3JTQA

Mutations in cephalosporin acylase affecting stability and autoproteolysis
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
154
structure length
154
Chain Sequence
QAPIAAYKPRSNEILWDGYGVPHIYGVDAPSAFYGYGWAQARSHGDNILRLYGEARGKGAEYWGPDYEQTTVWLLTNGVPERAQQWYAQQSPDFRANLDAFAAGINAYAQQNPDDISPDVRQVLPVSGADVVAHAHRLMNFLYVASPGRTLGEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutaryl 7-aminocephalosporanic acid acylase
publication title Structural features of cephalosporin acylase reveal the basis of autocatalytic activation.
pubmed doi rcsb
source organism Pseudomonas sp.
molecule tags Hydrolase
total genus 50
structure length 154
sequence length 154
ec nomenclature ec 3.5.1.93: Glutaryl-7-aminocephalosporanic-acid acylase.
pdb deposition date 2009-09-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.439.10 Mainly Alpha Orthogonal Bundle Penicillin Amidohydrolase; domain 1 Penicillin Amidohydrolase, domain 1 3jtqA00
3SRBA 2WYCA 1GHDA 1PNKA 1AI4A 1JX9A 3JTQA 4WKTA 2WYEA 3SRAA 1E3AA 3L91A 4HSTA 1PNMA 1AJQA 1AJPA 4YF9A 4HSRA 1AJNA 2ADVA 4M1JA 1FXVA 2AE3A 2AE4A 3SRCA 3K3WA 1KEHA 2WYBA 3ML0A 4WKVA 1GK1A 1K5SA 1KECA 4WKSA 1JVZA 1AI7A 1GM7A 3JTRA 2AE5A 1GM8A 4K2FA 4PEMA 3S8RA 1GK9A 1GKFA 1CP9A 1AI6A 4PELA 2WYDA 4K2GA 1GM9A 1JW0A 1PNLA 1AI5A 3L94A 1H2GA 4E55A 1FM2A 4E56A 4YFBA 4BTHA 4YFAA 1FXHA 1K7DA 1OR0A 4E57A 4WKUA 1GK0A 1K5QA
chains in the Genus database with same CATH superfamily
3SRBA 2WYCA 1GHDA 1PNKA 1AI4A 1JX9A 3JTQA 4WKTA 2WYEA 3SRAA 1E3AA 3L91A 4HSTA 1PNMA 1AJQA 1AJPA 4YF9A 4HSRA 1AJNA 2ADVA 4M1JA 1FXVA 2AE3A 2AE4A 3SRCA 3K3WA 1KEHA 2WYBA 3ML0A 4WKVA 1GK1A 4BWCA 1K5SA 1KECA 4WKSA 1JVZA 1AI7A 1GM7A 3JTRA 2AE5A 1GM8A 4K2FA 4PEMA 3S8RA 1GK9A 1GKFA 1CP9A 3FGRA 1AI6A 4PELA 2WYDA 4K2GA 3FGTA 1GM9A 1JW0A 1PNLA 1AI5A 3L94A 1H2GA 4E55A 1FM2A 4E56A 4YFBA 4BTHA 4YFAA 1FXHA 1K7DA 1OR0A 4E57A 4WKUA 1GK0A 1K5QA
chains in the Genus database with same CATH topology
3SRBA 2WYCA 1GHDA 1PNKA 1AI4A 1JX9A 3JTQA 4WKTA 2WYEA 3SRAA 1E3AA 3L91A 4HSTA 1PNMA 1AJQA 1AJPA 4YF9A 4HSRA 1AJNA 2ADVA 4M1JA 1FXVA 2AE3A 2AE4A 3SRCA 3K3WA 1KEHA 2WYBA 3ML0A 4WKVA 1GK1A 1K5SA 1KECA 4WKSA 1JVZA 1AI7A 1GM7A 3JTRA 2AE5A 1GM8A 4K2FA 4PEMA 3S8RA 1GK9A 1GKFA 1CP9A 1AI6A 4PELA 2WYDA 4K2GA 1GM9A 1JW0A 1PNLA 1AI5A 3L94A 1H2GA 4E55A 1FM2A 4E56A 4YFBA 4BTHA 4YFAA 1FXHA 1K7DA 1OR0A 4E57A 4WKUA 1GK0A 1K5QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SRB A;  2WYC A;  1GHD A;  1PNK A;  1AI4 A;  1JX9 A;  3JTQ A;  4WKT A;  2WYE A;  3SRA A;  1E3A A;  3L91 A;  4HST A;  1PNM A;  1AJQ A;  1AJP A;  4YF9 A;  4HSR A;  1AJN A;  2ADV A;  4M1J A;  1FXV A;  2AE3 A;  2AE4 A;  3SRC A;  3K3W A;  1KEH A;  2WYB A;  3ML0 A;  4WKV A;  1GK1 A;  1K5S A;  1KEC A;  4WKS A;  1JVZ A;  1AI7 A;  1GM7 A;  3JTR A;  2AE5 A;  1GM8 A;  4K2F A;  4PEM A;  3S8R A;  1GK9 A;  1GKF A;  1CP9 A;  1AI6 A;  4PEL A;  2WYD A;  4K2G A;  1GM9 A;  1JW0 A;  1PNL A;  1AI5 A;  3L94 A;  1H2G A;  4E55 A;  1FM2 A;  4E56 A;  4YFB A;  4BTH A;  4YFA A;  1FXH A;  1K7D A;  1OR0 A;  4E57 A;  4WKU A;  1GK0 A;  1K5Q A; 
#chains in the Genus database with same CATH topology
 3SRB A;  2WYC A;  1GHD A;  1PNK A;  1AI4 A;  1JX9 A;  3JTQ A;  4WKT A;  2WYE A;  3SRA A;  1E3A A;  3L91 A;  4HST A;  1PNM A;  1AJQ A;  1AJP A;  4YF9 A;  4HSR A;  1AJN A;  2ADV A;  4M1J A;  1FXV A;  2AE3 A;  2AE4 A;  3SRC A;  3K3W A;  1KEH A;  2WYB A;  3ML0 A;  4WKV A;  1GK1 A;  4BWC A;  1K5S A;  1KEC A;  4WKS A;  1JVZ A;  1AI7 A;  1GM7 A;  3JTR A;  2AE5 A;  1GM8 A;  4K2F A;  4PEM A;  3S8R A;  1GK9 A;  1GKF A;  1CP9 A;  3FGR A;  1AI6 A;  4PEL A;  2WYD A;  4K2G A;  3FGT A;  1GM9 A;  1JW0 A;  1PNL A;  1AI5 A;  3L94 A;  1H2G A;  4E55 A;  1FM2 A;  4E56 A;  4YFB A;  4BTH A;  4YFA A;  1FXH A;  1K7D A;  1OR0 A;  4E57 A;  4WKU A;  1GK0 A;  1K5Q A; 
#chains in the Genus database with same CATH homology
 3SRB A;  2WYC A;  1GHD A;  1PNK A;  1AI4 A;  1JX9 A;  3JTQ A;  4WKT A;  2WYE A;  3SRA A;  1E3A A;  3L91 A;  4HST A;  1PNM A;  1AJQ A;  1AJP A;  4YF9 A;  4HSR A;  1AJN A;  2ADV A;  4M1J A;  1FXV A;  2AE3 A;  2AE4 A;  3SRC A;  3K3W A;  1KEH A;  2WYB A;  3ML0 A;  4WKV A;  1GK1 A;  1K5S A;  1KEC A;  4WKS A;  1JVZ A;  1AI7 A;  1GM7 A;  3JTR A;  2AE5 A;  1GM8 A;  4K2F A;  4PEM A;  3S8R A;  1GK9 A;  1GKF A;  1CP9 A;  1AI6 A;  4PEL A;  2WYD A;  4K2G A;  1GM9 A;  1JW0 A;  1PNL A;  1AI5 A;  3L94 A;  1H2G A;  4E55 A;  1FM2 A;  4E56 A;  4YFB A;  4BTH A;  4YFA A;  1FXH A;  1K7D A;  1OR0 A;  4E57 A;  4WKU A;  1GK0 A;  1K5Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...