA 2NT4A 1JDNA 1JYFA 1Z17A 2NT3A 1DG9A 2WJWA 1NXOA 1T34A 1YIOA 2QVCA 4EUKA 4F06A 3H75A 2W42A 1GUBA 2ID7A 4LE1A 4HNSA 1U0SY 4RY0A 3UKJA 3NBMA 3HSYA 4QICA 3DBIA 4DADA 3DGEC 1F4VA 3MM4A 2PMCA 1RPJA 5JNWA 1PHRA 3GT7A 3I09A 4D6YA 2F8SA 5IX8A 2HQBA 3C3MA 3JPWA 4W5RA 2FXIA 3QK7A 4Q6BA 5HQJA 2PL1A 3MYYA 4JA2A 4YCSA 2PUEA 1DRJA 3GV0A 1JBEA 3LUFA 3RVSA 4L85A 3LUGA 4YRZA 3GYBA 4YR7A 1P6UA 1ZITA 3QELB 3HUTA 4Q7EA 4O1IA 5DGCA 3C6QA 1JLKA 1XWWA 2FSPA 2MYTA 4LDZA 1H9CA 3D8UA 3HVRA 2CWDA 7ABPA 3ROFA 3QLVC 5I4CA 5BQ3A 4IMJB 4WUTA 2KYRA 3M9XA 4YLEA 1QKKA 1KRXA 3KYIB 1USGA 3LUCA 1GUDA 1RNLA 1RXIA 4KNYA 1LBIA 4QPJC 1D1QA 3HDVA 1U2QA 3L49A 3E3MA 4ETMA 2M1ZA 4MR8B 3HS3A 4YGXB 4KQ9A 4RZSA 2PUCA 4NCBA 1R8JA 4E7PA 1E6KA 1LJLA 1VKRA 3KLOA 2FMFA 2JRLA 1CHNA 3LUAA 4ZPJA 1NXPA 2PUFA 2LPMA 2A9QA 5JS2A 4TN5A 1ZN2A 5TPZA 3CRNA 2PKXA 4MQEB 1P8AA 4PYRA 4QYWA 4WWHA 3BREA 5IBQA 4EYGA 5ED4A 2RDMA 1ZGGA 2R47A 3IPCA 9ABPA 4UHJA 4L4UA 2GX6A 2CHEA 1TJYA 3GWGA 2ZWMA 3O1JC 3HUUA 2R25B 1YS7A 4MS1A 4XASA 3MMNA 1DBWA 3FFWA 1JHZA 3CHYA 3JPYA 1QO0D 2AYZA 5EWMB 3F6CA 4MYRA 1P6QA 2HQRA 5D2CA 4YP9A 5CNKA 3SM9A 1APBA 2PUBA 4DQDA 5KQGA 4RU1A 4HYEA 1WETA 4MS1B 3Q41A 3A0RB 1PEYA 4G97A 2H3HA 3H5LA 2HSGA 2VYCA 3QEMB 1OXKB 4YWHA 1ZAYA 2L17A 3QEMA 1PNRA 4G0MA 1LJUA 3FDFA 2FLKA 3KG2A 1LK0A 5FBHA 4KVFA 2A9PA 5KI6A 5KQPA 1VPWA 2TMYA 4F3TA 2V0NA 2H0AA 2FEWB 3EODA 4MQFB 1DCKA 2P4UA 1EWVA 2E4VA 3F7NA 4F12A 1DCFA 3N53A 5FWYA 3OLWA 3QLUC 1JWLA 1BDHA 3RVNA 1JF8A 1ZHHA 4MRMA 1D1PA 3IPAA 3O2SB 3OO0A 4EYQA 3OO1A 5EWLA 2FMHA 1JYEA 3TD9A 4MLCA 2N9UA 4XAQA 4HNRA 4TMYA 3LOPA 3N0WA 4JB2A 1Z12A 4G0YA 5KC8A 4HNQA 4OATA 2PE5A 2B1JA 5TQ0A 3ILHA 1QQAA 4Q6WA 3F6PA 3M9WA 3T8YA 3K9CA 1FSPA 3FFTA 2JK1A 3KSMA 2FMIA 1A0OA 5B3JA 1CEYA 3QELA 3BRQA 3JS5A 2PL9A 3CG0A 1ZGZA 1W9HA 2LBPA 2O20A 1BAPA 2E4WA 3EGCA 3I5AA 5JNSA 1D2AA 2I6FA 3KCNA 5TPWB 2PAFA 2IDMA 2QV0A 2JVJA 1NATA 3RQIA 2GBPA 1TM2A 3QEKA 3TX6A 1JFVA 4S05A 4XXHA 1BDJA 2OENG 2X7XA 5BR1A 1KMIY 1OXBB 4H3KB 3Q7SA 1YVUA 1QP0A 2PUAA 1QNLA 1DC7A 2QXYA 2QVGA 4LE2A 4RXMA 3VNAA 4FE4A 3ROTA 3CLKA 2JCGA 4Z99A 1AB6A 3O2QB 3LFTA 3IP6A 1D5WA 1NXXA 1ZDMA 1NY5A 3CFYA 1USIA 5HKOA 2MSWA 3RH0A 1Z15A 3C3KA 1NTRA 5B3JC 3R0JA 4W5OA 1QPZA 4RK4A 4RY8A 4MS3B 3OQMA 2B4AA 4EGSA 3H6HA 4KFCA 1NXVA 2JBAA 3C3WA 5TQ0B 3QLVA 1TVMA 2QU7A 5T3YA 4EY3A 1E6LA 4KMRA 2CD7A 3RVMA 2MYNA 1ISRA 3C97A 4MQFA 1RXEA 3FGZA 5IEJA 4WXEA 4G0PA 5DKFA 3T38A 3T6KA 5C5CA 1F51E 4PICA 3MF4A 5PNTA 1IIBA 1M5UA 4RS3A 2LIVA 5FWXB 2FMKA 3JVDA 1JX6A 4TLLB 1DCMA 3UK0A 4EVSA 2BGGA 1DRKA 2VUHB 5C5EA 3QLUA 1ABEA 3E61A 1L5YA 3Q7RA 3GA5A 3RVRA 1U8TA 2IKSA 3N0XA 5TQJA 1AB5A 1GLGA 1MB3A 4MR7A 4RK1A 4EYOA 2R48A 1ZY2A 4KV7A 5KQMA 3OQOA 3DLBA 2RJOA 2Q5CA 2FEPA 5JS1A 3H1FA 1PUXA 4OBBA 4MR9A 4ZYLA 3T95A 2WY2D 3OLZA 1FQWA 3CG4A 1BVHA 1Z2DA 4EYKA 4S04A 3CKMA 3H5IA 4LDAA 4ZJPA 3MA0A 1FFSA 5HM6A 2AYXA 2IOYA 1YS6A 1FFGA 5DLEA 6ABPA 4RWEA 2RGYA 2ID9A 3H5OA 3A3KA 2FEKA 3QLTA 4MR7B 2FVYA 3SAJA 3TMYA 4GPAA 4O5AA 4W5QA 3HEBA 4IRXA 3UUGA 4RDCA 3VNBA 3IDOA 1Z16A 3G1WA 3H5VA 4XFKA 1JFSA 3Q9SA 4JAVC 3RVOA 3LUHA 5KWSA 2A9OA 4KK3A 4H3HB 3CNBA 1JFTA 5FWXA 4D6XA 1Z2EA 1XHFA 2PUDA 5TE9A 3MQ4A 3H6GA 3EJWA 1QO0A 3NHZA 3DZDA 4G0XA 4JOQA 3B2NA 3EQ2A 2WJAA 3MIZA 4ETNA 1MVOA 4QYMA 1GCAA 1YMVA 2NUBA 4MR9B 3KHTA 2VUIB 3W9SA 4Z4IA 1SXIA 2FN9A 3KTOA 3OLVA 1QP4A 1YK0A 3GL9A 5E3JA 1TMYA 1HEYA 4JP1A 2L19A 5TPZD 4MQEA 4RK7A 3OMXA 4Z4FA 4JASB 2FTKE 5F64A 1CYEA 3RVPA 1C0EA 4MGEA 3M6MD 4EVRA 4P1ZA 2MSKA 3OLYA 4ETIA 1YTUA 2QSJA 2WMYA 3N8IA 4IF4A 1DBQA 3KLNA 2QZJA 1KGSA 1L5ZA 2E4UA 4RXUA 5CNIA 1DP4A 4MR8A 5HSGA 2HQOA 3IP5A 1MB0A 4MPTA 4FB4A 3QX9A 4IILA 4N0QA 4N03A 3NHMA 1ZH4A 4NICA 2HJ9A 2QR3A 3HM9A 4OLBA 2PUGA 4Z4HA 3OLXA 4XLTA 4OG2A 5KQLA 3LUJA 4RSMA 4N41A 2FQXA 1MIHA 1KRWA 2JBAB 2WWVD 4WZZA 4H60A 3NNSA 5BRJA 3JTEA 1DC8A 3H5TA 2XDYA 4IMIB 3I42A 5EWJB 5TQ2A 3OM0A 3TB6A 4MS3A 4YV7A 1P2FA 2JVIA 4D74A 2J48A 4E7OA 3LUDA 4Z4EA 3TO5A 2MSLA 3EULA 3O21A 4N76A 6CHYA 1EWTA 3LTEA 1K68A 1ZH2A 2L2QA 4F11A 5JNRA 3F73A 2F8TA 1SRRA 1FFWA 1URPA 1U2PA 4MS4A 1S8NA 3SNKA 4OLAA 1Y1LA 2QW1A 3O2JA 4ML3A 3S99A 5KC9A 4MAAA 4B09A 2HPHA 3FMVA 4RKRA 2WB4A 4MS4B 4W5NA 1QP7A 4RK5A 3QX8A 3CTPA 1ZVVA 1M5TA 2E4YA 3D02A 1PNTA 2GKGA 4N47A 1DBPA 2IPNA 3RVQA 3H1EA 3JY6A 3H1GA 4IGAA 1UDRA 3DLHA 4KQCA 1LBHA 5EWJA 2A9RA 1VLZA 2PLNA 4G0QA 4NCAA 1DZ3A 2FN8A 1A2OA 4MLDA 5IEBA 2YHBA 3LUKA 1NXTA 4RK0A 3NNNA 3RVLA 3BRSA 5EWLB 3LKVA 3Q15C 2E4XA 3KYJB 8ABPA 1RZRA 3K4HA 1JH9A 1NXWA 3CU5A 4TLMB 4MRMB 5JNVA 1JDPA 2PJUA 3L6UA 3N75A 2JVKA 2FQWA 2ZAYA 3N6VA 5GOTA 4RV5A 3KJXA 3HZHA 2R4QA 3HCWA 2CHFA 3IP9A 5TPWA 3HO1A 5FWYB 3OMWA 5IULC 2P9HA 4XARA 1RZRD 2FW0A 2IPLA 3HV2A 2DRIA 4G0OA 1YK1A 1I3CA 1K66A 4O1HA 4Z0NA 1EWKA 1JL3A 1Z26A 4WXMA 1M2FA 2NZUG 3LKBA 4F8JA 4LZLA 1SD5A 4RY9A 3IP7A
chains in the Genus database with same CATH superfamily
3U1TA 2FKAA 4WOPA 2WINI 1QDUA 3RRMA 4KFRA 4Y6OA 2P1DA 2XWBF 2YHIA 5K0BA 3MWYW 3EZGA 1G8GA 2AXQA 1SRQA 2D59A 4E5YA 1MQAA 2C7RA 3MTAA 3E3OA 3UHPA 3GW8A 3ND5A 1DTWB 1RQNA 2ZPTX 2W0SA 2HCJB 1TFRA 3LDFA 2OGTA 2GCNA 4RESA 2QX4A 3VOAA 4KMMA 4MWBA 4AZ3A 1A9XB 2JLRA 2YYAA 3OJCA 1Y1KE 1M6YA 1NM5A 3DT8A 3E4CA 4UXHA 3ICCA 4YONB 2JFNA 4KREA 2EW8A 1GUFA 2D3WA 2Q3FA 1RAGA 1RI1A 5EKTA 4K40A 4EBBA 1UBGA 4LX8A 2AFHA 3P19A 5CW1A 1KI8A 3HZOA 4WXHA 4G0ZA 1P62B 2IQ5A 2OCDA 3MRSA 1B2RA 3EF3A 5FFNA 3WDKA 4QXAA 4HYYA 1YULA 2IYYA 2XJ4A 3G8CA 3VHXA 3FXAA 1J7JA 1OH7A 3FKSD 1I4OA 1P4RA 1Z4OA 4A2WA 2ZPAA 1VLQA 4WERA 2C9YA 4TVKA 4E4TA 2WT9A 1RWPA 1TK2A 2ID4A 5G1OA 1BTOA 4U5QA 3WLHA 3K70D 3LY5A 2NU8B 2RGBA 2MU1A 4FR5A 1JEOA 2NXCA 1P3Y1 2OPBA 5DBGA 4ZVVA 4CIBA 2LKCA 3O1HB 3THSA 1INLA 4BUCA 2I2CA 4K6OA 1T5SA 1ECBA 4I1YA 2WG0A 2WEKA 1EWRA 4KVZA 3TKAA 5JZMA 1BHQ1 1YAJA 3QOXA 2CYCA 2PT6A 1CJMA 1KL7A 4JJ6A 2V4ZA 4UZEA 1H5UA 4BX2A 4ERNA 5LOVF 3BSYA 3T41A 5K8TA 5KYWB 1N2EA 5MGNA 1MJ5A 3H2IA 1YJ5A 5K2OA 3QY0A 4JI5B 2WM2A 1QR2A 2IUTA 4YRCA 5FADA 3GT0A 1VLJA 2FG5A 3DONA 5EXEA 2ZUTA 1LB1B 5FYQA 1E58A 1QCCA 3FIUA 4JV5B 4J29A 1VRCA 3CSSA 1R1DA 3DAFA 3QPCA 2IYQA 1JECA 1OW3B 3VVCA 1CQPA 1N6KA 4K88A 1JQAA 4J6FA 5FR2A 4CCWA 4IKPA 1RABA 2II6A 5EIAA 3O8RA 2CZGA 2JF0A 2YXEA 4OQQA 1UJ5A 4R0VA 4KR7A 1PHRA 1ENOA 1UKEA 4YJDA 2CEKA 2MT9A 5BNFA 2PAAA 3EC7A 3KNZA 4KYIB 5JIBA 5CDSA 1IHDA 1IPFA 4XB2A 3UATA 2C7OA 3QXXA 2CCKA 4HHEA 2BTQB 3ITKA 1EVEA 4LQCA 5D6NA 4DWJA 2WNSA 3KD2A 4FZVA 3JQBC 4PC2A 2XNJA 1M7HA 3IE1A 3KR0A 4ZAGA 4O6VA 2YWFA 2WP8J 1P4GA 2JCYA 2ODWA 3HXKA 3NT5A 1E8MA 5ICFA 1RKBA 4OGKA 3ZY3A 4B6JA 4NCXA 1IH8A 3A9VA 4AY2A 2O6LA 4HNHA 4OQ4A 3MMPA 2XBUA 2HPZA 3ZVMA 3BJIC 3BZWA 5T4FA 5F98A 4UDYX 4DVJA 1GUAA 3KZKA 3QPBA 2OHGA 2NACA 2R7LA 2RH4A 2ZTLA 2EDAA 2R4TA 1JHXA 2W2OA 1CUAA 3A1TA 3LX8A 4J1SA 5EIOA 3EQ7A 1KMQA 3EVEA 4OI4A 1PG5A 3TQTA 1JP7A 1QFMA 3WGHA 4M8NE 4QM7A 2CZCA 3WB9A 1Y8QA 2FSVA 4HSEA 4EQZA 1TEZA 2CDCA 3ZOKA 1DUVG 1WUHS 2Q41A 4WFKA 4GI7A 5MFPA 3V55A 3DBHB 5G4KB 4DUPA 1IM5A 2QYTA 5JDIA 2JLXA 3PEWA 3I92A 4NCBA 2OHXA 4YV2A 2G36A 1Z6ZA 1VKRA 2C7BA 3U61B 1HMPA 5KKCA 1B4DA 3ZE9A 5ELLA 4IG9A 5J47A 4DV7B 3SLKA 3JWPA 3LJKA 4ND2A 1HA3A 2CFRA 1CR6A 1WV0A 2N0SA 2Z43A 3BREA 4YMTA 5JPIA 3IPCA 3VOTA 4E03A 5K8LA 3UXMA 3FPFA 1FUUA 1QHYA 3STYA 4LYYA 2PGLA 4GFDA 4QGFA 1XTZA 3CX3A 1AKYA 1Z4IA 3WTBA 4EKYA 1G41A 2XCSB 5JJLA 1RWVA 1EJ0A 2D2FA 3DFKA 1SA0B 1ZNYA 4P4GA 4LHVA 1QJ4A 2ECPA 1Q0LA 2OD7A 2PMKA 2I34A 3E9RA 5FAKA 3J7AC 2XWPA 3NWBA 2D06A 3PHLA 3QYJA 2PH5A 2OCAA 4IOLA 2AEEA 4RSGA 1ZCAA 5E1OA 4JNCA 4AJEA 3D5TA 2ZT8A 1XTPA 3EG5A 1XAHA 5BSKA 4DR5B 2IGTA 1QIJA 2JEOA 3FYTA 4C22A 3O7WA 3QEMB 4ND7A 3BPSA 3OI7A 2V7QD 2P9ZA 4IJWA 3WL3A 1XNRB 2IHJA 4EPWA 3DOJA 1E2EA 4FEGA 5EE0A 3LCVB 4W1SA 5ALNA 2V0NA 4YWJA 4AY5A 3H4TA 3W4IA 1PRYA 3I0NA 2E4VA 5IBPA 1WP4A 3H8JA 2O1XA 5AT1A 4BFXA 5JARA 4YPOA 3C7TA 3ICOA 1B26A 3I34X 4NNPA 4B7ZA 4R84A 5CP8A 3JQAA 1TUEA 4WY5A 5T41A 3SS7X 3TLBA 1MW8X 5TMEA 3LPAA 1F8FA 5AKHA 4UQPA 4IVRA 1B8PA 4EPRA 3JD1A 4M38A 3R9XB 4QSMA 4PLCA 2B6NA 3TVDA 1Z4NA 2VHXA 4GEKA 3C6KA 3DMPA 2V7UA 4GGMX 1KYYA 2QA5A 5DHPA 5LYJB 3UB4A 3OOYA 1GPMA 4II7A 4CIXA 4CM8B 3OETA 1S0UA 2OHVA 3MELA 3UANA 1IULA 4DSUA 5CA1A 4V0NA 4OSEA 4PQFA 4PYIA 4U3JA 3L92A 4U63A 4DSNA 3FFAA 1LBQA 3PL5A 3UV6A 3FB4A 3GRVA 4C0BA 1O1YA 1UL1X 2E4AA 2QWXA 1OE0A 1ZGZA 2BAGA 1BH2A 3KJQA 4FUTA 1QK3A 1MP0A 4JGIA 1A72A 1D2AA 2FUNB 3T9CA 4E5MA 5M34A 3GPLA 3HWWA 1YQXA 2V96A 3SQOA 3WWDA 3RSQA 1A7KA 2QK4A 3PC2A 4LYHA 3V00A 3ZHVA 4BASA 1NATA 4B6FA 2WJJA 5JMOA 1D8AA 1DUSA 4L3VA 3TX6A 1YQTA 1XGKA 4S05A 1A9RA 5HE8A 4OGWA 2VRNA 1JR4A 2ESRA 4YJFB 1UZMA 3A3NA 1IJBA 1BWQA 4JR0A 2QVZX 1BHSA 1BXGA 5DW0A 1QP0A 3D2BA 4Q4LA 1PIWA 1VPVA 1VRWA 1RP1A 3ESAA 2BMAA 5FA5A 4E3WA 5LD2C 4WA7A 2BGWA 4Q3BA 3R3WA 1DG1G 1JTVA 3OPMA 3TXYA 2D1RA 4D8YA 3ONDA 4C2UA 2H7CA 5DLDA 3AKCA 4QJBA 1LTQA 1M6HA 1S3SA 1ZEJA 1FP6A 5TVGA 4Y2PA 3VR5D 3NHPA 5DNUA 4CKCB 4MV4A 4WEOA 1M75A 1X7XB 2NIPA 1XHLA 1MC1A 1NXVA 3Q3JB 4ISBA 3UYLA 4C2BA 2IZ1A 4MCAA 2ZWAA 2P5SA 2BFMA 2B78A 3KUCA 3OICA 1NP3A 2OK8A 2OGSA 3OESA 2XZOA 4F6RB 3SDBA 4JUAA 1RZ3A 4PQEA 3I39X 4M0KA 1R0CA 1G19A 1YBHA 4B81A 4D9MA 1MQ8B 4RTMA 1T4MA 2AI1A 3KTAB 3SF0A 4YMHA 1E9CA 1RXEA 4XUEA 1NBIA 1G8FA 1P72A 4OMDA 4URYR 4MZXA 1W4ZA 3JX9A 4DA0A 1R0RE 2IBMA 1EFRD 2GM9A 1R9MA 2LIVA 1PR4A 2IY9A 2ZJFA 3JVDA 1NULA 4G65A 3VYTB 2PKRA 3ENKA 4NFLA 1OPRA 1Y4UA 1THZA 2BKEA 1NVWQ 1C7IA 4DNOA 1P91A 4QPPA 3EAGA 1IPEA 1KNXA 1YCHA 2BF7A 1L8OA 2WBLC 5EFOA 3BF8A 4E4YA 4EW6A 1RQXA 4Q12A 1T8WA 1H2BA 3I2HA 4GE3A 2R8BA 2NG1A 1RXSA 3T3MB 1BW9B 4S0ZA 2R48A 5EEGA 4YBZA 4KH0A 2Q5CA 4DKXA 1Y81A 5FAXA 2YRWA 3AJRA 5IN4A 3A1VA 5K20A 3PG5A 3MJ4A 3ZCQA 5T3UA 1FQWA 1IATA 1J5XA 2NNWB 2C04A 2XUFA 1Q44A 3ABIA 4QATA 2VTEA 3O82A 3FDZA 3NATA 3W1WA 1UOEA 1W9MA 2VATA 2X13A 3B36A 3MTIA 1NBMA 1YS6A 1MEOA 4ASUD 3TSYA 5L3VA 3BERA 1P9NA 1JRLA 1ENYA 3OOEA 4GWGA 1LVGA 3K8ZA 2ACVA 3QPVA 1D4FA 4NONA 2VOJA 5DNWA 1U8YA 1ZU4A 1R8SA 3PUKA 4LDRA 3COJA 2TYSB 3SKXA 5KYXB 1QGDA 2QUBA 1U7ZA 2AFHB 2GJ9A 4WBSA 1DGQA 2P0EA 4XGQA 1MV5A 4BMVA 5KSZA 5KYYA 1Y48E 2JHAA 3LKDA 3UN1A 1BIFA 1ORHA 2A9OA 3HJCA 4MWEA 5L9AA 4M9XA 4HN4B 1G3MA 4Q48A 4YCJA 4E08A 5CB6A 5JALA 4M9QA 2GD6A 3H6GA 5DK4A 1E64A 1RTTA 3EJWA 2C9BA 1XVUA 4AM8A 2O8FB 2H59A 3DZDA 4KRXA 2C7VA 2YVLA 4H17A 3ZVLA 4AJ4A 4AS2A 2YXNA 3NM6B 4BLUA 3KHTA 2MSNA 2VUIB 2FRDA 1JXOA 1O5OA 3ANMA 4KQKA 1UXOA 1CLUA 1OA1A 1Z33A 2AIRA 2WT4A 4IJVA 4UBKA 1O95D 5LQSA 1SVKA 4AL4A 3T7AA 3DVAB 4C6RA 4PGMA 2IS4A 1D04A 2BR5A 2M2IA 4K6CA 2V74B 2FTKE 3BFXA 4B87A 4NZNA 3LZ6A 3IVAA 5E6SB 4Q1DA 3ESYA 4QOEA 3VV2A 4ZOCA 1V9CA 1XZ8A 1BGVA 2ZBFA 5K45A 2VP0A 3RSZA 3G23A 4G89A 1KWKA 1DO0A 1LC0A 2ZETA 3M6FA 1WDWB 3JR7A 3L8YA 1L5ZA 4KLZA 1I3LA 1PJZA 1J8VA 2XUHA 2QQGA 4HRAA 2OXTA 1Y6GA 2CLLB 3G9UA 3I9KA 3QU7A 1EGVB 1PBTA 1XROA 1MB0A 3W7BA 3WLSA 2YUTA 2W4MA 3B7PA 3V33A 4BYMA 4H27A 1NOKA 3W5AA 4F9GA 1XDGA 2FGJA 2HH9A 3HFJA 4NCNA 3MJTA 1L5HA 4TKLA 1YA6A 3NHJA 5LNK6 3VKWA 2WKPA 1I7DA 4F85A 1UP7A 1VIAA 1KSHA 1MMFB 2JA1A 4TLAA 2UXBB 2LWIA 2O07A 4B6QA 1EIZA 2C5LA 1U5BA 2R8YA 3MW8A 1F4LA 4TX1A 1TTPB 4NX2A 3TUIC 3W5VA 3WHKA 1YR8A 1X77A 1U81A 3KHSA 3R23A 3UJPA 1VKJA 3H5TA 3PIDA 1YR6A 4BTVA 2C9MA 3AJEA 5AR1A 5TQ2A 1C1DB 1CY2A 1KETA 4O4JA 2DPYA 1J25A 1BE6A 1XZHA 1NMXA 4LQDA 4LYJA 4RLSA 3TL2A 3AEKB 2I3ZA 4MUBA 2R79A 3QENA 5CLLA 4QDJA 2IV2X 1U5BB 3WIOA 1TKRA 1C41A 3G9ZA 4AK9A 2P77A 5BPHA 2OAGA 2QVLA 2C4UA 3HKDA 5DIZA 2E87A 1WWKA 4X44A 1JT9A 4IR7A 3HO6A 1N36B 2QRVB 2O8BA 1NXQA 1YSCA 2UXCB 2FOIA 4HL6A 5A05A 2VT2A 2OV1A 4CV0A 5A4AA 1G64A 3ASUA 4X45A 4XUCA 3VC3A 4UEJA 1UMDB 1UFKA 1M6WA 4YRBA 2D2EA 4GLLA 4F2GA 5JWOA 5KKNB 1W8IA 4J0KA 4BNLA 2ZE5A 2GD0A 1DQSA 2M1XA 4NCKA 5CXSA 2R66A 3DLAA 3VPCA 3ZD6A 3UH1A 4GG1A 1WCWA 1P8JA 4DSTA 3GFRA 3GNLA 1KI6A 3ZD7A 1IOLA 5IYZA 2DEUA 4JQOA 4ZQFA 3RWOA 2IPNA 2LTAA 4PFSA 4ALIA 4YV1A 5KUTA 3DKKA 2A7QA 4PN7A 3JQFC 3DOHA 4J0HA 1MOPA 4ZYUA 3TLYA 2QT1A 3JQGB 1RLIA 1TTHA 2HSEA 2QTVA 3HJTA 1GLNA 3K9WA 1CP3A 2CKMA 3IQGX 3MLBA 3O4GA 4PU0A 1OXMA 4DPKA 1NF3A 5K7SA 1JJFA 3OJLA 4EITA 1B2LA 2Z98A 4N8SA 3W77A 3ZHZA 2J9RA 3WLIA 2A0UA 4CT0A 2OB1A 1L7NA 3K4HA 4B6PA 3RJTA 4J4HA 3TN7A 1JR3D 1X2EA 3ZIAD 4FDUA 4WLVA 2WJ4A 3DEAA 3TNJA 1JW9B 2QTLA 3TLZA 1I1NA 4EK9A 1CVIA 1YB6A 1T4CB 2OBNA 2VNSA 4OB8A 5AI0A 5FWYB 3SXUA 5CFOA 1CY1A 2O8CB 1MAAA 3QA9A 4LRXA 4YPFA 1NLFA 4UMFA 2BGNA 3OY2A 4D81A 4ND6A 2HXGA 2P9BA 1HLFA 1ZMTA 3C3XA 4WXMA 2WMDA 4BO4A 4F8JA 4YXWA 4LG1A 3JVUA 3VR6D 3GFGA 3E3LA 3TW8A 1BDIA 3EIQA 5C31A 1P0CA 4FUQA 4KK4A 4RXTA 3HBJA 3HXQA 3ZX5A 5JASA 1ZXLA 3U60B 1PBNA 5DHFA 3HLKA 3O8OA 4JOCA 3JAMA 4KXVA 5HUQA 4IO0A 3ZE1B 4TXHA 4YRGA 5JZSA 5CNMA 4MSUA 3GBPA 1HDOA 4HR7A 2D1TA 2J3KA 3KM0A 4OJMX 3H13A 4F4FA 4ISCA 2QAGC 2VJYA 1KJ8A 1Y33E 1W2WB 1RLJA 3TKLA 2B8WA 2YV3A 4XUDA 1MENA 1XMSA 3Q7TA 5JNUA 2H4JA 3AJDA 1FMCA 4MRAA 3F97A 2RE8A 4AYXA 4JS0A 2ZRLA 5BQPA 2VXBA 3LXUX 3RUFA 5BYAA 3ADDA 2AMYA 3WOHA 3OZEA 3GJ5A 1SCNE 3H2HA 2GK3A 4G86A 5AH0A 5FBKA 4CEHA 3CLUC 3ANNA 1V7ZA 1CIVA 3B6ZA 2QRNA 1VHTA 1TDJA 1YHYA 2X0FA 1FVXA 3RC3A 4JJAA 3GRZA 2I8CA 2LP4Y 4D97A 1WOYA 5C80A 3P9IA 1P75A 4RD3A 2PO5A 3G0BA 4M9UA 5FOXA 3WQSB 2BMFA 3LNTA 4TZKA 4BFLA 1OH5A 2OCGA 4QFBA 1FQKA 1EFAA 1M1YB 1R7RA 4HUTA 2CXRA 3SEAA 4PYKA 1FDSA 3ZXYA 5IUJC 5MN5A 1F7VA 1SXGA 3AVQA 2EJVA 1PWZA 1HKHA 2IIQA 2IOFA 1LZKA 3SYLA 1SOVA 3C8MA 4C9BA 3GZ4A 1EFVB 2R7AA 1ECGA 5KU7A 4I6JA 2QTNA 4WW0A 1JJ7A 2OO5A 2ZZMA 2YC2C 1AKQA 1QYVA 2ZLBA 4UDNA 3OOWA 4ZV4A 2IITA 1J4AA 2QJTA 5BOSB 4I5DA 1T2CA 2QRVA 4UEOA 2PYZA 3FUWA 5T4HA 2O8BB 1MB2A 1Y6JA 3G85A 4QRIA 1ISSA 1VE6A 2F1JA 2IYSA 3IAFA 5HJ2A 5ILOA 1SJ9A 4RK6A 1C8BA 4J7CA 4D96A 1TQ2A 1E5DA 1ABFA 1JMKC 3ETDA 3G7NA 5CLJA 1AHNA 1W76A 4YIKA 2QJFA 2RGNC 3IVGA 3Q6IA 4L5YA 4NBUA 5KYKA 5HTOA 3M2PA 4LSWA 3DULA 3NT2A 3WMWA 2WSMA 1W4RA 2C1XA 1VPDA 2NT3A 2WU4A 1JSXA 1Q1BA 2YZ7A 4P4SB 3WDMA 5DLQC 3R7DA 5C3MA 5I7EA 4Z53A 1E9FA 3K0FA 4MLZA 1NXOA 2CLOB 2W00A 2QVCA 3C7CB 4AXBA 4BLSA 2R65A 3G1TA 1DDOA 1PGOA 3A6ZA 1M10A 3T94A 1KORA 2YY5A 3HJHA 3OECA 2ZR7A 3IOCA 1SQ5A 2NXJA 2CFTA 4MUMA 2WWTA 1WEHA 3TRHA 1JDSA 4HY3A 2YN0A 3PD7A 5JQGB 3PCRB 5EXSA 4F71A 4NFHA 2F8SA 3S29A 3LVQE 1IY8A 2FSVC 2IW3A 5LMZA 3QKWA 1RC8A 3SJCA 3L8MA 1EVJA 1J6UA 1VL1A 3G3EA 4PZAA 1BEEA 2JIPA 4RZHA 3SC2A 3O92A 5C8YB 1UODA 1FYEA 3E81A 4YROA 5KNBD 2HU7A 2O2SA 3D0QA 4AZ0A 3W8NA 1XNQB 2AN9A 1DB3A 3DZIA 1P4AA 3FSJX 2V7TA 3IMKA 5IJ0B 2VQ3A 1E2PA 3UHJA 4M0CA 1H9CA 1PVDA 1IJFA 1DFIA 2I22A 3GZNB 4HDNB 5JAMA 3ZI7A 5BW8A 3T1VA 4YMUA 3CONA 3KEMA 1BEZA 2OYSA 2PZJA 3MD9A 4JEHA 3K8QA 1RJFA 1IEQA 4AICA 1X80A 3E0QA 3HUFA 1HFWA 4QYSA 2D5LA 3MBOA 1LDGA 2A59A 5G1PA 4AJNA 4WV3A 1QTIA 3I4CA 2X6QA 2PJZA 3P0FA 4ICIA 1CQIB 3E3MA 3L8HA 4RDHA 3LKZA 4BNIA 2E85A 2VHUA 3S2GA 4DV5B 4L73A 1UPUA 4E2FA 4J8PA 3QF7A 4RL4A 2YS7A 3ESCA 3ZY6A 3MWKA 3C3EA 5A4MS 1BXRB 2J45A 4UE2A 2A0KA 2D1QA 2IHYA 2QN8A 3HFRA 3JQRA 3LT4A 4JX9A 4RZSA 4LTMA 1ZGAA 1KEWA 1XI2A 2I71A 3FKQA 4J75A 3EFOB 2YV2A 1EFHA 1STOA 2NO7A 3TDKA 1L4GA 5ALRA 4BFTA 3W5CA 4KAJA 4EA6A 2Z2JA 1VE7A 4BXOA 4QOSA 4PPNA 3BN3A 3DDSA 3H2ZA 2B83A 3FWZA 4WWHA 3ROGA 3SSNA 3TTUA 4TYNA 1RBQA 3WA7A 4W9RA 4TS9A 2ZXFA 1UCFA 1TX4B 2GCOB 1TW2A 2CHEA 4PAGA 4B5LA 1E63A 1BXZA 3D64A 2AMJA 3HUUA 2P5TB 3PFGA 1S4QA 1FJXA 1QGUA 2Y1LA 4HNUA 3ND8A 2ZREA 1ISIA 4ID9A 4DNPA 3BMQA 4ITUA 4JJZA 3D7SA 3NI2A 3HCBA 5LP6F 3DC7A 3WO0A 3ZDYB 1E3TA 1ML3A 2AW3A 3G6KA 2DCUA 4EFDA 3B1WA 2D62A 5J1TB 2Q3DA 4M1SA 5EXDA 1WETA 1XC7A 1T9GS 2VOEA 3OE4A 3V3TA 3USCS 5I4BA 2O8CA 3L04A 2CF5A 5JJBA 2Z95A 5EQDA 3SZ3A 4TKMA 2BELA 2HHLA 3G7SA 4OQXA 1JQEA 1YZHA 2P8JA 4V38A 4PHGA 1U0HC 1S96A 1Y3HA 3KL4A 3ETCA 3K16A 3OP1A 1UZLA 4J90A 4XIJA 3WA6A 4DAOA 1QZTA 1NVTA 1QRRA 1XYYA 3DT6A 4N3BA 4MW6A 5IF9A 1WXQA 1O97C 3FI0A 2NLOA 1ZHHA 5IAOA 1W1IA 1I8TA 2YZGA 5KSWB 2UUCB 3DMFA 1DKNA 2WKQA 3OO0A 4PRLA 4V0SA 5TS3A 2RGRA 5ALUA 1OSNA 2FMHA 3AB8A 5BXYA 4QWMA 1N4AA 3N2GA 2WVHA 4MIOA 1RP7A 2BLNA 4BMCA 2PZBA 2E1PA 3ADOA 3UK6A 4YRAA 2PTGA 3M6XA 3T3EA 1EVKA 4C6HA 5AOVA 1A8QA 4PG8A 3HO8A 4LIPD 1NUAA 1ECJA 1LI5A 2YQZA 1FDIA 3TSAA 3I04A 2ZIGA 4FFLA 1FDVA 1J8QA 1K06A 1WB6A 1CEYA 4KBFA 1KMMA 4PBTA 1BQEA 4ARCA 3ZUPA 2WTNA 3BWDD 3NRBA 3UNXA 3VKGA 1H22A 2IXFA 2ZBGA 1SKYB 1J07A 1W9HA 4LY3A 2ST1A 3O03A 5DHUA 4AQDA 4R81A 1T4CA 5AKKA 1KDRA 4G1EB 3MT0A 4PSAA 2C07A 2Q6OA 1NIJA 4MV5A 4EKDA 1UM8A 2X0NA 5AJHA 1OILA 3QBDA 3PF9A 1TM2A 3ZGXA 4D9BA 4YJFA 2YL2A 1TZKA 2IL1A 3AY3A 5DRYA 2OWEA 4TXNA 6LDHA 2JJQA 5BR1A 4YC7A 3S2YA 4WH0A 1IVYA 3I0ZA 3DG9A 3VVBA 2C61A 2W6CX 3EZ2A 4MYCA 1OZAA 1AKTA 1M83A 2PWPA 5F4ZA 1M1NA 2QVGA 4P7GA 3QUQA 4JSTA 3T7KA 3B9QA 3DVRX 4R68A 4MIEA 4RFSA 4PPGA 1OMOA 3OY7A 4OHRA 3UAVA 1YU9A 2Q8QA 4W5OA 1SXJB 4PYOA 1N1EA 1YRBA 1JV2B 2EBWA 5ER6A 4US0R 3PJFA 1W0KA 1WMBA 3QW2A 4ZDIA 4IDQA 2JFGA 4U7JA 4QUJA 4V3BA 1UP4A 4G4SP 5B7GA 1QJCA 4B4WA 4POOA 2QU7A 1B0AA 4F72A 2AZ4A 4OH7A 3Q3VA 3B9PA 5J2TB 1QGYA 1ZIXA 3CZ4A 3NCTA 4NSNA 5FL3A 3E5MA 4TV9B 1Y3IA 2VTKA 4I4TB 4Z1OA 4M6WA 4QDTA 3WK5A 1F2VA 4U2BA 3VJLA 1ZK4A 2DQYA 5AM3A 3ACCA 5DLPA 2ECKA 2VJPA 4NPCA 3UK0A 3PXEA 3CNOA 1PLKA 3AOGA 4A82A 2POQX 3B5JA 2QDKA 1UT5A 4IWNA 2ZDQA 2GZMA 4JCCA 3DD5A 5I8WA 2VDVE 5ADUS 2J7KA 2Q3JA 2Z3ZA 5E4YA 4RVDA 4CUJA 1FVHA 1AE1A 5HA5A 3DTVB 4URXR 3DZJA 3QFCA 4S2UA 5CVCA 2DPHA 2IOFK 2PJDA 3MXOA 4MR7A 4EYOA 1V6CA 3D7RA 4HAOA 4JEIA 3RTBA 1EKXA 1QO9A 2P6NA 4Q9IA 3WBBA 3WYFA 2W6OA 4OBBA 1MABB 1A69A 2A5JA 1QQ6A 4X8HA 3Q5DA 5CLHA 1U9JA 4HB3A 3OLZA 5FJJA 1NPYA 4BO3A 5SY9A 5JZBA 3JYOA 3R9WA 1HFEL 1VYVA 1ZUNA 2QROA 2NN3C 3LC0A 4DIFA 1N78A 1SHLA 1II8A 2OL4A 5B1IA 4LWOA 4R71A 3AUJB 2R6ZA 1DAGA 4BNKA 3GJ8A 1E2KA 4CUZA 1ZGJA 2FV8A 2X4DA 2ID9A 1KFJB 2HDOA 1OC4A 1J2YA 2R5NA 4HEQA 1QWOA 4ZQCB 3C45A 4IZ6A 2XVMA 3GDOA 4BJ3A 2ZS7A 5HOEA 2PUHA 4PONA 4YJHB 4POAA 4Q3AA 1KO4A 3BBPA 2YWJA 1JAXA 2JJ1A 1G63A 1L9KA 2NV2B 2YY6A 3EFEA 2D7DA 4AAYA 3G1WA 2OCKA 2DHEA 1IUPA 1W44A 2JJMA 2PT5A 5FWAA 4AW9A 2MDTA 3ECAA 2PD6A 1E2MA 3RSLA 4D6XA 1PI3A 3ZQUA 3CVWA 3FTFA 2X5OA 6YASA 4EG8A 4JOQA 3ZV5A 5LXTB 2WMOB 3UTCA 3LD9A 2H9YA 2JAHA 3CTMA 4LOHA 2J7PD 2NTYC 2INGX 2NUBA 2HIGA 4IDGA 5EI5A 5HKLA 3X2FA 1JR6A 2HIAA 1U0BB 1TF7A 1TO6A 5LLSA 1YZQA 2YOHA 1YK0A 3ZLBA 3KUKA 5HTKA 1D07A 4EZIA 4F1KA 4PRYA 1AF4A 2PPVA 1YL5A 5HQ3A 3IDSA 5I9MA 4DMHA 5EJIA 3WJ7A 4CG0A 4PHTA 1XVTA 2PN1A 5CD9A 2PK3A 1K2WA 3NRCA 3NUGA 5KDLA 1WVGA 1Q1GA 2R6CA 3ZK8A 3WRWA 1JQBA 1FFDA 2HBYA 3RO7A 4A15A 3FNBA 4P1ZA 4CVNA 1LFDB 1PR1A 1TK9A 4EA8A 4I3FA 4JLAA 4CDRA 3OPYB 3RIHA 4OLFA 3OTWA 2QZJA 3CGWA 2DX7A 5L95A 4YT8A 4QPDA 4CM1A 1TT5B 1PFVA 3F8TA 4M21A 4P3XA 3OQHA 2AN5A 1EGAA 3KOMA 4EQ6B 4RZ2A 2RFLA 3PNOA 1Q14A 1IK4A 1NQ5A 1Q12A 3UW1A 3IUYA 1PZMA 4G01B 3WL8A 2ONZA 1T2AA 3IMFA 4HMQA 5DM2A 3RARA 4NV0A 5LCXA 4B3MB 2VVTA 4OI2A 2O2CA 1FTQA 3B1KA 4KXLA 4OO3A 4KGXA 2W2TA 3BIJA 4H60A 4QIHA 3ANXA 2XWQA 3O4RA 4Y2UA 1FE8A 2NSDA 3EEBA 5EOVA 1C1DA 4BWYA 4S1VA 4PXYA 3IUBA 5COBA 3UB2A 4ENWA 1L7VC 4U6SA 3STVA 2ZJ4A 2E82A 2OCBA 5BRNA 3GY0A 1CERA 1PKEA 1RYHA 2IXTA 1QYXA 4NYIR 3P45A 4MTCA 1CJKC 1ULTA 2VRCD 3FGNA 3MCZA 4ZI5A 2CVHA 3KVOA 3TIIA 3FZQA 1MO4A 1O95C 4C5BA 3UQYS 1V6AA 2J9FA 3LTEA 4QEZA 4O3MA 3IDQA 4U9UA 1K68A 4ZVPA 1ZISA 2EC5A 4C04A 4TWRA 1BDBA 4RPIA 4CMEC 1CY8A 3NJ4A 4H7PA 3EPRA 3NVMB 3Q8MA 4UAUA 2CFIA 1UC8A 3LBFA 2BMJA 3OZRA 1PJ8A 1QHFA 2H8KA 4MS4B 3T3HA 1N5OX 4JVMA 2O3RA 3U7HB 1P0QA 2GRUA 1G6KA 2GKGA 4N47A 3HH8A 2O2XA 4CMEA 2QRMA 3BHIA 3DWEX 1PYGA 4FPXA 5DE3A 5ALIA 5EUQB 4Z7QB 2JCXA 4HGRA 3K20A 4MJLA 4GOXA 3NTOA 2IIBA 4AFNA 5DNYB 2F43A 3FNHA 2BEWB 2JATA 4I1IA 4RHXA 1KY3A 1AXRA 1DLJA 1UBSB 2RK3A 2X6RA 3G8YA 3LE8A 3R6WA 1MIOA 5AM5A 5EMLA 3MLAA 4NCAA 3FWKA 3JWEA 3MAJA 3QXGA 1R18A 3ETHA 4R9RA 3R7WB 1AM4D 4A0SA 2B35A 3AVXA 1K6MA 2JJ2A 2NGRA 2OILA 3KK0A 3LQQA 3Q15C 4MUHA 2ZDHA 4R2JA 5DTQA 3S1AB 5ICMA 2P9GA 4FFSA 3RSGA 5E3HA 1NXWA 4JIMA 4XOUA 5JDCA 2PJUA 1B0ZA 3EHDA 1ULAA 4MUJA 1H6BA 5EA2A 1ULZA 1WB4A 3K53A 2PX2A 3K8YA 3KLBA 3EWSA 3PC8A 3PDJA 3QXCA 4RIIA 5B1YA 2HF9A 3GQBA 1FVFA 1GAJA 1SFRA 2A86A 2TMDA 3D8TA 4C7OB 4REQA 1SCBA 2FW0A 5K3FB 3VAZA 4WCDA 2O7QA 3P0JA 3RS5A 1WZEA 1RYMA 4XCXA 3NORA 1ULHA 4KCGA 4EPXA 2XDWA 2F17A 2NZUG 4F3NA 1VMKA 3GFFA 5IYZB 2QM7A 3AR4A 4BJ6A 1BHO1 2HFKA 5EESA 3ZBUA 1EDOA 4LFBB 2I1VB 3OZ7A 1NZDA 2QIPA 1EBUA 4P7FA 5HUJA 1JZQA 5LYJA 1S4MA 2ODEA 3FHCB 3HXMA 3KB2A 3KKEA 3BWMA 2ERCA 4JLVA 1JDTA 1VKHA 3PFHA 4L0CA 2FR0A 5EIHA 1VMAA 1DIRA 4PM4A 4V2IA 5DO9A 3PU6A 2R7NA 4RVSA 3TBKA 2VAMA 2LV8A 2PG3A 4MVJH 5A02A 2A9JA 2DFKB 2JD1A 4RM3A 4IUDS 2ANBA 1SBNE 2ZU0C 3ETGA 1KK1A 4P81A 3LF1A 2B2XA 4REOA 4I81A 1DJMA 4JODA 3EFOA 4RMHA 5I7HA 3GBVA 4E30A 4DLTA 5JJIA 2OUKA 2ZRQA 1W0KD 4HAYA 2CHVA 2MWMA 2BGTA 3N2IA 5AJZA 3SS9X 4CLHA 2XKJE 2ZYRA 2VK2A 2X8AA 1K7XB 3ESBA 2IDJA 4UHHA 5CNJA 2WILA 3WJ2A 1VJ1A 1H9AA 3OP4A 1OVGA 1U0GA 1DPFA 1K6EA 3GRYA 5FPPA 5FYDA 4FNOA 1OI3A 4LY6A 3TLEA 2CXOA 13PKA 5TRTA 1T24A 3VVLA 3T3NA 1QONA 4KFTA 4LV5B 4P35A 3W5UA 1MNQA 2LUOA 2WF9A 3A58B 1DDIA 3D6AA 4MUIA 3PQ3A 1YMUA 2X8WA 4Y1FA 2AT1A 1PR5A 3HXLA 1FTWA 2QX8A 5DYWA 2FGKA 3S1AA 5ENDA 4RJKA 4C14A 4B3TB 4IEEA 3RREA 1A76A 1MB4A 1YOBA 4RBNA 4AIRA 1BNCA 4MEJA 4C0HA 2FA9A 2IHUA 1FMLA 2WAOA 4O2AF 4YALA 5KTRA 2W4QA 4GX0A 2JEYA 3DMHA 1WSBA 1Z5GA 3H9CA 3PFIA 3I2JA 5LBUA 1J56A 2B7BA 1FW8A 1HY3A 1GKLA 3LDUA 3QVMA 4IFBA 1M2VA 5IC5A 5HM8A 3D0OA 4RHTA 1L0BA 4KTTE 1D9XA 4KMSA 1NG9A 3E18A 3LLVA 4EX7A 3KJHA 1SXJA 2OBLA 2EFCB 2CUTA 3GLHB 4RA9B 5EMHA 4ZRMA 1JLLB 2DCMA 4LE0A 4TTRA 2AEMA 4WVFA 2C0PA 1KZGB 3TNDA 1Z35A 4LWQA 3LK7A 1Q0TA 1N0HA 2JG3A 1DX6A 3WBKA 1K5GA 1S1CA 2Y0EA 1X7GA 3KUXA 2O8VA 4P7KA 4CU5A 2XA9A 1CT9A 1M1YA 2CLCX 1OAAA 1U0SY 2EIHA 4OQDA 4ZQBA 3LM8A 2PZEA 3DBIA 3FZGA 3WICA 4KW7A 2RG1A 1AKNA 3EK2A 4O1MA 4GKKB 1HRDA 3NYRA 3R9IA 4BKQA 4UNQA 1TEXA 2IZ6A 3MYYA 3PA6A 1U0RA 3E4DA 2WKWA 4P3KA 1FRZA 4X3PA 1VB5A 4Q7MB 3W6NA 1JJAA 2ZDGA 2GLUA 3AEXA 3GV0A 4IKEA 4JT2A 3TK1A 5B7QA 4M9RA 4PGGA 3UJDA 4AZ0B 1Z73A 2IDZA 1P6UA 2WSYB 4GPIB 4OXIA 2X19A 4LJKA 3X1YA 1Q0HA 3N74A 2AMFA 1RKVA 3GXOA 4REMA 4B34A 1PTKA 2X0IA 4C6TB 3DAOA 4ENTA 4LXGA 4QYXA 1J5PA 2EKLA 1YC5A 2OXRA 4CCYB 1I80A 3HFGA 4ZGGA 4OFXA 4JGGA 1R6XA 3SEFA 2HSDA 5B4UA 1EP2B 4ND8A 5ADHA 3M9XA 3S8EA 2CV2A 1KRXA 4V0KA 4NZMA 4RVFA 2YHIB 3H2KA 3SOZA 4N7JA 1FFHA 5IAGA 1L4FA 5K9ZA 1Q91A 1TZMA 3DEYX 3DDCA 1Q20A 3QH4A 2G25A 4QPJC 4KU4A 1T2DA 1UK6A 1XF1A 4KITB 1BW9A 1KOFA 1N32B 1KMHA 3NHBA 4BEVA 4YGXB 1RJWA 1WB5A 2FZEA 3VTAA 4ALMA 1PLJA 4PO8A 2AR9A 4HOYA 2ZP1A 1Q57A 4EHKA 5E9JA 1R5NA 2VHYA 4YJ2B 2GA8A 3QVXA 3RKSA 4F8YA 3ZKWB 3FCUB 2D4AA 1RTKA 2QAGA 3FVQA 3KQQA 1GTL1 1K4MA 1FY2A 2MSEB 3CIOA 5BSFA 5AVQA 4TMZA 5AW7A 1RKUA 4YRNA 1V7CA 4TN5A 4LF4B 3CRNA 4K3VA 1GNVA 5BVGA 5F2OA 2H1LA 4Z8YA 3OJWA 3M0EA 4CF7A 2Q27A 4PO9A 4P86A 2Z1MA 2C4HA 4QHYA 3LOQA 4FSDA 2Y0DA 1D2RA 2ATXA 4JKYA 5I7WA 4KDCA 5K6TA 4IMRA 2Q62A 1YRAA 2HBRA 1UQUA 3CEPB 4BB9A 4ER3A 1XRLA 1AKEA 2HMYB 1T25A 2C8VA 5JVDA 4UE3S 3FTCA 1CZKA 5FKJA 4IX9A 1S01A 5G40A 3E7PA 3ZJ4A 1AXEA 1DQPA 2Q6IA 3S8YA 3WQBA 1RHJA 1GQSA 1K9VF 1SZDA 4G97A 3P2YA 4M22A 5JECA 3W79A 5B3LA 4GQBA 4YWHA 4YAUA 2WIFA 5FEUA 2GF2A 4A0QA 4ON9A 4BO5A 1GGEA 3B3JA 1XTKA 4F3TA 2F1OA 2ZI9A 5HGJA 2XYQA 3G9TA 1JHAA 3LW7A 5TT1A 2G9UA 1XL0A 2B92A 3OIVA 1DELA 1SOUA 4C0QC 2ICAA 3FH0A 5J2UB 4CDGA 2WJIA 1XCBA 3H87A 1CEQA 3KOUA 5JS6A 3BE6A 3ZS9A 5BWOA 5JBIA 3O2SB 2JIRA 3CRRA 5F52A 5H3LA 2QTGA 4DXDA 2O1SA 3H7IA 1W0JA 4A73A 1JYEA 2BY4A 3RQSA 4BUZA 2VBGA 1Q83A 4CM9A 4DR6B 3L6RA 3FVWA 2COEA 3F7TA 4YA6A 2BEWA 3SJBA 2JAOA 2F62A 3EIUA 3SK0A 4UTNA 2PE5A 1DO8A 2JD2A 3GLQA 2V1UA 4I8XA 2DE0X 1QQAA 3X1DA 5DTMA 2Y92A 3C1OA 3ZW7A 1A2KC 1XNHA 2AOTB 1WV1A 2BR4A 2JK1A 3EDMA 3LQKA 4J3JA 4AO6A 2RK4A 3FF1A 4CE6A 3EMDA 1QP7A 2ZUBA 4G25A 1Y42X 3EDOA 2P4HX 3AETA 3BRQA 3JS5A 4KGZA 1L1RA 1Y7LA 2AXPA 4L4SA 2ZSJA 1EUZA 4D3DA 4F0JA 2RB4A 2OHIA 1O2DA 2VDWB 1NLMA 3JYQA 3PTLA 3RSFA 1JHMA 3I83A 4L5AA 5TEVA 2RHMA 5I45A 3G68A 1H3FA 4G1CA 4AECA 1BKDR 3PVCA 1DXOA 2GZSA 3QU4A 4HAVA 1JG3A 2XWSA 1KEKA 1WUIS 3OE5A 5JW6A 5D5QA 1QXSA 4PC6A 3DZFA 3QKUA 1GUYA 1YO6A 2VAXA 3EC1A 3PDIA 1OXBB 3Q7SA 4L75A 5I3ZA 4RZUA 3E7FA 5AI4A 2J07A 3TIVA 1VHJA 3DA8A 3VZSA 2YNMC 3OFVA 5F3WB 2NV6A 1Q2XA 1SC3A 2EKZA 5ESRA 3CLKA 2JCGA 3IULA 3RC7A 2F59A 4DMMA 4RGBA 1P5HA 1E2UA 2XVYA 1I5OA 1Z2AA 3Q2OA 1F20A 5ITZB 1GTMA 1USVA 1A71A 1YR9A 2BFBA 2QJWA 4R6XA 4XVHA 1M74A 2C83A 1R16A 2OZEA 2VJQA 3JWIA 2H07A 4FOOA 4HLCA 4UATA 1P7WA 4BRZA 1N9KA 1U4NA 3R5JA 4ROSA 4HB2A 2P90A 2OCIA 2IS2A 4D4LA 1W6UA 4A2CA 1XRJA 4PQGA 5A4DA 1L3IA 3RVMA 3V2UA 3P9RA 4CV1A 1BROA 1V6SA 3WBFA 2NNLD 2NO6A 3BX1A 2A9VA 5BORA 1LDMA 1RIIA 3NDIA 3NWEA 5F21A 2FMTA 2RGAA 2YMMA 3OC0A 4H4EA 4RH3A 4TKVA 2XX3A 2WQ7A 1E5QA 3BFVA 3C48A 3HU3A 3L4EA 4FDTA 3K96A 2F00A 4JDPA 4TTVA 1S2GA 2BGIA 2ZCVA 2ANCA 2GERA 1R5OA 3G59A 3OPNA 1GCUA 2IBSA 4MV8A 3O6VA 1YDMA 2EQAA 4XVRA 4BLTA 4D3SA 2WIAA 4PG7A 4OI0A 1ID1A 1IHPA 3IVMA 1PR0A 3OF2A 3BJMA 3HTXA 1ZY2A 3JARB 3BH0A 1VFNA 4V1CI 3DLBA 2VEOA 3EC2A 3QM1A 5FTLA 1TTTA 2QTFA 5IAEA 3SIPA 4JKOA 5H9WA 2GYUA 4WDQA 3T95A 1C8KA 1M1UA 3D59A 4Y9RA 3MERA 5AM0A 4A0GA 4WBNF 2YKGA 5C51B 1N5MA 1RQ2A 2IX9A 1P7VA 3IIIA 3AR7A 2B98A 3VR6A 2XXBA 2WPDA 3MA0A 2OXEA 1IMJA 1QMGA 5DN9A 2OGUA 4R2MA 1SVSA 2FPIA 2CSUA 5DNDA 4YDQA 1CUFA 2FUEA 2B5WA 2XGOA 3KZXA 4HBGA 4DCOA 2VAPA 2I3AA 4IQ0A 2JC3A 2Y93A 2GN4A 2BKVA 4PPFA 1TU4A 4ARZB 4BV3A 2YVUA 4QODA 4K9PA 1LTKA 3TRJA 1L5OA 4RJLA 2FMUA 2BRUA 2HWUA 4DLKA 1O96A 2YWRA 4KK3A 1GPWB 2CMGA 1ZICA 4IXTA 5EQJB 1XHFA 5CR9A 4UPEA 1MDFA 1HE1C 4KSBA 4ESVA 2WUFA 3WJAA 4FGZA 4G0XA 4PSDA 4M7WA 3EQ2A 5IFKA 1QIGA 1YQQA 1SG0A 1YD7A 3K6RA 2QN6A 4KO3S 4IHAA 4OGFA 3RCBA 1ZHOA 2FPGB 3A6LA 4EJ2A 2XMDA 1XJCA 3EXHB 1C9JA 2FN9A 2ZYTX 4BO7A 2VH1A 1MR3F 4RPHA 3DLPX 1RADA 1Y9ZA 3E8SA 3GL9A 4H0CA 5E3JA 3WK9A 4BFZA 5BR7A 5M29A 4YRQA 1X94A 3ZZUA 1R64A 3BH7A 4CIYA 1D3AA 5CHEA 3T06B 3DYIA 5EMMA 4BLOA 1DQRA 3HYRA 3HCRA 3RK4A 4B85A 3REQA 1ZA1A 5KWJA 4CTOA 5TR9A 2G8NA 4Q0MA 3SYMA 4RDIA 1QRSA 1ZGBA 5JEEA 2FFQA 3ZX4A 2GD1O 4KACA 4A0HA 1E1CB 3DE1X 2IDKA 3PVSA 1O95A 1AUOA 3IV9A 3QGMA 1B42A 3LGSA 4FCTA 4C1NA 3T3GA 3PTAA 1CQXA 2XNDA 4ZVRA 3ER8A 3REFA 4MWTA 4TS1A 5ECYA 4GZLA 4YAKA 3A1CA 1X7YA 4OLBA 4DQLA 4I1OA 1FYXA 1JXQA 1OASA 4OJYA 2BM1A 1QHIA 4KLCA 3V1LA 2QLJA 1AVTA 4ARVA 1PNVA 2HDNB 2PO7A 5KQLA 2BL4A 3ICVA 2FQXA 2DTDA 1CRQA 2XADA 1MIOB 2OXFA 4MQBA 3KVRA 5E4FA 3T5GA 1KEEB 1EFUA 4MMXB 4X60A 3UW3A 3SXPA 4MEAA 2F64A 1EQ2A 4IFEA 1NLYA 3IILA 4G5YA 2XEDA 5K99A 1A98A 4A8TA 5F5XA 2PT7A 1XNGA 5ALKA 3VSAA 1P17A 1V1RA 5GJWC 4TM7A 5BN3A 1GL6A 4ZI3A 1EUYA 1O97D 1Z45A 5K3BA 4Q3NA 5AOBA 2C31A 2H1VA 3CN7A 3HVJA 2Y67A 3IKMB 5LQDA 3SQWA 4TN1A 4C7VA 1J42A 4ZZ0A 1ZH2A 1OZGA 2FXVA 5L45A 3F73A 4EEXA 5LQMA 2QL7A 1CNFA 4MS4A 5EZ6B 4BX8A 2K4MA 5GIPE 2NU9B 3U81A 4MLPA 1D5CA 1B8NA 3QLJA 4BPRA 4ZANA 4RKRA 4Q4HA 4W5NA 4GYWA 2R87A 3QPUA 1TM3E 1T5HX 1EMDA 3LFHA 4BECA 5A6VA 2A84A 3OT1A 4LDQA 2QI9C 4UNNA 1XJQA 4WA8A 5BYJA 5HF6A 5LJLA 4FP9A 2Y05A 2X1HA 3H5RA 1XMPA 2HA4A 5LQAA 3L0OA 1R3DA 4E2XA 1P1RA 2EJCA 5IMSA 1L4BA 3FPBA 3N87A 3P2OA 4RZXA 4M9CA 3MUNA 4ZDKA 4JWKA 5BNIA 2CLIB 2R8RA 1C1YA 1MG0A 3PENA 1K7SN 4ZTBA 3RIXA 2HJVA 1DADA 1N6LA 2Q5QA 1NXTA 2V7EA 3DE2X 4MKXA 4XD7A 4YTEA 5K3EA 1YUNA 4WKCA 4YCLA 1EGQA 1IB6A 3KYJB 1RZRA 1TUBB 3T9BA 1KTIA 1YJBA 4Q39A 4GS5A 1YUBA 1AURA 3D31A 3E9QA 4INOA 2I2XB 1N6PA 3HB9A 2VDMB 3CUEF 3C1TA 4G36A 1ZM9A 2WSSA 3HO1A 1UAGA 1EUCA 2A9KA 3CR8A 1OROA 3HCEA 4QNNA 5D51S 4AULA 3CBGA 4U6QA 3L84A 5BN4A 2ZQ5A 1VA5A 1W4CA 1OX4A 5GJCA 3ZHOA 2E6UX 1CR2A 2OM6A 3H0KA 4IP0A 1M2KA 1ZJJA 1NV8A 2HWKA 1GPLA 3A1EA 3GEBA 4HBZA 2VFAA 4NZPA 4XCVA 1GGNA 4EGFA 4XRGA 5TEWA 1XZEA 1YB1A 2X0RA 2C96A 4RANA 2C5SA 2HF2A 4R9NA 3EFHA 3ABZA 3BMQB 3GJXC 1WX1A 3RNLA 5IS2A 4JT4A 4I8IA 1WCV1 1CXZA 2JCBA 3O31A 2B4QA 4I19A 4J0EA 4PG5A 4PX3A 3QPDA 4D9KA 2L82A 2PV0A 3FJ1A 3GVCA 2PY6A 1PS0A 2EWVA 4FZJA 4BCCA 1E2JA 1PGNA 1CJTC 5FTKA 3SY8A 3G5LA 1Z25A 1Z13A 5T67A 2CL7X 4YFVA 3CZRA 3UJ8A 1TMGE 3W0LB 4EF6A 4D8VA 1FB5A 2NSHA 1J8DA 4MRSA 3DFZA 3EWAA 4TQUS 1L5LA 1YNSA 4RKYA 3WGTA 3M1IA 1B00A 1C2YA 1MEEA 2ETVA 3L5KA 3DHNA 3NDJA 4K7JA 1XEWX 1P81A 2B25A 2B3DA 3KHKA 2BDUA 4LN1A 4LWZA 3TZLA 5JFGA 4DWWA 4J4BA 3L6CA 4X84A 1LSJA 3HXOA 5J1SB 2XGMA 5CYFA 2QTAA 1XLTA 1ZOPA 1AKMA 1UBRS 4FKBA 4HRXA 5HJ7A 2WTUA 2V5AA 4L51A 2P6RA 2I6XA 2ZAMA 3K72B 2CJWA 2GM4A 1Q3KA 5CDFE 1QVZA 3PGKA 3U3OA 4FKZA 2IYOA 1H0KA 1OWPA 1ZKMA 4OEHA 3W9BA 4B44A 1XQVA 3OZCA 4O4HA 1OB5A 3BL5A 3JQ9C 1N8NA 5C2JB 1RBYA 2YICA 4INPA 2QM3A 1EX9A 3LXRA 3OM1A 3WLOA 1NMSA 3WL4A 1XVVA 1ORDA 4X54A 3TZQA 4W5HA 1J2UA 2I9PA 4LTDA 1G8JA 1JHRA 1U4OA 2A1IA 3HDGA 3HCDA 4UPDA 3EAFA 2N1BA 1Z0SA 2VPQA 2AMLA 3PWZA 4YAJA 1AK9A 3OIWA 1HYEA 4IKOA 4WZBA 3VC1A 4L4XA 1F17A 1V2GA 4EB6B 2Z6QA 3Q87B 1QU2A 1PHPA 2RMKA 3MAGA 1WZIA 4MWCA 4G37A 1NNI1 1CSEE 3AVTA 2WIGA 3MUEA 2FEAA 1LNSA 1KEVA 4KYVA 3QOWA 3AHFA 2F9LA 1PTJA 4EB8A 1YGYA 5CIQA 1JIJA 1C8VB 2F3PA 2WJWA 3OJFA 2O0HA 1YIOA 3EIWA 3IOBA 4NBSA 4K46A 4G3XA 1QIFA 4KSYA 3MN1A 3LT1A 4B4DA 1QV6A 2FW8A 3FNFA 3DW3X 1Y7IA 1T9CA 1GY8A 3K05A 2AVNA 1RPJA 2ONYA 3EOZA 2WMNB 3GT7A 3C41J 5AXBA 4GOMD 3BCRA 3DWGA 2IEGA 4L5JA 1CF2O 1E7YA 3PFWO 2PL1A 1Q1ZA 3U3RA 2OO3A 3ETLA 4P4SA 3BQ9A 4URVR 3Q6NA 1H9BA 2F67A 5IDYA 1ZMXA 4R40A 4DLAA 5DBFA 3G5TA 2PNFA 1DEXA 1RYZA 1OA0A 3Q9LA 4BE7B 3MJRA 2PTHA 4MGZR 1E6CA 3BA1A 4YJGA 2VF2A 5J4KA 1N77A 1Z5NA 1DU4A 2MYTA 1AUVA 1JQDA 4DT1A 2OKGA 4CLRA 1V43A 2H0QA 3ROFA 3ORFA 4HNAA 3IR6A 2Q4TA 3GR6A 4UQOA 1N75A 4KLRA 1B23P 1T1IA 2BZ0A 5G3ZA 1A9PA 5BWMA 3F1LA 4KYUA 1RNLA 1REQB 2R5WA 4ESHA 2HCFA 5JEDA 2ORWA 3ONWA 4N49A 4NS1A 4GLFA 4C76A 3GA7A 2Z1DA 3C70A 4FN4A 4U02A 5F1OA 3ST7A 2J33A 3OCXA 1SHZA 1MAUA 2ZI7A 2C88A 4I55F 3DBLB 4RIHA 1E0DA 2ASVA 1A8UA 4L8LA 4AUEA 3U6KA 4C4TA 5HCUA 4GEGA 3VJRA 2BD0A 1RJEA 4ESEA 3TR6A 1YBVA 4LHXA 4MV3A 4ZKDA 3H42B 4DPLA 3HSKA 1K8YB 4L4RA 1RHUA 3AQ4A 1U02A 3U7QB 3C24A 4CFSA 1HX7A 5JS2A 3DB2A 2PUTA 1XQWA 4RETA 3A2NA 4PYRA 1ZCFA 1HDIA 1OHHD 2I29A 4RVGA 4UAVA 1VMDA 2RDMA 3TSCA 4H6PA 1W36C 2R47A 2VRBA 5B6JA 1M0WA 5KVQA 5GM1A 2PGDA 4Y0AA 1VYTA 3BSSA 2Q0HA 3LPMA 4MUYA 1EDZA 4Y0NA 3FMPB 3BS4A 1MJFA 1P0MA 3PB3A 3A6EA 1XEXB 1NE2A 3FJYA 3FFWA 4Z9XA 1BMTA 3SCZA 1A77A 2VXYA 3PQ5A 3VC2A 1IM8A 1FMTA 3EOAI 3PE6A 4QBHA 2QNIA 1AN9A 1FEZA 3DMRA 421PA 3COYA 1U7TA 3W6UA 1ZCJA 2FF7A 1VG8A 2IU3A 2WJ3A 1YDWA 5BT8A 5L3SB 3W5DA 3OCCA 5ER9A 2I8LA 3JARA 1QSGA 2WWXA 3O4HA 3GWZA 4KUEA 4BO0A 9LDTA 5E0OA 3ZQ6A 1GZ6A 1WHSB 1R4ZA 2XGJA 3NOQA 2DLCX 2IJGX 4FHDA 3E9ZA 4G0MA 5ALTA 3U0VA 1LK0A 3MMZA 4E5UA 3TIFA 4EHDA 4AD8A 1MHPA 2Y2VA 1XG5A 2D13A 2W2LA 1J00A 2OBYA 3CO0S 1RAIA 1SVUA 2AKAB 2N3ZA 3LFUA 1CS4C 4FD3A 1VMEA 1QFJA 3ZV3A 4L5CA 2VDUE 3GVHA 3NW9A 3RF7A 2XDQB 2YZKA 4EJ6A 1XMXA 1XJWA 2W0MA 4W9NC 1IY2A 1HXHA 5K0ZA 3SI7A 2VQ6A 1K88A 4HQLA 1RYNA 2GHIA 3OO1A 3W6OA 4UVEA 2V8OA 1R0YA 3ZU5A 1D6JA 1DBRA 2EG5A 4GC5A 2J9FB 2E37A 2RIPA 3M1AA 4OB7A 3TD9A 4CNQA 5BUSA 4DBLE 2EW1A 3T4EA 1C3VA 1JKFA 2QL9A 3C4VA 4S1NA 3ZW8A 2XQFA 3ZHBA 2FH5B 1SQ0A 1T6XA 1S7CA 4HGZA 3ZWWA 4TMTA 4TM8A 4JLJA 4PNHA 1ENPA 3K0SA 1QX4A 1W36B 1UFVA 1OXTA 4B17A 3ELDA 1KS9A 1A5ZA 1UPXA 4FFDA 5B3JA 4RS4A 2WW8A 5AI5A 4E88A 4WJLA 3DDNA 1LEHA 3EJ6A 4J9VA 4M1EA 4QXPA 3L40A 3V9PA 2A1UB 5CYOA 4QYIA 1Z88A 1ADGA 4XIGS 3NJ8A 3J7TA 1EE1A 1KVRA 1O03A 1VSQA 1Z5VA 4MUKA 4XQEA 2NU6B 2CBZA 2Y1FA 2GK4A 2PRSA 4P32A 1L5WA 3RS0A 3P7MA 1XWFA 1FDRA 2C4WA 5KTOA 2WZBA 4K6MA 4XXHA 4HGNA 3ND9A 1BDJA 2PSFA 3DV0B 3WWOA 4BN5A 5IKOA 3ROEA 3S0JA 2QSZA 4QYIB 3AKEA 4G5RA 3TNLA 5CTJA 4YP1A 4MYUA 1O0CA 2PUAA 1G3IA 2VSXA 2I66A 3QF4A 3W5HA 3IALA 5U1PA 1KI1A 3K32A 5DV9A 4OXYA 3ROTA 5CA1B 3FPAA 1ESDA 5DT9A 4K6KA 4MB0A 3V46A 3HB5X 1LBTA 4ZEWA 2HNBA 2PNJA 3DXXA 3X1KA 1G3RA 1AG9A 4S12A 2X0EA 1YDGA 2Q4OA 4DC9A 4PO3X 3IP3A 2GHTA 4YQZA 5BQXA 3ZNQA 1ZD9A 2AOTA 2FB9A 4RTNA 2C3PA 4L2IA 1Q1AA 3LIPA 2PX5A 2FR8A 5ES4B 2WNIA 4IH9A 4BAZA 3GOQA 4GC9A 2WSLA 4TMVA 1MGOA 4Y30A 1PEKE 1GG9A 3JALA 4PC1A 5KYUB 3TTVA 2AJCA 5F2KA 1Q50A 2ZBEA 1UFRA 3QBEA 4JK3A 2XCQA 2YY7A 5C5CA 2DTEA 3UYKA 4IOJA 4QQFA 4Q37A 1UEIA 1OFUX 5HF5A 1M2OB 1JNXX 2NUPB 3M6UA 3SC6A 3M4ZA 2CJWB 2ZTVA 1EP9A 2BGGA 2WU0A 1K97A 2RAFA 3EGVA 4L9WA 2GN6A 3GEEA 3HVIA 4YAGA 1PU2A 2O14A 5EPOA 4IPTA 3ZNOA 5KDOA 3EUWA 3GLGB 4HATA 3WK8A 5BUQA 4M1WA 1GIAA 2Y8EA 3ORSA 3RVRA 3QPAA 2O54A 4R3UC 1FX0A 1QPBA 1G4AE 3NS7A 5JE8A 3ZBTA 2FWIA 3T5DA 4JHLA 4HQRA 3KPYA 2QEQA 2WJPA 4XDGA 1ONOA 3PGA1 1Z5OA 3LC1O 4JVNA 4BEJA 2GJAA 4EYKA 2A7XA 1E3DA 2GF9A 3WGUA 3CKMA 7AT1A 4AKTA 1FFSA 1X7DA 1T9GR 3QJGA 2O4UX 1SQFA 3K9QO 3NWJA 2BFCB 3CUKA 5LDDC 1C81A 1MC8A 1ATZA 1CJCA 1U3DA 3PXBA 4MR7B 2PM8A 4XEHA 3X1MA 2FVXA 4AJLA 1J2RA 1YL7A 1GWNA 3TMYA 4RF4A 5KNCD 3GLHE 3IIMA 2VQSA 1V8DA 4TKVB 3T1TA 3VR6H 1OF1A 2DY0A 2QT0A 4Q7LA 1F0PA 4FMPA 4LMBA 4HWOA 4Q3KA 3R40A 4CW7A 5KJCA 2UZ1A 4F3RA 2O0JA 3PHHA 5EJ4A 2ZSUA 3SF8B 5CDGA 2CBXA 2QQ5A 4DLNA 1Q77A 5EGNA 3IP8A 3C85A 1R8YA 3SHQA 2E48A 2RHBA 3GN2A 3MJEA 5FCDA 3RUAA 2B1QA 2FZLA 3Q9NA 2WJAA 4QUIA 3JASA 2FW9A 3WGOA 3H0EA 3IL2A 1SXIA 2J6CA 5JYDA 1HL7A 3WQRA 1IZ8A 3OLVA 3FOWA 1JBQA 2E5LB 5KYNA 3FY4A 5IKPA 3L8EA 1N1DA 4F56A 3ZWNA 4FKMA 4WKNA 4C43A 4ZOLF 4ZZIA 4AQ7A 1T35A 2C29D 3OMXA 1GM5A 5F64A 1QG4A 1YV9A 4ZCMA 5TNXA 2O7RA 2GNOA 3SU8A 5KHOC 1U9YA 4B6GA 3FDJA 1T5OA 4OK5A 2HGSA 5KMGA 1WXDA 2YWBA 1N34B 2XXAB 4WINA 1XZJA 2YV5A 1HQYE 3QUAA 4C0JA 2PQ2A 1OC2A 4E1AA 1F8UA 4YGYA 4AVYA 1NUPA 3RKRA 2R6FA 3PEEA 4FFWA 5IVPA 3PUZA 4TTSA 4MPTA 2KX7A 1FXWA 5LDHA 2B4TO 3CBQA 1U7WA 4F3KA 1VMIA 4HAWA 1BVRA 3AI7A 3KPJA 2IEYA 3MCWA 2H9IA 3VFDA 3T5AA 2ZXUA 5LZ4A 3ORQA 3GFBA 4XYBA 1UF9A 2OD2A 2O2HA 2AJBA 2PR7A 5LKRA 2PUGA 1OGIA 4ZCLA 3LUJA 3G9QA 2FCRA 3ET5A 4TWZA 1EGMB 4X6YA 3G2IA 4IS3A 5CGZA 1XVLA 1V1RB 2FPSA 1BVYF 3QVGA 3EVFA 5AP9A 3N8KA 3DOEA 4JI7B 3KJGA 3BSFA 4MW7A 3AIMA 1L4HA 3CLSC 3FOBA 3NHYA 4F60A 2SKEA 5IVIA 4Q9KA 5AUQA 2WIKA 4Z4EA 4RNCA 2MSLA 2BH2A 2Z3VA 2P4QA 4G24A 4ZAZA 4K86A 2QRHA 5AVKA 1O8BA 1T0IA 4YP7A 4JXXA 3UENA 1SIUA 3L6EA 1P19A 2AF4C 2FI1A 1Z62A 1KSJA 1LXCA 3R0ZA 4U39A 1KPHA 5IJ9B 1U2PA 3E3AA 4G5OA 1V16B 2YRFA 1OXXK 1NJ1A 2A0YA 2GZ3A 4ITRC 4KQ1A 3KLPX 4BP9A 5AVVA 3N8HA 5J2UA 3FIJA 5E6UA 4ZOQI 4O2AA 3JALB 1ZNZA 2X23A 3RK0A 2NUTA 1VLVA 3EDYA 3ZYZA 1VI2A 5ABPA 3OTOB 4G4SO 4HADA 4JHXA 2IUSA 4JJKA 2ZUSA 4YDSA 1SOMA 2YNMA 1W29A 4JP8A 1QLHA 3KYCA 5BWNA 1Y6ZA 2JGAA 2ZJ5A 1H2FA 1Y8RA 1F9EA 1VGVA 2VT6A 1R0ZA 3WNDA 4KC0A 1PUIA 1GG5A 3FUXA 3KLMX 4MVJA 4FR0A 5M3BA 1NWHA 2ZJ6A 3FCCA 3LECA 4OCZA 5LFAA 5K8CA 5LZ2A 3VYWA 2V97A 3SXJA 2VSYA 4FEAA 3WYCA 4A6XA 3GJQA 1KIFA 3PX3A 4GYYA 2GBFA 3SP1A 3UOGA 4X20A 2UVDA 4YHBA 4KBYA 1UXIA 2WYIA 3KQVA 3FCOA 4K2HA 3VUFA 2DH6A 4EKEA 3MGBA 1EXVA 3NVKI 4K8RB 2GK7A 4FFNA 1QRUA 5CFNA 2JVKA 5HMLA 3LX4A 4NZ9A 5HYVA 1E7QA 2G5GX 2I3DA 3DPUA 2BC9A 4RIEA 4HDMA 5TDHA 2DRIA 1JQKA 2Q2VA 2ZS8A 3RIGA 3U3MA 1JPJA 4JJEA 5BPFA 1R4MB 4O1HA 1KU0A 2HI0A 5IMBA 3TRIA 1U0NA 2NU7B 1ZYUA 2R1UA 3E5RA 1NSTA 3PE4A 4GAEA 4Q4JB 3TLXA 1ETHA 2YN2A 2LCIA 2DQ4A 3IVRA 4OMFG 4X41A 3UJNA 2I65A 3L43A 2NUPA 5C3UA 2IS6A 1JE0A 1QHGA 2GARA 4BC1A 3KPWA 4DFDA 1HORA 1ODFA 2A4KA 2E4ZA 3GF4A 4ARUA 3LCRA 2OA0A 4YO7A 4C7OA 1DWUA 1E7MA 1IEWA 1NPDA 1YS2X 2MYPA 2YVQA 3RVKA 3GVXA 1P0PA 1R4NB 3L2OB 2QI9F 2H4HA 4YBRA 4UEKA 4V0MA 1RWQA 1J2EA 2H7YA 1D1TA 1FP4B 4P7JA 4TKZA 3B8EA 1ZIYA 2P75A 1KHHA 2XKBA 4MP3A 1AK2A 1E8NA 1OBVA 1YKGA 2ERYA 2M98A 1QYWA 2XUIA 3WLMA 2VBFA 4B8YA 2GCOA 4AO8A 3QMMA 4PFKA 3G8AA 4JFRA 4ZHQB 2WR8A 8LDHA 3I12A 1H6CA 1JG4A 4AX4A 2WIDA 2NQTA 4RUKA 3HY6A 3BWYA 3THXA 1CIJA 3ROZA 4E33A 1EBBA 1T0JB 1VPTA 1YTLA 2G9ZA 2I4NA 2XMQA 3DVSX 3IJRA 3NIFB 3OZUA 1WG8A 4EI2A 5LWHA 5MN6A 1Y80A 4P08A 4YQFA 3SJAA 3IEXA 3LWDA 4G84A 1E2BA 2KB0A 2ONCA 3K5IA 1XALA 3GZTB 4R1PA 4GPBA 1QLJA 2AW5A 3OQ1A 1ARZA 2O23A 6REQB 4AJ9A 4CQMA 2H2IA 1E3JA 3Q1KA 3QI2A 5TY0A 3UBTA 1VI5A 3QVKA 5DGXA 5EZSA 4WBNB 5JSQA 1TJ3A 5THXA 3LO5A 3KZMA 3DTTA 3O75A 2C2KA 3KBBA 3EPKA 3NM4A 2QAJA 4LJ4A 1S8OA 2OO7A 3ZXUB 1XTIA 3CZAA 2ENUA 3G6WA 3MBIA 1FLVA 5B6PA 4BNHA 3GLIA 3PR1A 4V1CA 3X44A 2CJYA 3PDUA 4YY3B 3O74A 2PGJA 1TCBA 4R8KA 5CT5A 3HNPA 4CM8A 3P0IA 5DI9A 1THMA 5C8XA 3DZCA 1GQOA 1KF0A 2ZIEA 4IV8A 4MRRA 3ZV7A 1V3QE 1CFZA 3TR0A 4BU1A 2GWRA 4YVFA 1RSZA 4MB2A 3UMFA 2Z57A 1L2TA 4ZO6A 1F2UA 1OCEA 4IIVA 3DMYA 3JYHA 2FWAA 1JKMA 3OFKA 1H2HA 4YB8A 5FULA 1H8HA 2J5KA 4R9SA 4Z6KA 1U3CA 1UBJS 2ID7A 3IBSA 2G7ZA 3D3WA 2VH2A 5IXJA 1GQRA 4ZYVA 1BFUA 1LA2A 3F90A 1XT6A 4NABA 3BHNA 2HX1A 3H4VA 2PEYA 3I09A 3EXEA 2G70A 4MW2A 3Q7IA 1H6DA 3P32A 1R0XA 2UYQA 4IEIA 3BXZA 5AK6A 1UJ2A 3S1LA 1S6YA 4KIJA 4MZDA 3UY4A 1PGPA 2CEAA 3ZG6A 2PUEA 1K6XA 1V1MB 2BJWA 2PZGA 2Q3MA 2GFQA 2ZITA 4I3GA 3ICWA 3ONEA 1KZHA 2WF7A 3HJGA 1UEXC 1M34A 2BCJQ 4QEDA 2O3SA 4G1VA 4XTCS 1YT5A 4TV8F 2ZJ2A 1SZCA 5FPSA 1JLKA 1LI4A 5CA0F 5B4VA 4HFJA 3D1VA 3PP8A 2O7SA 3IQDB 4GKBA 1QF9A 2GRAA 5A0VA 2IEAA 3WOVA 3H3XA 2C5GA 4BNTA 5HDQA 4BCBA 1W2GA 4OBEA 4ME6A 5CUQA 3EEYA 2X2PA 2NVBA 1DC3A 3F47A 4CQMB 4F91B 2B99A 2ZJ1A 3SBXA 2CL0X 1GUDA 1ZD4A 4BJ1A 4R01A 5GY7A 5INTA 2ZRJA 4V2UA 3L8ZA 4DVGA 1CX9B 2PH7A 1A27A 2QKYA 1U2QA 3L49A 4IV5A 1Q21A 4ZCPA 4BNZA 4CM9D 4G8DA 1D4AA 4ZIRB 1VCNA 4MIYA 2DWUA 4IZHA 1AZSC 2BWJA 2QUZA 3KXPA 4EMSA 3IKLA 1ZSNA 1O57A 4I2VA 1NVAA 1K6JA 4OKNA 2D5AA 2Q3LA 1VXRA 4HFNA 4IGIA 4QDXA 3CZQA 4PC7A 2GLXA 1AGXA 4W9NA 3BXFA 5CAEB 5KVAA 1KP2A 3FVTA 1SBZA 4JUCA 2VDJA 4P34A 5KCMA 5KYXA 5FX2A 3DB1A 4OPMA 2Q8PA 3TZ6A 1DI0A 1ZGGA 4I9GA 2VHJA 3IJPA 4R0NA 3DZKA 4C4ZA 4C2AA 2O5RA 3F5DA 3THWB 1PL6A 3Q0EA 3ITNA 4RMIA 3ELUA 2ZWMA 4JLNA 4E2ZA 2CXTA 4RTOA 4CNBA 4Y1RB 2Q07A 4PLPA 3UEOA 3MMNA 5E1MA 1OLOA 1JHZA 3W5BA 3VR4D 3RYFA 1XD2B 4AN0A 4GX2A 3HVUA 3F6CA 4MYRA 2QS9A 3BWVA 1DAHA 4IO1A 3V4RA 2WHRA 3BVPA 1FX0B 3E22A 2VSQA 3FI9A 1BMDA 2PQ0A 5KKAA 4FFMA 1UKBA 2O05A 1UAYA 1V1MA 1KBOA 2HRRA 3L02A 3RIYA 3UK2A 2R4UA 1HNXB 2ZYWX 4D4GA 3RU3A 1WDMA 2HQ1A 4TMFA 2B0CA 3OZXA 4Z1MD 1DKQA 3ZI4A 2XKKA 4BJHB 3FHJA 5CCXA 2YFHA 4CG3A 1ZXXA 1EWVA 2HADA 5JD5A 4MQLA 2D5CA 3OAAA 3Q7PA 4PZLA 3F1KA 2H18A 3L7BA 3QHPA 1HYGA 3R0XA 3EASA 2WSSD 4YRMA 5JY1A 1E98A 1HWYA 4EB0A 2BONA 1AUXA 1HT3A 2IE0A 3AUSA 4Q9NA 1AA9A 2C9OA 2WWRA 1KEZA 2PGIA 3FG9A 3QBJA 5DYGA 3RAGA 5D7NA 1UC5B 4PVCA 2WG2A 5GMOA 4A5OA 4OKSA 4P4LA 5TQ0A 3UICA 4QBGB 3WKBA 4M55A 3C16C 1ABBA 3B6EA 2OK7A 2G72A 2D1FA 3KVNA 1DOAA 2Q7OE 1C2TA 3T5BA 3KQWA 2AWNA 2XYHA 3FTPA 3U4GA 3F74A 3GLIB 1C3LA 1FQOA 3O38A 4FTWA 3STTA 3QELA 3AUAA 5CCEA 3K0EA 4EP1A 3EIEA 2HA6A 5EKUA 1NUSA 2QUAA 3BFJA 4QJ4A 3W2IA 2Z6AA 2PVSA 3RAEC 2UYYA 4OP3A 3KSUA 3OU6A 3I6ZA 4M0EA 4TQAA 3TR5A 2IU0A 4R0MA 2Q5OA 2BDEA 1NASA 1QZXA 4PYNA 4QUHA 1TA0A 3V7YA 3ZUGA 1I5RA 2GBPA 1U7OA 1C14A 3E3NA 1GZSA 1XEAA 1KP3A 4LGVA 2CLFB 3JQFA 1XXHA 3EA5A 3MHTA 1TT5A 1I9CA 4XGKA 4N48A 4GPTA 1I4WA 1U94A 1KMIY 3PNPA 3GRUA 3GGGA 4ZZ3A 5E9WA 1KVUA 5IG2A 5AESA 4NFSA 4LMAA 4FE4A 2AQ8A 1LW6E 2FUG6 3AWIA 3S81A 4Z49A 1G8KA 2PHZA 4PPQA 3HXPA 3KXLA 3I30X 1IBCA 1AB6A 4IQ8A 3TJRA 2XNSA 1D5WA 1NXXA 2GXUA 2V7QA 4H1HA 3SEZA 4JROA 3W4KA 3ZK9A 3O8QA 4F45A 3B85A 4J3FA 3DE6X 4UVIA 2D5BA 1K5HA 1NN0A 1OUMA 1MKYA 2HYDA 2XTJA 1Q95A 1G7RA 3M8KA 4HYQA 4L0DA 1CG6A 5FRDA 3RPEA 4YP0A 5KSOA 4HQOA 10MHA 4G2NA 3TH5A 3OT1B 5C46F 3JQQA 4AJ2A 4CF3A 4IMPA 1IWBB 3WX0A 3GAFA 4LF7B 3SOPA 1DUIA 2PUVA 5AKJA 1TVEA 1T3GA 2IIPA 3K4QA 2ZR8A 3Q9UA 4KQ6A 4CMIA 1XZLA 4RFVA 5LQCA 2QRJA