3JTGA

Crystal structure of mouse elf3 c-terminal dna-binding domain in complex with type ii tgf-beta receptor promoter dna
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
95
structure length
95
Chain Sequence
GTHLWEFIRDILIHPELNEGLMKWENRHEGVFKFLRSEAVAQLWGQKKKNSNMTYEKLSRAMRYYYKREILERVDGRRLVYKFGKNSSGWKEEEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ETS-related transcription factor Elf-3
publication title Crystal structure of mouse Elf3 C-terminal DNA-binding domain in complex with type II TGF-beta receptor promoter DNA.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription
total genus 29
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2009-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3jtgA01
3E6BA 4HX4A 3VOEA 4Z2YA 2GAUA 4A6EA 1UCRA 4IF4A 2PQ8A 3I53A 3E6MA 3WTXC 1R22A 4HZFA 1ZAOA 4RGUA 4L9NA 3K2ZA 5L3DA 1ZN2A 3CDHA 5FO5A 2JTVA 1OYYA 3AAFA 3WTTC 3L9FA 3J80K 4M72A 2ZMEB 2OA4A 3VODA 2QM3A 3B73A 5LHHA 1DDNA 3U1DA 1D5VA 1R36A 2ZFWA 2ZNZA 5BMZA 2HKOA 4E70A 2R7FA 3WODF 1LEBA 3KP7A 4BAYA 4CDGA 1HSTA 4HW0A 2K7LA 1IUYA 4ZH4F 3F8NA 2UWMA 1KA8A 1ON1A 3COAC 1FC3A 2L4AA 3K1NA 1DUXC 2CYYA 2FQ3A 4G7ZF 3FZVA 2P4WA 3KP5A 3KE2A 1T2KA 1PP8F 2G7HA 4UVAA 5JI6A 2WV0A 3I59A 4LLLA 2XVCA 3NRVA 4EJUA 4HX7A 3CTAA 4HQMA 4G9YA 3KETA 4ENJA 2IA0A 3E5XA 2VE9A 4U0WA 1P92A 3R0AA 1WWXA 4OIQF 2XROA 5E1ZB 3KCCA 1IXSB 4HYEA 2D2WA 5D5XB 2W25A 4ON0A 2O61A 1UB9A 2MH9A 2DU9A 3I4PA 5BQTA 3QRFF 1KQ9A 1BIBA 2ELHA 4IPAA 1P6RA 2EK5A 2CSOA 5E1WA 4ENMA 1NHAA 4I02A 1KQ0A 1T38A 4AIHA 2JRTA 1B59A 3QPTA 1LJ9A 3GX4X 3GFIA 2Z99A 4GCVA 2F5CA 2DPUA 2IVMA 1HKSA 5CLSA 2VT3A 2STWA 1HSJA 5D4RA 5CVJA 4ENNA 4K2EA 4O6JA 1MJAA 3LQRA 2FMYA 5DEQA 2KIUA 2KJCA 2KIFA 4A12A 2QQ9A 2CG4A 3T0YA 2HGCA 1KU2A 5BOXA 2OAZA 2QQBA 4IJAA 1R7JA 2M45A 1STZA 4PGGA 4M9XA 2WC2A 4KICA 3DP7A 1XDUA 1BN5A 2Y0MA 3WU0A 4LD5A 3EDPA 5CVVA 3DXJF 3RTRA 1ON2A 2XAHA 1KYZA 4AVPA 1XSVA 4NQWA 5TRDA 1CGPA 2IA2A 2ESNA 1XMKA 2IP2A 2P7CB 3IKVA 3LQQA 3FM3A 3SZPA 1IN4A 3OOPA 1IN5A 4U7DA 1R5GA 1EH7A 1R00A 2DK5A 4MHGA 1S3JA 3CUQB 1LNWA 3L7WA 2QLZA 1MDMB 1AOYA 3H3UA 4L9TA 2IT0A 3HHGA 5ICEA 1D8JA 4CGZA 4UVBA 1YO5C 4I0AA 5J6XA 4LK0F 4ZYDA 2VOOA 5CJ9A 4RAYA 2EWNA 4EM1A 1PUEE 3V7CA 1ZHFA 3KEOA 1REPC 4LFUA 5F1RA 2LF7A 3P9IA 2P8TA 3GO5A 3WGHA 5LRRA 4HV5A 2Y75A 1XSDA 4MGRA 2HQRA 3ZMZA 1ZLKA 2ZMEA 2VONA 2V79A 2OQRA 3KP4A 2DT5A 4TV7A 1I27A 3W6JB 3HSFA 1BOAA 1O7FA 1W7PD 1IW7F 2Y48A 3Q9VA 1XCBA 1UFMA 3L2CA 2P5KA 2HOEA 2VBYA 4B09A 1JE8A 3S2WA 1TNSA 3O6BB 2KJBA 3I0TA 1SD6A 2A61A 4CICA 2DQLA 1LDDA 5E8GA 3T8RA 2YX7A 1Z7UA 3HTSB 1TQMA 3E5UA 4LLGF 3V7RA 5DCMA 1RUOA 3VFZA 3F3XA 2P6SA 3IHUA 1XSXA 5DUKA 1VTNC 3F8MA 1RNLA 3BPXA 3HRSA 3JAMZ 4NHJA 4HA8A 1U78A 4XBFA 2GIVA 1ZREA 2CW0F 1FYMA 2VE8A 2BGCA 1ODDA 5D8KB 3I58A 4KDPA 3BJ6A 4N9HA 4EV0A 2FNPA 1I1SA 4UV8A 2NNNA 2AXLA 1S29A 3ROUA 1LDKB 1YW7A 4ESJA 1R1TA 1IZ1A 5LGNA 1YG2A 1I6XA 2DI3A 2YSRA 3OV8A 4XRFA 3KEQA 4YFXF 5DV5A 1KU3A 1DPUA 1KU9A 3MZYA 1SD7A 3FMRA 2QQAA 3JTGA 4WXDA 2HEOA 2MC3A 4EJTA 3HRUA 1YS7A 3DF8A 1WRJA 5FGMA 1U6GA 3SXYA 4WX9A 5HLHA 2PN6A 1ONVA 5CVUA 4HF1A 4MTEA 4EJVA 4M9SA 1USTA 2QWWA 1YW8A 2VODA 4HV6A 1CF7B 4L0YB 3BY6A 2XGXA 1HW2A 2XIGA 2W24A 4MNUA 4F7ZA 4D0PA 2FBKA 4NB5A 1HXDA 4RS8A 3K0LA 2K02A 2W84A 4UHTA 3T1BA 5K1YA 4HAMA 2RC4A 1HW1A 3K1PA 2V6CA 2X4HA 4EVIA 3KLNA 3SFZA 2F5DA 2OQGA 2JZYA 5FB2A 3E3VA 4A5MA 2R7DA 1H9TA 1W4MA 1ZLJA 1Z05A 2FA5A 2D1HA 3RDIA 3WG9A 3ELKA 4Y13A 1U8RA 2VC0A 3KLOA 3R6SA 3ECHA 5LBQA 4HDUA 3SZTA 5L3CA 4CXFA 3M1EA 2XAQA 5HS9A 1DP7P 1HQCA 2R3SA 2ISZA 5LHIA 2XV4S 5H6QA 4KMFA 4S04A 3ZMSA 1ZYRF 3RPQA 3GW2A 4Q4ZF 1SMYF 3ZMVA 2HS5A 5ICGA 3CO7C 4PDKA 4P55A 3K9TA 2HTJA 3U2RA 2NYXA 1W7PB 1QZZA 1IF1A 5K5RA 3K1MA 3G3ZA 4WF2A 4I98B 4MQ9F 3WE3A 3K69A 4EM2A 3KP3A 4XSZF 2EB7A 3VB2A 1D8KA 3ZP5A 1ULYA 3BOQA 3FMQA 3GWZA 1XN7A 1IN8A 3WTWC 4PGHA 2Q8KA 5EEHA 1R5HA 4N0BA 2LKPA 3TGNA 2P6TA 1MZBA 2MLGA 4WWCA 2Z9OA 5JVTA 1TQPA 1G3SA 4Q48A 5ICFA 2VOPA 2H09A 1U2WA 3M8EA 3LA3A 2BE5F 4R79A 2F5FA 3U9GA 5FLXK 2WWYA 2RVCA 3C7JA 3M7GA 1T0FA 3PQJA 1XDSA 2Q0OA 4YG2F 2EA4A 3PFIA 4G94A 4RAZA 4UUVA 3Q9SA 1A04A 3IL2A 4HDVA 1SFXA 1XGMA 2VT2A 3O2PE 2OD5A 4L5JA 2MLKA 1ZG3A 2EV5A 1IXCA 3CUOA 5IT9Z 1F1ZA 2EFWA 1UHWA 1IAWA 5F64A 5CVIA 1L3LA 1P4AA 5JR3A 1XGOA 2OU2A 3IRRA 5ICCA 4U0YA 4H0EA 4EJOA 2XAJA 2QYOA 1BBYA 2V1XA 1IRFA 2FBHA 1WQ2A 3QU6A 5DDGA 2IPQX 3KP6A 2DO7A 2IRFG 1OPCA 4A0YA 1K78B 4UNOA 2V1UA 5CVRA 5DCFA 3QOPA 2V9VA 1U5TB 2VXZA 3BJOA 3E97A 3DEUA 3GZ6A 2C6YA 3EUHA 5HDKA 5E8IA 3MZHA 2CWEA 1RUNA 5D5WB 5J8CA 1B4AA 1TLHB 4BH9A 3NQOA 5K5OA 4U0VA 2XAFA 2LSOA 3V4GA 4BYYA 4IRGA 5ERIA 3ZMUA 5IT3A 1S7OA 1YYVA 4WXCA 4GGGA 3MCZA 4ZZLA 3MEXA 1G3YA 3ECOA 1I5ZA 4PZJA 2ETHA 3CUQC 4YIFA 2K86A 2E7XA 3T8TA 3REOA 2E7WA 3RYRA 4IHTA 3MFKA 1J7KA 1B9NA 1YTYA 2HKXA 3IWZA 2K4BA 2UZKA 1YW9A 4S05A 1FSHA 3RJPA 2XKOA 4U7BA 5HVQC 2DFIA 1KGSA 1WI9A 5HLGA 2JPCA 4O3MA 5TJJA 3BZ6A 1YLFA 1B6AA 4HF0A 2L01A 1FYLA 3GYHX 2MA3A 5D6FA 2K27A 4FX4A 4ASNA 5F6FA 1ZARA 1JXSA 5ED4A 3F8FA 1L0OC 4YFKF 4AIJA 4FT8A 4FHTA 3BWGA 2YU3A 2ZBKA 4I09A 4CO8A 4OIRF 4A2UA 1H0MA 3RPUA 4WCGA 3Q5FA 2JSCA 3RYPA 5LLQA 3FM5A 5FD6A 3WTVC 4QLCU 2QVOA 2ZJ2A 5IT9K 1BI1A 3TOAA 3F72A 2M87A 5KVRA 2W85A 4MEYF 3F8BA 3TDUC 4EQQA 2P7VB 4BQAA 4G7OF 4GYGA 1EV7A 1ZG5A 3CO6C 3WGGA 1XGSA 4RB0A 4WXHA 4GXOA 3H92A 5AIQA 3R4KA 3ZMTA 2BEOA 3JSOA 4LGWA 4KYWA 4A5NA 4L0ZB 1BI3A 3F6OA 5LGTA 1FP2A 3V8JA 2RNJA 3F6VA 2PEXA 2A69F 2XKPA 1Q1HA 2FEZA 2NS0A 1K7AA 2H94A 3TQNA 1FNNA 3IWFA 1JHHA 4RGXA 3RKWA 2HWVA 4LG0B 3I59B 2KKOA 3GFJA 1BM9A 4JK1X 1QNTA 4FX0A 3V8LA 3D5LA 1KYWA 2OZUA 5H20A 1C0WA 4G6DA 2O6GE 4P9FA 5HOOA 1IXRC 4R8HA 2IJLA 3JTHA 3WTYC 4Y17A 4A6DA 5A2QZ 4ZYEA 1SD4A 1J59A 4Y15A 3ZN0A 1T98A 2M8EA 4LMYA 1Y0UA 2ISYA 3MWMA 3DQVC 3FWEA 2MD5A 4U88A 1I1GA 4GYIA 2NRAC 4KIBA 4CYDA 2QBYB 4JQFA 3VEPA 3HSRA 5D5UB 3QP5A 2PBIA 3C18A 4LJZF 2RN7A 2HZTA 2O03A 2ZXJA 5CYVA 4KN7X 3JW4A 2F2EA 4WK8F 3WE2A 4KIGA 2NNYA 4ESFA 2XUBA 3E6CC 4IXAA 3WTSC 1XMAA 4XSXF 1W5SA 1OKRA 4KIFA 5DD8A 4P96A 3CLOA 1YQAA 1BC7C 3C3WA 1K78A 1HW5A 2QZ8A 3FXUA 3M9AA 1FX7A 1G6NA 2DBBA 2EFPA 1U5TA 4ETSA 1TQIA 1P4WA 2RQPA 2ZNYA 3ZQ7A 5D8LB 1HBXG 3B02A 2H6BA 1OMIA 2IW5A 2L02A 2FRHA 4KA4A 4I01A 4OU0A 2KRFA 5L3BA 2PJPA 2ZKZA 1XCVA 2VBXA 3I5UA 5ILSA 5DUIA 3QP6A 3L09A 4DNCA 3E6DA 3LAPA 1ZGAA 2LF8A 1FP1D 1Z1DA 2EV6A 1R23A 1LB2A 3F8CA 4KNYA 2KIMA 1UHMA 1X3UA 2ADUA 3BDDA 3GF2A 1BIAA 2Z5UA 1QO0D 2XAGA 1YFHA 4G7HF 2GA2A 2STTA 5ILVA 1O57A 4GO1A 4Q47A 2ACJA 2UXNA 4I2OA 2FF4A 1FYKA 2OZ6A 3HRTA 1O3SA 2A07F 3GEZA 1LEAA 3SHFA 2NAZA 1EH8A 2IA1A 2H6CA 2P5LC 4PCQA 2YPRA 4CHUA 1Z6RA 3KZZA 1O3TA 3CUQA 4RB2C 1YIOA 1MDMA 2LDUA 4RGRA 2O8XA 4ZYHA 1RI7A 5E18F 2XRNA 2L4MA 1J75A 2J5PA 4O5VA 1W5TA 3MAJA 3JAMK 3DPTA 2DAOA 3RIRA 1J9IA 3PQKA 2FE3A 2CFXA 4KUMA 3ABTA 3V8KA 5KK1A 1GHCA 1S8NA 1TW2A 3D0SA 1T6SA 2CO5A 2B0LA 4A0XA 1QZYA 5DD4A 2V1DA 3RI4A 3ULQB 3HOTA 4RB3C 1Z6TA 2OBPA 4KT5C 4HBLA 1U5TC 2PG4A 3ZN1A 2PMHA 4RGSA 3E5QA 3J81Z 1F9NA 3JSPA 2FMLA 5HS8A 3NEUA 4LG0A 4AIKA 5DCMB 2HYGD 2A3SA 3KZYA 1R1UA 3FF5A 4G6QA 3TDZC 5HLIA 3TOBA 1WSUA 1IN6A 4LB6B 1MJ9A 1IRGA 4EGZA 3QPHA 2PI0A 1PDNC 3F22A 2ESHA 4YFNF 3HOSA 3L00A 3KP2A 4CZZA 4HLYA 1EH6A 3ZMDA 2QBYA 2K4JA 3HYIA 1QBJA 1QPMA 2P5VA 2VBZA 4P9UA 2CGPA 1OYIA 3EQLF 3HRMA 4EMSA 4ZZDA 1WKMA 1O3QA 2M5WA 2BBYA 1V3FA 3N4MA 1G4DA 4IHSA 2A6HF 3GUDA 1BI2A 3GZ5A 5L3FA 4LLNA 6PAXA 2TDXA 1E17A 3FHZA 1OYWA 3ISPA 3TO9A 5BS6A 4Q5SF 1Z91A 4KFCA 5K5QA 1SMTA 4L5IA 2G9WA 1FBQA 3HSEA 4G8XA 2PMUA 2EV0A 5L3GA 2J5OA 2YR2A 1XD7A 3TO7A 3BJAA 1RIOH 4MQVA 1B1BA 3DV8A 1XB4A 4M71A 3LA2A 1J0RA 3HTUA 1KU7A 3RKYA 1CF7A 4OINF 1FZPB 4L9JA 2X0LA 5D5VB 2FBIA 3FXRA 3EYIA 3FMSA 1JGSA 5JFRA 1ZRFA 2RKHA 3T5XA 2D1VA 1J5YA 3CJNA 3I54A 1FLIA 2RV8A 5D4SA 2VC1A 1E2XA 1R1VA 4MTDA 3GFLA 1AWCA 5H6RA 3J7AO 1OR7A 5AONA 5L3EA 1QQIA 2H27A 4AWXB 1GXPA 3P9CA 3HUGA 4LK1F 3EETA 3IKTA 3WGIA 3V7SA 4UXNA 3M8FA 2O0YA 3J81K 4BHBA 2MBFA 3ML6A 3O3KA 2BYVE 2GXBA 2ZCWA 1HKTA 4M74A 2Z3YA 1SFUA 1TBXA 3FX3A 1F4KA 3TO6A 3WTUC 3N97A 5HDGA 3LSTA 1FBSA 1MGTA 2Q2EA 2D45A 5E17F 4N9IA 1Z9CA 2FOKA 2EFOA 5JHUA 1W7PA 4M73A 2FU4A 3RKXA 5BPIA 1RZ4A 4B8XA 1SFEA 4MEXF 2FXAA 4HOBA 1DPRA 3WTZA 3TKYA 1HKQA 3F23A 4A0ZA 1TW3A 1ZRDA 2VBWA 2M1BA 3KFWX 3SQNA 4EGYA 2XASA 3BROA 1FPQA 1PP7U 3C1DA 2GQQA 4EM0B 4HQEA 5E1XA 4IVNA 3MQ0A 3BP8A 1ZH5A 3IC7A 4L9VA 1BJAA 4EJWA 2QUFA 3GXOA 2GXGA 1FSEA 3BPVA 3G73A 3LWFA 3GLXA 1V4RA 4KN4X 2HQNA 2YX4A 4BHPA 3P7NA 1P2FA 2RDPA 4BXUA 2CQKA 5AIPA 1MD0A 5LHGA 1YS6A 1LQ1A 2DTRA 3GVAA 2PLYA 5LRSA 2DLLA 2DQRA 4QWQA 1T39A 1U3EM 2UXXA 1USSA 1F5TA 1ZGJA 2HYFA 3EYYA 2JT1A 2Z33A 1K79A 2DW4A 2FSWA 4RB1A 3W6KB 1KQ8A 1FBUA 4M6YA 3J80Z 2AS5F 1K6OA 1ZG1A 2GWRA 5HDNA 4OIOF 4KMUX 2EFQA 1FWZA 4M9ZA 3LAJA 2LNBA 2FNAA 4DQ2A 4XLNF 2HR3A 5EEGA 2WTEA 4LB5A 4HLXA 3F21A 2F5EA 5E20A 3P9KA 2BV6A 2VN2A 1BI0A 3HHHA 1BC8C 1G3TA 2A6EF 5BPDA 4ZYGA 4OIPF 2ZO4A 1SD5A 4UVCA 1QGPA 3QU3A 1JHFA 1LDJA 1O7LA 2M30A 1J2XA 4BHCA 3H3ZA 4I0BA 2A68F 2XHKA 2EFNA 1D3YA 5ILUA 2PFBA 5J8FA 5FLXZ 5FFXA 1LVAA 3WU1B 4OMYA 3ZPLA 1P4XA 2HTSA 3I64A 1TNTA 3I71A 2L3DA 4UV9A 3FXQA 1GVJA 5D6EA 2E1NA 5LEKA 1ZRCA 4P5OA 1MKMA 4AD9A 3DKWA 3R61A 4ESBA 4R1HA 2A5YB 4IRHA 3ERED 2L54A 1XGNA 3IRQA 1FY7A 1H9GA 5LGUA 5LEJA 3R60A 2COMA 2HDCA 1FT9A 4JBAA 1G3WA 2MH2A 5HS7A 1O3RA 2GZWA 4L18B 4OOIA 4YIIA 1R58A 3DFGA 2JPBA 1TTYA 2HFHA 2E1CA 4I7HA 2GA1A 5FD5A 3GFMA 1FOKA 3QAHA 2EJRA 4HF2A 2QENA 3DPLC 4IRIA 2O3FA 1SAXA 2DPDA 5DYMA 1B9MA 1S7AA 4ENKA 4BNCA 3R0JA 3ABUA 1GXQA 3LA7A 1MJBA 1IN7A 1S6LA 4OMZA 4M6XA 2G7UA 5A2QK 3LFKA 4XLPF 4HX8A 2RGVA 2W57A 3HIFA 5FFZA 2DK8A 2EA2A
chains in the Genus database with same CATH superfamily
3E6BA 4HX4A 3VOEA 2DCEA 4Z2YA 4RLFA 1V55H 1BW6A 1UCRA 2GAUA 4IF4A 4A6EA 2PQ8A 3I53A 2E2HJ 1Y8QB 2W4SA 2E5ZA 3E6MA 3WTXC 3GTGJ 4M3BA 1R22A 4BU2A 4HZFA 2E5NA 1ZAOA 4RGUA 4L9NA 1X58A 4XIDA 1X1DA 3K2ZA 5L3DA 1ZN2A 4LG3A 3CDHA 4MO7A 1U8BA 1AKHA 1HOMA 2JMWA 2MC4A 5FO5A 3TW6A 3VYTB 5IY5H 2JTVA 1OYYA 3PO3J 3QPSA 3AAFA 2NOGA 1Z21A 4BE0A 3WTTC 1LKXA 4F55A 3L9FA 3NWTA 3J80K 3NARA 4M72A 3HGYA 5C4XJ 2ZMEB 3BR3A 2OA4A 2BXZA 3VODA 2QM3A 1XG1A 1B72B 3B73A 4A3GJ 1JUMA 5LHHA 1DDNA 3U1DA 1OJLA 1D5VA 1R36A 2ZFWA 2ZNZA 5BMZA 1Y0NA 1IJWC 2HKOA 3PUFA 4E70A 2R7FA 4DYQA 3WODF 1LEBA 3KP7A 4BAYA 4CDGA 4C2UA 1PVEA 1HSTA 1WJDA 3FK7A 2Y9YA 2B63J 1VQPI 4HW0A 3L1PA 2K7LA 1IUYA 2GOXB 4KT6A 4ZH4F 3F8NA 3MMYB 2UWMA 1KA8A 1QZEA 2AHQA 1ON1A 3COAC 1FC3A 4YELA 1MW7A 2VQCA 2L4AA 3K1NA 4ANJA 5C4JJ 1DUXC 2CYYA 2FQ3A 1A6IA 2JSPA 2VQHA 4DYCA 4G7ZF 4BY1J 3FZVA 2P4WA 3KP5A 3KE2A 4C2MJ 4IO9F 1T2KA 2K5CA 3AG3H 2G7HA 4UVAA 1PP8F 3E7LA 2CW8A 2QEXI 4AYBA 1MSEC 3SZGA 3W6VA 3OS0A 1E3PA 2E19A 2K9NA 1OLTA 2VB6A 5JI6A 2WV0A 3ZRGA 3I59A 4LLLA 2XGDA 2XVCA 2DXIA 1APLC 3NRVA 4EJUA 4BEHB 4HX7A 2ZXIA 3VSLA 5F0FA 3CTAA 4HQMA 2R5ZA 2B9SA 4G9YA 3KETA 2CH0A 1UG2A 2KL4A 5J4VA 2R7RA 4ENJA 4I76A 3IV5A 2X6YA 2IA0A 3E5XA 3FXKA 3JRHA 2VE9A 4U0WA 1P92A 4V19K 3R0AA 2K9LA 3WU2C 1WWXA 4OIQF 1LE8B 2XROA 5E1ZB 4X0GA 3KCCA 1IXSB 2LC2A 2D2WA 3BG6A 4HYEA 4JX5A 3MN2A 3A01B 5D5XB 3G1OA 4XLEA 2W25A 4ON0A 3HKZN 2O61A 5GP9A 1UB9A 2JA2A 2MH9A 1AU7A 3ZQFA 3DTEA 3KYLA 2DU9A 2DFHA 3I4PA 5BQTA 1GV5A 2X85A 3QRFF 2ZXWH 1KQ9A 2DA5A 1BIBA 1TZLA 1PJRA 2ELHA 1VQLI 3DBLB 4IPAA 2L2OA 1P6RA 3BR5A 2EK5A 3QYEA 3M3YJ 2CSOA 2FD5A 5E1WA 1RESA 2NS8A 4ENMA 1NHAA 3FIWA 2L5QA 2Y0SA 5F0HA 1UAAA 3DKXA 4I02A 1KQ0A 1SVOA 2EZLA 4DIQA 1T38A 4AIHA 1VQ6I 2JRTA 5JLXA 1H8AC 2QF7A 1B59A 1R5ID 3BC8A 3VSKA 5B1BH 3QPTA 1HCRA 1DU0A 2M34A 4BJTA 1LJ9A 3GX4X 1ACIA 3GFIA 4BY7J 2KRHA 2Z99A 2Y69H 2A6TA 1KZHA 3E1SA 3H0GJ 4GCVA 1OCTC 2KISA 2F5CA 1ZKGA 3OY9A 2DPUA 2F6CA 2IVMA 1HKSA 2OTJI 2DA3A 4PK4A 2HXIA 3DU5A 4IX7A 3DU6A 5CLSA 2VT3A 2XF6A 4QIWN 1IGNA 2XF7A 4H4KC 2STWA 1HSJA 5D4RA 2IS4A 5CVJA 4ENNA 1FIAA 4K2EA 1MJAA 4O6JA 3HL2A 5M5WJ 3OYFA 3LQRA 2FMYA 1ZR4A 3J7YJ 2EH3A 3OYKA 3CLQA 3OYIA 5DEQA 2KIUA 3WG7H 2KJCA 4XKCA 2KIFA 4A12A 1VQ7I 1XC5A 2QQ9A 2CG4A 3T0YA 2HGCA 5IOZA 2DFFA 1KU2A 5BOXA 2OAZA 4XNFA 2QQBA 3GLLA 4IJAA 1R7JA 5GPAA 4IHXA 2X1DA 2M45A 3HOYJ 1STZA 4GRIA 5TGTA 5CKTA 2OUMA 4PGGA 4M9XA 1MH3A 2WC2A 1MNMC 3OOUA 5EZHA 3ZCOA 4BQNA 4J00A 2LP0A 1POGA 4KICA 4BACA 1T08B 3DP7A 3BTCA 1XDUA 1BN5A 2Y0MA 3WU0A 4LD5A 3EDPA 5CVVA 3AKZA 3DTKA 3DXJF 4A3DJ 1SVMA 2R7TA 3RTRA 5E3OA 3GTOJ 1ON2A 3CF2A 2XAHA 1JTXA 1KYZA 2BHZA 2GXAA 4AVPA 1SVLA 2KPMA 1N25A 2BY0A 1XSVA 2WAEA 1JI8A 4NQWA 5TRDA 1CGPA 2IA2A 2ESNA 1R49A 2DMTA 2DMPA 2O8KA 1IDZA 1XMKA 2IP2A 3H0DA 4C3HJ 2P7CB 2KDZA 5F08A 3IKVA 3LQQA 3FM3A 4RDUA 4D9JA 4XRSG 3SZPA 5KHDA 1IN4A 2JK3A 3OOPA 4CSWA 2EILH 2EIMH 3TP0A 1IN5A 3M1CA 2JA5J 4U7DA 1R5GA 4DYRA 1EH7A 2AQFA 3L2QA 2ME6A 2M4KA 4BQOA 1R00A 2DK5A 4MHGA 1WJFA 3TP3A 1S3JA 2KT0A 1V5FA 4UB6C 2WY7Q 1ZGWA 3CUQB 1LNWA 5EG0B 2M9HA 3L7WA 2QLZA 2JN6A 4ZJZA 5J3LA 1T0FC 1MDMB 3UNGC 2DDBA 2ZB9A 3CCUI 4A3BJ 4B3XA 1AOYA 3H3UA 4L9TA 5FKOA 1GUUA 2I8DA 1IO2A 2R93J 2IT0A 1HLVA 3HHGA 5ICEA 1D8JA 2OC6A 1D0XA 4CGZA 4UVBA 1RRJA 1YO5C 4I0AA 2CW7A 2NVYJ 1Q1VA 5HNFA 5J6XA 1W1WE 1MNEA 4NC7A 4LK0F 4ZYDA 2VOOA 2AXTC 5CJ9A 4RAYA 2LYCA 1Y8RB 2MYSA 5F0CA 2EWNA 1R4MB 1TP4A 4EM1A 4II3A 1PUEE 3V7CA 3S14J 1ZHFA 3SYTA 3KEOA 1REPC 2CQNA 4LFUA 5F1RA 3M07A 3A02A 2LF7A 3P9IA 3RPUD 2P8TA 3B6AA 1N75A 4HEA2 4BE2A 3QODA 4BJ6C 3UR3C 4E7JA 3GO5A 5GTIC 3KYCB 1ETVA 3S16J 1RKWA 4PJLA 3WGHA 5LRRA 3K4CA 4HV5A 2Y75A 1XSDA 4PFPA 4MGRA 3HB9A 2HQRA 3ZMZA 1YOVB 4CCJA 4QSHA 1TWCJ 2QSFX 4BBSJ 2VJ5A 1ZLKA 2ZMEA 2VONA 1BR4A 2V79A 1OCRH 2OQRA 3KP4A 2PJRB 1B72A 2DT5A 4TV7A 3AG4H 3HOVJ 3HOXJ 4XN3A 3BQZA 1I27A 3IAM2 3ASNH 2JA8J 5IP9J 2BVMA 3W6JB 2MW8A 3HSFA 1XMXA 1BOAA 2FUG2 1O7FA 3H36A 1W7PD 1IW7F 3CC7I 3HKZA 1K61A 1BW5A 2Y48A 2M8GX 3Q9VA 2QKLB 1XCBA 5FLMJ 3JRCA 1TWFJ 1UFMA 3L2CA 4XMYA 2P5KA 2HQAA 3FKIJ 1NK3P 4PJMA 2HOEA 2V1NA 2VBYA 3CQZJ 4B09A 1JE8A 1PYVA 1GDTA 3S2WA 1H88C 1U9NA 1ENHA 4CYCB 2W48A 1X19A 1TNSA 1FOWA 3HJEA 3IH2A 1T56A 2IS6A 5KAIC 4DBQA 3O6BB 2KJBA 3I0TA 1SD6A 4AIDA 4YIRX 3CCRI 2A61A 4RMNA 2DQLA 4CICA 4A3FJ 2ZSHB 1LDDA 3BZCA 5E8GA 3T8RA 2YX7A 1Z7UA 2WY8Q 1E3OC 3HOWJ 3DLLF 1FTZA 4CZCA 3HTSB 1TQMA 2O5RA 3E5UA 5JVGF 4LLGF 2QGUA 3CCMI 3V7RA 5DCMA 4ZTFA 1TT5B 1D0YA 4XK4A 4M3FA 3BG3A 2WAFA 3PM1A 3AL0C 5B1AH 1RUOA 3VFZA 3ZQHA 4BGDA 3F3XA 2P6SA 3S1QJ 3IHUA 1YX5A 3RZDJ 1XSXA 5DUKA 3A2KA 1VTNC 1X2NA 3F8MA 5IYDJ 1RNLA 3BPXA 3HRSA 3JAMZ 4NHJA 4HA8A 1U78A 2IS1A 2EZIA 4XBFA 4CCKA 3PL8A 2GIVA 1ZREA 1P9QC 2CW0F 4ZC3A 3KPHA 1FYMA 5DM6F 3MZ8A 2DYSH 3LSKA 2A5WA 2VE8A 4RLQA 2BGCA 3A01A 1ODDA 3A1YA 5D8KB 3LSGA 1JKQC 3I58A 4KDPA 3BJ6A 4N9HA 1WJBA 2CUJA 4EV0A 2FNPA 5J4YA 1I1SA 4UV8A 2NNNA 2AXLA 1S29A 3ROUA 2BW3B 1LDKB 1YW7A 1ETOA 4ESJA 1R1TA 3VPRA 3CDLA 5B3SH 1IZ1A 4PJNA 5LGNA 1YG2A 5K7FA 1I6XA 3U1KA 2DI3A 2YSRA 4F3QA 3OV8A 4XRFA 3KEQA 4YFXF 5DV5A 1KU3A 1DPUA 3W3CA 2XSDC 3ABMH 1FMVA 1QU3A 1KU9A 3MZYA 3A03A 2HVQA 5DTDA 1LVKA 1X3WB 2NS7A 1SD7A 3FMRA 2QQAA 1X4OA 3JTGA 4WXDA 3S15J 2HEOA 2MC3A 4EJTA 3HRUA 1YS7A 3CCYA 3DF8A 1WI3A 2ZJQF 1WRJA 5FGMA 1JT6A 5F27A 3TMOA 1JKPC 1U6GA 3SXYA 4WX9A 4C30A 5HLHA 2PN6A 3HPGA 4XQFA 3GTQJ 1ONVA 5CVUA 4HF1A 1NG6A 4MTEA 4EJVA 2V6EA 5FKLA 2DT7B 4M9SA 4BS9A 1USTA 2QWWA 1YW8A 4XM3A 3ZQGA 3RQIA 2VODA 3TBIA 1FEXA 1FOXA 4HV6A 1X1CA 1CF7B 4L0YB 3K70C 3BY6A 2XGXA 1HW2A 1YJWI 2XIGA 2DOFA 2W24A 4MNUA 4F7ZA 3AG1H 3ASOH 4D0PA 4AVZA 2FBKA 2OV7A 4NB5A 3FBNB 1HXDA 2XPVA 1I39A 1D1AA 4RS8A 3K0LA 5FKNA 4UUSA 3HOUJ 2K02A 2W84A 4UHTA 3T1BA 5K1YA 4HAMA 1ZQ3P 2RC4A 3BTJA 1HW1A 3K1PA 2V6CA 2CV2A 3DTIA 4BDZA 2X4HA 4EVIA 3KLNA 3CMEI 3SFZA 3VDXA 2CUZA 1K4SA 2LKSA 2F5DA 1UMQA 2OQGA 1MBEA 2JZYA 5FB2A 3U21A 3RKQA 3E3VA 4A5MA 2R7DA 1T33A 1H9TA 1W4MA 1ZLJA 1Z05A 4PFOA 2DYRH 2FA5A 5J1YA 2D1HA 1WGXA 3RDIA 3WG9A 3ELKA 3HUGB 4Y13A 1U8RA 2VC0A 2DN0A 3KLOA 2R5YB 3R6SA 4F52A 2VQGA 3ECHA 5LBQA 3CC2I 4HDUA 2HOAA 3SZTA 2P81A 5L3CA 4CXFA 3M1EA 2XAQA 2N8GA 2KIQA 5HS9A 3KZIC 1OISA 1DP7P 1HQCA 1YX3A 5GAEJ 2R3SA 1Z3YA 3TEDA 2ISZA 2W1OA 5LHIA 2XV4S 3A0HC 2WAQN 5H6QA 2MSYA 4KMFA 4S04A 3BR0A 3H1CA 1YRNB 3ZMSA 1ZYRF 3TW7A 3RPQA 1SANA 4N4OB 3GW2A 4Q4ZF 1SMYF 3ZMVA 2HS5A 5ICGA 3CO7C 4HPQA 1JGGA 4PDKA 3OIQA 4B1RA 2OPTA 4P55A 2EIKH 3K9TA 5FJ8J 4FCYA 5EG0A 1XPXA 2HTJA 1VFCA 3U2RA 3W2VA 2NYXA 1W7PB 1QZZA 1IF1A 1VQNI 5K5RA 1VQMI 3IH3A 3OYGA 2M2EA 4NDLA 3K1MA 3G3ZA 4WF2A 4I98B 4OAYA 4MQ9F 3WE3A 3K69A 4EM2A 2R7XA 2IBDA 1PUFB 3KP3A 4XSZF 4HRIA 1YJNI 2EB7A 4C3JJ 2Y2ZA 2IEKA 3VB2A 4LOCA 1HDDC 1D8KA 3ZP5A 2E34A 2PX9A 1VQOI 3I4MJ 1ULYA 1WJEA 1VF9A 3BOQA 3FMQA 3GWZA 3CCLI 1XN7A 4XLHA 3ABKH 1ITYA 2JUGA 3OYJA 1IN8A 1QHHD 3FISA 2DOAA 3WTWC 2ECBA 3OR2C 4PGHA 2Q8KA 3PFYA 5EEHA 2HYJA 3P5JA 4D7NA 5GADJ 4JYKA 1R5HA 4N0BA 1E3HA 1MIJA 2LKPA 3TGNA 2P6TA 1MZBA 2MLGA 1U9OA 3EUKL 4WWCA 2Z9OA 1MMSA 2DA7A 5JVTA 1TQPA 3BTLA 2K3PA 1G3SA 4Q48A 4NC8A 1FJLA 5ICFA 4E7LA 3RCOA 2VOPA 5FRNA 2H09A 1U2WA 4P1WA 5JHFA 1Z0XA 3M8EA 3V42A 1W0TA 3LA3A 2ZJRF 2BE5F 3I56I 4F91B 4R79A 2F5FA 3U9GA 1T8IA 5FLXK 2DA4A 3CJRB 2WWYA 2RVCA 5IP6A 3C7JA 3M7GA 1T0FA 1RR7A 2L9VA 2ZFUA 3PQJA 1D1BA 5FRMA 1XDSA 2Q0OA 3GBGA 4YG2F 2EA4A 5C44J 1OCZH 3GTKJ 3PFIA 5E79C 1R6RA 2R7WA 4G94A 4RAZA 4UUVA 3Q9SA 1A04A 3IL2A 4HNUA 3LMMA 4HDVA 1SFXA 1XGMA 4JX4A 4BXXJ 2VT2A 3O2PE 2OD5A 4L5JA 2MLKA 5F1JA 4JOMA 1ZG3A 2QKMB 2EV5A 3DKYA 1IXCA 3PJRA 3CUOA 1CQTA 2LY2A 5IT9Z 1F1ZA 2EFWA 1MNDA 2LRDA 1EA3A 1UHWA 4XR6A 3EUAA 3G1MA 3FK6A 2FOWA 5CVIA 1P4AA 5F64A 5JR3A 1XGOA 2OU2A 1L3LA 3IRRA 1XS9A 5ICCA 4U0YA 1I6HJ 3H5NA 5M5YJ 4H0EA 4II2A 3KIOA 4EJOA 4B47A 2XAJA 4ZDLA 2QYOA 4Z6YA 2X9DA 1BBYA 2V1XA 2NVUB 1IRFA 2RAEA 2FBHA 1WQ2A 3QU6A 5DDGA 3S2HJ 3GTPJ 4CCOA 2L9SA 2IPQX 3D5RC 1T95A 1E0EA 4D5CA 2BY3A 2VQLA 3KP6A 2DO7A 2IRFG 1OPCA 1MH4A 4A0YA 1K78B 4UNOA 1GLNA 1BJZA 4A3IJ 2V1UA 5CVRA 2HXOA 1YITI 5DCFA 3SEQA 4BBRJ 3QOPA 4LIUA 2V9VA 4PJ0C 4NNJA 4DZJA 1IG7A 2G0EA 1U5TB 2VXZA 3BJOA 2K3FA 4E7HA 3H9QA 1S9HA 3E97A 2LREA 3DEUA 3GZ6A 3F9KA 2C6YA 1QA6A 3EUHA 5HDKA 1R9TJ 5E8IA 3MZHA 1MMNA 2CWEA 1RUNA 5D5WB 5J8CA 1B4AA 1TLHB 4BH9A 2KRCA 3OYLA 4RM3A 1JT0A 2BW3A 2W82A 3B6CA 3NQOA 4U0VA 2XAFA 5K5OA 2LSOA 3V4GA 4BYYA 4IRGA 5ERIA 5J1RA 3ZMUA 2VKHA 3OYNA 5IT3A 3VWBA 1S7OA 1YYVA 2EQRA 1GVDA 5GAHJ 1G2HA 4WXCA 2DT6A 4GGGA 3LNQA 3MCZA 4Y33A 4ZZLA 2H1LA 3MEXA 4J01A 4IHVA 1G3YA 3ECOA 4U87A 1X1BA 1JJ6C 1BR2A 1I5ZA 4PZJA 3HBLA 2ETHA 3CUQC 4YIFA 4QTRA 2K86A 3F0CA 2CS3A 3CCQI 2KZGA 2E7XA 3T8TA 3ZGKA 3REOA 3OYHA 2VPLA 2E7WA 3RYRA 3K4JA 4IHTA 3CC4I 4S0HB 3H9GA 2M0CA 4FE4A 5HLTA 5E3MA 2LD5A 1VQ5I 5KNLA 1VNDA 2LY9A 4BDYA 2L7MP 3FKJA 1FMWA 1ZK8A 1BL0A 2L9RA 3MFKA 1KONA 1WZ2A 2WAQA 3OYDA 2X6OA 2EPFA 2X6WA 3OYCA 1J7KA 1B9NA 1YTYA 2HKXA 3IWZA 4B4CA 3OYMA 2K4BA 2UZKA 1A36A 1YW9A 2NVXJ 2HI3A 4S05A 1FSHA 4B3AA 2M3AA 3RJPA 1MBKA 3S3MA 3HOZJ 4IOCF 3L2RA 1BR1A 2XKOA 4U7BA 5HVQC 2DFIA 1FIPA 1KGSA 1WI9A 3HPHA 5HLGA 1ETYA 2JPCA 4O3MA 4Y52J 1RC9A 5TJJA 2KFDA 4MFDA 3BZ6A 3J7AY 3G2BA 1YLFA 3RQ4A 1B6AA 4HF0A 3HXLA 2WADA 2MFZA 2L01A 1FYLA 3GYHX 1M1EB 2MA3A 3QPLA 5D6FA 1W36D 2K27A 2COBA 4FX4A 4ASNA 5F6FA 1ZARA 1JXSA 2CUEA 4CH7A 5ED4A 1TT0A 3F8FA 1L0OC 4YFKF 4KISA 3K4BA 1R4NB 4AIJA 4FT8A 4FHTA 3BWGA 2YU3A 3Q0WA 2ZBKA 4F93B 5EGOB 2R5YA 4I09A 3ZR8X 4CO8A 2OCEA 2JJ7A 4OIRF 4A2UA 1H0MA 2HDDA 3RPUA 4WCGA 4M6VA 2CFOA 2LBFA 1RETA 4AM3A 3Q5FA 1DQUA 1JUPA 2JSCA 3K4KA 2BHYA 3RYPA 5LLQA 3FM5A 2V9KA 5FD6A 3WTVC 4QLCU 3DEEA 2R7OA 2QVOA 2ZJ2A 3CP8A 2R7SA 1WHUA 5IT9K 2ECCA 1BI1A 4V2GA 3FXLA 3MVPA 3Q3SA 2EZHA 3TOAA 5KCMA 1SFOJ 3F72A 1YRNA 1WJAA 2DA1A 2M87A 5KVRA 2W85A 4MEYF 4E7IA 4M3DA 3MKZA 3F8BA 3TDUC 3S8PA 1OQYA 4G12A 4EQQA 1MMDA 1O4XA 1HDPA 1WH7A 2P7VB 4BQAA 1SEUA 4A69C 2Z16A 2JQ7A 4G7OF 1ERDA 3ZQLA 3BCBA 4GYGA 3NWSA 2VJ4A 2WB1N 1EV7A 2M4GA 4MIMA 1ZG5A 2D5VA 3CO6C 3WGGA 1XGSA 1WFXA 4RB0A 4WXHA 4GXOA 1QVUA 1G59A 3H92A 5AIQA 3R4KA 3ZMTA 2BEOA 3JSOA 1JUSA 2L7ZA 1D0ZA 4LGWA 4KYWA 4A5NA 2KMUA 2Y30A 4L0ZB 1FTTA 2YS9A 2HQ5A 4PUSA 5J47A 1PUFA 1IDYA 1BI3A 4RAGA 3F6OA 5LGTA 1OFCX 1XX5A 1FP2A 1WH5A 5IYCJ 3V8JA 2RNJA 3F6VA 3GZNB 4ZTJA 5DM7F 2PEXA 3K2AA 2E1MB 3CMMA 2VJJA 2JA7J 2A69F 3EUHC 2XKPA 1Q1HA 2TCTA 2FEZA 2NS0A 2P0WA 1K7AA 1UG0A 2H94A 2ELJA 3TQNA 1FNNA 2VIXA 3IWFA 1JHHA 4RGXA 2KLOA 3RKWA 2HWVA 4LG0B 3I59B 2QSGX 2KKOA 2OF7A 1A5JA 2DMNA 2R7ZJ 3GFJA 4BXFA 1BM9A 4JK1X 1QNTA 4FX0A 3V8LA 2QA4I 5FKKA 3D5LA 1KYWA 4A3LJ 1QVTA 2OZUA 3HG9A 5H20A 2LKXA 1C0WA 4G6DA 2O6GE 1I50J 4JX6A 2GLOA 4P9FA 5HOOA 5LD2C 1IXRC 4R8HA 2IJLA 1LFUP 4BKXA 3JTHA 3WTYC 2HVRA 2NVTJ 4Y17A 4A6DA 5B66C 1TL8A 5A2QZ 3LSPA 2ZXHA 1P7JA 4ZYEA 1SD4A 1J59A 4Y15A 3FBIB 2DMQA 4ZYAA 3ZQIA 4BEHA 3ZN0A 4W1UA 1T98A 2XPWA 2M8EA 4LMYA 4NBQA 1Y0UA 4X1EA 2ISYA 3MWMA 3DQVC 3KEYA 2BY1A 2MD5A 2LH9A 3FWEA 4HNTA 4BQQA 4U88A 1I1GA 2QSHX 2XAUA 4GYIA 2NRAC 4KIBA 4XRSA 4CYDA 1SC7A 2QBYB 1MMAA 4L5EA 3VYRB 4JQFA 5GAGJ 3VEPA 3HSRA 1IV8A 5D5UB 3QP5A 2OJED 2PBIA 3C18A 4LJZF 2E60A 1LE8A 3OS1A 2RN7A 2HZTA 2KP6A 2O03A 2ZXJA 3W2WA 5CYVA 4KN7X 2CU7A 3JW4A 1RKTA 3JREA 1LPQA 2F2EA 4WK8F 4OAZA 3WE2A 4KIGA 2NNYA 4ESFA 2R7UA 4D1QA 2XUBA 3E6CC 4IXAA 3WTSC 1NH3A 2DDAA 1XMAA 1ETKA 3WHCA 5M5XJ 1NTCA 4XICA 4XSXF 2W7NA 1BOBA 3OIPA 1W5SA 2OCCH 5LFAA 1OKRA 4KIFA 3JRIA 3UKGA 2VKDA 3OSGA 1IV6A 1Z7LA 5DD8A 2V9PA 4P96A 3CLOA 4A3EJ 1Y1VJ 1YQAA 2CMPA 3LL7A 1BC7C 3C3WA 4XKBA 4FE7A 1K78A 1HW5A 1D1CA 2EBIA 3PNTA 2QZ8A 3FXUA 1OR7C 3M9AA 3JCUC 3RSNA 2HVSA 4A3JJ 1FX7A 1G6NA 2DBBA 4XKVA 3W2AA 2EFPA 3MKYB 2VXDA 1U5TA 4C9YA 1JJ8C 4ETSA 2ZC2A 4FETA 1TQIA 2R7VA 1P4WA 3DPUA 2CJJA 2RQPA 4JP0A 2ZNYA 1QRYA 3ZQ7A 5D8LB 3CMAI 1HBXG 1ETQA 3B02A 2H6BA 1OMIA 2IW5A 4W97A 2L02A 2JA6J 2FRHA 2BOLA 4KA4A 4I01A 4OU0A 2KRFA 5L3BA 2PJPA 2ZKZA 4BUPA 2BVLA 3L2UA 1XCVA 5FKMA 2VBXA 3FXMA 4FTHA 3I5UA 5ILSA 5DUIA 1W5CC 3QP6A 3L09A 4DNCA 3E6DA 4EATA 3SJMA 3LAPA 2X51A 4D7MA 2DJIA 4PSXA 3I3LA 1ZGAA 2LF8A 1FP1D 1F36A 1NG7A 4IHYA 1Z1DA 2EV6A 1W0UA 1IAWA 2DFEA 2MG4A 2VKEA 3AG2H 4YRVA 1R23A 1LB2A 1R71A 3F8CA 4KNYA 2KIMA 1UHMA 1X3UA 4E7ZA 2ADUA 3BDDA 3GF2A 1F43A 2CQQA 3G6EI 1BIAA 4IL6C 1YIJI 4XLCA 2Z5UA 2VI6A 2VUMJ 1QO0D 2XAGA 4XOPA 1YFHA 2XGEA 4G7HF 2GA2A 3VYSB 2STTA 5EZGA 3C2GA 5ILVA 2VJIA 1O57A 4GO1A 4Q47A 4XN0A 2ACJA 3JRGA 2UXNA 4XRMA 4I2OA 5BNGA 2FF4A 3S3OA 1FYKA 2OZ6A 3HRTA 1O3SA 2BXYA 2A07F 5M3FJ 3GEZA 2F5VA 2E1OA 1N77A 3ZXSA 1LEAA 2KHMA 3SHFA 2NAZA 2WB1A 3E0JB 5CPRB 1EH8A 2VKVA 4RBOA 2IA1A 1V5GA 2IGKA 3S17J 1K6YA 2H6CA 3SFIA 2P5LC 2FJ1A 2ELKA 4PCQA 2YPRA 4CHUA 2M7BA 1Z6RA 3KZZA 1O3TA 4DGWB 3BZKA 2Q2EB 1MMGA 3JRAA 3CUQA 4RB2C 1YIOA 3K4NA 3SDGA 2LLKA 4PSWA 4Y3OA 1A35A 3DCFA 1MDMA 3NAUA 5IP7J 4IKFA 5EGOA 2LDUA 4RGRA 1Z77A 2O8XA 2Y9ZA 3A4CA 4ABZA 5F04A 2RNGA 3ABLH 3Q0VA 4ZYHA 2H8RA 1YE9A 1RI7A 5E18F 2K9MA 2Q1ZB 2XRNA 2L4MA 3RZOJ 2RQQA 3K10A 2EZKA 1I3AA 3CCSI 2Z1DA 2J5PA 1P7IA 1W5TA 2DA6A 2LVSA 3MAJA 3O8HA 4O5VA 3JAMK 1GT0C 3DPTA 2DAOA 3RIRA 4B44A 3IP4B 3DLAA 3CCEI 3H3VK 2DTZA 1MBJA 1J9IA 3PQKA 2FE3A 2DOEA 4CCNA 5IOYA 5EEAA 2CFXA 1JKRC 2LR8A 3I55I 2DODA 4C3IJ 2YU9J 2F48A 2HOTA 4KUMA 3ABTA 4AUXA 3V8KA 3OWTA 3Q0UA 4RAFA 3BT9A 5KK1A 1GHCA 1S8NA 4UB8C 1B8IB 2TRTA 2F4IA 2DJNA 1TW2A 3D0SA 1A6QA 1HC8A 2L0KA 4ZDPA 1T6SA 1OCCH 5J40A 2CO5A 4AC0A 2B0LA 4A0XA 1QZYA 2LFBA 5DD4A 5FROA 1WPKA 1IRXA 2HNHA 2V1DA 3RI4A 2E2JJ 2PJRA 3ULQB 4RB3C 3HOTA 1Z6TA 2OBPA 4KT5C 1MBGA 3QYBA 4DW6A 2JRMA 3PNVA 4HBLA 3ZQQA 5KAFC 1A31A 3QOEA 1U5TC 2PG4A 5GTHC 3ZN1A 2PMHA 4LITA 4RGSA 4G6TB 3E5QA 3J81Z 1F9NA 1X4PA 3JSPA 2FMLA 5HS8A 5K7HA 1UELB 4UY8I 3NEUA 3CZ6A 1V5EA 2MD0A 4LG0A 4I6ZA 2I5UA 5EF6A 4AIKA 5DCMB 1RPWA 2HYGD 5JLWA 4CYCA 2A3SA 2IGOA 2VASA 2EIJH 4X6AJ 1WJ5A 4XLFA 3KZYA 2ZJPF 1R1UA 3FF5A 3ERMA 4G6QA 4HNVA 1K83J 3BCAA 3TDZC 5HLIA 3TOBA 1WSUA 4IOAF 3G4SI 1IN6A 4LB6B 1MJ9A 1IRGA 4EGZA 3QPHA 3OIOA 1PDNC 2PI0A 3F22A 2WBMA 2ESHA 4YFNF 1BA5A 3HOSA 4CCLA 1IUFA 3L00A 3KP2A 4CZZA 4HLYA 1EH6A 2E71A 3ZMDA 2QBYA 2X1EA 5IYBJ 2K4JA 3HYIA 1HF0A 1QBJA 4PJJA 2LY1A 4OWRB 1QPMA 2P5VA 2VBZA 4P9UA 2CGPA 1OYIA 3EQLF 2L7FP 3HRMA 5EYRA 4EMSA 4ZZDA 5HNHA 1WKMA 2CQ7A 1O3QA 2M5WA 5E3LA 1DP3A 2BBYA 1V3FA 3N4MA 2IGMA 1G4DA 3HDDA 2HU9A 2A6HF 4IHSA 3GUDA 1BI2A 3GZ5A 5L3FA 3HGGA 1VZ0A 4A3CJ 2R7QA 4LLNA 6PAXA 3JRBA 3S3NA 2TDXA 1E17A 3FHZA 1OYWA 4DOZA 3ISPA 3TO9A 5BS6A 4IQ4A 4Q5SF 1Z91A 3BLYA 3PSFA 4KFCA 4GDFA 2O7OA 5K5QA 1SMTA 3OMYA 2QQ8A 4L5IA 5EDNA 2G9WA 1X1PA 1FBQA 1UZCA 3HSEA 2ZSIB 1IC8A 4FISA 1S72I 4G8XA 2PMUA 2EV0A 5L3GA 2J5OA 2YR2A 1OCPA 1Y56A 1LUJB 4IQJA 1XD7A 2HPIA 3TO7A 2OTLI 3N05A 3CCJI 2V26A 4DZPA 2XRLA 3BJAA 4EEFG 3SEZA 2K85A 2JWTA 1RIOH 3H9JA 2A05A 4Y4RA 1EKEA 4MQVA 4KJZA 2LG4A 4BE1A 1YJ9I 3CJTB 2K40A 4UUSB 2W00A 4QPOA 1B1BA 3DV8A 2E35A 3HC7A 1JKOC 1VQ4I 2HZDA 4XORA 1XB4A 4M71A 4CA0A 3LA2A 4D5FA 4CUGA 2QCOA 1J0RA 3HTUA 1KU7A 1QPIA 3RKYA 1CF7A 4OINF 1FZPB 4L9JA 2X0LA 2ID6A 5D5VB 1V54H 3BG7A 2FBIA 3FXRA 3LSRA 3MKLA 3EYIA 4MLOA 4HG2A 2NOJB 2H1KA 3FMSA 3CP2A 5E3NA 2JVGA 4N4NB 3LSIA 2VPRA 3JR9A 3DWLE 1JGSA 4IEJA 5JFRA 1ZRFA 2RKHA 3T5XA 3OSFA 2D1VA 2KDOA 1J5YA 4B48A 3PIOF 3CJNA 3I54A 1FLIA 4E7KA 3OL3A 1VQ8I 4E4HA 1SFKA 2RV8A 2PMZN 5D4SA 3M4OJ 1QHGA 1Y39A 1UJ8A 2VC1A 1E2XA 2YUSA 2HDWA 1R1VA 4MTDA 2XSJC 3GFLA 2XC7A 1AWCA 5H6RA 3J7AO 1OR7A 4A93J 5AONA 2M0MA 5L3EA 2CV0A 2HOSA 1QQIA 5FLVA 2H27A 4AWXB 3GTLJ 1GXPA 3P9CA 1JTYA 3HUGA 3EETA 4LK1F 3IKTA 3WGIA 3BG5A 3V7SA 4UXNA 2DA2A 2O0YA 3M8FA 1ORKA 2XF5A 4GFBA 2E1MC 3J81K 4BHBA 4HSRA 1X1AA 2MBFA 4J19A 3H5RA 3ESWB 3ML6A 5GPCA 3O3KA 2XB5A 4E6KG 2BYVE 2GXBA 2ZCWA 1HKTA 3GTMJ 1AKHB 4M74A 2Z3YA 3DEWA 1SFUA 3OYEA 1S5LC 4HSTA 2Z2SB 3QWLA 1WCMJ 2E2IJ 2NXNB 3HZJA 1TBXA 3FX3A 1F4KA 3JRFA 3TO6A 3WTUC 1H89C 3LFUA 3N97A 5HDGA 2IXSA 3GTJJ 3LSTA 1FBSA 1MGTA 1YHQI 3LSMA 2UUZA 2Q2EA 2D45A 4ZDOA 5E17F 4N9IA 1Z9CA 1Z3XA 2FOKA 2EFOA 5JHUA 1W7PA 4M73A 2XGCA 3FXOA 2FU4A 3D5SC 3RKXA 5BPIA 1MBHA 3JRDA 4DBRA 1RZ4A 4B8XA 1SFEA 2L7KA 5HODA 3BR1A 4MEXF 4XOTA 2FXAA 4HOBA 1DPRA 1Z67A 3WTZA 2LK2A 3TKYA 1HKQA 3F23A 4A0ZA 1TW3A 1J09A 2CUFA 1ZRDA 3S2DJ 4F92B 2AO9A 3QYFA 4ITVA 2VBWA 2M1BA 3KFWX 2E36A 1OCOH 4MFEA 3SQNA 2I10A 4EGYA 2XASA 1G8XA 2V4JC 3BROA 3K70D 3J7ZI 1FPQA 1AHDP 1PP7U 3C1DA 1D5YA 2WA0A 2GQQA 3CCVI 1RR8C 4EM0B 2ICWG 4HQEA 2X48A 3CMYA 2JUCA 5E1XA 4IVNA 3MQ0A 3BP8A 1N78A 1ZH5A 3IC7A 4CCMA 3PO2J 2KQRA 4L9VA 1WVRA 1BJAA 4EJWA 9ANTA 2QUFA 3GXOA 2GXGA 1FSEA 3PIPF 1B8IA 2JVHA 3BTIA 2R5ZB 3BPVA 3G73A 3LWFA 3GLXA 1V4RA 3CD6I 4KN4X 2CRGA 2HQNA 2YX4A 4BHPA 3P7NA 4KITB 1P2FA 2RDPA 4BXUA 2CQKA 3CESA 4RM2A 5AIPA 1MD0A 2O9LA 2XB0X 3KX2A 2X6XA 5LHGA 3L2WA 3BG9A 1YS6A 4A3MJ 3IH4A 1LQ1A 3S32A 2DTRA 1SAUA 1HA8A 3FHNA 3A0BC 3GVAA 4M3EA 4UUTA 3S1RJ 2PLYA 5LRSA 1TWAJ 2H8WA 2DLLA 2DQRA 2RREA 4QWQA 1U0JA 1X3ZB 1T39A 1U3EM 5IPAA 3O8GA 2UXXA 2L9NA 1EF4A 1USSA 2UV1A 1F5TA 1ZGJA 2HYFA 3EYYA 1LFPA 3CF5F 3H35A 4NUBA 2GBYA 3D1NI 2JT1A 3OS2A 2Z33A 2R0QC 4AU7A 1K79A 1LFBA 3S1NJ 3LSHA 2DW4A 2FSWA 4RB1A 3OYBA 4RA2A 4XLAA 2X1CA 3W6KB 1KQ8A 3HM5A 1MSFC 1FBUA 2B7EA 4M6YA 1W36C 1VQKI 2AQEA 3J80Z 3S93A 1K6OA 2AS5F 1NK2P 1YI2I 1ZG1A 3X2QH 3HEFA 2GWRA 3PNYA 5HDNA 4OIOF 2NVQJ 3LSJA 4KMUX 2EFQA 4AYBN 4E7SA 1FWZA 3OL4A 4M9ZA 3LAJA 2LNBA 2EINH 2FNAA 5J1UA 2FQ4A 4XLNF 4DQ2A 2HR3A 3L2VA 5EEGA 2MABA 2WTEA 4LB5A 3C2HA 4HLXA 3F21A 5EJCA 1ETXA 3KYDB 5K7ZA 3WHBA 2F5EA 5E20A 3BR2A 3P9KA 1EJ9A 2BV6A 2K9SA 2VN2A 1BI0A 3HHHA 1TWHJ 2LTPA 1BC8C 2GIZA 1G3TA 2A6EF 5B5EC 5DS9A 3G71I 3G1LA 2F4MB 3IAS2 4XKWA 5BPDA 2R92J 4ZYGA 2HPMA 4OIPF 1ZELA 2ZO4A 1SD5A 4UVCA 1QGPA 3QU3A 1GV2A 1JHFA 1LDJA 1TWGJ 1ZTRA 1I3QJ 1O7LA 2M30A 1DU6A 1J2XA 5C3EJ 4BHCA 3H3ZA 3K6GA 4I0BA 2A68F 2XHKA 2EFNA 1D3YA 5ILUA 2PFBA 4YEJA 5J8FA 2IAIA 4M3GA 1FOYA 2VL8A 4FQGA 5FLXZ 5FFXA 1LVAA 1AA7A 3DBHB 2XPUA 3OR1C 1IRZA 2K9QA 3WU1B 4OMYA 1TC3C 3AL0B 2V7FA 3ZPLA 2PMZA 1P4XA 2HTSA 3I64A 5H2FC 1WJCA 1TNTA 2F4OB 1Y6IA 3I71A 2L3DA 4UV9A 3FXQA 3ZQCA 1GVJA 2WV1A 5D6EA 2Y0SN 2E1NA 3MD2A 1VI0A 5LEKA 2GM4A 1ZRCA 4P5OA 3K4LA 1MKMA 2CQXA 2LMDA 4XL9A 2ID3A 3DKWA 3R61A 4AD9A 4IZZA 3ONQA 4ESBA 4XONA 4R1HA 2A5YB 4IRHA 2M7AA 3ERED 3AFHA 3S1MJ 4A3KJ 3VYUB 2L54A 1DGWY 1XGNA 4NQWB 3IRQA 2ME0A 2Y31A 3C2BA 1FY7A 1H9GA 5LGUA 5LEJA 3R60A 2COMA 2HDCA 1FT9A 4JBAA 1G3WA 1S7EA 2MH2A 5HS7A 1O3RA 1K4TA 2GZWA 4DJAA 4L18B 4OOIA 4YIIA 1R58A 2XDVA 3DFGA 2JPBA 3M8JA 2R4GA 2DMUA 1TTYA 2IS2A 2HFHA 2E1CA 1VQ9I 4IHWA 2IGNA 4FASD 3LOCA 3PSIA 3I4NJ 4I7HA 2GA1A 5FD5A 3GFMA 1FOKA 3QAHA 3DBRB 2EJRA 2GOMA 5TISC 2FX0A 4C2TA 2KZVA 4I99C 4NC6A 2ZMEC 5CQEA 2QENA 3DPLC 4HF2A 4IRIA 2O3FA 3H5AA 1SAXA 1UHSA 3TL4X 2DPDA 4BL0B 5DYMA 1B9MA 3QQAA 3IUOA 5M3MJ 3EPZA 1MBFA 1S7AA 4ENKA 4BNCA 3I9V2 3R0JA 3ABUA 4LIVA 3FXJA 1GXQA 3OYAA 1ZR2A 3LA7A 1J75A 3CDIA 2BZTA 1MJBA 4BJ5C 1IN7A 4B43A 2BY2A 1S6LA 4Y7NJ 3PUBA 3MKWB 2CV1A 1X2MA 5CQGA 4QPQA 1ETWA 3BR6A 3K4MA 1DGRM 4OMZA 3SDBA 3GCMA 4V2FA 2LBFB 3ZOBA 3FDYA 3K7AJ 4M6XA 3GMEA 3BQYA 2G7UA 2LOOA 2VLAA 5A2QK 3LFKA 4XLPF 4HX8A 2MGQA 2RGVA 2W57A 1Y1WJ 1XTAA 3HIFA 5FFZA 2DK8A 3CJQB 2EA2A
chains in the Genus database with same CATH topology
3E6BA 4HX4A 3VOEA 4Z2YA 2GAUA 4A6EA 1UCRA 4IF4A 2PQ8A 3I53A 3E6MA 3WTXC 1R22A 4HZFA 1ZAOA 4RGUA 4L9NA 3K2ZA 5L3DA 1ZN2A 3CDHA 5FO5A 2JTVA 1OYYA 3AAFA 3WTTC 3L9FA 3J80K 4M72A 2ZMEB 2OA4A 3VODA 2QM3A 3B73A 5LHHA 1DDNA 3U1DA 1D5VA 1R36A 2ZFWA 2ZNZA 5BMZA 2HKOA 4E70A 2R7FA 3WODF 1LEBA 3KP7A 4BAYA 4CDGA 1HSTA 4HW0A 2K7LA 1IUYA 4ZH4F 3F8NA 2UWMA 1KA8A 1ON1A 3COAC 1FC3A 2L4AA 3K1NA 1DUXC 2CYYA 2FQ3A 4G7ZF 3FZVA 2P4WA 3KP5A 3KE2A 1T2KA 1PP8F 2G7HA 4UVAA 5JI6A 2WV0A 3I59A 4LLLA 2XVCA 3NRVA 4EJUA 4HX7A 3CTAA 4HQMA 4G9YA 3KETA 4ENJA 2IA0A 3E5XA 2VE9A 4U0WA 1P92A 3R0AA 1WWXA 4OIQF 2XROA 5E1ZB 3KCCA 1IXSB 4HYEA 2D2WA 5D5XB 2W25A 4ON0A 2O61A 1UB9A 2MH9A 2DU9A 3I4PA 5BQTA 3QRFF 1KQ9A 1BIBA 2ELHA 4IPAA 1P6RA 2EK5A 2CSOA 5E1WA 4ENMA 1NHAA 4I02A 1KQ0A 1T38A 4AIHA 2JRTA 1B59A 3QPTA 1LJ9A 3GX4X 3GFIA 2Z99A 4GCVA 2F5CA 2DPUA 2IVMA 1HKSA 5CLSA 2VT3A 2STWA 1HSJA 5D4RA 5CVJA 4ENNA 4K2EA 4O6JA 1MJAA 3LQRA 2FMYA 5DEQA 2KIUA 2KJCA 2KIFA 4A12A 2QQ9A 2CG4A 3T0YA 2HGCA 1KU2A 5BOXA 2OAZA 2QQBA 4IJAA 1R7JA 2M45A 1STZA 4PGGA 4M9XA 2WC2A 4KICA 3DP7A 1XDUA 1BN5A 2Y0MA 3WU0A 4LD5A 3EDPA 5CVVA 3DXJF 3RTRA 1ON2A 2XAHA 1KYZA 4AVPA 1XSVA 4NQWA 5TRDA 1CGPA 2IA2A 2ESNA 1XMKA 2IP2A 2P7CB 3IKVA 3LQQA 3FM3A 3SZPA 1IN4A 3OOPA 1IN5A 4U7DA 1R5GA 1EH7A 1R00A 2DK5A 4MHGA 1S3JA 3CUQB 1LNWA 3L7WA 2QLZA 1MDMB 1AOYA 3H3UA 4L9TA 2IT0A 3HHGA 5ICEA 1D8JA 4CGZA 4UVBA 1YO5C 4I0AA 5J6XA 4LK0F 4ZYDA 2VOOA 5CJ9A 4RAYA 2EWNA 4EM1A 1PUEE 3V7CA 1ZHFA 3KEOA 1REPC 4LFUA 5F1RA 2LF7A 3P9IA 2P8TA 3GO5A 3WGHA 5LRRA 4HV5A 2Y75A 1XSDA 4MGRA 2HQRA 3ZMZA 1ZLKA 2ZMEA 2VONA 2V79A 2OQRA 3KP4A 2DT5A 4TV7A 1I27A 3W6JB 3HSFA 1BOAA 1O7FA 1W7PD 1IW7F 2Y48A 3Q9VA 1XCBA 1UFMA 3L2CA 2P5KA 2HOEA 2VBYA 4B09A 1JE8A 3S2WA 1TNSA 3O6BB 2KJBA 3I0TA 1SD6A 2A61A 4CICA 2DQLA 1LDDA 5E8GA 3T8RA 2YX7A 1Z7UA 3HTSB 1TQMA 3E5UA 4LLGF 3V7RA 5DCMA 1RUOA 3VFZA 3F3XA 2P6SA 3IHUA 1XSXA 5DUKA 1VTNC 3F8MA 1RNLA 3BPXA 3HRSA 3JAMZ 4NHJA 4HA8A 1U78A 4XBFA 2GIVA 1ZREA 2CW0F 1FYMA 2VE8A 2BGCA 1ODDA 5D8KB 3I58A 4KDPA 3BJ6A 4N9HA 4EV0A 2FNPA 1I1SA 4UV8A 2NNNA 2AXLA 1S29A 3ROUA 1LDKB 1YW7A 4ESJA 1R1TA 1IZ1A 5LGNA 1YG2A 1I6XA 2DI3A 2YSRA 3OV8A 4XRFA 3KEQA 4YFXF 5DV5A 1KU3A 1DPUA 1KU9A 3MZYA 1SD7A 3FMRA 2QQAA 3JTGA 4WXDA 2HEOA 2MC3A 4EJTA 3HRUA 1YS7A 3DF8A 1WRJA 5FGMA 1U6GA 3SXYA 4WX9A 5HLHA 2PN6A 1ONVA 5CVUA 4HF1A 4MTEA 4EJVA 4M9SA 1USTA 2QWWA 1YW8A 2VODA 4HV6A 1CF7B 4L0YB 3BY6A 2XGXA 1HW2A 2XIGA 2W24A 4MNUA 4F7ZA 4D0PA 2FBKA 4NB5A 1HXDA 4RS8A 3K0LA 2K02A 2W84A 4UHTA 3T1BA 5K1YA 4HAMA 2RC4A 1HW1A 3K1PA 2V6CA 2X4HA 4EVIA 3KLNA 3SFZA 2F5DA 2OQGA 2JZYA 5FB2A 3E3VA 4A5MA 2R7DA 1H9TA 1W4MA 1ZLJA 1Z05A 2FA5A 2D1HA 3RDIA 3WG9A 3ELKA 4Y13A 1U8RA 2VC0A 3KLOA 3R6SA 3ECHA 5LBQA 4HDUA 3SZTA 5L3CA 4CXFA 3M1EA 2XAQA 5HS9A 1DP7P 1HQCA 2R3SA 2ISZA 5LHIA 2XV4S 5H6QA 4KMFA 4S04A 3ZMSA 1ZYRF 3RPQA 3GW2A 4Q4ZF 1SMYF 3ZMVA 2HS5A 5ICGA 3CO7C 4PDKA 4P55A 3K9TA 2HTJA 3U2RA 2NYXA 1W7PB 1QZZA 1IF1A 5K5RA 3K1MA 3G3ZA 4WF2A 4I98B 4MQ9F 3WE3A 3K69A 4EM2A 3KP3A 4XSZF 2EB7A 3VB2A 1D8KA 3ZP5A 1ULYA 3BOQA 3FMQA 3GWZA 1XN7A 1IN8A 3WTWC 4PGHA 2Q8KA 5EEHA 1R5HA 4N0BA 2LKPA 3TGNA 2P6TA 1MZBA 2MLGA 4WWCA 2Z9OA 5JVTA 1TQPA 1G3SA 4Q48A 5ICFA 2VOPA 2H09A 1U2WA 3M8EA 3LA3A 2BE5F 4R79A 2F5FA 3U9GA 5FLXK 2WWYA 2RVCA 3C7JA 3M7GA 1T0FA 3PQJA 1XDSA 2Q0OA 4YG2F 2EA4A 3PFIA 4G94A 4RAZA 4UUVA 3Q9SA 1A04A 3IL2A 4HDVA 1SFXA 1XGMA 2VT2A 3O2PE 2OD5A 4L5JA 2MLKA 1ZG3A 2EV5A 1IXCA 3CUOA 5IT9Z 1F1ZA 2EFWA 1UHWA 1IAWA 5F64A 5CVIA 1L3LA 1P4AA 5JR3A 1XGOA 2OU2A 3IRRA 5ICCA 4U0YA 4H0EA 4EJOA 2XAJA 2QYOA 1BBYA 2V1XA 1IRFA 2FBHA 1WQ2A 3QU6A 5DDGA 2IPQX 3KP6A 2DO7A 2IRFG 1OPCA 4A0YA 1K78B 4UNOA 2V1UA 5CVRA 5DCFA 3QOPA 2V9VA 1U5TB 2VXZA 3BJOA 3E97A 3DEUA 3GZ6A 2C6YA 3EUHA 5HDKA 5E8IA 3MZHA 2CWEA 1RUNA 5D5WB 5J8CA 1B4AA 1TLHB 4BH9A 3NQOA 5K5OA 4U0VA 2XAFA 2LSOA 3V4GA 4BYYA 4IRGA 5ERIA 3ZMUA 5IT3A 1S7OA 1YYVA 4WXCA 4GGGA 3MCZA 4ZZLA 3MEXA 1G3YA 3ECOA 1I5ZA 4PZJA 2ETHA 3CUQC 4YIFA 2K86A 2E7XA 3T8TA 3REOA 2E7WA 3RYRA 4IHTA 3MFKA 1J7KA 1B9NA 1YTYA 2HKXA 3IWZA 2K4BA 2UZKA 1YW9A 4S05A 1FSHA 3RJPA 2XKOA 4U7BA 5HVQC 2DFIA 1KGSA 1WI9A 5HLGA 2JPCA 4O3MA 5TJJA 3BZ6A 1YLFA 1B6AA 4HF0A 2L01A 1FYLA 3GYHX 2MA3A 5D6FA 2K27A 4FX4A 4ASNA 5F6FA 1ZARA 1JXSA 5ED4A 3F8FA 1L0OC 4YFKF 4AIJA 4FT8A 4FHTA 3BWGA 2YU3A 2ZBKA 4I09A 4CO8A 4OIRF 4A2UA 1H0MA 3RPUA 4WCGA 3Q5FA 2JSCA 3RYPA 5LLQA 3FM5A 5FD6A 3WTVC 4QLCU 2QVOA 2ZJ2A 5IT9K 1BI1A 3TOAA 3F72A 2M87A 5KVRA 2W85A 4MEYF 3F8BA 3TDUC 4EQQA 2P7VB 4BQAA 4G7OF 4GYGA 1EV7A 1ZG5A 3CO6C 3WGGA 1XGSA 4RB0A 4WXHA 4GXOA 3H92A 5AIQA 3R4KA 3ZMTA 2BEOA 3JSOA 4LGWA 4KYWA 4A5NA 4L0ZB 1BI3A 3F6OA 5LGTA 1FP2A 3V8JA 2RNJA 3F6VA 2PEXA 2A69F 2XKPA 1Q1HA 2FEZA 2NS0A 1K7AA 2H94A 3TQNA 1FNNA 3IWFA 1JHHA 4RGXA 3RKWA 2HWVA 4LG0B 3I59B 2KKOA 3GFJA 1BM9A 4JK1X 1QNTA 4FX0A 3V8LA 3D5LA 1KYWA 2OZUA 5H20A 1C0WA 4G6DA 2O6GE 4P9FA 5HOOA 1IXRC 4R8HA 2IJLA 3JTHA 3WTYC 4Y17A 4A6DA 5A2QZ 4ZYEA 1SD4A 1J59A 4Y15A 3ZN0A 1T98A 2M8EA 4LMYA 1Y0UA 2ISYA 3MWMA 3DQVC 3FWEA 2MD5A 4U88A 1I1GA 4GYIA 2NRAC 4KIBA 4CYDA 2QBYB 4JQFA 3VEPA 3HSRA 5D5UB 3QP5A 2PBIA 3C18A 4LJZF 2RN7A 2HZTA 2O03A 2ZXJA 5CYVA 4KN7X 3JW4A 2F2EA 4WK8F 3WE2A 4KIGA 2NNYA 4ESFA 2XUBA 3E6CC 4IXAA 3WTSC 1XMAA 4XSXF 1W5SA 1OKRA 4KIFA 5DD8A 4P96A 3CLOA 1YQAA 1BC7C 3C3WA 1K78A 1HW5A 2QZ8A 3FXUA 3M9AA 1FX7A 1G6NA 2DBBA 2EFPA 1U5TA 4ETSA 1TQIA 1P4WA 2RQPA 2ZNYA 3ZQ7A 5D8LB 1HBXG 3B02A 2H6BA 1OMIA 2IW5A 2L02A 2FRHA 4KA4A 4I01A 4OU0A 2KRFA 5L3BA 2PJPA 2ZKZA 1XCVA 2VBXA 3I5UA 5ILSA 5DUIA 3QP6A 3L09A 4DNCA 3E6DA 3LAPA 1ZGAA 2LF8A 1FP1D 1Z1DA 2EV6A 1R23A 1LB2A 3F8CA 4KNYA 2KIMA 1UHMA 1X3UA 2ADUA 3BDDA 3GF2A 1BIAA 2Z5UA 1QO0D 2XAGA 1YFHA 4G7HF 2GA2A 2STTA 5ILVA 1O57A 4GO1A 4Q47A 2ACJA 2UXNA 4I2OA 2FF4A 1FYKA 2OZ6A 3HRTA 1O3SA 2A07F 3GEZA 1LEAA 3SHFA 2NAZA 1EH8A 2IA1A 2H6CA 2P5LC 4PCQA 2YPRA 4CHUA 1Z6RA 3KZZA 1O3TA 3CUQA 4RB2C 1YIOA 1MDMA 2LDUA 4RGRA 2O8XA 4ZYHA 1RI7A 5E18F 2XRNA 2L4MA 1J75A 2J5PA 4O5VA 1W5TA 3MAJA 3JAMK 3DPTA 2DAOA 3RIRA 1J9IA 3PQKA 2FE3A 2CFXA 4KUMA 3ABTA 3V8KA 5KK1A 1GHCA 1S8NA 1TW2A 3D0SA 1T6SA 2CO5A 2B0LA 4A0XA 1QZYA 5DD4A 2V1DA 3RI4A 3ULQB 3HOTA 4RB3C 1Z6TA 2OBPA 4KT5C 4HBLA 1U5TC 2PG4A 3ZN1A 2PMHA 4RGSA 3E5QA 3J81Z 1F9NA 3JSPA 2FMLA 5HS8A 3NEUA 4LG0A 4AIKA 5DCMB 2HYGD 2A3SA 3KZYA 1R1UA 3FF5A 4G6QA 3TDZC 5HLIA 3TOBA 1WSUA 1IN6A 4LB6B 1MJ9A 1IRGA 4EGZA 3QPHA 2PI0A 1PDNC 3F22A 2ESHA 4YFNF 3HOSA 3L00A 3KP2A 4CZZA 4HLYA 1EH6A 3ZMDA 2QBYA 2K4JA 3HYIA 1QBJA 1QPMA 2P5VA 2VBZA 4P9UA 2CGPA 1OYIA 3EQLF 3HRMA 4EMSA 4ZZDA 1WKMA 1O3QA 2M5WA 2BBYA 1V3FA 3N4MA 1G4DA 4IHSA 2A6HF 3GUDA 1BI2A 3GZ5A 5L3FA 4LLNA 6PAXA 2TDXA 1E17A 3FHZA 1OYWA 3ISPA 3TO9A 5BS6A 4Q5SF 1Z91A 4KFCA 5K5QA 1SMTA 4L5IA 2G9WA 1FBQA 3HSEA 4G8XA 2PMUA 2EV0A 5L3GA 2J5OA 2YR2A 1XD7A 3TO7A 3BJAA 1RIOH 4MQVA 1B1BA 3DV8A 1XB4A 4M71A 3LA2A 1J0RA 3HTUA 1KU7A 3RKYA 1CF7A 4OINF 1FZPB 4L9JA 2X0LA 5D5VB 2FBIA 3FXRA 3EYIA 3FMSA 1JGSA 5JFRA 1ZRFA 2RKHA 3T5XA 2D1VA 1J5YA 3CJNA 3I54A 1FLIA 2RV8A 5D4SA 2VC1A 1E2XA 1R1VA 4MTDA 3GFLA 1AWCA 5H6RA 3J7AO 1OR7A 5AONA 5L3EA 1QQIA 2H27A 4AWXB 1GXPA 3P9CA 3HUGA 4LK1F 3EETA 3IKTA 3WGIA 3V7SA 4UXNA 3M8FA 2O0YA 3J81K 4BHBA 2MBFA 3ML6A 3O3KA 2BYVE 2GXBA 2ZCWA 1HKTA 4M74A 2Z3YA 1SFUA 1TBXA 3FX3A 1F4KA 3TO6A 3WTUC 3N97A 5HDGA 3LSTA 1FBSA 1MGTA 2Q2EA 2D45A 5E17F 4N9IA 1Z9CA 2FOKA 2EFOA 5JHUA 1W7PA 4M73A 2FU4A 3RKXA 5BPIA 1RZ4A 4B8XA 1SFEA 4MEXF 2FXAA 4HOBA 1DPRA 3WTZA 3TKYA 1HKQA 3F23A 4A0ZA 1TW3A 1ZRDA 2VBWA 2M1BA 3KFWX 3SQNA 4EGYA 2XASA 3BROA 1FPQA 1PP7U 3C1DA 2GQQA 4EM0B 4HQEA 5E1XA 4IVNA 3MQ0A 3BP8A 1ZH5A 3IC7A 4L9VA 1BJAA 4EJWA 2QUFA 3GXOA 2GXGA 1FSEA 3BPVA 3G73A 3LWFA 3GLXA 1V4RA 4KN4X 2HQNA 2YX4A 4BHPA 3P7NA 1P2FA 2RDPA 4BXUA 2CQKA 5AIPA 1MD0A 5LHGA 1YS6A 1LQ1A 2DTRA 3GVAA 2PLYA 5LRSA 2DLLA 2DQRA 4QWQA 1T39A 1U3EM 2UXXA 1USSA 1F5TA 1ZGJA 2HYFA 3EYYA 2JT1A 2Z33A 1K79A 2DW4A 2FSWA 4RB1A 3W6KB 1KQ8A 1FBUA 4M6YA 3J80Z 2AS5F 1K6OA 1ZG1A 2GWRA 5HDNA 4OIOF 4KMUX 2EFQA 1FWZA 4M9ZA 3LAJA 2LNBA 2FNAA 4DQ2A 4XLNF 2HR3A 5EEGA 2WTEA 4LB5A 4HLXA 3F21A 2F5EA 5E20A 3P9KA 2BV6A 2VN2A 1BI0A 3HHHA 1BC8C 1G3TA 2A6EF 5BPDA 4ZYGA 4OIPF 2ZO4A 1SD5A 4UVCA 1QGPA 3QU3A 1JHFA 1LDJA 1O7LA 2M30A 1J2XA 4BHCA 3H3ZA 4I0BA 2A68F 2XHKA 2EFNA 1D3YA 5ILUA 2PFBA 5J8FA 5FLXZ 5FFXA 1LVAA 3WU1B 4OMYA 3ZPLA 1P4XA 2HTSA 3I64A 1TNTA 3I71A 2L3DA 4UV9A 3FXQA 1GVJA 5D6EA 2E1NA 5LEKA 1ZRCA 4P5OA 1MKMA 4AD9A 3DKWA 3R61A 4ESBA 4R1HA 2A5YB 4IRHA 3ERED 2L54A 1XGNA 3IRQA 1FY7A 1H9GA 5LGUA 5LEJA 3R60A 2COMA 2HDCA 1FT9A 4JBAA 1G3WA 2MH2A 5HS7A 1O3RA 2GZWA 4L18B 4OOIA 4YIIA 1R58A 3DFGA 2JPBA 1TTYA 2HFHA 2E1CA 4I7HA 2GA1A 5FD5A 3GFMA 1FOKA 3QAHA 2EJRA 4HF2A 2QENA 3DPLC 4IRIA 2O3FA 1SAXA 2DPDA 5DYMA 1B9MA 1S7AA 4ENKA 4BNCA 3R0JA 3ABUA 1GXQA 3LA7A 1MJBA 1IN7A 1S6LA 4OMZA 4M6XA 2G7UA 5A2QK 3LFKA 4XLPF 4HX8A 2RGVA 2W57A 3HIFA 5FFZA 2DK8A 2EA2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E6B A;  4HX4 A;  3VOE A;  4Z2Y A;  2GAU A;  4A6E A;  1UCR A;  4IF4 A;  2PQ8 A;  3I53 A;  3E6M A;  3WTX C;  1R22 A;  4HZF A;  1ZAO A;  4RGU A;  4L9N A;  3K2Z A;  5L3D A;  1ZN2 A;  3CDH A;  5FO5 A;  2JTV A;  1OYY A;  3AAF A;  3WTT C;  3L9F A;  3J80 K;  4M72 A;  2ZME B;  2OA4 A;  3VOD A;  2QM3 A;  3B73 A;  5LHH A;  1DDN A;  3U1D A;  1D5V A;  1R36 A;  2ZFW A;  2ZNZ A;  5BMZ A;  2HKO A;  4E70 A;  2R7F A;  3WOD F;  1LEB A;  3KP7 A;  4BAY A;  4CDG A;  1HST A;  4HW0 A;  2K7L A;  1IUY A;  4ZH4 F;  3F8N A;  2UWM A;  1KA8 A;  1ON1 A;  3COA C;  1FC3 A;  2L4A A;  3K1N A;  1DUX C;  2CYY A;  2FQ3 A;  4G7Z F;  3FZV A;  2P4W A;  3KP5 A;  3KE2 A;  1T2K A;  1PP8 F;  2G7H A;  4UVA A;  5JI6 A;  2WV0 A;  3I59 A;  4LLL A;  2XVC A;  3NRV A;  4EJU A;  4HX7 A;  3CTA A;  4HQM A;  4G9Y A;  3KET A;  4ENJ A;  2IA0 A;  3E5X A;  2VE9 A;  4U0W A;  1P92 A;  3R0A A;  1WWX A;  4OIQ F;  2XRO A;  5E1Z B;  3KCC A;  1IXS B;  4HYE A;  2D2W A;  5D5X B;  2W25 A;  4ON0 A;  2O61 A;  1UB9 A;  2MH9 A;  2DU9 A;  3I4P A;  5BQT A;  3QRF F;  1KQ9 A;  1BIB A;  2ELH A;  4IPA A;  1P6R A;  2EK5 A;  2CSO A;  5E1W A;  4ENM A;  1NHA A;  4I02 A;  1KQ0 A;  1T38 A;  4AIH A;  2JRT A;  1B59 A;  3QPT A;  1LJ9 A;  3GX4 X;  3GFI A;  2Z99 A;  4GCV A;  2F5C A;  2DPU A;  2IVM A;  1HKS A;  5CLS A;  2VT3 A;  2STW A;  1HSJ A;  5D4R A;  5CVJ A;  4ENN A;  4K2E A;  4O6J A;  1MJA A;  3LQR A;  2FMY A;  5DEQ A;  2KIU A;  2KJC A;  2KIF A;  4A12 A;  2QQ9 A;  2CG4 A;  3T0Y A;  2HGC A;  1KU2 A;  5BOX A;  2OAZ A;  2QQB A;  4IJA A;  1R7J A;  2M45 A;  1STZ A;  4PGG A;  4M9X A;  2WC2 A;  4KIC A;  3DP7 A;  1XDU A;  1BN5 A;  2Y0M A;  3WU0 A;  4LD5 A;  3EDP A;  5CVV A;  3DXJ F;  3RTR A;  1ON2 A;  2XAH A;  1KYZ A;  4AVP A;  1XSV A;  4NQW A;  5TRD A;  1CGP A;  2IA2 A;  2ESN A;  1XMK A;  2IP2 A;  2P7C B;  3IKV A;  3LQQ A;  3FM3 A;  3SZP A;  1IN4 A;  3OOP A;  1IN5 A;  4U7D A;  1R5G A;  1EH7 A;  1R00 A;  2DK5 A;  4MHG A;  1S3J A;  3CUQ B;  1LNW A;  3L7W A;  2QLZ A;  1MDM B;  1AOY A;  3H3U A;  4L9T A;  2IT0 A;  3HHG A;  5ICE A;  1D8J A;  4CGZ A;  4UVB A;  1YO5 C;  4I0A A;  5J6X A;  4LK0 F;  4ZYD A;  2VOO A;  5CJ9 A;  4RAY A;  2EWN A;  4EM1 A;  1PUE E;  3V7C A;  1ZHF A;  3KEO A;  1REP C;  4LFU A;  5F1R A;  2LF7 A;  3P9I A;  2P8T A;  3GO5 A;  3WGH A;  5LRR A;  4HV5 A;  2Y75 A;  1XSD A;  4MGR A;  2HQR A;  3ZMZ A;  1ZLK A;  2ZME A;  2VON A;  2V79 A;  2OQR A;  3KP4 A;  2DT5 A;  4TV7 A;  1I27 A;  3W6J B;  3HSF A;  1BOA A;  1O7F A;  1W7P D;  1IW7 F;  2Y48 A;  3Q9V A;  1XCB A;  1UFM A;  3L2C A;  2P5K A;  2HOE A;  2VBY A;  4B09 A;  1JE8 A;  3S2W A;  1TNS A;  3O6B B;  2KJB A;  3I0T A;  1SD6 A;  2A61 A;  4CIC A;  2DQL A;  1LDD A;  5E8G A;  3T8R A;  2YX7 A;  1Z7U A;  3HTS B;  1TQM A;  3E5U A;  4LLG F;  3V7R A;  5DCM A;  1RUO A;  3VFZ A;  3F3X A;  2P6S A;  3IHU A;  1XSX A;  5DUK A;  1VTN C;  3F8M A;  1RNL A;  3BPX A;  3HRS A;  3JAM Z;  4NHJ A;  4HA8 A;  1U78 A;  4XBF A;  2GIV A;  1ZRE A;  2CW0 F;  1FYM A;  2VE8 A;  2BGC A;  1ODD A;  5D8K B;  3I58 A;  4KDP A;  3BJ6 A;  4N9H A;  4EV0 A;  2FNP A;  1I1S A;  4UV8 A;  2NNN A;  2AXL A;  1S29 A;  3ROU A;  1LDK B;  1YW7 A;  4ESJ A;  1R1T A;  1IZ1 A;  5LGN A;  1YG2 A;  1I6X A;  2DI3 A;  2YSR A;  3OV8 A;  4XRF A;  3KEQ A;  4YFX F;  5DV5 A;  1KU3 A;  1DPU A;  1KU9 A;  3MZY A;  1SD7 A;  3FMR A;  2QQA A;  3JTG A;  4WXD A;  2HEO A;  2MC3 A;  4EJT A;  3HRU A;  1YS7 A;  3DF8 A;  1WRJ A;  5FGM A;  1U6G A;  3SXY A;  4WX9 A;  5HLH A;  2PN6 A;  1ONV A;  5CVU A;  4HF1 A;  4MTE A;  4EJV A;  4M9S A;  1UST A;  2QWW A;  1YW8 A;  2VOD A;  4HV6 A;  1CF7 B;  4L0Y B;  3BY6 A;  2XGX A;  1HW2 A;  2XIG A;  2W24 A;  4MNU A;  4F7Z A;  4D0P A;  2FBK A;  4NB5 A;  1HXD A;  4RS8 A;  3K0L A;  2K02 A;  2W84 A;  4UHT A;  3T1B A;  5K1Y A;  4HAM A;  2RC4 A;  1HW1 A;  3K1P A;  2V6C A;  2X4H A;  4EVI A;  3KLN A;  3SFZ A;  2F5D A;  2OQG A;  2JZY A;  5FB2 A;  3E3V A;  4A5M A;  2R7D A;  1H9T A;  1W4M A;  1ZLJ A;  1Z05 A;  2FA5 A;  2D1H A;  3RDI A;  3WG9 A;  3ELK A;  4Y13 A;  1U8R A;  2VC0 A;  3KLO A;  3R6S A;  3ECH A;  5LBQ A;  4HDU A;  3SZT A;  5L3C A;  4CXF A;  3M1E A;  2XAQ A;  5HS9 A;  1DP7 P;  1HQC A;  2R3S A;  2ISZ A;  5LHI A;  2XV4 S;  5H6Q A;  4KMF A;  4S04 A;  3ZMS A;  1ZYR F;  3RPQ A;  3GW2 A;  4Q4Z F;  1SMY F;  3ZMV A;  2HS5 A;  5ICG A;  3CO7 C;  4PDK A;  4P55 A;  3K9T A;  2HTJ A;  3U2R A;  2NYX A;  1W7P B;  1QZZ A;  1IF1 A;  5K5R A;  3K1M A;  3G3Z A;  4WF2 A;  4I98 B;  4MQ9 F;  3WE3 A;  3K69 A;  4EM2 A;  3KP3 A;  4XSZ F;  2EB7 A;  3VB2 A;  1D8K A;  3ZP5 A;  1ULY A;  3BOQ A;  3FMQ A;  3GWZ A;  1XN7 A;  1IN8 A;  3WTW C;  4PGH A;  2Q8K A;  5EEH A;  1R5H A;  4N0B A;  2LKP A;  3TGN A;  2P6T A;  1MZB A;  2MLG A;  4WWC A;  2Z9O A;  5JVT A;  1TQP A;  1G3S A;  4Q48 A;  5ICF A;  2VOP A;  2H09 A;  1U2W A;  3M8E A;  3LA3 A;  2BE5 F;  4R79 A;  2F5F A;  3U9G A;  5FLX K;  2WWY A;  2RVC A;  3C7J A;  3M7G A;  1T0F A;  3PQJ A;  1XDS A;  2Q0O A;  4YG2 F;  2EA4 A;  3PFI A;  4G94 A;  4RAZ A;  4UUV A;  3Q9S A;  1A04 A;  3IL2 A;  4HDV A;  1SFX A;  1XGM A;  2VT2 A;  3O2P E;  2OD5 A;  4L5J A;  2MLK A;  1ZG3 A;  2EV5 A;  1IXC A;  3CUO A;  5IT9 Z;  1F1Z A;  2EFW A;  1UHW A;  1IAW A;  5F64 A;  5CVI A;  1L3L A;  1P4A A;  5JR3 A;  1XGO A;  2OU2 A;  3IRR A;  5ICC A;  4U0Y A;  4H0E A;  4EJO A;  2XAJ A;  2QYO A;  1BBY A;  2V1X A;  1IRF A;  2FBH A;  1WQ2 A;  3QU6 A;  5DDG A;  2IPQ X;  3KP6 A;  2DO7 A;  2IRF G;  1OPC A;  4A0Y A;  1K78 B;  4UNO A;  2V1U A;  5CVR A;  5DCF A;  3QOP A;  2V9V A;  1U5T B;  2VXZ A;  3BJO A;  3E97 A;  3DEU A;  3GZ6 A;  2C6Y A;  3EUH A;  5HDK A;  5E8I A;  3MZH A;  2CWE A;  1RUN A;  5D5W B;  5J8C A;  1B4A A;  1TLH B;  4BH9 A;  3NQO A;  5K5O A;  4U0V A;  2XAF A;  2LSO A;  3V4G A;  4BYY A;  4IRG A;  5ERI A;  3ZMU A;  5IT3 A;  1S7O A;  1YYV A;  4WXC A;  4GGG A;  3MCZ A;  4ZZL A;  3MEX A;  1G3Y A;  3ECO A;  1I5Z A;  4PZJ A;  2ETH A;  3CUQ C;  4YIF A;  2K86 A;  2E7X A;  3T8T A;  3REO A;  2E7W A;  3RYR A;  4IHT A;  3MFK A;  1J7K A;  1B9N A;  1YTY A;  2HKX A;  3IWZ A;  2K4B A;  2UZK A;  1YW9 A;  4S05 A;  1FSH A;  3RJP A;  2XKO A;  4U7B A;  5HVQ C;  2DFI A;  1KGS A;  1WI9 A;  5HLG A;  2JPC A;  4O3M A;  5TJJ A;  3BZ6 A;  1YLF A;  1B6A A;  4HF0 A;  2L01 A;  1FYL A;  3GYH X;  2MA3 A;  5D6F A;  2K27 A;  4FX4 A;  4ASN A;  5F6F A;  1ZAR A;  1JXS A;  5ED4 A;  3F8F A;  1L0O C;  4YFK F;  4AIJ A;  4FT8 A;  4FHT A;  3BWG A;  2YU3 A;  2ZBK A;  4I09 A;  4CO8 A;  4OIR F;  4A2U A;  1H0M A;  3RPU A;  4WCG A;  3Q5F A;  2JSC A;  3RYP A;  5LLQ A;  3FM5 A;  5FD6 A;  3WTV C;  4QLC U;  2QVO A;  2ZJ2 A;  5IT9 K;  1BI1 A;  3TOA A;  3F72 A;  2M87 A;  5KVR A;  2W85 A;  4MEY F;  3F8B A;  3TDU C;  4EQQ A;  2P7V B;  4BQA A;  4G7O F;  4GYG A;  1EV7 A;  1ZG5 A;  3CO6 C;  3WGG A;  1XGS A;  4RB0 A;  4WXH A;  4GXO A;  3H92 A;  5AIQ A;  3R4K A;  3ZMT A;  2BEO A;  3JSO A;  4LGW A;  4KYW A;  4A5N A;  4L0Z B;  1BI3 A;  3F6O A;  5LGT A;  1FP2 A;  3V8J A;  2RNJ A;  3F6V A;  2PEX A;  2A69 F;  2XKP A;  1Q1H A;  2FEZ A;  2NS0 A;  1K7A A;  2H94 A;  3TQN A;  1FNN A;  3IWF A;  1JHH A;  4RGX A;  3RKW A;  2HWV A;  4LG0 B;  3I59 B;  2KKO A;  3GFJ A;  1BM9 A;  4JK1 X;  1QNT A;  4FX0 A;  3V8L A;  3D5L A;  1KYW A;  2OZU A;  5H20 A;  1C0W A;  4G6D A;  2O6G E;  4P9F A;  5HOO A;  1IXR C;  4R8H A;  2IJL A;  3JTH A;  3WTY C;  4Y17 A;  4A6D A;  5A2Q Z;  4ZYE A;  1SD4 A;  1J59 A;  4Y15 A;  3ZN0 A;  1T98 A;  2M8E A;  4LMY A;  1Y0U A;  2ISY A;  3MWM A;  3DQV C;  3FWE A;  2MD5 A;  4U88 A;  1I1G A;  4GYI A;  2NRA C;  4KIB A;  4CYD A;  2QBY B;  4JQF A;  3VEP A;  3HSR A;  5D5U B;  3QP5 A;  2PBI A;  3C18 A;  4LJZ F;  2RN7 A;  2HZT A;  2O03 A;  2ZXJ A;  5CYV A;  4KN7 X;  3JW4 A;  2F2E A;  4WK8 F;  3WE2 A;  4KIG A;  2NNY A;  4ESF A;  2XUB A;  3E6C C;  4IXA A;  3WTS C;  1XMA A;  4XSX F;  1W5S A;  1OKR A;  4KIF A;  5DD8 A;  4P96 A;  3CLO A;  1YQA A;  1BC7 C;  3C3W A;  1K78 A;  1HW5 A;  2QZ8 A;  3FXU A;  3M9A A;  1FX7 A;  1G6N A;  2DBB A;  2EFP A;  1U5T A;  4ETS A;  1TQI A;  1P4W A;  2RQP A;  2ZNY A;  3ZQ7 A;  5D8L B;  1HBX G;  3B02 A;  2H6B A;  1OMI A;  2IW5 A;  2L02 A;  2FRH A;  4KA4 A;  4I01 A;  4OU0 A;  2KRF A;  5L3B A;  2PJP A;  2ZKZ A;  1XCV A;  2VBX A;  3I5U A;  5ILS A;  5DUI A;  3QP6 A;  3L09 A;  4DNC A;  3E6D A;  3LAP A;  1ZGA A;  2LF8 A;  1FP1 D;  1Z1D A;  2EV6 A;  1R23 A;  1LB2 A;  3F8C A;  4KNY A;  2KIM A;  1UHM A;  1X3U A;  2ADU A;  3BDD A;  3GF2 A;  1BIA A;  2Z5U A;  1QO0 D;  2XAG A;  1YFH A;  4G7H F;  2GA2 A;  2STT A;  5ILV A;  1O57 A;  4GO1 A;  4Q47 A;  2ACJ A;  2UXN A;  4I2O A;  2FF4 A;  1FYK A;  2OZ6 A;  3HRT A;  1O3S A;  2A07 F;  3GEZ A;  1LEA A;  3SHF A;  2NAZ A;  1EH8 A;  2IA1 A;  2H6C A;  2P5L C;  4PCQ A;  2YPR A;  4CHU A;  1Z6R A;  3KZZ A;  1O3T A;  3CUQ A;  4RB2 C;  1YIO A;  1MDM A;  2LDU A;  4RGR A;  2O8X A;  4ZYH A;  1RI7 A;  5E18 F;  2XRN A;  2L4M A;  1J75 A;  2J5P A;  4O5V A;  1W5T A;  3MAJ A;  3JAM K;  3DPT A;  2DAO A;  3RIR A;  1J9I A;  3PQK A;  2FE3 A;  2CFX A;  4KUM A;  3ABT A;  3V8K A;  5KK1 A;  1GHC A;  1S8N A;  1TW2 A;  3D0S A;  1T6S A;  2CO5 A;  2B0L A;  4A0X A;  1QZY A;  5DD4 A;  2V1D A;  3RI4 A;  3ULQ B;  3HOT A;  4RB3 C;  1Z6T A;  2OBP A;  4KT5 C;  4HBL A;  1U5T C;  2PG4 A;  3ZN1 A;  2PMH A;  4RGS A;  3E5Q A;  3J81 Z;  1F9N A;  3JSP A;  2FML A;  5HS8 A;  3NEU A;  4LG0 A;  4AIK A;  5DCM B;  2HYG D;  2A3S A;  3KZY A;  1R1U A;  3FF5 A;  4G6Q A;  3TDZ C;  5HLI A;  3TOB A;  1WSU A;  1IN6 A;  4LB6 B;  1MJ9 A;  1IRG A;  4EGZ A;  3QPH A;  2PI0 A;  1PDN C;  3F22 A;  2ESH A;  4YFN F;  3HOS A;  3L00 A;  3KP2 A;  4CZZ A;  4HLY A;  1EH6 A;  3ZMD A;  2QBY A;  2K4J A;  3HYI A;  1QBJ A;  1QPM A;  2P5V A;  2VBZ A;  4P9U A;  2CGP A;  1OYI A;  3EQL F;  3HRM A;  4EMS A;  4ZZD A;  1WKM A;  1O3Q A;  2M5W A;  2BBY A;  1V3F A;  3N4M A;  1G4D A;  4IHS A;  2A6H F;  3GUD A;  1BI2 A;  3GZ5 A;  5L3F A;  4LLN A;  6PAX A;  2TDX A;  1E17 A;  3FHZ A;  1OYW A;  3ISP A;  3TO9 A;  5BS6 A;  4Q5S F;  1Z91 A;  4KFC A;  5K5Q A;  1SMT A;  4L5I A;  2G9W A;  1FBQ A;  3HSE A;  4G8X A;  2PMU A;  2EV0 A;  5L3G A;  2J5O A;  2YR2 A;  1XD7 A;  3TO7 A;  3BJA A;  1RIO H;  4MQV A;  1B1B A;  3DV8 A;  1XB4 A;  4M71 A;  3LA2 A;  1J0R A;  3HTU A;  1KU7 A;  3RKY A;  1CF7 A;  4OIN F;  1FZP B;  4L9J A;  2X0L A;  5D5V B;  2FBI A;  3FXR A;  3EYI A;  3FMS A;  1JGS A;  5JFR A;  1ZRF A;  2RKH A;  3T5X A;  2D1V A;  1J5Y A;  3CJN A;  3I54 A;  1FLI A;  2RV8 A;  5D4S A;  2VC1 A;  1E2X A;  1R1V A;  4MTD A;  3GFL A;  1AWC A;  5H6R A;  3J7A O;  1OR7 A;  5AON A;  5L3E A;  1QQI A;  2H27 A;  4AWX B;  1GXP A;  3P9C A;  3HUG A;  4LK1 F;  3EET A;  3IKT A;  3WGI A;  3V7S A;  4UXN A;  3M8F A;  2O0Y A;  3J81 K;  4BHB A;  2MBF A;  3ML6 A;  3O3K A;  2BYV E;  2GXB A;  2ZCW A;  1HKT A;  4M74 A;  2Z3Y A;  1SFU A;  1TBX A;  3FX3 A;  1F4K A;  3TO6 A;  3WTU C;  3N97 A;  5HDG A;  3LST A;  1FBS A;  1MGT A;  2Q2E A;  2D45 A;  5E17 F;  4N9I A;  1Z9C A;  2FOK A;  2EFO A;  5JHU A;  1W7P A;  4M73 A;  2FU4 A;  3RKX A;  5BPI A;  1RZ4 A;  4B8X A;  1SFE A;  4MEX F;  2FXA A;  4HOB A;  1DPR A;  3WTZ A;  3TKY A;  1HKQ A;  3F23 A;  4A0Z A;  1TW3 A;  1ZRD A;  2VBW A;  2M1B A;  3KFW X;  3SQN A;  4EGY A;  2XAS A;  3BRO A;  1FPQ A;  1PP7 U;  3C1D A;  2GQQ A;  4EM0 B;  4HQE A;  5E1X A;  4IVN A;  3MQ0 A;  3BP8 A;  1ZH5 A;  3IC7 A;  4L9V A;  1BJA A;  4EJW A;  2QUF A;  3GXO A;  2GXG A;  1FSE A;  3BPV A;  3G73 A;  3LWF A;  3GLX A;  1V4R A;  4KN4 X;  2HQN A;  2YX4 A;  4BHP A;  3P7N A;  1P2F A;  2RDP A;  4BXU A;  2CQK A;  5AIP A;  1MD0 A;  5LHG A;  1YS6 A;  1LQ1 A;  2DTR A;  3GVA A;  2PLY A;  5LRS A;  2DLL A;  2DQR A;  4QWQ A;  1T39 A;  1U3E M;  2UXX A;  1USS A;  1F5T A;  1ZGJ A;  2HYF A;  3EYY A;  2JT1 A;  2Z33 A;  1K79 A;  2DW4 A;  2FSW A;  4RB1 A;  3W6K B;  1KQ8 A;  1FBU A;  4M6Y A;  3J80 Z;  2AS5 F;  1K6O A;  1ZG1 A;  2GWR A;  5HDN A;  4OIO F;  4KMU X;  2EFQ A;  1FWZ A;  4M9Z A;  3LAJ A;  2LNB A;  2FNA A;  4DQ2 A;  4XLN F;  2HR3 A;  5EEG A;  2WTE A;  4LB5 A;  4HLX A;  3F21 A;  2F5E A;  5E20 A;  3P9K A;  2BV6 A;  2VN2 A;  1BI0 A;  3HHH A;  1BC8 C;  1G3T A;  2A6E F;  5BPD A;  4ZYG A;  4OIP F;  2ZO4 A;  1SD5 A;  4UVC A;  1QGP A;  3QU3 A;  1JHF A;  1LDJ A;  1O7L A;  2M30 A;  1J2X A;  4BHC A;  3H3Z A;  4I0B A;  2A68 F;  2XHK A;  2EFN A;  1D3Y A;  5ILU A;  2PFB A;  5J8F A;  5FLX Z;  5FFX A;  1LVA A;  3WU1 B;  4OMY A;  3ZPL A;  1P4X A;  2HTS A;  3I64 A;  1TNT A;  3I71 A;  2L3D A;  4UV9 A;  3FXQ A;  1GVJ A;  5D6E A;  2E1N A;  5LEK A;  1ZRC A;  4P5O A;  1MKM A;  4AD9 A;  3DKW A;  3R61 A;  4ESB A;  4R1H A;  2A5Y B;  4IRH A;  3ERE D;  2L54 A;  1XGN A;  3IRQ A;  1FY7 A;  1H9G A;  5LGU A;  5LEJ A;  3R60 A;  2COM A;  2HDC A;  1FT9 A;  4JBA A;  1G3W A;  2MH2 A;  5HS7 A;  1O3R A;  2GZW A;  4L18 B;  4OOI A;  4YII A;  1R58 A;  3DFG A;  2JPB A;  1TTY A;  2HFH A;  2E1C A;  4I7H A;  2GA1 A;  5FD5 A;  3GFM A;  1FOK A;  3QAH A;  2EJR A;  4HF2 A;  2QEN A;  3DPL C;  4IRI A;  2O3F A;  1SAX A;  2DPD A;  5DYM A;  1B9M A;  1S7A A;  4ENK A;  4BNC A;  3R0J A;  3ABU A;  1GXQ A;  3LA7 A;  1MJB A;  1IN7 A;  1S6L A;  4OMZ A;  4M6X A;  2G7U A;  5A2Q K;  3LFK A;  4XLP F;  4HX8 A;  2RGV A;  2W57 A;  3HIF A;  5FFZ A;  2DK8 A;  2EA2 A; 
#chains in the Genus database with same CATH topology
 3E6B A;  4HX4 A;  3VOE A;  2DCE A;  4Z2Y A;  4RLF A;  1V55 H;  1BW6 A;  1UCR A;  2GAU A;  4IF4 A;  4A6E A;  2PQ8 A;  3I53 A;  2E2H J;  1Y8Q B;  2W4S A;  2E5Z A;  3E6M A;  3WTX C;  3GTG J;  4M3B A;  1R22 A;  4BU2 A;  4HZF A;  2E5N A;  1ZAO A;  4RGU A;  4L9N A;  1X58 A;  4XID A;  1X1D A;  3K2Z A;  5L3D A;  1ZN2 A;  4LG3 A;  3CDH A;  4MO7 A;  1U8B A;  1AKH A;  1HOM A;  2JMW A;  2MC4 A;  5FO5 A;  3TW6 A;  3VYT B;  5IY5 H;  2JTV A;  1OYY A;  3PO3 J;  3QPS A;  3AAF A;  2NOG A;  1Z21 A;  4BE0 A;  3WTT C;  1LKX A;  4F55 A;  3L9F A;  3NWT A;  3J80 K;  3NAR A;  4M72 A;  3HGY A;  5C4X J;  2ZME B;  3BR3 A;  2OA4 A;  2BXZ A;  3VOD A;  2QM3 A;  1XG1 A;  1B72 B;  3B73 A;  4A3G J;  1JUM A;  5LHH A;  1DDN A;  3U1D A;  1OJL A;  1D5V A;  1R36 A;  2ZFW A;  2ZNZ A;  5BMZ A;  1Y0N A;  1IJW C;  2HKO A;  3PUF A;  4E70 A;  2R7F A;  4DYQ A;  3WOD F;  1LEB A;  3KP7 A;  4BAY A;  4CDG A;  4C2U A;  1PVE A;  1HST A;  1WJD A;  3FK7 A;  2Y9Y A;  2B63 J;  1VQP I;  4HW0 A;  3L1P A;  2K7L A;  1IUY A;  2GOX B;  4KT6 A;  4ZH4 F;  3F8N A;  3MMY B;  2UWM A;  1KA8 A;  1QZE A;  2AHQ A;  1ON1 A;  3COA C;  1FC3 A;  4YEL A;  1MW7 A;  2VQC A;  2L4A A;  3K1N A;  4ANJ A;  5C4J J;  1DUX C;  2CYY A;  2FQ3 A;  1A6I A;  2JSP A;  2VQH A;  4DYC A;  4G7Z F;  4BY1 J;  3FZV A;  2P4W A;  3KP5 A;  3KE2 A;  4C2M J;  4IO9 F;  1T2K A;  2K5C A;  3AG3 H;  2G7H A;  4UVA A;  1PP8 F;  3E7L A;  2CW8 A;  2QEX I;  4AYB A;  1MSE C;  3SZG A;  3W6V A;  3OS0 A;  1E3P A;  2E19 A;  2K9N A;  1OLT A;  2VB6 A;  5JI6 A;  2WV0 A;  3ZRG A;  3I59 A;  4LLL A;  2XGD A;  2XVC A;  2DXI A;  1APL C;  3NRV A;  4EJU A;  4BEH B;  4HX7 A;  2ZXI A;  3VSL A;  5F0F A;  3CTA A;  4HQM A;  2R5Z A;  2B9S A;  4G9Y A;  3KET A;  2CH0 A;  1UG2 A;  2KL4 A;  5J4V A;  2R7R A;  4ENJ A;  4I76 A;  3IV5 A;  2X6Y A;  2IA0 A;  3E5X A;  3FXK A;  3JRH A;  2VE9 A;  4U0W A;  1P92 A;  4V19 K;  3R0A A;  2K9L A;  3WU2 C;  1WWX A;  4OIQ F;  1LE8 B;  2XRO A;  5E1Z B;  4X0G A;  3KCC A;  1IXS B;  2LC2 A;  2D2W A;  3BG6 A;  4HYE A;  4JX5 A;  3MN2 A;  3A01 B;  5D5X B;  3G1O A;  4XLE A;  2W25 A;  4ON0 A;  3HKZ N;  2O61 A;  5GP9 A;  1UB9 A;  2JA2 A;  2MH9 A;  1AU7 A;  3ZQF A;  3DTE A;  3KYL A;  2DU9 A;  2DFH A;  3I4P A;  5BQT A;  1GV5 A;  2X85 A;  3QRF F;  2ZXW H;  1KQ9 A;  2DA5 A;  1BIB A;  1TZL A;  1PJR A;  2ELH A;  1VQL I;  3DBL B;  4IPA A;  2L2O A;  1P6R A;  3BR5 A;  2EK5 A;  3QYE A;  3M3Y J;  2CSO A;  2FD5 A;  5E1W A;  1RES A;  2NS8 A;  4ENM A;  1NHA A;  3FIW A;  2L5Q A;  2Y0S A;  5F0H A;  1UAA A;  3DKX A;  4I02 A;  1KQ0 A;  1SVO A;  2EZL A;  4DIQ A;  1T38 A;  4AIH A;  1VQ6 I;  2JRT A;  5JLX A;  1H8A C;  2QF7 A;  1B59 A;  1R5I D;  3BC8 A;  3VSK A;  5B1B H;  3QPT A;  1HCR A;  1DU0 A;  2M34 A;  4BJT A;  1LJ9 A;  3GX4 X;  1ACI A;  3GFI A;  4BY7 J;  2KRH A;  2Z99 A;  2Y69 H;  2A6T A;  1KZH A;  3E1S A;  3H0G J;  4GCV A;  1OCT C;  2KIS A;  2F5C A;  1ZKG A;  3OY9 A;  2DPU A;  2F6C A;  2IVM A;  1HKS A;  2OTJ I;  2DA3 A;  4PK4 A;  2HXI A;  3DU5 A;  4IX7 A;  3DU6 A;  5CLS A;  2VT3 A;  2XF6 A;  4QIW N;  1IGN A;  2XF7 A;  4H4K C;  2STW A;  1HSJ A;  5D4R A;  2IS4 A;  5CVJ A;  4ENN A;  1FIA A;  4K2E A;  1MJA A;  4O6J A;  3HL2 A;  5M5W J;  3OYF A;  3LQR A;  2FMY A;  1ZR4 A;  3J7Y J;  2EH3 A;  3OYK A;  3CLQ A;  3OYI A;  5DEQ A;  2KIU A;  3WG7 H;  2KJC A;  4XKC A;  2KIF A;  4A12 A;  1VQ7 I;  1XC5 A;  2QQ9 A;  2CG4 A;  3T0Y A;  2HGC A;  5IOZ A;  2DFF A;  1KU2 A;  5BOX A;  2OAZ A;  4XNF A;  2QQB A;  3GLL A;  4IJA A;  1R7J A;  5GPA A;  4IHX A;  2X1D A;  2M45 A;  3HOY J;  1STZ A;  4GRI A;  5TGT A;  5CKT A;  2OUM A;  4PGG A;  4M9X A;  1MH3 A;  2WC2 A;  1MNM C;  3OOU A;  5EZH A;  3ZCO A;  4BQN A;  4J00 A;  2LP0 A;  1POG A;  4KIC A;  4BAC A;  1T08 B;  3DP7 A;  3BTC A;  1XDU A;  1BN5 A;  2Y0M A;  3WU0 A;  4LD5 A;  3EDP A;  5CVV A;  3AKZ A;  3DTK A;  3DXJ F;  4A3D J;  1SVM A;  2R7T A;  3RTR A;  5E3O A;  3GTO J;  1ON2 A;  3CF2 A;  2XAH A;  1JTX A;  1KYZ A;  2BHZ A;  2GXA A;  4AVP A;  1SVL A;  2KPM A;  1N25 A;  2BY0 A;  1XSV A;  2WAE A;  1JI8 A;  4NQW A;  5TRD A;  1CGP A;  2IA2 A;  2ESN A;  1R49 A;  2DMT A;  2DMP A;  2O8K A;  1IDZ A;  1XMK A;  2IP2 A;  3H0D A;  4C3H J;  2P7C B;  2KDZ A;  5F08 A;  3IKV A;  3LQQ A;  3FM3 A;  4RDU A;  4D9J A;  4XRS G;  3SZP A;  5KHD A;  1IN4 A;  2JK3 A;  3OOP A;  4CSW A;  2EIL H;  2EIM H;  3TP0 A;  1IN5 A;  3M1C A;  2JA5 J;  4U7D A;  1R5G A;  4DYR A;  1EH7 A;  2AQF A;  3L2Q A;  2ME6 A;  2M4K A;  4BQO A;  1R00 A;  2DK5 A;  4MHG A;  1WJF A;  3TP3 A;  1S3J A;  2KT0 A;  1V5F A;  4UB6 C;  2WY7 Q;  1ZGW A;  3CUQ B;  1LNW A;  5EG0 B;  2M9H A;  3L7W A;  2QLZ A;  2JN6 A;  4ZJZ A;  5J3L A;  1T0F C;  1MDM B;  3UNG C;  2DDB A;  2ZB9 A;  3CCU I;  4A3B J;  4B3X A;  1AOY A;  3H3U A;  4L9T A;  5FKO A;  1GUU A;  2I8D A;  1IO2 A;  2R93 J;  2IT0 A;  1HLV A;  3HHG A;  5ICE A;  1D8J A;  2OC6 A;  1D0X A;  4CGZ A;  4UVB A;  1RRJ A;  1YO5 C;  4I0A A;  2CW7 A;  2NVY J;  1Q1V A;  5HNF A;  5J6X A;  1W1W E;  1MNE A;  4NC7 A;  4LK0 F;  4ZYD A;  2VOO A;  2AXT C;  5CJ9 A;  4RAY A;  2LYC A;  1Y8R B;  2MYS A;  5F0C A;  2EWN A;  1R4M B;  1TP4 A;  4EM1 A;  4II3 A;  1PUE E;  3V7C A;  3S14 J;  1ZHF A;  3SYT A;  3KEO A;  1REP C;  2CQN A;  4LFU A;  5F1R A;  3M07 A;  3A02 A;  2LF7 A;  3P9I A;  3RPU D;  2P8T A;  3B6A A;  1N75 A;  4HEA 2;  4BE2 A;  3QOD A;  4BJ6 C;  3UR3 C;  4E7J A;  3GO5 A;  5GTI C;  3KYC B;  1ETV A;  3S16 J;  1RKW A;  4PJL A;  3WGH A;  5LRR A;  3K4C A;  4HV5 A;  2Y75 A;  1XSD A;  4PFP A;  4MGR A;  3HB9 A;  2HQR A;  3ZMZ A;  1YOV B;  4CCJ A;  4QSH A;  1TWC J;  2QSF X;  4BBS J;  2VJ5 A;  1ZLK A;  2ZME A;  2VON A;  1BR4 A;  2V79 A;  1OCR H;  2OQR A;  3KP4 A;  2PJR B;  1B72 A;  2DT5 A;  4TV7 A;  3AG4 H;  3HOV J;  3HOX J;  4XN3 A;  3BQZ A;  1I27 A;  3IAM 2;  3ASN H;  2JA8 J;  5IP9 J;  2BVM A;  3W6J B;  2MW8 A;  3HSF A;  1XMX A;  1BOA A;  2FUG 2;  1O7F A;  3H36 A;  1W7P D;  1IW7 F;  3CC7 I;  3HKZ A;  1K61 A;  1BW5 A;  2Y48 A;  2M8G X;  3Q9V A;  2QKL B;  1XCB A;  5FLM J;  3JRC A;  1TWF J;  1UFM A;  3L2C A;  4XMY A;  2P5K A;  2HQA A;  3FKI J;  1NK3 P;  4PJM A;  2HOE A;  2V1N A;  2VBY A;  3CQZ J;  4B09 A;  1JE8 A;  1PYV A;  1GDT A;  3S2W A;  1H88 C;  1U9N A;  1ENH A;  4CYC B;  2W48 A;  1X19 A;  1TNS A;  1FOW A;  3HJE A;  3IH2 A;  1T56 A;  2IS6 A;  5KAI C;  4DBQ A;  3O6B B;  2KJB A;  3I0T A;  1SD6 A;  4AID A;  4YIR X;  3CCR I;  2A61 A;  4RMN A;  2DQL A;  4CIC A;  4A3F J;  2ZSH B;  1LDD A;  3BZC A;  5E8G A;  3T8R A;  2YX7 A;  1Z7U A;  2WY8 Q;  1E3O C;  3HOW J;  3DLL F;  1FTZ A;  4CZC A;  3HTS B;  1TQM A;  2O5R A;  3E5U A;  5JVG F;  4LLG F;  2QGU A;  3CCM I;  3V7R A;  5DCM A;  4ZTF A;  1TT5 B;  1D0Y A;  4XK4 A;  4M3F A;  3BG3 A;  2WAF A;  3PM1 A;  3AL0 C;  5B1A H;  1RUO A;  3VFZ A;  3ZQH A;  4BGD A;  3F3X A;  2P6S A;  3S1Q J;  3IHU A;  1YX5 A;  3RZD J;  1XSX A;  5DUK A;  3A2K A;  1VTN C;  1X2N A;  3F8M A;  5IYD J;  1RNL A;  3BPX A;  3HRS A;  3JAM Z;  4NHJ A;  4HA8 A;  1U78 A;  2IS1 A;  2EZI A;  4XBF A;  4CCK A;  3PL8 A;  2GIV A;  1ZRE A;  1P9Q C;  2CW0 F;  4ZC3 A;  3KPH A;  1FYM A;  5DM6 F;  3MZ8 A;  2DYS H;  3LSK A;  2A5W A;  2VE8 A;  4RLQ A;  2BGC A;  3A01 A;  1ODD A;  3A1Y A;  5D8K B;  3LSG A;  1JKQ C;  3I58 A;  4KDP A;  3BJ6 A;  4N9H A;  1WJB A;  2CUJ A;  4EV0 A;  2FNP A;  5J4Y A;  1I1S A;  4UV8 A;  2NNN A;  2AXL A;  1S29 A;  3ROU A;  2BW3 B;  1LDK B;  1YW7 A;  1ETO A;  4ESJ A;  1R1T A;  3VPR A;  3CDL A;  5B3S H;  1IZ1 A;  4PJN A;  5LGN A;  1YG2 A;  5K7F A;  1I6X A;  3U1K A;  2DI3 A;  2YSR A;  4F3Q A;  3OV8 A;  4XRF A;  3KEQ A;  4YFX F;  5DV5 A;  1KU3 A;  1DPU A;  3W3C A;  2XSD C;  3ABM H;  1FMV A;  1QU3 A;  1KU9 A;  3MZY A;  3A03 A;  2HVQ A;  5DTD A;  1LVK A;  1X3W B;  2NS7 A;  1SD7 A;  3FMR A;  2QQA A;  1X4O A;  3JTG A;  4WXD A;  3S15 J;  2HEO A;  2MC3 A;  4EJT A;  3HRU A;  1YS7 A;  3CCY A;  3DF8 A;  1WI3 A;  2ZJQ F;  1WRJ A;  5FGM A;  1JT6 A;  5F27 A;  3TMO A;  1JKP C;  1U6G A;  3SXY A;  4WX9 A;  4C30 A;  5HLH A;  2PN6 A;  3HPG A;  4XQF A;  3GTQ J;  1ONV A;  5CVU A;  4HF1 A;  1NG6 A;  4MTE A;  4EJV A;  2V6E A;  5FKL A;  2DT7 B;  4M9S A;  4BS9 A;  1UST A;  2QWW A;  1YW8 A;  4XM3 A;  3ZQG A;  3RQI A;  2VOD A;  3TBI A;  1FEX A;  1FOX A;  4HV6 A;  1X1C A;  1CF7 B;  4L0Y B;  3K70 C;  3BY6 A;  2XGX A;  1HW2 A;  1YJW I;  2XIG A;  2DOF A;  2W24 A;  4MNU A;  4F7Z A;  3AG1 H;  3ASO H;  4D0P A;  4AVZ A;  2FBK A;  2OV7 A;  4NB5 A;  3FBN B;  1HXD A;  2XPV A;  1I39 A;  1D1A A;  4RS8 A;  3K0L A;  5FKN A;  4UUS A;  3HOU J;  2K02 A;  2W84 A;  4UHT A;  3T1B A;  5K1Y A;  4HAM A;  1ZQ3 P;  2RC4 A;  3BTJ A;  1HW1 A;  3K1P A;  2V6C A;  2CV2 A;  3DTI A;  4BDZ A;  2X4H A;  4EVI A;  3KLN A;  3CME I;  3SFZ A;  3VDX A;  2CUZ A;  1K4S A;  2LKS A;  2F5D A;  1UMQ A;  2OQG A;  1MBE A;  2JZY A;  5FB2 A;  3U21 A;  3RKQ A;  3E3V A;  4A5M A;  2R7D A;  1T33 A;  1H9T A;  1W4M A;  1ZLJ A;  1Z05 A;  4PFO A;  2DYR H;  2FA5 A;  5J1Y A;  2D1H A;  1WGX A;  3RDI A;  3WG9 A;  3ELK A;  3HUG B;  4Y13 A;  1U8R A;  2VC0 A;  2DN0 A;  3KLO A;  2R5Y B;  3R6S A;  4F52 A;  2VQG A;  3ECH A;  5LBQ A;  3CC2 I;  4HDU A;  2HOA A;  3SZT A;  2P81 A;  5L3C A;  4CXF A;  3M1E A;  2XAQ A;  2N8G A;  2KIQ A;  5HS9 A;  3KZI C;  1OIS A;  1DP7 P;  1HQC A;  1YX3 A;  5GAE J;  2R3S A;  1Z3Y A;  3TED A;  2ISZ A;  2W1O A;  5LHI A;  2XV4 S;  3A0H C;  2WAQ N;  5H6Q A;  2MSY A;  4KMF A;  4S04 A;  3BR0 A;  3H1C A;  1YRN B;  3ZMS A;  1ZYR F;  3TW7 A;  3RPQ A;  1SAN A;  4N4O B;  3GW2 A;  4Q4Z F;  1SMY F;  3ZMV A;  2HS5 A;  5ICG A;  3CO7 C;  4HPQ A;  1JGG A;  4PDK A;  3OIQ A;  4B1R A;  2OPT A;  4P55 A;  2EIK H;  3K9T A;  5FJ8 J;  4FCY A;  5EG0 A;  1XPX A;  2HTJ A;  1VFC A;  3U2R A;  3W2V A;  2NYX A;  1W7P B;  1QZZ A;  1IF1 A;  1VQN I;  5K5R A;  1VQM I;  3IH3 A;  3OYG A;  2M2E A;  4NDL A;  3K1M A;  3G3Z A;  4WF2 A;  4I98 B;  4OAY A;  4MQ9 F;  3WE3 A;  3K69 A;  4EM2 A;  2R7X A;  2IBD A;  1PUF B;  3KP3 A;  4XSZ F;  4HRI A;  1YJN I;  2EB7 A;  4C3J J;  2Y2Z A;  2IEK A;  3VB2 A;  4LOC A;  1HDD C;  1D8K A;  3ZP5 A;  2E34 A;  2PX9 A;  1VQO I;  3I4M J;  1ULY A;  1WJE A;  1VF9 A;  3BOQ A;  3FMQ A;  3GWZ A;  3CCL I;  1XN7 A;  4XLH A;  3ABK H;  1ITY A;  2JUG A;  3OYJ A;  1IN8 A;  1QHH D;  3FIS A;  2DOA A;  3WTW C;  2ECB A;  3OR2 C;  4PGH A;  2Q8K A;  3PFY A;  5EEH A;  2HYJ A;  3P5J A;  4D7N A;  5GAD J;  4JYK A;  1R5H A;  4N0B A;  1E3H A;  1MIJ A;  2LKP A;  3TGN A;  2P6T A;  1MZB A;  2MLG A;  1U9O A;  3EUK L;  4WWC A;  2Z9O A;  1MMS A;  2DA7 A;  5JVT A;  1TQP A;  3BTL A;  2K3P A;  1G3S A;  4Q48 A;  4NC8 A;  1FJL A;  5ICF A;  4E7L A;  3RCO A;  2VOP A;  5FRN A;  2H09 A;  1U2W A;  4P1W A;  5JHF A;  1Z0X A;  3M8E A;  3V42 A;  1W0T A;  3LA3 A;  2ZJR F;  2BE5 F;  3I56 I;  4F91 B;  4R79 A;  2F5F A;  3U9G A;  1T8I A;  5FLX K;  2DA4 A;  3CJR B;  2WWY A;  2RVC A;  5IP6 A;  3C7J A;  3M7G A;  1T0F A;  1RR7 A;  2L9V A;  2ZFU A;  3PQJ A;  1D1B A;  5FRM A;  1XDS A;  2Q0O A;  3GBG A;  4YG2 F;  2EA4 A;  5C44 J;  1OCZ H;  3GTK J;  3PFI A;  5E79 C;  1R6R A;  2R7W A;  4G94 A;  4RAZ A;  4UUV A;  3Q9S A;  1A04 A;  3IL2 A;  4HNU A;  3LMM A;  4HDV A;  1SFX A;  1XGM A;  4JX4 A;  4BXX J;  2VT2 A;  3O2P E;  2OD5 A;  4L5J A;  2MLK A;  5F1J A;  4JOM A;  1ZG3 A;  2QKM B;  2EV5 A;  3DKY A;  1IXC A;  3PJR A;  3CUO A;  1CQT A;  2LY2 A;  5IT9 Z;  1F1Z A;  2EFW A;  1MND A;  2LRD A;  1EA3 A;  1UHW A;  4XR6 A;  3EUA A;  3G1M A;  3FK6 A;  2FOW A;  5CVI A;  1P4A A;  5F64 A;  5JR3 A;  1XGO A;  2OU2 A;  1L3L A;  3IRR A;  1XS9 A;  5ICC A;  4U0Y A;  1I6H J;  3H5N A;  5M5Y J;  4H0E A;  4II2 A;  3KIO A;  4EJO A;  4B47 A;  2XAJ A;  4ZDL A;  2QYO A;  4Z6Y A;  2X9D A;  1BBY A;  2V1X A;  2NVU B;  1IRF A;  2RAE A;  2FBH A;  1WQ2 A;  3QU6 A;  5DDG A;  3S2H J;  3GTP J;  4CCO A;  2L9S A;  2IPQ X;  3D5R C;  1T95 A;  1E0E A;  4D5C A;  2BY3 A;  2VQL A;  3KP6 A;  2DO7 A;  2IRF G;  1OPC A;  1MH4 A;  4A0Y A;  1K78 B;  4UNO A;  1GLN A;  1BJZ A;  4A3I J;  2V1U A;  5CVR A;  2HXO A;  1YIT I;  5DCF A;  3SEQ A;  4BBR J;  3QOP A;  4LIU A;  2V9V A;  4PJ0 C;  4NNJ A;  4DZJ A;  1IG7 A;  2G0E A;  1U5T B;  2VXZ A;  3BJO A;  2K3F A;  4E7H A;  3H9Q A;  1S9H A;  3E97 A;  2LRE A;  3DEU A;  3GZ6 A;  3F9K A;  2C6Y A;  1QA6 A;  3EUH A;  5HDK A;  1R9T J;  5E8I A;  3MZH A;  1MMN A;  2CWE A;  1RUN A;  5D5W B;  5J8C A;  1B4A A;  1TLH B;  4BH9 A;  2KRC A;  3OYL A;  4RM3 A;  1JT0 A;  2BW3 A;  2W82 A;  3B6C A;  3NQO A;  4U0V A;  2XAF A;  5K5O A;  2LSO A;  3V4G A;  4BYY A;  4IRG A;  5ERI A;  5J1R A;  3ZMU A;  2VKH A;  3OYN A;  5IT3 A;  3VWB A;  1S7O A;  1YYV A;  2EQR A;  1GVD A;  5GAH J;  1G2H A;  4WXC A;  2DT6 A;  4GGG A;  3LNQ A;  3MCZ A;  4Y33 A;  4ZZL A;  2H1L A;  3MEX A;  4J01 A;  4IHV A;  1G3Y A;  3ECO A;  4U87 A;  1X1B A;  1JJ6 C;  1BR2 A;  1I5Z A;  4PZJ A;  3HBL A;  2ETH A;  3CUQ C;  4YIF A;  4QTR A;  2K86 A;  3F0C A;  2CS3 A;  3CCQ I;  2KZG A;  2E7X A;  3T8T A;  3ZGK A;  3REO A;  3OYH A;  2VPL A;  2E7W A;  3RYR A;  3K4J A;  4IHT A;  3CC4 I;  4S0H B;  3H9G A;  2M0C A;  4FE4 A;  5HLT A;  5E3M A;  2LD5 A;  1VQ5 I;  5KNL A;  1VND A;  2LY9 A;  4BDY A;  2L7M P;  3FKJ A;  1FMW A;  1ZK8 A;  1BL0 A;  2L9R A;  3MFK A;  1KON A;  1WZ2 A;  2WAQ A;  3OYD A;  2X6O A;  2EPF A;  2X6W A;  3OYC A;  1J7K A;  1B9N A;  1YTY A;  2HKX A;  3IWZ A;  4B4C A;  3OYM A;  2K4B A;  2UZK A;  1A36 A;  1YW9 A;  2NVX J;  2HI3 A;  4S05 A;  1FSH A;  4B3A A;  2M3A A;  3RJP A;  1MBK A;  3S3M A;  3HOZ J;  4IOC F;  3L2R A;  1BR1 A;  2XKO A;  4U7B A;  5HVQ C;  2DFI A;  1FIP A;  1KGS A;  1WI9 A;  3HPH A;  5HLG A;  1ETY A;  2JPC A;  4O3M A;  4Y52 J;  1RC9 A;  5TJJ A;  2KFD A;  4MFD A;  3BZ6 A;  3J7A Y;  3G2B A;  1YLF A;  3RQ4 A;  1B6A A;  4HF0 A;  3HXL A;  2WAD A;  2MFZ A;  2L01 A;  1FYL A;  3GYH X;  1M1E B;  2MA3 A;  3QPL A;  5D6F A;  1W36 D;  2K27 A;  2COB A;  4FX4 A;  4ASN A;  5F6F A;  1ZAR A;  1JXS A;  2CUE A;  4CH7 A;  5ED4 A;  1TT0 A;  3F8F A;  1L0O C;  4YFK F;  4KIS A;  3K4B A;  1R4N B;  4AIJ A;  4FT8 A;  4FHT A;  3BWG A;  2YU3 A;  3Q0W A;  2ZBK A;  4F93 B;  5EGO B;  2R5Y A;  4I09 A;  3ZR8 X;  4CO8 A;  2OCE A;  2JJ7 A;  4OIR F;  4A2U A;  1H0M A;  2HDD A;  3RPU A;  4WCG A;  4M6V A;  2CFO A;  2LBF A;  1RET A;  4AM3 A;  3Q5F A;  1DQU A;  1JUP A;  2JSC A;  3K4K A;  2BHY A;  3RYP A;  5LLQ A;  3FM5 A;  2V9K A;  5FD6 A;  3WTV C;  4QLC U;  3DEE A;  2R7O A;  2QVO A;  2ZJ2 A;  3CP8 A;  2R7S A;  1WHU A;  5IT9 K;  2ECC A;  1BI1 A;  4V2G A;  3FXL A;  3MVP A;  3Q3S A;  2EZH A;  3TOA A;  5KCM A;  1SFO J;  3F72 A;  1YRN A;  1WJA A;  2DA1 A;  2M87 A;  5KVR A;  2W85 A;  4MEY F;  4E7I A;  4M3D A;  3MKZ A;  3F8B A;  3TDU C;  3S8P A;  1OQY A;  4G12 A;  4EQQ A;  1MMD A;  1O4X A;  1HDP A;  1WH7 A;  2P7V B;  4BQA A;  1SEU A;  4A69 C;  2Z16 A;  2JQ7 A;  4G7O F;  1ERD A;  3ZQL A;  3BCB A;  4GYG A;  3NWS A;  2VJ4 A;  2WB1 N;  1EV7 A;  2M4G A;  4MIM A;  1ZG5 A;  2D5V A;  3CO6 C;  3WGG A;  1XGS A;  1WFX A;  4RB0 A;  4WXH A;  4GXO A;  1QVU A;  1G59 A;  3H92 A;  5AIQ A;  3R4K A;  3ZMT A;  2BEO A;  3JSO A;  1JUS A;  2L7Z A;  1D0Z A;  4LGW A;  4KYW A;  4A5N A;  2KMU A;  2Y30 A;  4L0Z B;  1FTT A;  2YS9 A;  2HQ5 A;  4PUS A;  5J47 A;  1PUF A;  1IDY A;  1BI3 A;  4RAG A;  3F6O A;  5LGT A;  1OFC X;  1XX5 A;  1FP2 A;  1WH5 A;  5IYC J;  3V8J A;  2RNJ A;  3F6V A;  3GZN B;  4ZTJ A;  5DM7 F;  2PEX A;  3K2A A;  2E1M B;  3CMM A;  2VJJ A;  2JA7 J;  2A69 F;  3EUH C;  2XKP A;  1Q1H A;  2TCT A;  2FEZ A;  2NS0 A;  2P0W A;  1K7A A;  1UG0 A;  2H94 A;  2ELJ A;  3TQN A;  1FNN A;  2VIX A;  3IWF A;  1JHH A;  4RGX A;  2KLO A;  3RKW A;  2HWV A;  4LG0 B;  3I59 B;  2QSG X;  2KKO A;  2OF7 A;  1A5J A;  2DMN A;  2R7Z J;  3GFJ A;  4BXF A;  1BM9 A;  4JK1 X;  1QNT A;  4FX0 A;  3V8L A;  2QA4 I;  5FKK A;  3D5L A;  1KYW A;  4A3L J;  1QVT A;  2OZU A;  3HG9 A;  5H20 A;  2LKX A;  1C0W A;  4G6D A;  2O6G E;  1I50 J;  4JX6 A;  2GLO A;  4P9F A;  5HOO A;  5LD2 C;  1IXR C;  4R8H A;  2IJL A;  1LFU P;  4BKX A;  3JTH A;  3WTY C;  2HVR A;  2NVT J;  4Y17 A;  4A6D A;  5B66 C;  1TL8 A;  5A2Q Z;  3LSP A;  2ZXH A;  1P7J A;  4ZYE A;  1SD4 A;  1J59 A;  4Y15 A;  3FBI B;  2DMQ A;  4ZYA A;  3ZQI A;  4BEH A;  3ZN0 A;  4W1U A;  1T98 A;  2XPW A;  2M8E A;  4LMY A;  4NBQ A;  1Y0U A;  4X1E A;  2ISY A;  3MWM A;  3DQV C;  3KEY A;  2BY1 A;  2MD5 A;  2LH9 A;  3FWE A;  4HNT A;  4BQQ A;  4U88 A;  1I1G A;  2QSH X;  2XAU A;  4GYI A;  2NRA C;  4KIB A;  4XRS A;  4CYD A;  1SC7 A;  2QBY B;  1MMA A;  4L5E A;  3VYR B;  4JQF A;  5GAG J;  3VEP A;  3HSR A;  1IV8 A;  5D5U B;  3QP5 A;  2OJE D;  2PBI A;  3C18 A;  4LJZ F;  2E60 A;  1LE8 A;  3OS1 A;  2RN7 A;  2HZT A;  2KP6 A;  2O03 A;  2ZXJ A;  3W2W A;  5CYV A;  4KN7 X;  2CU7 A;  3JW4 A;  1RKT A;  3JRE A;  1LPQ A;  2F2E A;  4WK8 F;  4OAZ A;  3WE2 A;  4KIG A;  2NNY A;  4ESF A;  2R7U A;  4D1Q A;  2XUB A;  3E6C C;  4IXA A;  3WTS C;  1NH3 A;  2DDA A;  1XMA A;  1ETK A;  3WHC A;  5M5X J;  1NTC A;  4XIC A;  4XSX F;  2W7N A;  1BOB A;  3OIP A;  1W5S A;  2OCC H;  5LFA A;  1OKR A;  4KIF A;  3JRI A;  3UKG A;  2VKD A;  3OSG A;  1IV6 A;  1Z7L A;  5DD8 A;  2V9P A;  4P96 A;  3CLO A;  4A3E J;  1Y1V J;  1YQA A;  2CMP A;  3LL7 A;  1BC7 C;  3C3W A;  4XKB A;  4FE7 A;  1K78 A;  1HW5 A;  1D1C A;  2EBI A;  3PNT A;  2QZ8 A;  3FXU A;  1OR7 C;  3M9A A;  3JCU C;  3RSN A;  2HVS A;  4A3J J;  1FX7 A;  1G6N A;  2DBB A;  4XKV A;  3W2A A;  2EFP A;  3MKY B;  2VXD A;  1U5T A;  4C9Y A;  1JJ8 C;  4ETS A;  2ZC2 A;  4FET A;  1TQI A;  2R7V A;  1P4W A;  3DPU A;  2CJJ A;  2RQP A;  4JP0 A;  2ZNY A;  1QRY A;  3ZQ7 A;  5D8L B;  3CMA I;  1HBX G;  1ETQ A;  3B02 A;  2H6B A;  1OMI A;  2IW5 A;  4W97 A;  2L02 A;  2JA6 J;  2FRH A;  2BOL A;  4KA4 A;  4I01 A;  4OU0 A;  2KRF A;  5L3B A;  2PJP A;  2ZKZ A;  4BUP A;  2BVL A;  3L2U A;  1XCV A;  5FKM A;  2VBX A;  3FXM A;  4FTH A;  3I5U A;  5ILS A;  5DUI A;  1W5C C;  3QP6 A;  3L09 A;  4DNC A;  3E6D A;  4EAT A;  3SJM A;  3LAP A;  2X51 A;  4D7M A;  2DJI A;  4PSX A;  3I3L A;  1ZGA A;  2LF8 A;  1FP1 D;  1F36 A;  1NG7 A;  4IHY A;  1Z1D A;  2EV6 A;  1W0U A;  1IAW A;  2DFE A;  2MG4 A;  2VKE A;  3AG2 H;  4YRV A;  1R23 A;  1LB2 A;  1R71 A;  3F8C A;  4KNY A;  2KIM A;  1UHM A;  1X3U A;  4E7Z A;  2ADU A;  3BDD A;  3GF2 A;  1F43 A;  2CQQ A;  3G6E I;  1BIA A;  4IL6 C;  1YIJ I;  4XLC A;  2Z5U A;  2VI6 A;  2VUM J;  1QO0 D;  2XAG A;  4XOP A;  1YFH A;  2XGE A;  4G7H F;  2GA2 A;  3VYS B;  2STT A;  5EZG A;  3C2G A;  5ILV A;  2VJI A;  1O57 A;  4GO1 A;  4Q47 A;  4XN0 A;  2ACJ A;  3JRG A;  2UXN A;  4XRM A;  4I2O A;  5BNG A;  2FF4 A;  3S3O A;  1FYK A;  2OZ6 A;  3HRT A;  1O3S A;  2BXY A;  2A07 F;  5M3F J;  3GEZ A;  2F5V A;  2E1O A;  1N77 A;  3ZXS A;  1LEA A;  2KHM A;  3SHF A;  2NAZ A;  2WB1 A;  3E0J B;  5CPR B;  1EH8 A;  2VKV A;  4RBO A;  2IA1 A;  1V5G A;  2IGK A;  3S17 J;  1K6Y A;  2H6C A;  3SFI A;  2P5L C;  2FJ1 A;  2ELK A;  4PCQ A;  2YPR A;  4CHU A;  2M7B A;  1Z6R A;  3KZZ A;  1O3T A;  4DGW B;  3BZK A;  2Q2E B;  1MMG A;  3JRA A;  3CUQ A;  4RB2 C;  1YIO A;  3K4N A;  3SDG A;  2LLK A;  4PSW A;  4Y3O A;  1A35 A;  3DCF A;  1MDM A;  3NAU A;  5IP7 J;  4IKF A;  5EGO A;  2LDU A;  4RGR A;  1Z77 A;  2O8X A;  2Y9Z A;  3A4C A;  4ABZ A;  5F04 A;  2RNG A;  3ABL H;  3Q0V A;  4ZYH A;  2H8R A;  1YE9 A;  1RI7 A;  5E18 F;  2K9M A;  2Q1Z B;  2XRN A;  2L4M A;  3RZO J;  2RQQ A;  3K10 A;  2EZK A;  1I3A A;  3CCS I;  2Z1D A;  2J5P A;  1P7I A;  1W5T A;  2DA6 A;  2LVS A;  3MAJ A;  3O8H A;  4O5V A;  3JAM K;  1GT0 C;  3DPT A;  2DAO A;  3RIR A;  4B44 A;  3IP4 B;  3DLA A;  3CCE I;  3H3V K;  2DTZ A;  1MBJ A;  1J9I A;  3PQK A;  2FE3 A;  2DOE A;  4CCN A;  5IOY A;  5EEA A;  2CFX A;  1JKR C;  2LR8 A;  3I55 I;  2DOD A;  4C3I J;  2YU9 J;  2F48 A;  2HOT A;  4KUM A;  3ABT A;  4AUX A;  3V8K A;  3OWT A;  3Q0U A;  4RAF A;  3BT9 A;  5KK1 A;  1GHC A;  1S8N A;  4UB8 C;  1B8I B;  2TRT A;  2F4I A;  2DJN A;  1TW2 A;  3D0S A;  1A6Q A;  1HC8 A;  2L0K A;  4ZDP A;  1T6S A;  1OCC H;  5J40 A;  2CO5 A;  4AC0 A;  2B0L A;  4A0X A;  1QZY A;  2LFB A;  5DD4 A;  5FRO A;  1WPK A;  1IRX A;  2HNH A;  2V1D A;  3RI4 A;  2E2J J;  2PJR A;  3ULQ B;  4RB3 C;  3HOT A;  1Z6T A;  2OBP A;  4KT5 C;  1MBG A;  3QYB A;  4DW6 A;  2JRM A;  3PNV A;  4HBL A;  3ZQQ A;  5KAF C;  1A31 A;  3QOE A;  1U5T C;  2PG4 A;  5GTH C;  3ZN1 A;  2PMH A;  4LIT A;  4RGS A;  4G6T B;  3E5Q A;  3J81 Z;  1F9N A;  1X4P A;  3JSP A;  2FML A;  5HS8 A;  5K7H A;  1UEL B;  4UY8 I;  3NEU A;  3CZ6 A;  1V5E A;  2MD0 A;  4LG0 A;  4I6Z A;  2I5U A;  5EF6 A;  4AIK A;  5DCM B;  1RPW A;  2HYG D;  5JLW A;  4CYC A;  2A3S A;  2IGO A;  2VAS A;  2EIJ H;  4X6A J;  1WJ5 A;  4XLF A;  3KZY A;  2ZJP F;  1R1U A;  3FF5 A;  3ERM A;  4G6Q A;  4HNV A;  1K83 J;  3BCA A;  3TDZ C;  5HLI A;  3TOB A;  1WSU A;  4IOA F;  3G4S I;  1IN6 A;  4LB6 B;  1MJ9 A;  1IRG A;  4EGZ A;  3QPH A;  3OIO A;  1PDN C;  2PI0 A;  3F22 A;  2WBM A;  2ESH A;  4YFN F;  1BA5 A;  3HOS A;  4CCL A;  1IUF A;  3L00 A;  3KP2 A;  4CZZ A;  4HLY A;  1EH6 A;  2E71 A;  3ZMD A;  2QBY A;  2X1E A;  5IYB J;  2K4J A;  3HYI A;  1HF0 A;  1QBJ A;  4PJJ A;  2LY1 A;  4OWR B;  1QPM A;  2P5V A;  2VBZ A;  4P9U A;  2CGP A;  1OYI A;  3EQL F;  2L7F P;  3HRM A;  5EYR A;  4EMS A;  4ZZD A;  5HNH A;  1WKM A;  2CQ7 A;  1O3Q A;  2M5W A;  5E3L A;  1DP3 A;  2BBY A;  1V3F A;  3N4M A;  2IGM A;  1G4D A;  3HDD A;  2HU9 A;  2A6H F;  4IHS A;  3GUD A;  1BI2 A;  3GZ5 A;  5L3F A;  3HGG A;  1VZ0 A;  4A3C J;  2R7Q A;  4LLN A;  6PAX A;  3JRB A;  3S3N A;  2TDX A;  1E17 A;  3FHZ A;  1OYW A;  4DOZ A;  3ISP A;  3TO9 A;  5BS6 A;  4IQ4 A;  4Q5S F;  1Z91 A;  3BLY A;  3PSF A;  4KFC A;  4GDF A;  2O7O A;  5K5Q A;  1SMT A;  3OMY A;  2QQ8 A;  4L5I A;  5EDN A;  2G9W A;  1X1P A;  1FBQ A;  1UZC A;  3HSE A;  2ZSI B;  1IC8 A;  4FIS A;  1S72 I;  4G8X A;  2PMU A;  2EV0 A;  5L3G A;  2J5O A;  2YR2 A;  1OCP A;  1Y56 A;  1LUJ B;  4IQJ A;  1XD7 A;  2HPI A;  3TO7 A;  2OTL I;  3N05 A;  3CCJ I;  2V26 A;  4DZP A;  2XRL A;  3BJA A;  4EEF G;  3SEZ A;  2K85 A;  2JWT A;  1RIO H;  3H9J A;  2A05 A;  4Y4R A;  1EKE A;  4MQV A;  4KJZ A;  2LG4 A;  4BE1 A;  1YJ9 I;  3CJT B;  2K40 A;  4UUS B;  2W00 A;  4QPO A;  1B1B A;  3DV8 A;  2E35 A;  3HC7 A;  1JKO C;  1VQ4 I;  2HZD A;  4XOR A;  1XB4 A;  4M71 A;  4CA0 A;  3LA2 A;  4D5F A;  4CUG A;  2QCO A;  1J0R A;  3HTU A;  1KU7 A;  1QPI A;  3RKY A;  1CF7 A;  4OIN F;  1FZP B;  4L9J A;  2X0L A;  2ID6 A;  5D5V B;  1V54 H;  3BG7 A;  2FBI A;  3FXR A;  3LSR A;  3MKL A;  3EYI A;  4MLO A;  4HG2 A;  2NOJ B;  2H1K A;  3FMS A;  3CP2 A;  5E3N A;  2JVG A;  4N4N B;  3LSI A;  2VPR A;  3JR9 A;  3DWL E;  1JGS A;  4IEJ A;  5JFR A;  1ZRF A;  2RKH A;  3T5X A;  3OSF A;  2D1V A;  2KDO A;  1J5Y A;  4B48 A;  3PIO F;  3CJN A;  3I54 A;  1FLI A;  4E7K A;  3OL3 A;  1VQ8 I;  4E4H A;  1SFK A;  2RV8 A;  2PMZ N;  5D4S A;  3M4O J;  1QHG A;  1Y39 A;  1UJ8 A;  2VC1 A;  1E2X A;  2YUS A;  2HDW A;  1R1V A;  4MTD A;  2XSJ C;  3GFL A;  2XC7 A;  1AWC A;  5H6R A;  3J7A O;  1OR7 A;  4A93 J;  5AON A;  2M0M A;  5L3E A;  2CV0 A;  2HOS A;  1QQI A;  5FLV A;  2H27 A;  4AWX B;  3GTL J;  1GXP A;  3P9C A;  1JTY A;  3HUG A;  3EET A;  4LK1 F;  3IKT A;  3WGI A;  3BG5 A;  3V7S A;  4UXN A;  2DA2 A;  2O0Y A;  3M8F A;  1ORK A;  2XF5 A;  4GFB A;  2E1M C;  3J81 K;  4BHB A;  4HSR A;  1X1A A;  2MBF A;  4J19 A;  3H5R A;  3ESW B;  3ML6 A;  5GPC A;  3O3K A;  2XB5 A;  4E6K G;  2BYV E;  2GXB A;  2ZCW A;  1HKT A;  3GTM J;  1AKH B;  4M74 A;  2Z3Y A;  3DEW A;  1SFU A;  3OYE A;  1S5L C;  4HST A;  2Z2S B;  3QWL A;  1WCM J;  2E2I J;  2NXN B;  3HZJ A;  1TBX A;  3FX3 A;  1F4K A;  3JRF A;  3TO6 A;  3WTU C;  1H89 C;  3LFU A;  3N97 A;  5HDG A;  2IXS A;  3GTJ J;  3LST A;  1FBS A;  1MGT A;  1YHQ I;  3LSM A;  2UUZ A;  2Q2E A;  2D45 A;  4ZDO A;  5E17 F;  4N9I A;  1Z9C A;  1Z3X A;  2FOK A;  2EFO A;  5JHU A;  1W7P A;  4M73 A;  2XGC A;  3FXO A;  2FU4 A;  3D5S C;  3RKX A;  5BPI A;  1MBH A;  3JRD A;  4DBR A;  1RZ4 A;  4B8X A;  1SFE A;  2L7K A;  5HOD A;  3BR1 A;  4MEX F;  4XOT A;  2FXA A;  4HOB A;  1DPR A;  1Z67 A;  3WTZ A;  2LK2 A;  3TKY A;  1HKQ A;  3F23 A;  4A0Z A;  1TW3 A;  1J09 A;  2CUF A;  1ZRD A;  3S2D J;  4F92 B;  2AO9 A;  3QYF A;  4ITV A;  2VBW A;  2M1B A;  3KFW X;  2E36 A;  1OCO H;  4MFE A;  3SQN A;  2I10 A;  4EGY A;  2XAS A;  1G8X A;  2V4J C;  3BRO A;  3K70 D;  3J7Z I;  1FPQ A;  1AHD P;  1PP7 U;  3C1D A;  1D5Y A;  2WA0 A;  2GQQ A;  3CCV I;  1RR8 C;  4EM0 B;  2ICW G;  4HQE A;  2X48 A;  3CMY A;  2JUC A;  5E1X A;  4IVN A;  3MQ0 A;  3BP8 A;  1N78 A;  1ZH5 A;  3IC7 A;  4CCM A;  3PO2 J;  2KQR A;  4L9V A;  1WVR A;  1BJA A;  4EJW A;  9ANT A;  2QUF A;  3GXO A;  2GXG A;  1FSE A;  3PIP F;  1B8I A;  2JVH A;  3BTI A;  2R5Z B;  3BPV A;  3G73 A;  3LWF A;  3GLX A;  1V4R A;  3CD6 I;  4KN4 X;  2CRG A;  2HQN A;  2YX4 A;  4BHP A;  3P7N A;  4KIT B;  1P2F A;  2RDP A;  4BXU A;  2CQK A;  3CES A;  4RM2 A;  5AIP A;  1MD0 A;  2O9L A;  2XB0 X;  3KX2 A;  2X6X A;  5LHG A;  3L2W A;  3BG9 A;  1YS6 A;  4A3M J;  3IH4 A;  1LQ1 A;  3S32 A;  2DTR A;  1SAU A;  1HA8 A;  3FHN A;  3A0B C;  3GVA A;  4M3E A;  4UUT A;  3S1R J;  2PLY A;  5LRS A;  1TWA J;  2H8W A;  2DLL A;  2DQR A;  2RRE A;  4QWQ A;  1U0J A;  1X3Z B;  1T39 A;  1U3E M;  5IPA A;  3O8G A;  2UXX A;  2L9N A;  1EF4 A;  1USS A;  2UV1 A;  1F5T A;  1ZGJ A;  2HYF A;  3EYY A;  1LFP A;  3CF5 F;  3H35 A;  4NUB A;  2GBY A;  3D1N I;  2JT1 A;  3OS2 A;  2Z33 A;  2R0Q C;  4AU7 A;  1K79 A;  1LFB A;  3S1N J;  3LSH A;  2DW4 A;  2FSW A;  4RB1 A;  3OYB A;  4RA2 A;  4XLA A;  2X1C A;  3W6K B;  1KQ8 A;  3HM5 A;  1MSF C;  1FBU A;  2B7E A;  4M6Y A;  1W36 C;  1VQK I;  2AQE A;  3J80 Z;  3S93 A;  1K6O A;  2AS5 F;  1NK2 P;  1YI2 I;  1ZG1 A;  3X2Q H;  3HEF A;  2GWR A;  3PNY A;  5HDN A;  4OIO F;  2NVQ J;  3LSJ A;  4KMU X;  2EFQ A;  4AYB N;  4E7S A;  1FWZ A;  3OL4 A;  4M9Z A;  3LAJ A;  2LNB A;  2EIN H;  2FNA A;  5J1U A;  2FQ4 A;  4XLN F;  4DQ2 A;  2HR3 A;  3L2V A;  5EEG A;  2MAB A;  2WTE A;  4LB5 A;  3C2H A;  4HLX A;  3F21 A;  5EJC A;  1ETX A;  3KYD B;  5K7Z A;  3WHB A;  2F5E A;  5E20 A;  3BR2 A;  3P9K A;  1EJ9 A;  2BV6 A;  2K9S A;  2VN2 A;  1BI0 A;  3HHH A;  1TWH J;  2LTP A;  1BC8 C;  2GIZ A;  1G3T A;  2A6E F;  5B5E C;  5DS9 A;  3G71 I;  3G1L A;  2F4M B;  3IAS 2;  4XKW A;  5BPD A;  2R92 J;  4ZYG A;  2HPM A;  4OIP F;  1ZEL A;  2ZO4 A;  1SD5 A;  4UVC A;  1QGP A;  3QU3 A;  1GV2 A;  1JHF A;  1LDJ A;  1TWG J;  1ZTR A;  1I3Q J;  1O7L A;  2M30 A;  1DU6 A;  1J2X A;  5C3E J;  4BHC A;  3H3Z A;  3K6G A;  4I0B A;  2A68 F;  2XHK A;  2EFN A;  1D3Y A;  5ILU A;  2PFB A;  4YEJ A;  5J8F A;  2IAI A;  4M3G A;  1FOY A;  2VL8 A;  4FQG A;  5FLX Z;  5FFX A;  1LVA A;  1AA7 A;  3DBH B;  2XPU A;  3OR1 C;  1IRZ A;  2K9Q A;  3WU1 B;  4OMY A;  1TC3 C;  3AL0 B;  2V7F A;  3ZPL A;  2PMZ A;  1P4X A;  2HTS A;  3I64 A;  5H2F C;  1WJC A;  1TNT A;  2F4O B;  1Y6I A;  3I71 A;  2L3D A;  4UV9 A;  3FXQ A;  3ZQC A;  1GVJ A;  2WV1 A;  5D6E A;  2Y0S N;  2E1N A;  3MD2 A;  1VI0 A;  5LEK A;  2GM4 A;  1ZRC A;  4P5O A;  3K4L A;  1MKM A;  2CQX A;  2LMD A;  4XL9 A;  2ID3 A;  3DKW A;  3R61 A;  4AD9 A;  4IZZ A;  3ONQ A;  4ESB A;  4XON A;  4R1H A;  2A5Y B;  4IRH A;  2M7A A;  3ERE D;  3AFH A;  3S1M J;  4A3K J;  3VYU B;  2L54 A;  1DGW Y;  1XGN A;  4NQW B;  3IRQ A;  2ME0 A;  2Y31 A;  3C2B A;  1FY7 A;  1H9G A;  5LGU A;  5LEJ A;  3R60 A;  2COM A;  2HDC A;  1FT9 A;  4JBA A;  1G3W A;  1S7E A;  2MH2 A;  5HS7 A;  1O3R A;  1K4T A;  2GZW A;  4DJA A;  4L18 B;  4OOI A;  4YII A;  1R58 A;  2XDV A;  3DFG A;  2JPB A;  3M8J A;  2R4G A;  2DMU A;  1TTY A;  2IS2 A;  2HFH A;  2E1C A;  1VQ9 I;  4IHW A;  2IGN A;  4FAS D;  3LOC A;  3PSI A;  3I4N J;  4I7H A;  2GA1 A;  5FD5 A;  3GFM A;  1FOK A;  3QAH A;  3DBR B;  2EJR A;  2GOM A;  5TIS C;  2FX0 A;  4C2T A;  2KZV A;  4I99 C;  4NC6 A;  2ZME C;  5CQE A;  2QEN A;  3DPL C;  4HF2 A;  4IRI A;  2O3F A;  3H5A A;  1SAX A;  1UHS A;  3TL4 X;  2DPD A;  4BL0 B;  5DYM A;  1B9M A;  3QQA A;  3IUO A;  5M3M J;  3EPZ A;  1MBF A;  1S7A A;  4ENK A;  4BNC A;  3I9V 2;  3R0J A;  3ABU A;  4LIV A;  3FXJ A;  1GXQ A;  3OYA A;  1ZR2 A;  3LA7 A;  1J75 A;  3CDI A;  2BZT A;  1MJB A;  4BJ5 C;  1IN7 A;  4B43 A;  2BY2 A;  1S6L A;  4Y7N J;  3PUB A;  3MKW B;  2CV1 A;  1X2M A;  5CQG A;  4QPQ A;  1ETW A;  3BR6 A;  3K4M A;  1DGR M;  4OMZ A;  3SDB A;  3GCM A;  4V2F A;  2LBF B;  3ZOB A;  3FDY A;  3K7A J;  4M6X A;  3GME A;  3BQY A;  2G7U A;  2LOO A;  2VLA A;  5A2Q K;  3LFK A;  4XLP F;  4HX8 A;  2MGQ A;  2RGV A;  2W57 A;  1Y1W J;  1XTA A;  3HIF A;  5FFZ A;  2DK8 A;  3CJQ B;  2EA2 A; 
#chains in the Genus database with same CATH homology
 3E6B A;  4HX4 A;  3VOE A;  4Z2Y A;  2GAU A;  4A6E A;  1UCR A;  4IF4 A;  2PQ8 A;  3I53 A;  3E6M A;  3WTX C;  1R22 A;  4HZF A;  1ZAO A;  4RGU A;  4L9N A;  3K2Z A;  5L3D A;  1ZN2 A;  3CDH A;  5FO5 A;  2JTV A;  1OYY A;  3AAF A;  3WTT C;  3L9F A;  3J80 K;  4M72 A;  2ZME B;  2OA4 A;  3VOD A;  2QM3 A;  3B73 A;  5LHH A;  1DDN A;  3U1D A;  1D5V A;  1R36 A;  2ZFW A;  2ZNZ A;  5BMZ A;  2HKO A;  4E70 A;  2R7F A;  3WOD F;  1LEB A;  3KP7 A;  4BAY A;  4CDG A;  1HST A;  4HW0 A;  2K7L A;  1IUY A;  4ZH4 F;  3F8N A;  2UWM A;  1KA8 A;  1ON1 A;  3COA C;  1FC3 A;  2L4A A;  3K1N A;  1DUX C;  2CYY A;  2FQ3 A;  4G7Z F;  3FZV A;  2P4W A;  3KP5 A;  3KE2 A;  1T2K A;  1PP8 F;  2G7H A;  4UVA A;  5JI6 A;  2WV0 A;  3I59 A;  4LLL A;  2XVC A;  3NRV A;  4EJU A;  4HX7 A;  3CTA A;  4HQM A;  4G9Y A;  3KET A;  4ENJ A;  2IA0 A;  3E5X A;  2VE9 A;  4U0W A;  1P92 A;  3R0A A;  1WWX A;  4OIQ F;  2XRO A;  5E1Z B;  3KCC A;  1IXS B;  4HYE A;  2D2W A;  5D5X B;  2W25 A;  4ON0 A;  2O61 A;  1UB9 A;  2MH9 A;  2DU9 A;  3I4P A;  5BQT A;  3QRF F;  1KQ9 A;  1BIB A;  2ELH A;  4IPA A;  1P6R A;  2EK5 A;  2CSO A;  5E1W A;  4ENM A;  1NHA A;  4I02 A;  1KQ0 A;  1T38 A;  4AIH A;  2JRT A;  1B59 A;  3QPT A;  1LJ9 A;  3GX4 X;  3GFI A;  2Z99 A;  4GCV A;  2F5C A;  2DPU A;  2IVM A;  1HKS A;  5CLS A;  2VT3 A;  2STW A;  1HSJ A;  5D4R A;  5CVJ A;  4ENN A;  4K2E A;  4O6J A;  1MJA A;  3LQR A;  2FMY A;  5DEQ A;  2KIU A;  2KJC A;  2KIF A;  4A12 A;  2QQ9 A;  2CG4 A;  3T0Y A;  2HGC A;  1KU2 A;  5BOX A;  2OAZ A;  2QQB A;  4IJA A;  1R7J A;  2M45 A;  1STZ A;  4PGG A;  4M9X A;  2WC2 A;  4KIC A;  3DP7 A;  1XDU A;  1BN5 A;  2Y0M A;  3WU0 A;  4LD5 A;  3EDP A;  5CVV A;  3DXJ F;  3RTR A;  1ON2 A;  2XAH A;  1KYZ A;  4AVP A;  1XSV A;  4NQW A;  5TRD A;  1CGP A;  2IA2 A;  2ESN A;  1XMK A;  2IP2 A;  2P7C B;  3IKV A;  3LQQ A;  3FM3 A;  3SZP A;  1IN4 A;  3OOP A;  1IN5 A;  4U7D A;  1R5G A;  1EH7 A;  1R00 A;  2DK5 A;  4MHG A;  1S3J A;  3CUQ B;  1LNW A;  3L7W A;  2QLZ A;  1MDM B;  1AOY A;  3H3U A;  4L9T A;  2IT0 A;  3HHG A;  5ICE A;  1D8J A;  4CGZ A;  4UVB A;  1YO5 C;  4I0A A;  5J6X A;  4LK0 F;  4ZYD A;  2VOO A;  5CJ9 A;  4RAY A;  2EWN A;  4EM1 A;  1PUE E;  3V7C A;  1ZHF A;  3KEO A;  1REP C;  4LFU A;  5F1R A;  2LF7 A;  3P9I A;  2P8T A;  3GO5 A;  3WGH A;  5LRR A;  4HV5 A;  2Y75 A;  1XSD A;  4MGR A;  2HQR A;  3ZMZ A;  1ZLK A;  2ZME A;  2VON A;  2V79 A;  2OQR A;  3KP4 A;  2DT5 A;  4TV7 A;  1I27 A;  3W6J B;  3HSF A;  1BOA A;  1O7F A;  1W7P D;  1IW7 F;  2Y48 A;  3Q9V A;  1XCB A;  1UFM A;  3L2C A;  2P5K A;  2HOE A;  2VBY A;  4B09 A;  1JE8 A;  3S2W A;  1TNS A;  3O6B B;  2KJB A;  3I0T A;  1SD6 A;  2A61 A;  4CIC A;  2DQL A;  1LDD A;  5E8G A;  3T8R A;  2YX7 A;  1Z7U A;  3HTS B;  1TQM A;  3E5U A;  4LLG F;  3V7R A;  5DCM A;  1RUO A;  3VFZ A;  3F3X A;  2P6S A;  3IHU A;  1XSX A;  5DUK A;  1VTN C;  3F8M A;  1RNL A;  3BPX A;  3HRS A;  3JAM Z;  4NHJ A;  4HA8 A;  1U78 A;  4XBF A;  2GIV A;  1ZRE A;  2CW0 F;  1FYM A;  2VE8 A;  2BGC A;  1ODD A;  5D8K B;  3I58 A;  4KDP A;  3BJ6 A;  4N9H A;  4EV0 A;  2FNP A;  1I1S A;  4UV8 A;  2NNN A;  2AXL A;  1S29 A;  3ROU A;  1LDK B;  1YW7 A;  4ESJ A;  1R1T A;  1IZ1 A;  5LGN A;  1YG2 A;  1I6X A;  2DI3 A;  2YSR A;  3OV8 A;  4XRF A;  3KEQ A;  4YFX F;  5DV5 A;  1KU3 A;  1DPU A;  1KU9 A;  3MZY A;  1SD7 A;  3FMR A;  2QQA A;  3JTG A;  4WXD A;  2HEO A;  2MC3 A;  4EJT A;  3HRU A;  1YS7 A;  3DF8 A;  1WRJ A;  5FGM A;  1U6G A;  3SXY A;  4WX9 A;  5HLH A;  2PN6 A;  1ONV A;  5CVU A;  4HF1 A;  4MTE A;  4EJV A;  4M9S A;  1UST A;  2QWW A;  1YW8 A;  2VOD A;  4HV6 A;  1CF7 B;  4L0Y B;  3BY6 A;  2XGX A;  1HW2 A;  2XIG A;  2W24 A;  4MNU A;  4F7Z A;  4D0P A;  2FBK A;  4NB5 A;  1HXD A;  4RS8 A;  3K0L A;  2K02 A;  2W84 A;  4UHT A;  3T1B A;  5K1Y A;  4HAM A;  2RC4 A;  1HW1 A;  3K1P A;  2V6C A;  2X4H A;  4EVI A;  3KLN A;  3SFZ A;  2F5D A;  2OQG A;  2JZY A;  5FB2 A;  3E3V A;  4A5M A;  2R7D A;  1H9T A;  1W4M A;  1ZLJ A;  1Z05 A;  2FA5 A;  2D1H A;  3RDI A;  3WG9 A;  3ELK A;  4Y13 A;  1U8R A;  2VC0 A;  3KLO A;  3R6S A;  3ECH A;  5LBQ A;  4HDU A;  3SZT A;  5L3C A;  4CXF A;  3M1E A;  2XAQ A;  5HS9 A;  1DP7 P;  1HQC A;  2R3S A;  2ISZ A;  5LHI A;  2XV4 S;  5H6Q A;  4KMF A;  4S04 A;  3ZMS A;  1ZYR F;  3RPQ A;  3GW2 A;  4Q4Z F;  1SMY F;  3ZMV A;  2HS5 A;  5ICG A;  3CO7 C;  4PDK A;  4P55 A;  3K9T A;  2HTJ A;  3U2R A;  2NYX A;  1W7P B;  1QZZ A;  1IF1 A;  5K5R A;  3K1M A;  3G3Z A;  4WF2 A;  4I98 B;  4MQ9 F;  3WE3 A;  3K69 A;  4EM2 A;  3KP3 A;  4XSZ F;  2EB7 A;  3VB2 A;  1D8K A;  3ZP5 A;  1ULY A;  3BOQ A;  3FMQ A;  3GWZ A;  1XN7 A;  1IN8 A;  3WTW C;  4PGH A;  2Q8K A;  5EEH A;  1R5H A;  4N0B A;  2LKP A;  3TGN A;  2P6T A;  1MZB A;  2MLG A;  4WWC A;  2Z9O A;  5JVT A;  1TQP A;  1G3S A;  4Q48 A;  5ICF A;  2VOP A;  2H09 A;  1U2W A;  3M8E A;  3LA3 A;  2BE5 F;  4R79 A;  2F5F A;  3U9G A;  5FLX K;  2WWY A;  2RVC A;  3C7J A;  3M7G A;  1T0F A;  3PQJ A;  1XDS A;  2Q0O A;  4YG2 F;  2EA4 A;  3PFI A;  4G94 A;  4RAZ A;  4UUV A;  3Q9S A;  1A04 A;  3IL2 A;  4HDV A;  1SFX A;  1XGM A;  2VT2 A;  3O2P E;  2OD5 A;  4L5J A;  2MLK A;  1ZG3 A;  2EV5 A;  1IXC A;  3CUO A;  5IT9 Z;  1F1Z A;  2EFW A;  1UHW A;  1IAW A;  5F64 A;  5CVI A;  1L3L A;  1P4A A;  5JR3 A;  1XGO A;  2OU2 A;  3IRR A;  5ICC A;  4U0Y A;  4H0E A;  4EJO A;  2XAJ A;  2QYO A;  1BBY A;  2V1X A;  1IRF A;  2FBH A;  1WQ2 A;  3QU6 A;  5DDG A;  2IPQ X;  3KP6 A;  2DO7 A;  2IRF G;  1OPC A;  4A0Y A;  1K78 B;  4UNO A;  2V1U A;  5CVR A;  5DCF A;  3QOP A;  2V9V A;  1U5T B;  2VXZ A;  3BJO A;  3E97 A;  3DEU A;  3GZ6 A;  2C6Y A;  3EUH A;  5HDK A;  5E8I A;  3MZH A;  2CWE A;  1RUN A;  5D5W B;  5J8C A;  1B4A A;  1TLH B;  4BH9 A;  3NQO A;  5K5O A;  4U0V A;  2XAF A;  2LSO A;  3V4G A;  4BYY A;  4IRG A;  5ERI A;  3ZMU A;  5IT3 A;  1S7O A;  1YYV A;  4WXC A;  4GGG A;  3MCZ A;  4ZZL A;  3MEX A;  1G3Y A;  3ECO A;  1I5Z A;  4PZJ A;  2ETH A;  3CUQ C;  4YIF A;  2K86 A;  2E7X A;  3T8T A;  3REO A;  2E7W A;  3RYR A;  4IHT A;  3MFK A;  1J7K A;  1B9N A;  1YTY A;  2HKX A;  3IWZ A;  2K4B A;  2UZK A;  1YW9 A;  4S05 A;  1FSH A;  3RJP A;  2XKO A;  4U7B A;  5HVQ C;  2DFI A;  1KGS A;  1WI9 A;  5HLG A;  2JPC A;  4O3M A;  5TJJ A;  3BZ6 A;  1YLF A;  1B6A A;  4HF0 A;  2L01 A;  1FYL A;  3GYH X;  2MA3 A;  5D6F A;  2K27 A;  4FX4 A;  4ASN A;  5F6F A;  1ZAR A;  1JXS A;  5ED4 A;  3F8F A;  1L0O C;  4YFK F;  4AIJ A;  4FT8 A;  4FHT A;  3BWG A;  2YU3 A;  2ZBK A;  4I09 A;  4CO8 A;  4OIR F;  4A2U A;  1H0M A;  3RPU A;  4WCG A;  3Q5F A;  2JSC A;  3RYP A;  5LLQ A;  3FM5 A;  5FD6 A;  3WTV C;  4QLC U;  2QVO A;  2ZJ2 A;  5IT9 K;  1BI1 A;  3TOA A;  3F72 A;  2M87 A;  5KVR A;  2W85 A;  4MEY F;  3F8B A;  3TDU C;  4EQQ A;  2P7V B;  4BQA A;  4G7O F;  4GYG A;  1EV7 A;  1ZG5 A;  3CO6 C;  3WGG A;  1XGS A;  4RB0 A;  4WXH A;  4GXO A;  3H92 A;  5AIQ A;  3R4K A;  3ZMT A;  2BEO A;  3JSO A;  4LGW A;  4KYW A;  4A5N A;  4L0Z B;  1BI3 A;  3F6O A;  5LGT A;  1FP2 A;  3V8J A;  2RNJ A;  3F6V A;  2PEX A;  2A69 F;  2XKP A;  1Q1H A;  2FEZ A;  2NS0 A;  1K7A A;  2H94 A;  3TQN A;  1FNN A;  3IWF A;  1JHH A;  4RGX A;  3RKW A;  2HWV A;  4LG0 B;  3I59 B;  2KKO A;  3GFJ A;  1BM9 A;  4JK1 X;  1QNT A;  4FX0 A;  3V8L A;  3D5L A;  1KYW A;  2OZU A;  5H20 A;  1C0W A;  4G6D A;  2O6G E;  4P9F A;  5HOO A;  1IXR C;  4R8H A;  2IJL A;  3JTH A;  3WTY C;  4Y17 A;  4A6D A;  5A2Q Z;  4ZYE A;  1SD4 A;  1J59 A;  4Y15 A;  3ZN0 A;  1T98 A;  2M8E A;  4LMY A;  1Y0U A;  2ISY A;  3MWM A;  3DQV C;  3FWE A;  2MD5 A;  4U88 A;  1I1G A;  4GYI A;  2NRA C;  4KIB A;  4CYD A;  2QBY B;  4JQF A;  3VEP A;  3HSR A;  5D5U B;  3QP5 A;  2PBI A;  3C18 A;  4LJZ F;  2RN7 A;  2HZT A;  2O03 A;  2ZXJ A;  5CYV A;  4KN7 X;  3JW4 A;  2F2E A;  4WK8 F;  3WE2 A;  4KIG A;  2NNY A;  4ESF A;  2XUB A;  3E6C C;  4IXA A;  3WTS C;  1XMA A;  4XSX F;  1W5S A;  1OKR A;  4KIF A;  5DD8 A;  4P96 A;  3CLO A;  1YQA A;  1BC7 C;  3C3W A;  1K78 A;  1HW5 A;  2QZ8 A;  3FXU A;  3M9A A;  1FX7 A;  1G6N A;  2DBB A;  2EFP A;  1U5T A;  4ETS A;  1TQI A;  1P4W A;  2RQP A;  2ZNY A;  3ZQ7 A;  5D8L B;  1HBX G;  3B02 A;  2H6B A;  1OMI A;  2IW5 A;  2L02 A;  2FRH A;  4KA4 A;  4I01 A;  4OU0 A;  2KRF A;  5L3B A;  2PJP A;  2ZKZ A;  1XCV A;  2VBX A;  3I5U A;  5ILS A;  5DUI A;  3QP6 A;  3L09 A;  4DNC A;  3E6D A;  3LAP A;  1ZGA A;  2LF8 A;  1FP1 D;  1Z1D A;  2EV6 A;  1R23 A;  1LB2 A;  3F8C A;  4KNY A;  2KIM A;  1UHM A;  1X3U A;  2ADU A;  3BDD A;  3GF2 A;  1BIA A;  2Z5U A;  1QO0 D;  2XAG A;  1YFH A;  4G7H F;  2GA2 A;  2STT A;  5ILV A;  1O57 A;  4GO1 A;  4Q47 A;  2ACJ A;  2UXN A;  4I2O A;  2FF4 A;  1FYK A;  2OZ6 A;  3HRT A;  1O3S A;  2A07 F;  3GEZ A;  1LEA A;  3SHF A;  2NAZ A;  1EH8 A;  2IA1 A;  2H6C A;  2P5L C;  4PCQ A;  2YPR A;  4CHU A;  1Z6R A;  3KZZ A;  1O3T A;  3CUQ A;  4RB2 C;  1YIO A;  1MDM A;  2LDU A;  4RGR A;  2O8X A;  4ZYH A;  1RI7 A;  5E18 F;  2XRN A;  2L4M A;  1J75 A;  2J5P A;  4O5V A;  1W5T A;  3MAJ A;  3JAM K;  3DPT A;  2DAO A;  3RIR A;  1J9I A;  3PQK A;  2FE3 A;  2CFX A;  4KUM A;  3ABT A;  3V8K A;  5KK1 A;  1GHC A;  1S8N A;  1TW2 A;  3D0S A;  1T6S A;  2CO5 A;  2B0L A;  4A0X A;  1QZY A;  5DD4 A;  2V1D A;  3RI4 A;  3ULQ B;  3HOT A;  4RB3 C;  1Z6T A;  2OBP A;  4KT5 C;  4HBL A;  1U5T C;  2PG4 A;  3ZN1 A;  2PMH A;  4RGS A;  3E5Q A;  3J81 Z;  1F9N A;  3JSP A;  2FML A;  5HS8 A;  3NEU A;  4LG0 A;  4AIK A;  5DCM B;  2HYG D;  2A3S A;  3KZY A;  1R1U A;  3FF5 A;  4G6Q A;  3TDZ C;  5HLI A;  3TOB A;  1WSU A;  1IN6 A;  4LB6 B;  1MJ9 A;  1IRG A;  4EGZ A;  3QPH A;  2PI0 A;  1PDN C;  3F22 A;  2ESH A;  4YFN F;  3HOS A;  3L00 A;  3KP2 A;  4CZZ A;  4HLY A;  1EH6 A;  3ZMD A;  2QBY A;  2K4J A;  3HYI A;  1QBJ A;  1QPM A;  2P5V A;  2VBZ A;  4P9U A;  2CGP A;  1OYI A;  3EQL F;  3HRM A;  4EMS A;  4ZZD A;  1WKM A;  1O3Q A;  2M5W A;  2BBY A;  1V3F A;  3N4M A;  1G4D A;  4IHS A;  2A6H F;  3GUD A;  1BI2 A;  3GZ5 A;  5L3F A;  4LLN A;  6PAX A;  2TDX A;  1E17 A;  3FHZ A;  1OYW A;  3ISP A;  3TO9 A;  5BS6 A;  4Q5S F;  1Z91 A;  4KFC A;  5K5Q A;  1SMT A;  4L5I A;  2G9W A;  1FBQ A;  3HSE A;  4G8X A;  2PMU A;  2EV0 A;  5L3G A;  2J5O A;  2YR2 A;  1XD7 A;  3TO7 A;  3BJA A;  1RIO H;  4MQV A;  1B1B A;  3DV8 A;  1XB4 A;  4M71 A;  3LA2 A;  1J0R A;  3HTU A;  1KU7 A;  3RKY A;  1CF7 A;  4OIN F;  1FZP B;  4L9J A;  2X0L A;  5D5V B;  2FBI A;  3FXR A;  3EYI A;  3FMS A;  1JGS A;  5JFR A;  1ZRF A;  2RKH A;  3T5X A;  2D1V A;  1J5Y A;  3CJN A;  3I54 A;  1FLI A;  2RV8 A;  5D4S A;  2VC1 A;  1E2X A;  1R1V A;  4MTD A;  3GFL A;  1AWC A;  5H6R A;  3J7A O;  1OR7 A;  5AON A;  5L3E A;  1QQI A;  2H27 A;  4AWX B;  1GXP A;  3P9C A;  3HUG A;  4LK1 F;  3EET A;  3IKT A;  3WGI A;  3V7S A;  4UXN A;  3M8F A;  2O0Y A;  3J81 K;  4BHB A;  2MBF A;  3ML6 A;  3O3K A;  2BYV E;  2GXB A;  2ZCW A;  1HKT A;  4M74 A;  2Z3Y A;  1SFU A;  1TBX A;  3FX3 A;  1F4K A;  3TO6 A;  3WTU C;  3N97 A;  5HDG A;  3LST A;  1FBS A;  1MGT A;  2Q2E A;  2D45 A;  5E17 F;  4N9I A;  1Z9C A;  2FOK A;  2EFO A;  5JHU A;  1W7P A;  4M73 A;  2FU4 A;  3RKX A;  5BPI A;  1RZ4 A;  4B8X A;  1SFE A;  4MEX F;  2FXA A;  4HOB A;  1DPR A;  3WTZ A;  3TKY A;  1HKQ A;  3F23 A;  4A0Z A;  1TW3 A;  1ZRD A;  2VBW A;  2M1B A;  3KFW X;  3SQN A;  4EGY A;  2XAS A;  3BRO A;  1FPQ A;  1PP7 U;  3C1D A;  2GQQ A;  4EM0 B;  4HQE A;  5E1X A;  4IVN A;  3MQ0 A;  3BP8 A;  1ZH5 A;  3IC7 A;  4L9V A;  1BJA A;  4EJW A;  2QUF A;  3GXO A;  2GXG A;  1FSE A;  3BPV A;  3G73 A;  3LWF A;  3GLX A;  1V4R A;  4KN4 X;  2HQN A;  2YX4 A;  4BHP A;  3P7N A;  1P2F A;  2RDP A;  4BXU A;  2CQK A;  5AIP A;  1MD0 A;  5LHG A;  1YS6 A;  1LQ1 A;  2DTR A;  3GVA A;  2PLY A;  5LRS A;  2DLL A;  2DQR A;  4QWQ A;  1T39 A;  1U3E M;  2UXX A;  1USS A;  1F5T A;  1ZGJ A;  2HYF A;  3EYY A;  2JT1 A;  2Z33 A;  1K79 A;  2DW4 A;  2FSW A;  4RB1 A;  3W6K B;  1KQ8 A;  1FBU A;  4M6Y A;  3J80 Z;  2AS5 F;  1K6O A;  1ZG1 A;  2GWR A;  5HDN A;  4OIO F;  4KMU X;  2EFQ A;  1FWZ A;  4M9Z A;  3LAJ A;  2LNB A;  2FNA A;  4DQ2 A;  4XLN F;  2HR3 A;  5EEG A;  2WTE A;  4LB5 A;  4HLX A;  3F21 A;  2F5E A;  5E20 A;  3P9K A;  2BV6 A;  2VN2 A;  1BI0 A;  3HHH A;  1BC8 C;  1G3T A;  2A6E F;  5BPD A;  4ZYG A;  4OIP F;  2ZO4 A;  1SD5 A;  4UVC A;  1QGP A;  3QU3 A;  1JHF A;  1LDJ A;  1O7L A;  2M30 A;  1J2X A;  4BHC A;  3H3Z A;  4I0B A;  2A68 F;  2XHK A;  2EFN A;  1D3Y A;  5ILU A;  2PFB A;  5J8F A;  5FLX Z;  5FFX A;  1LVA A;  3WU1 B;  4OMY A;  3ZPL A;  1P4X A;  2HTS A;  3I64 A;  1TNT A;  3I71 A;  2L3D A;  4UV9 A;  3FXQ A;  1GVJ A;  5D6E A;  2E1N A;  5LEK A;  1ZRC A;  4P5O A;  1MKM A;  4AD9 A;  3DKW A;  3R61 A;  4ESB A;  4R1H A;  2A5Y B;  4IRH A;  3ERE D;  2L54 A;  1XGN A;  3IRQ A;  1FY7 A;  1H9G A;  5LGU A;  5LEJ A;  3R60 A;  2COM A;  2HDC A;  1FT9 A;  4JBA A;  1G3W A;  2MH2 A;  5HS7 A;  1O3R A;  2GZW A;  4L18 B;  4OOI A;  4YII A;  1R58 A;  3DFG A;  2JPB A;  1TTY A;  2HFH A;  2E1C A;  4I7H A;  2GA1 A;  5FD5 A;  3GFM A;  1FOK A;  3QAH A;  2EJR A;  4HF2 A;  2QEN A;  3DPL C;  4IRI A;  2O3F A;  1SAX A;  2DPD A;  5DYM A;  1B9M A;  1S7A A;  4ENK A;  4BNC A;  3R0J A;  3ABU A;  1GXQ A;  3LA7 A;  1MJB A;  1IN7 A;  1S6L A;  4OMZ A;  4M6X A;  2G7U A;  5A2Q K;  3LFK A;  4XLP F;  4HX8 A;  2RGV A;  2W57 A;  3HIF A;  5FFZ A;  2DK8 A;  2EA2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...